F489558

General Info

Members Datasets Scaffolds Average Seq Length
1075 831 472 375

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10030240|Ga0105241_100302405
Length 393
Sequence MMRAEDERRFRQDGADSHDIGGRLMAARQRMGVGIIGAGNISSQYLKAMRDFPVLDIRGIADMRPEVAAKKATEFGVKSATVEALLADPSVDIIVNLTIPRAHVEVGLKAIAAGKHIYGEKPLGVSFADGKKLIAAASKKGVRVGSAPDTFLGGGHQTARAVIDSGKLGRIIGGSVWFGVPGHEYWHPDPAFYYDIGGGPVLDMGPYYITDLVNLLGPVKAVQAMSVTPHKSRPVRSEPKKGQMMPVRVFTHVTGTLQFVSGALVQLSLSFDVPKHTHGPIEIYGTDAAMQVPDPNWFGGEVKIARPRADHWDDVPVKIPYADANYRSLGVADMAYAIINNRPHRASGELALHVLEVMEAFEVASKSGEIVKIKTKAERPAPMTESLKRGKIS

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
8 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
9 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
10 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
11 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
12 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
13 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
14 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
15 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
16 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
17 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
18 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
19 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
20 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
21 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
22 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
23 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
24 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
25 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
26 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
27 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
28 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
29 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
30 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
31 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
32 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
33 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
34 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
35 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
36 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
37 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
38 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
39 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
40 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
41 2516143018 Ensifer sp. BR816 Isolate Nodule
42 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
43 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
44 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
45 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
46 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
47 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
48 2519899620 Rhizobium sp. Pop5 Isolate Nodule
49 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
50 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
51 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
52 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
53 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
54 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
55 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
56 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
57 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
58 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
59 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
60 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
61 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
62 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
63 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
64 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
65 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
66 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
67 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
68 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
69 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
70 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
71 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
72 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
73 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
74 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
75 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
76 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
77 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
78 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
79 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
80 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
81 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
82 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
83 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
84 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
85 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
86 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
87 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
88 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
89 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
90 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
91 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
92 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
93 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
94 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
95 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
96 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
97 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
98 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
99 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
100 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
101 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
102 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
103 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
104 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
105 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
106 2643221557 Ensifer sp. Root558 Isolate Unclassified
107 2643221558 Rhizobium sp. Root149 Isolate Unclassified
108 2643221568 Rhizobium sp. Root564 Isolate Unclassified
109 2643221580 Devosia sp. Root635 Isolate Unclassified
110 2643221582 Rhizobium sp. Root651 Isolate Unclassified
111 2643221591 Devosia sp. Root685 Isolate Unclassified
112 2643221599 Rhizobium sp. Root708 Isolate Unclassified
113 2643221607 Rhizobium sp. Root73 Isolate Unclassified
114 2643221610 Ensifer sp. Root74 Isolate Unclassified
115 2643221618 Ensifer sp. Root231 Isolate Unclassified
116 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
117 2643221626 Ensifer sp. Root31 Isolate Unclassified
118 2643221629 Devosia sp. Root105 Isolate Unclassified
119 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
120 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
121 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
122 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
123 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
124 2643221655 Ensifer sp. Root1252 Isolate Unclassified
125 2643221659 Ensifer sp. Root127 Isolate Unclassified
126 2643221662 Devosia sp. Root413D1 Isolate Unclassified
127 2643221668 Ensifer sp. Root423 Isolate Unclassified
128 2643221674 Devosia sp. Root436 Isolate Unclassified
129 2643221675 Ensifer sp. Root1298 Isolate Unclassified
130 2643221680 Ensifer sp. Root1312 Isolate Unclassified
131 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
132 2643221688 Rhizobium sp. Root482 Isolate Unclassified
133 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
134 2643221693 Rhizobium sp. Root491 Isolate Unclassified
135 2643221698 Ensifer sp. Root142 Isolate Unclassified
136 2643221712 Ensifer sp. Root258 Isolate Unclassified
137 2643221718 Rhizobium sp. Root268 Isolate Unclassified
138 2643221719 Rhizobium sp. Root274 Isolate Unclassified
139 2643221723 Ensifer sp. Root278 Isolate Unclassified
140 2643221726 Ensifer sp. Root954 Isolate Unclassified
141 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
142 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
143 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
144 2718217882 Rhizobium sp. N741 Isolate Nodule
145 2718217927 Rhizobium sp. N324 Isolate Nodule
146 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
147 2718218009 Rhizobium sp. N561 Isolate Nodule
148 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
149 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
150 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
151 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
152 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
153 2718218363 Rhizobium sp. N113 Isolate Nodule
154 2718218365 Rhizobium sp. N731 Isolate Nodule
155 2718218366 Rhizobium sp. N621 Isolate Nodule
156 2718218423 Rhizobium sp. N941 Isolate Nodule
157 2721755514 Rhizobium sp. N6212 Isolate Nodule
158 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
159 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
160 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
161 2721755809 Rhizobium sp. N541 Isolate Nodule
162 2721755810 Rhizobium sp. N871 Isolate Nodule
163 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
164 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
165 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
166 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
167 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
168 2728369365 Rhizobium sp. N1341 Isolate Nodule
169 2728369397 Rhizobium sp. N1314 Isolate Nodule
170 2738541293 Rhizobium sp. GV031 Isolate Unclassified
171 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
172 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
173 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
174 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
175 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
176 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
177 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
178 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
179 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
180 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
181 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
182 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
183 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
184 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
185 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
186 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
187 2791355256 Rhizobium sp. M10 Isolate Nodule
188 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
189 2791355260 Rhizobium sp. L9 Isolate Nodule
190 2791355261 Rhizobium sp. J15 Isolate Nodule
191 2791355262 Rhizobium sp. M1 Isolate Nodule
192 2791355263 Rhizobium chutanense C5 Isolate Nodule
193 2791355264 Rhizobium sp. S9 Isolate Nodule
194 2791355265 Rhizobium sp. H4 Isolate Nodule
195 2791355266 Rhizobium sp. L43 Isolate Nodule
196 2791355267 Rhizobium sp. L18 Isolate Nodule
197 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
198 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
199 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
200 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
201 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
202 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
203 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
204 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
205 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
206 2802429633 Rhizobium anhuiense J3 Isolate Nodule
207 2802429634 Rhizobium anhuiense S10 Isolate Nodule
208 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
209 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
210 2802429637 Rhizobium anhuiense C15 Isolate Nodule
211 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
212 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
213 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
214 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
215 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
216 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
217 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
218 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
219 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
220 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
221 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
222 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
223 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
224 2838048938 Rhizobium pisi 27/80 Isolate Nodule
225 2838061910 Rhizobium phaseoli L15 Isolate Nodule
226 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
227 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
228 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
229 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
230 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
231 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
232 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
233 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
234 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
235 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
236 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
237 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
238 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
239 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
240 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
241 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
242 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
243 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
244 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
245 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
246 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
247 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
248 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
249 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
250 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
251 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
252 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
253 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
254 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
255 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
256 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
257 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
258 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
259 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
260 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
261 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
262 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
263 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
264 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
265 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
266 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
267 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
268 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
269 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
270 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
271 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
272 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
273 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
274 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
275 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
276 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
277 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
278 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
279 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
280 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
281 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
282 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
283 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
284 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
285 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
286 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
287 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
288 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
289 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
290 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
291 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
292 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
293 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
294 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
295 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
296 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
297 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
298 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
299 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
300 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
301 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
302 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
303 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
304 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
305 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
306 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
307 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
308 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
309 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
310 2844163670 Ensifer sp. 1H6 Isolate Unclassified
311 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
312 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
313 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
314 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
315 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
316 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
317 2854911287 Brucella lupini LUP21 Isolate Unclassified
318 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
319 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
320 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
321 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
322 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
323 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
324 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
325 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
326 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
327 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
328 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
329 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
330 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
331 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
332 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
333 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
334 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
335 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
336 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
337 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
338 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
339 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
340 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
341 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
342 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
343 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
344 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
345 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
346 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
347 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
348 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
349 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
350 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
351 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
352 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
353 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
354 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
355 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
356 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
357 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
358 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
359 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
360 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
361 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
362 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
363 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
364 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
365 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
366 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
367 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
368 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
369 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
370 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
371 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
372 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
373 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
374 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
375 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
376 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
377 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
378 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
379 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
380 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
381 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
382 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
383 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
384 2932401849 Devosia sp. 2618 Isolate Rhizosphere
385 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
386 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
387 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
388 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
389 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
390 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
391 2933599457 Rhizobium phaseoli M3 Isolate Nodule
392 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
393 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
394 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
395 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
396 2936381700 Rhizobium chutanense C16 Isolate Unclassified
397 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
398 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
399 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
400 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
401 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
402 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
403 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
404 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
405 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
406 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
407 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
408 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
409 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
410 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
411 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
412 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
413 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
414 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
415 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
416 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
417 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
418 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
419 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
420 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
421 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
422 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
423 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
424 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
425 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
426 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
427 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
428 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
429 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
430 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
431 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
432 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
433 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
434 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
435 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
436 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
437 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
438 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
439 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
440 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
441 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
442 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
443 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
444 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
445 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
446 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
447 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
448 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
449 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
450 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
451 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
452 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
453 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
454 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
455 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
456 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
457 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
458 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
459 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
460 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
461 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
462 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
463 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
464 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
465 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
466 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
467 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
468 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
469 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
470 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
471 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
472 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
473 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
474 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
475 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
476 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
477 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
478 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
479 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
480 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
481 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
482 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
483 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
484 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
485 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
486 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
487 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
488 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
489 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
490 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
491 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
492 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
493 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
494 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
495 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
496 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
497 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
498 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
499 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
500 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
501 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
502 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
503 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
504 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
505 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
506 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
507 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
508 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
509 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
510 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
511 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
512 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
513 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
514 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
515 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
516 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
517 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
518 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
519 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
520 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
521 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
522 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
523 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
524 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
525 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
526 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
527 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
528 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
529 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
530 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
531 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
532 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
533 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
534 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
535 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
536 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
537 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
538 2996887358 Rhizobium sp. R711 Isolate Nodule
539 2996893221 Rhizobium sp. R635 Isolate Nodule
540 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
541 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
542 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
543 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
544 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
545 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
546 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
547 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
548 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
549 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
550 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
551 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
552 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
553 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
554 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
555 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
556 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
557 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
558 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
559 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
560 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
561 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
562 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
563 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
564 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
565 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
566 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
567 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
568 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
569 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
570 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
571 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
572 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
573 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
574 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
575 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
576 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
577 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
578 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
579 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
580 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
581 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
582 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
583 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
584 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
585 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
586 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
587 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
588 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
589 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
590 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
591 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
592 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
593 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
594 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
595 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
596 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
597 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
598 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
599 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
600 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
601 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
602 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
603 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
604 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
605 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
606 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
607 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
608 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
609 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
610 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
611 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
612 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
613 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
614 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
615 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
616 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
617 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
618 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
619 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
620 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
621 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
622 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
623 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
624 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
625 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
626 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
627 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
628 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
629 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
630 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
631 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
632 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
633 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
634 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
635 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
636 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
637 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
638 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
639 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
640 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
641 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
642 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
643 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
644 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
645 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
646 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
647 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
648 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
649 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
650 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
651 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
652 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
653 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
654 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
655 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
656 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
657 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
658 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
659 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
660 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
661 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
662 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
663 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
664 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
665 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
666 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
667 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
668 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
669 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
670 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
671 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
672 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
673 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
674 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
675 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
676 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
677 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
678 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
679 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
680 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
681 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
682 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
683 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
684 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
685 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
686 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
687 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
688 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
689 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
690 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
691 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
692 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
693 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
694 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
695 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
696 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
697 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
698 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
699 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
700 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
701 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
702 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
703 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
704 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
705 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
706 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
707 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
708 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
709 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
710 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
711 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
712 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
713 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
714 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
715 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
716 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
717 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
718 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
719 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
720 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
721 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
722 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
723 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
724 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
725 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
726 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
727 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
728 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
729 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
730 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
731 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
732 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
733 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
734 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
735 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
736 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
737 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
738 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
739 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
740 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
741 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
742 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
743 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
744 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
745 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
746 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
747 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
748 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
749 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
750 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
751 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
752 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
753 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
754 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
755 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
756 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
757 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
758 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
759 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
760 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
761 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
762 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
763 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
764 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
765 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
766 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
767 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
768 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
769 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
770 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
771 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
772 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
773 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
774 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
775 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
776 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
777 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
778 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
779 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
780 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
781 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
782 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
783 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
784 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
785 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
786 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
787 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
788 8005258706 Rhizobium sp. R693 Isolate Nodule
789 8005275841 Rhizobium sp. N4311 Isolate Nodule
790 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
791 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
792 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
793 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
794 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
795 8005321885 Rhizobium sp. R72 Isolate Nodule
796 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
797 8005382845 Rhizobium sp. R634 Isolate Nodule
798 8005395548 Rhizobium sp. R339 Isolate Nodule
799 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
800 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
801 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
802 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
803 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
804 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
805 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
806 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
807 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
808 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
809 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
810 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
811 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
812 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
813 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
814 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
815 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
816 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
817 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
818 8018176218 Rhizobium sp. N122 Isolate Nodule
819 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
820 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
821 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
822 8024501048 Rhizobium sp. H4 Isolate Nodule
823 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
824 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
825 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
826 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
827 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
828 8056382006 Rhizobium croatiense 13T Isolate Nodule
829 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
830 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
831 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 43.63
Metatranscriptomes 0.37
Isolates 56

Biome Distribution

Category Percentage (%)
Aerial Root 0.47
Bulb 0
Endosphere 15.07
Nodule 41.21
Rhizoplane 1.86
Rhizosphere 25.21
Stem 0
Stem Tuber 0
Unclassified 16.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000136 3300001979 Bacteria 28016
2 JGI25155J39150_1000001 3300002704 Bacteria 354543
3 JGI25156J39149_1000001 3300002705 Bacteria 354557
4 JGI25154J39366_1000011 3300002738 Bacteria 296007
5 JGI25158J39367_1000114 3300002739 Bacteria 18397
6 JGI25157J39369_1000030 3300002741 Bacteria 146112
7 JGI25152J39213_1000570 3300002773 Bacteria 20104
8 JGI25152J39213_1001028 3300002773 Bacteria 13358
9 JGI25152J39213_1005380 3300002773 Bacteria 3749
10 JGI25150J39212_1000326 3300002774 Bacteria 23479
11 JGI25159J45721_1000078 3300002987 Bacteria 46708
12 JGI25159J45721_1000199 3300002987 Bacteria 27917
13 JGI25159J45721_1008988 3300002987 Bacteria 2680
14 JGI25151J46595_10000083 3300003187 Bacteria 130658
15 JGI25151J46595_10000603 3300003187 Bacteria 31677
16 JGI25151J46595_10014053 3300003187 Bacteria 3583
17 JGI25165J46597_1004159 3300003214 Bacteria 3212
18 JGI25153J46596_10002343 3300003215 Bacteria 10986
19 JGI25153J46596_10005742 3300003215 Bacteria 6467
20 JGI25153J46596_10008791 3300003215 Bacteria 4779
21 JGI25160J50197_1000010 3300003354 Bacteria 279365
22 JGI25160J50197_1000216 3300003354 Bacteria 46708
23 JGI25160J50197_1008518 3300003354 Bacteria 3901
24 JGI25160J50197_1012212 3300003354 Bacteria 2997
25 JGI25160J50197_1012905 3300003354 Bacteria 2873
26 JGI25161J50226_1000006 3300003374 Bacteria 279563
27 JGI25161J50226_1000138 3300003374 Bacteria 50562
28 JGI25161J50226_1000412 3300003374 Bacteria 20844
29 JGI25161J50226_1000583 3300003374 Bacteria 15416
30 JGI25161J50226_1001023 3300003374 Bacteria 9734
31 Ga0055526_1000594 3300003771 Bacteria 28489
32 Ga0055526_1000998 3300003771 Bacteria 20772
33 Ga0055526_1006006 3300003771 Bacteria 6741
34 Ga0055526_1014891 3300003771 Bacteria 3163
35 Ga0055524_1000866 3300003775 Bacteria 19803
36 Ga0055524_1001805 3300003775 Bacteria 11731
37 Ga0055524_1001872 3300003775 Bacteria 11470
38 Ga0055524_1004012 3300003775 Bacteria 6943
39 Ga0055528_1000358 3300003790 Bacteria 37118
40 Ga0055528_1000676 3300003790 Bacteria 24723
41 Ga0055528_1001985 3300003790 Bacteria 11518
42 Ga0055528_1005700 3300003790 Bacteria 5743
43 Ga0055528_1007582 3300003790 Bacteria 4779
44 Ga0055540_1000354 3300003792 Bacteria 38972
45 Ga0055540_1013619 3300003792 Bacteria 2473
46 Ga0055531_10018855 3300003794 Bacteria 2825
47 Ga0055531_10019507 3300003794 Bacteria 2739
48 Ga0058692_1002834 3300003856 Bacteria 5678
49 Ga0055543_1000053 3300004625 Bacteria 104589
50 Ga0055543_1000301 3300004625 Bacteria 35189
51 Ga0055543_1001332 3300004625 Bacteria 10080
52 Ga0065165_1000717 3300005262 Bacteria 46746
53 Ga0065165_1009792 3300005262 Bacteria 4238
54 Ga0065165_1012321 3300005262 Bacteria 3490
55 Ga0070658_10005999 3300005327 Bacteria 9852
56 Ga0070670_100001771 3300005331 Bacteria 17578
57 Ga0070660_100021341 3300005339 Bacteria 4774
58 Ga0070661_100003058 3300005344 Bacteria 11508
59 Ga0070661_100012268 3300005344 Bacteria 5991
60 Ga0070661_100038645 3300005344 Bacteria 3475
61 Ga0070661_100048108 3300005344 Bacteria 3121
62 Ga0070661_100228306 3300005344 Bacteria 1430
63 Ga0070668_100005878 3300005347 Bacteria 9097
64 Ga0070668_100122993 3300005347 Bacteria 2076
65 Ga0070668_100259398 3300005347 Bacteria 1445
66 Ga0070671_100220808 3300005355 Bacteria 1608
67 Ga0070659_100004052 3300005366 Bacteria 10445
68 Ga0070659_100008711 3300005366 Bacteria 7422
69 Ga0070659_100019420 3300005366 Bacteria 5151
70 Ga0070659_100333682 3300005366 Bacteria 1270
71 Ga0070684_100148732 3300005535 Bacteria 2121
72 Ga0068853_100000271 3300005539 Bacteria 36616
73 Ga0068853_100024802 3300005539 Bacteria 5030
74 Ga0068853_100037735 3300005539 Bacteria 4112
75 Ga0070665_100097786 3300005548 Bacteria 2940
76 Ga0068855_100040700 3300005563 Bacteria 5514
77 Ga0068855_100044031 3300005563 Bacteria 5284
78 Ga0068855_100175558 3300005563 Bacteria 2425
79 Ga0068855_100289863 3300005563 Bacteria 1815
80 Ga0070664_100046347 3300005564 Bacteria 3672
81 Ga0068857_100009724 3300005577 Bacteria 8354
82 Ga0068854_100001115 3300005578 Bacteria 16144
83 Ga0068854_100022418 3300005578 Bacteria 4302
84 Ga0068856_100024578 3300005614 Bacteria 5865
85 Ga0068856_100055765 3300005614 Bacteria 3900
86 Ga0068856_100100092 3300005614 Bacteria 2890
87 Ga0068856_100130470 3300005614 Bacteria 2518
88 Ga0068856_100216897 3300005614 Bacteria 1929
89 Ga0068852_100002681 3300005616 Bacteria 12307
90 Ga0068852_100008011 3300005616 Bacteria 7748
91 Ga0068852_100012510 3300005616 Bacteria 6447
92 Ga0068852_100013007 3300005616 Bacteria 6351
93 Ga0068852_100017842 3300005616 Bacteria 5579
94 Ga0068852_100170827 3300005616 Bacteria 2038
95 Ga0068852_100381707 3300005616 Bacteria 1382
96 Ga0081455_10115747 3300005937 Bacteria 2122
97 Ga0075365_10000306 3300006038 Bacteria 17174
98 Ga0075365_10000404 3300006038 Bacteria 15855
99 Ga0075365_10015261 3300006038 Bacteria 4643
100 Ga0075365_10030747 3300006038 Bacteria 3442
101 Ga0075368_10019516 3300006042 Bacteria 2560
102 Ga0075363_100039411 3300006048 Bacteria 2486
103 Ga0075364_10000091 3300006051 Bacteria 36563
104 Ga0075364_10011277 3300006051 Bacteria 5427
105 Ga0075362_10004177 3300006177 Bacteria 5152
106 Ga0075362_10035850 3300006177 Bacteria 2167
107 Ga0075367_10001214 3300006178 Bacteria 10821
108 Ga0075367_10003637 3300006178 Bacteria 7391
109 Ga0075366_10001037 3300006195 Bacteria 13641
110 Ga0075366_10008524 3300006195 Bacteria 5703
111 Ga0075366_10054185 3300006195 Bacteria 2382
112 Ga0075370_10002712 3300006353 Bacteria 8287
113 Ga0079104_1000610 3300006946 Bacteria 35237
114 Ga0079104_1013220 3300006946 Bacteria 2555
115 Ga0099826_10000054 3300006948 Bacteria 71175
116 Ga0105251_10023177 3300009011 Bacteria 3209
117 Ga0105240_10000005 3300009093 Bacteria 702630
118 Ga0105240_10009447 3300009093 Bacteria 13807
119 Ga0105240_10087374 3300009093 Bacteria 3818
120 Ga0105243_10039379 3300009148 Bacteria 3684
121 Ga0105241_10006649 3300009174 Bacteria 8516
122 Ga0105241_10030240 3300009174 Bacteria 4046
123 Ga0105241_10031587 3300009174 Bacteria 3966
124 Ga0105241_10115356 3300009174 Bacteria 2156
125 Ga0105248_10191206 3300009177 Bacteria 2306
126 Ga0105237_10000809 3300009545 Bacteria 42758
127 Ga0105237_10006832 3300009545 Bacteria 12577
128 Ga0105238_10001305 3300009551 Bacteria 25040
129 Ga0105238_10073212 3300009551 Bacteria 3421
130 Ga0123341_1000188 3300009765 Bacteria 31454
131 Ga0123342_1014890 3300009766 Bacteria 7276
132 Ga0123342_1033521 3300009766 Bacteria 2325
133 Ga0105239_10012400 3300010375 Bacteria 9491
134 Ga0105239_10197818 3300010375 Bacteria 2251
135 Ga0157373_10015740 3300013100 Bacteria 5522
136 Ga0157373_10133085 3300013100 Bacteria 1748
137 Ga0157371_10000002 3300013102 Bacteria 665040
138 Ga0157371_10015741 3300013102 Bacteria 5662
139 Ga0157370_10000286 3300013104 Bacteria 64173
140 Ga0157370_10001170 3300013104 Bacteria 32703
141 Ga0157370_10043828 3300013104 Bacteria 4303
142 Ga0157370_10108215 3300013104 Bacteria 2599
143 Ga0157369_10058539 3300013105 Bacteria 4156
144 Ga0157369_10226328 3300013105 Bacteria 1956
145 Ga0171463_1003 3300013249 Bacteria 695693
146 Ga0157378_10016798 3300013297 Bacteria 6413
147 Ga0157378_10204004 3300013297 Bacteria 1871
148 Ga0157372_10093818 3300013307 Bacteria 3416
149 Ga0157372_10236234 3300013307 Bacteria 2120
150 Ga0182007_10004491 3300015262 Bacteria 6311
151 Ga0183363_1047 3300015690 Bacteria 39413
152 Ga0214544_1001682 3300021320 Bacteria 46508
153 Ga0214542_1001614 3300021321 Bacteria 46380
154 Ga0214542_1016791 3300021321 Bacteria 6921
155 Ga0214543_1000078 3300021327 Bacteria 119775
156 Ga0214543_1001395 3300021327 Bacteria 46435
157 Ga0228711_1000016 3300022739 Bacteria 126351
158 Ga0228710_1000013 3300022740 Bacteria 145976
159 Ga0209435_100012 3300025206 Bacteria 401621
160 Ga0209436_100085 3300025208 Bacteria 46798
161 Ga0207427_101277 3300025231 Bacteria 9577
162 Ga0209437_100047 3300025233 Bacteria 405163
163 Ga0209437_100165 3300025233 Bacteria 145009
164 Ga0207425_1000024 3300025245 Bacteria 328978
165 Ga0207425_1003357 3300025245 Bacteria 5160
166 Ga0207425_1004232 3300025245 Bacteria 4355
167 Ga0207425_1016370 3300025245 Bacteria 1646
168 Ga0209646_1000026 3300025246 Bacteria 401621
169 Ga0209026_1000014 3300025250 Bacteria 401621
170 Ga0209677_103130 3300025253 Bacteria 5619
171 Ga0209759_1000012 3300025256 Bacteria 401621
172 Ga0209129_1000069 3300025258 Bacteria 212790
173 Ga0209129_1000184 3300025258 Bacteria 87102
174 Ga0209129_1000376 3300025258 Bacteria 36225
175 Ga0209129_1000703 3300025258 Bacteria 21754
176 Ga0209129_1000735 3300025258 Bacteria 21020
177 Ga0209129_1003238 3300025258 Bacteria 7245
178 Ga0209233_1000048 3300025261 Bacteria 453669
179 Ga0209233_1000069 3300025261 Bacteria 367639
180 Ga0209233_1000195 3300025261 Bacteria 125863
181 Ga0209233_1000208 3300025261 Bacteria 115633
182 Ga0209673_1000010 3300025273 Bacteria 596656
183 Ga0209673_1000013 3300025273 Bacteria 571633
184 Ga0209673_1000296 3300025273 Bacteria 92350
185 Ga0209673_1000850 3300025273 Bacteria 39843
186 Ga0209673_1002846 3300025273 Bacteria 11085
187 Ga0209673_1005667 3300025273 Bacteria 6234
188 Ga0209673_1008745 3300025273 Bacteria 4470
189 Ga0209130_1000021 3300025284 Bacteria 374278
190 Ga0209130_1000029 3300025284 Bacteria 323399
191 Ga0209130_1000081 3300025284 Bacteria 166440
192 Ga0209676_1007150 3300025292 Bacteria 5329
193 Ga0209676_1009134 3300025292 Bacteria 4316
194 Ga0209025_1000050 3300025294 Bacteria 331531
195 Ga0209025_1000166 3300025294 Bacteria 164692
196 Ga0209025_1000959 3300025294 Bacteria 43491
197 Ga0209025_1001225 3300025294 Bacteria 35824
198 Ga0209025_1001950 3300025294 Bacteria 23818
199 Ga0209025_1004412 3300025294 Bacteria 12242
200 Ga0209025_1022035 3300025294 Bacteria 3400
201 Ga0209025_1026054 3300025294 Bacteria 2950
202 Ga0209564_1000260 3300025295 Bacteria 112444
203 Ga0209564_1000278 3300025295 Bacteria 105405
204 Ga0209564_1000584 3300025295 Bacteria 57729
205 Ga0209564_1000920 3300025295 Bacteria 38309
206 Ga0209564_1004501 3300025295 Bacteria 8498
207 Ga0209564_1016076 3300025295 Bacteria 3002
208 Ga0209564_1016737 3300025295 Bacteria 2898
209 Ga0209564_1021031 3300025295 Bacteria 2366
210 Ga0209758_1000083 3300025297 Bacteria 257283
211 Ga0209758_1000418 3300025297 Bacteria 72150
212 Ga0209758_1001270 3300025297 Bacteria 31259
213 Ga0209758_1001487 3300025297 Bacteria 27386
214 Ga0209758_1001756 3300025297 Bacteria 24054
215 Ga0209758_1005225 3300025297 Bacteria 10173
216 Ga0209050_1003249 3300025298 Bacteria 12243
217 Ga0209050_1031523 3300025298 Bacteria 1650
218 Ga0209256_1000042 3300025299 Bacteria 341821
219 Ga0209256_1000383 3300025299 Bacteria 70773
220 Ga0209256_1000588 3300025299 Bacteria 50690
221 Ga0209256_1001127 3300025299 Bacteria 30457
222 Ga0209256_1002941 3300025299 Bacteria 12786
223 Ga0209256_1010688 3300025299 Bacteria 3800
224 Ga0209256_1031368 3300025299 Bacteria 1454
225 Ga0207426_1000008 3300025302 Bacteria 848730
226 Ga0207426_1000010 3300025302 Bacteria 796003
227 Ga0207426_1000039 3300025302 Bacteria 439937
228 Ga0207426_1000074 3300025302 Bacteria 323399
229 Ga0207426_1000952 3300025302 Bacteria 28571
230 Ga0209051_1000611 3300025303 Bacteria 41422
231 Ga0209051_1002092 3300025303 Bacteria 15051
232 Ga0209051_1010035 3300025303 Bacteria 4821
233 Ga0209051_1016142 3300025303 Bacteria 3401
234 Ga0209257_1002801 3300025304 Bacteria 16394
235 Ga0209257_1007900 3300025304 Bacteria 6254
236 Ga0207705_10030520 3300025909 Bacteria 3846
237 Ga0207705_10041547 3300025909 Bacteria 3299
238 Ga0207654_10040636 3300025911 Bacteria 2622
239 Ga0207654_10042574 3300025911 Bacteria 2571
240 Ga0207695_10000011 3300025913 Bacteria 910221
241 Ga0207695_10038263 3300025913 Bacteria 5167
242 Ga0207671_10000804 3300025914 Bacteria 39792
243 Ga0207671_10018551 3300025914 Bacteria 5332
244 Ga0207657_10014455 3300025919 Bacteria 7707
245 Ga0207657_10046011 3300025919 Bacteria 3824
246 Ga0207649_10001779 3300025920 Bacteria 12329
247 Ga0207649_10008450 3300025920 Bacteria 5614
248 Ga0207649_10060527 3300025920 Bacteria 2380
249 Ga0207694_10014275 3300025924 Bacteria 5989
250 Ga0207650_10002483 3300025925 Bacteria 12829
251 Ga0207644_10202029 3300025931 Bacteria 1568
252 Ga0207690_10038204 3300025932 Bacteria 3123
253 Ga0207690_10105357 3300025932 Bacteria 2022
254 Ga0207691_10082674 3300025940 Bacteria 2884
255 Ga0207667_10010615 3300025949 Bacteria 10754
256 Ga0207667_10016213 3300025949 Bacteria 8421
257 Ga0207667_10071066 3300025949 Bacteria 3620
258 Ga0207667_10082530 3300025949 Bacteria 3329
259 Ga0207668_10049389 3300025972 Bacteria 2892
260 Ga0207668_10274457 3300025972 Bacteria 1380
261 Ga0207668_10331068 3300025972 Bacteria 1267
262 Ga0207640_10002795 3300025981 Bacteria 9359
263 Ga0207640_10053445 3300025981 Bacteria 2637
264 Ga0207640_10147048 3300025981 Bacteria 1726
265 Ga0207639_10001791 3300026041 Bacteria 14472
266 Ga0207678_10054418 3300026067 Bacteria 3447
267 Ga0207678_10200116 3300026067 Bacteria 1708
268 Ga0207702_10045718 3300026078 Bacteria 3683
269 Ga0207702_10076174 3300026078 Bacteria 2899
270 Ga0207702_10099294 3300026078 Bacteria 2566
271 Ga0207702_10105393 3300026078 Bacteria 2497
272 Ga0207702_10184388 3300026078 Bacteria 1924
273 Ga0207702_10214492 3300026078 Bacteria 1791
274 Ga0207674_10071035 3300026116 Bacteria 3499
275 Ga0207698_10000890 3300026142 Bacteria 17333
276 Ga0207698_10039607 3300026142 Bacteria 3493
277 Ga0207698_10049365 3300026142 Bacteria 3202
278 Ga0207698_10131252 3300026142 Bacteria 2141
279 Ga0207698_10144437 3300026142 Bacteria 2055
280 Ga0207698_10202097 3300026142 Bacteria 1780
281 Ga0209281_1000036 3300027111 Bacteria 369415
282 Ga0209281_1000047 3300027111 Bacteria 326514
283 Ga0209281_1000221 3300027111 Bacteria 122380
284 Ga0209281_1000453 3300027111 Bacteria 58584
285 Ga0209371_1000012 3300027312 Bacteria 748304
286 Ga0209371_1002509 3300027312 Bacteria 10168
287 Ga0209371_1003859 3300027312 Bacteria 6946
288 Ga0209282_1000041 3300027666 Bacteria 122268
289 Ga0209282_1000140 3300027666 Bacteria 42807
290 Ga0209813_10005946 3300027866 Bacteria 2995
291 Ga0268266_10074885 3300028379 Bacteria 2940
292 Ga0268266_10139096 3300028379 Bacteria 2178
293 Ga0265318_10003757 3300028577 Bacteria 7552
294 Ga0307515_10000023 3300028794 Bacteria 400846
295 Ga0307515_10046287 3300028794 Bacteria 6654
296 Ga0307515_10080288 3300028794 Bacteria 4257
297 Ga0265338_10013153 3300028800 Bacteria 9371
298 Ga0268256_1000013 3300030500 Bacteria 752103
299 Ga0268256_1003570 3300030500 Bacteria 6946
300 Ga0316181_1124615 3300030744 Bacteria 4431
301 Ga0265330_10030273 3300031235 Bacteria 2431
302 Ga0265332_10026923 3300031238 Bacteria 2520
303 Ga0265325_10001358 3300031241 Bacteria 17326
304 Ga0265329_10006287 3300031242 Bacteria 4721
305 Ga0265339_10000443 3300031249 Bacteria 32418
306 Ga0265331_10014508 3300031250 Bacteria 4195
307 Ga0265316_10038069 3300031344 Bacteria 3878
308 Ga0307513_10003030 3300031456 Bacteria 22903
309 Ga0307408_100122433 3300031548 Bacteria 2017
310 Ga0265313_10000048 3300031595 Bacteria 112723
311 Ga0265314_10010928 3300031711 Bacteria 7537
312 Ga0265342_10013396 3300031712 Bacteria 5503
313 Ga0307405_10000781 3300031731 Bacteria 12489
314 Ga0307405_10061347 3300031731 Bacteria 2377
315 Ga0307405_10152944 3300031731 Bacteria 1625
316 Ga0307407_10191787 3300031903 Bacteria 1363
317 Ga0307412_10140528 3300031911 Bacteria 1768
318 Ga0315914_1000030 3300031967 Bacteria 102599
319 Ga0307416_100085503 3300032002 Bacteria 2685
320 Ga0307414_10100666 3300032004 Bacteria 2174
321 Ga0307411_10119669 3300032005 Bacteria 1903
322 Ga0315913_1000017 3300033430 Bacteria 102835
323 Ga0315915_1000017 3300033464 Bacteria 148111
324 Ga0395901_0264505 3300038443 Bacteria 1789
325 Ga0400483_029206 3300039062 Unclassified 4687
326 Ga0400483_091231 3300039062 Unclassified 1577
327 Ga0400483_094012 3300039062 Bacteria 2585
328 Ga0400483_124851 3300039062 Bacteria 1352
329 Ga0400483_290121 3300039062 Bacteria 2925
330 Ga0436360_0610068 3300039438 Bacteria 2676
331 Ga0439436_0001642 3300041404 Bacteria 6526
332 Ga0439439_0010918 3300041406 Bacteria 2178
333 Ga0451787_009192 3300041441 Bacteria 3758
334 Ga0451807_1358952 3300041486 Bacteria 1923
335 Ga0451833_0028360 3300041491 Bacteria 1642
336 Ga0451841_0180374 3300041498 Bacteria 2136
337 Ga0451845_0316168 3300041501 Bacteria 3780
338 Ga0451849_0293555 3300041505 Bacteria 2101
339 Ga0451851_0510789 3300041507 Bacteria 1500
340 Ga0451843_0517638 3300041509 Bacteria 2266
341 Ga0451853_0469856 3300041512 Bacteria 1957
342 Ga0439431_0025176 3300041997 Bacteria 1452
343 Ga0439449_0005799 3300042007 Bacteria 4721
344 Ga0466957_0089726 3300044842 Bacteria 1925
345 Ga0495629_0065953 3300046459 Bacteria 2526
346 Ga0495638_0001984 3300046460 Bacteria 17461
347 Ga0495662_0012415 3300046476 Bacteria 4157
348 Ga0495585_0046485 3300046492 Bacteria 2421
349 Ga0495606_0089977 3300046507 Bacteria 1890
350 Ga0495631_0011061 3300046518 Bacteria 4452
351 Ga0495654_0000090 3300046530 Bacteria 101947
352 Ga0495587_0126025 3300046536 Bacteria 1465
353 Ga0495622_0005922 3300046557 Bacteria 5680
354 Ga0495625_0050368 3300046660 Bacteria 2989
355 Ga0495588_0011344 3300046674 Bacteria 4178
356 Ga0495624_0069428 3300046690 Bacteria 2195
357 Ga0495649_0041615 3300046694 Bacteria 2512
358 Ga0495604_0048763 3300047317 Bacteria 3293
359 Ga0495681_0000886 3300047470 Bacteria 23149
360 Ga0495686_0008216 3300047472 Bacteria 7697
361 Ga0496100_0042674 3300048903 Bacteria 2898
362 Ga0496102_0109133 3300048905 Bacteria 2578
363 Ga0496110_0184017 3300048913 Bacteria 1897
364 Ga0496111_0012743 3300048914 Bacteria 5700
365 Ga0496111_0056372 3300048914 Bacteria 2843
366 Ga0496113_0022885 3300048916 Bacteria 4427
367 Ga0496114_0173611 3300048917 Bacteria 1880
368 Ga0496116_0000061 3300048919 Bacteria 271860
369 Ga0496116_0018700 3300048919 Bacteria 5327
370 Ga0496116_0067462 3300048919 Bacteria 2284
371 Ga0496117_0000016 3300048920 Bacteria 523642
372 Ga0496118_0000535 3300048921 Bacteria 62444
373 Ga0496118_0016390 3300048921 Bacteria 6801
374 Ga0496118_0025170 3300048921 Bacteria 5113
375 Ga0496118_0035617 3300048921 Bacteria 4038
376 Ga0496118_0036469 3300048921 Bacteria 3975
377 Ga0496119_0021558 3300048922 Bacteria 4651
378 Ga0496119_0083943 3300048922 Bacteria 1827
379 Ga0496120_0000056 3300048923 Bacteria 180367
380 Ga0496120_0055452 3300048923 Bacteria 2241
381 Ga0496121_0000001 3300048924 Bacteria 1830318
382 Ga0496121_0003418 3300048924 Bacteria 22706
383 Ga0496121_0025293 3300048924 Bacteria 5640
384 Ga0496121_0049063 3300048924 Bacteria 3585
385 Ga0496121_0051938 3300048924 Bacteria 3448
386 Ga0496122_0000002 3300048925 Bacteria 905834
387 Ga0496122_0000369 3300048925 Bacteria 96672
388 Ga0496122_0019117 3300048925 Bacteria 6281
389 Ga0496122_0049793 3300048925 Bacteria 3202
390 Ga0496122_0053662 3300048925 Bacteria 3036
391 Ga0496122_0171475 3300048925 Bacteria 1307
392 Ga0496123_0000002 3300048926 Bacteria 1811682
393 Ga0496123_0000054 3300048926 Bacteria 234046
394 Ga0496123_0045707 3300048926 Bacteria 2980
395 Ga0496123_0073509 3300048926 Bacteria 2120
396 Ga0496124_0000091 3300048927 Bacteria 189706
397 Ga0496124_0002629 3300048927 Bacteria 23098
398 Ga0496124_0010219 3300048927 Bacteria 9534
399 Ga0496124_0060519 3300048927 Bacteria 3177
400 Ga0496124_0124752 3300048927 Bacteria 2053
401 Ga0496124_0158031 3300048927 Bacteria 1770
402 Ga0496125_0000001 3300048928 Bacteria 1766138
403 Ga0496125_0000301 3300048928 Bacteria 96860
404 Ga0496126_0000059 3300048929 Bacteria 267449
405 Ga0496126_0024626 3300048929 Bacteria 5807
406 Ga0501031_0000831 3300049568 Bacteria 18554
407 Ga0501031_0042020 3300049568 Bacteria 2985
408 Ga0501032_0000019 3300049569 Bacteria 155168
409 Ga0501032_0010722 3300049569 Bacteria 6596
410 Ga0501033_0003165 3300049570 Bacteria 13674
411 Ga0501034_0000130 3300049571 Bacteria 139568
412 Ga0501034_0001091 3300049571 Bacteria 38199
413 Ga0501034_0003341 3300049571 Bacteria 18310
414 Ga0501034_0025994 3300049571 Bacteria 5963
415 Ga0501034_0086855 3300049571 Bacteria 3128
416 Ga0501034_0102421 3300049571 Bacteria 2856
417 Ga0501034_0127961 3300049571 Bacteria 2524
418 Ga0501034_0254112 3300049571 Bacteria 1701
419 Ga0501036_0000635 3300049572 Bacteria 25582
420 Ga0501036_0072071 3300049572 Bacteria 2920
421 Ga0501036_0153858 3300049572 Bacteria 1940
422 Ga0501037_0005590 3300049573 Bacteria 9165
423 Ga0501037_0008501 3300049573 Bacteria 7527
424 Ga0501037_0086156 3300049573 Bacteria 2274
425 Ga0501038_0000478 3300049574 Bacteria 35183
426 Ga0501038_0030525 3300049574 Bacteria 4768
427 Ga0501039_0000028 3300049575 Bacteria 139568
428 Ga0501039_0012409 3300049575 Bacteria 6505
429 Ga0501039_0169072 3300049575 Bacteria 1719
430 Ga0501041_0106345 3300049577 Bacteria 1739
431 Ga0501043_0003505 3300049579 Bacteria 12900
432 Ga0501043_0155011 3300049579 Bacteria 1791
433 Ga0501046_0140291 3300049580 Bacteria 1829
434 Ga0501047_0261675 3300049581 Bacteria 1577
435 Ga0501047_0272208 3300049581 Bacteria 1540
436 Ga0501048_0156218 3300049582 Bacteria 1614
437 Ga0501069_0125237 3300049585 Bacteria 1469
438 Ga0501070_0187400 3300049586 Bacteria 1701
439 Ga0501073_0157453 3300049589 Bacteria 1574
440 Ga0501074_0209435 3300049590 Bacteria 1389
441 Ga0501280_005335 3300049776 Bacteria 1840
442 Ga0501035_0000143 3300049822 Bacteria 86821
443 Ga0501035_0092282 3300049822 Bacteria 2664
444 Ga0501044_0008899 3300049823 Bacteria 10973
445 nmdc:mga00v17_156_c1 3300050491 Bacteria 40197
446 nmdc:mga00v17_3_c1 3300050491 Bacteria 242367
447 nmdc:mga00v17_8320_c1 3300050491 Bacteria 5581
448 nmdc:mga0k408_17499_c1 3300050493 Bacteria 3994
449 nmdc:mga04h51_41482_c1 3300050495 Bacteria 1504
450 nmdc:mga0sz30_2395_c1 3300050516 Bacteria 6693
451 Ga0500572_011708 3300053111 Bacteria 2130
452 Ga0500618_002658 3300053125 Bacteria 6573
453 Ga0500658_0017602 3300053134 Bacteria 2670
454 Ga0500568_0030432 3300053139 Bacteria 2235
455 Ga0500568_0035223 3300053139 Bacteria 2044
456 Ga0500573_0000259 3300053140 Bacteria 22228
457 Ga0500604_0000146 3300053151 Bacteria 21141
458 Ga0500604_0002515 3300053151 Bacteria 5003
459 Ga0500616_0000301 3300053153 Bacteria 71758
460 Ga0500616_0006977 3300053153 Bacteria 7272
461 Ga0500616_0008228 3300053153 Bacteria 6505
462 Ga0500616_0009464 3300053153 Bacteria 5927
463 Ga0500622_0002301 3300053156 Bacteria 13988
464 Ga0500624_000733 3300053157 Bacteria 8098
465 Ga0500634_0000004 3300053161 Bacteria 214946
466 Ga0500634_0001667 3300053161 Bacteria 8818
467 Ga0500636_0000034 3300053177 Bacteria 72555
468 Ga0500636_0029235 3300053177 Bacteria 3255
469 Ga0587077_008812 3300059493 Bacteria 1513
470 Ga0587098_001071 3300059604 Bacteria 1983
471 Ga0587072_004741 3300059643 Bacteria 1996
472 Ga0587076_009010 3300059645 Bacteria 1408

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2937084907 2937087053 320
2 iso_pu_bacteria 2690316117 2692315849 325
3 3300042007 Ga0439449_0005799 Ga0439449_0005799_2184_3167 327
4 3300046476 Ga0495662_0012415 Ga0495662_0012415_3123_4142 339
5 3300041997 Ga0439431_0025176 Ga0439431_0025176_330_1433 356
6 iso_pu_bacteria 2643221629 2644165318 356
7 iso_pu_bacteria 2643221662 2644348301 356
8 3300025261 Ga0209233_1000208 Ga0209233_10002085 359
9 3300025294 Ga0209025_1026054 Ga0209025_10260543 359
10 3300039438 Ga0436360_0610068 Ga0436360_0610068_1468_2565 359
11 3300048917 Ga0496114_0173611 Ga0496114_0173611_597_1694 359
12 3300053156 Ga0500622_0002301 Ga0500622_0002301_12062_13159 359
13 iso_pu_bacteria 2643221580 2643911158 359
14 iso_pu_bacteria 2643221674 2644411995 359
15 3300041486 Ga0451807_1358952 Ga0451807_1358952_450_1559 360
16 3300005327 Ga0070658_10005999 Ga0070658_1000599912 361
17 3300005344 Ga0070661_100003058 Ga0070661_1000030585 361
18 3300005344 Ga0070661_100012268 Ga0070661_1000122685 361
19 3300005344 Ga0070661_100038645 Ga0070661_1000386455 361
20 3300005366 Ga0070659_100008711 Ga0070659_1000087117 361
21 3300005366 Ga0070659_100019420 Ga0070659_1000194202 361
22 3300005535 Ga0070684_100148732 Ga0070684_1001487322 361
23 3300005539 Ga0068853_100000271 Ga0068853_10000027126 361
24 3300005539 Ga0068853_100037735 Ga0068853_1000377355 361
25 3300005563 Ga0068855_100040700 Ga0068855_1000407004 361
26 3300005563 Ga0068855_100044031 Ga0068855_1000440316 361
27 3300005564 Ga0070664_100046347 Ga0070664_1000463471 361
28 3300005577 Ga0068857_100009724 Ga0068857_1000097243 361
29 3300005578 Ga0068854_100001115 Ga0068854_10000111516 361
30 3300005578 Ga0068854_100022418 Ga0068854_1000224182 361
31 3300005614 Ga0068856_100024578 Ga0068856_1000245788 361
32 3300005614 Ga0068856_100216897 Ga0068856_1002168973 361
33 3300005616 Ga0068852_100008011 Ga0068852_1000080114 361
34 3300005616 Ga0068852_100012510 Ga0068852_1000125106 361
35 3300005616 Ga0068852_100017842 Ga0068852_1000178428 361
36 3300005616 Ga0068852_100170827 Ga0068852_1001708272 361
37 3300005616 Ga0068852_100381707 Ga0068852_1003817071 361
38 3300006038 Ga0075365_10030747 Ga0075365_100307474 361
39 3300006042 Ga0075368_10019516 Ga0075368_100195164 361
40 3300006177 Ga0075362_10035850 Ga0075362_100358502 361
41 3300006195 Ga0075366_10008524 Ga0075366_100085245 361
42 3300006353 Ga0075370_10002712 Ga0075370_100027122 361
43 3300009093 Ga0105240_10087374 Ga0105240_100873746 361
44 3300009174 Ga0105241_10006649 Ga0105241_100066493 361
45 3300009174 Ga0105241_10030240 Ga0105241_100302405 361
46 3300009174 Ga0105241_10115356 Ga0105241_101153562 361
47 3300009545 Ga0105237_10006832 Ga0105237_100068328 361
48 3300009551 Ga0105238_10001305 Ga0105238_1000130517 361
49 3300010375 Ga0105239_10012400 Ga0105239_100124002 361
50 3300010375 Ga0105239_10197818 Ga0105239_101978183 361
51 3300013104 Ga0157370_10043828 Ga0157370_100438282 361
52 3300013105 Ga0157369_10226328 Ga0157369_102263282 361
53 3300013297 Ga0157378_10016798 Ga0157378_100167982 361
54 3300013297 Ga0157378_10204004 Ga0157378_102040042 361
55 3300013307 Ga0157372_10093818 Ga0157372_100938184 361
56 3300013307 Ga0157372_10236234 Ga0157372_102362342 361
57 3300025909 Ga0207705_10030520 Ga0207705_100305202 361
58 3300025911 Ga0207654_10040636 Ga0207654_100406363 361
59 3300025911 Ga0207654_10042574 Ga0207654_100425744 361
60 3300025914 Ga0207671_10018551 Ga0207671_100185515 361
61 3300025919 Ga0207657_10014455 Ga0207657_1001445510 361
62 3300025920 Ga0207649_10001779 Ga0207649_100017796 361
63 3300025920 Ga0207649_10060527 Ga0207649_100605273 361
64 3300025924 Ga0207694_10014275 Ga0207694_100142752 361
65 3300025932 Ga0207690_10038204 Ga0207690_100382045 361
66 3300025932 Ga0207690_10105357 Ga0207690_101053572 361
67 3300025940 Ga0207691_10082674 Ga0207691_100826745 361
68 3300025949 Ga0207667_10010615 Ga0207667_100106157 361
69 3300025949 Ga0207667_10082530 Ga0207667_100825306 361
70 3300025981 Ga0207640_10002795 Ga0207640_100027952 361
71 3300025981 Ga0207640_10147048 Ga0207640_101470482 361
72 3300026041 Ga0207639_10001791 Ga0207639_100017918 361
73 3300026067 Ga0207678_10054418 Ga0207678_100544186 361
74 3300026067 Ga0207678_10200116 Ga0207678_102001162 361
75 3300026078 Ga0207702_10045718 Ga0207702_100457183 361
76 3300026078 Ga0207702_10105393 Ga0207702_101053932 361
77 3300026078 Ga0207702_10214492 Ga0207702_102144922 361
78 3300026116 Ga0207674_10071035 Ga0207674_100710353 361
79 3300026142 Ga0207698_10000890 Ga0207698_100008902 361
80 3300026142 Ga0207698_10039607 Ga0207698_100396075 361
81 3300026142 Ga0207698_10049365 Ga0207698_100493656 361
82 3300026142 Ga0207698_10131252 Ga0207698_101312522 361
83 3300026142 Ga0207698_10144437 Ga0207698_101444372 361
84 3300028577 Ga0265318_10003757 Ga0265318_100037571 361
85 3300028800 Ga0265338_10013153 Ga0265338_100131539 361
86 3300031235 Ga0265330_10030273 Ga0265330_100302732 361
87 3300031238 Ga0265332_10026923 Ga0265332_100269233 361
88 3300031241 Ga0265325_10001358 Ga0265325_100013589 361
89 3300031242 Ga0265329_10006287 Ga0265329_100062877 361
90 3300031249 Ga0265339_10000443 Ga0265339_1000044325 361
91 3300031250 Ga0265331_10014508 Ga0265331_100145085 361
92 3300031344 Ga0265316_10038069 Ga0265316_100380693 361
93 3300031595 Ga0265313_10000048 Ga0265313_1000004884 361
94 3300031711 Ga0265314_10010928 Ga0265314_100109282 361
95 3300031712 Ga0265342_10013396 Ga0265342_100133964 361
96 3300044842 Ga0466957_0089726 Ga0466957_0089726_316_1425 361
97 3300047472 Ga0495686_0008216 Ga0495686_0008216_786_1895 361
98 3300049571 Ga0501034_0025994 Ga0501034_0025994_2459_3568 361
99 3300049571 Ga0501034_0086855 Ga0501034_0086855_1490_2599 361
100 3300049571 Ga0501034_0102421 Ga0501034_0102421_1053_2162 361
101 3300049572 Ga0501036_0072071 Ga0501036_0072071_875_1984 361
102 3300049573 Ga0501037_0008501 Ga0501037_0008501_1495_2604 361
103 3300049574 Ga0501038_0030525 Ga0501038_0030525_295_1404 361
104 3300049575 Ga0501039_0012409 Ga0501039_0012409_212_1321 361
105 3300049579 Ga0501043_0155011 Ga0501043_0155011_477_1586 361
106 3300049581 Ga0501047_0261675 Ga0501047_0261675_207_1316 361
107 3300049586 Ga0501070_0187400 Ga0501070_0187400_396_1505 361
108 3300049822 Ga0501035_0092282 Ga0501035_0092282_1069_2178 361
109 3300050493 nmdc:mga0k408_17499_c1 nmdc:mga0k408_17499_c1_2109_3218 361
110 3300053139 Ga0500568_0030432 Ga0500568_0030432_1026_2135 361
111 3300005347 Ga0070668_100005878 Ga0070668_1000058789 362
112 3300025972 Ga0207668_10049389 Ga0207668_100493894 362
113 3300031911 Ga0307412_10140528 Ga0307412_101405282 362
114 3300049568 Ga0501031_0042020 Ga0501031_0042020_1108_2235 362
115 3300049571 Ga0501034_0003341 Ga0501034_0003341_5101_6225 362
116 3300049571 Ga0501034_0254112 Ga0501034_0254112_202_1326 362
117 3300049575 Ga0501039_0169072 Ga0501039_0169072_69_1196 362
118 3300053151 Ga0500604_0002515 Ga0500604_0002515_1192_2316 362
119 3300053153 Ga0500616_0008228 Ga0500616_0008228_3630_4742 362
120 iso_pu_bacteria 2916068649 2916074290 366
121 iso_pu_bacteria 2837651117 2837654140 368
122 iso_pu_bacteria 8055431914 8055432582 368
123 iso_pu_bacteria 2995392953 2995393081 369
124 3300039062 Ga0400483_094012 Ga0400483_094012_322_1437 370
125 3300021321 Ga0214542_1016791 Ga0214542_10167915 371
126 3300021327 Ga0214543_1000078 Ga0214543_100007823 371
127 3300022739 Ga0228711_1000016 Ga0228711_100001636 371
128 3300022740 Ga0228710_1000013 Ga0228710_100001398 371
129 3300027111 Ga0209281_1000221 Ga0209281_100022132 371
130 3300027666 Ga0209282_1000041 Ga0209282_100004132 371
131 3300031967 Ga0315914_1000030 Ga0315914_100003099 371
132 3300033430 Ga0315913_1000017 Ga0315913_100001797 371
133 3300033464 Ga0315915_1000017 Ga0315915_100001768 371
134 3300039062 Ga0400483_091231 Ga0400483_091231_257_1375 371
135 3300039062 Ga0400483_124851 Ga0400483_124851_75_1193 371
136 3300039062 Ga0400483_029206 Ga0400483_029206_2435_3553 372
137 3300049582 Ga0501048_0156218 Ga0501048_0156218_239_1366 373
138 iso_pu_bacteria 2508501122 2509111396 373
139 iso_pu_bacteria 2509276019 2509375665 373
140 iso_pu_bacteria 2509276021 2509392532 373
141 iso_pu_bacteria 2509276033 2509446553 373
142 iso_pu_bacteria 2510065019 2510133445 373
143 iso_pu_bacteria 2510065057 2510303291 373
144 iso_pu_bacteria 2510461069 2510840035 373
145 iso_pu_bacteria 2510461076 2510894832 373
146 iso_pu_bacteria 2510917022 2511135126 373
147 iso_pu_bacteria 2510917026 2511171672 373
148 iso_pu_bacteria 2510917028 2511181658 373
149 iso_pu_bacteria 2510917030 2511194372 373
150 iso_pu_bacteria 2511231027 2511391053 373
151 iso_pu_bacteria 2511231052 2511501971 373
152 iso_pu_bacteria 2512047086 2512533339 373
153 iso_pu_bacteria 2512875026 2512971092 373
154 iso_pu_bacteria 2513237084 2513572368 373
155 iso_pu_bacteria 2513237085 2513577417 373
156 iso_pu_bacteria 2513237086 2513582632 373
157 iso_pu_bacteria 2513237088 2513594691 373
158 iso_pu_bacteria 2513237089 2513604551 373
159 iso_pu_bacteria 2513237091 2513615466 373
160 iso_pu_bacteria 2513237093 2513629948 373
161 iso_pu_bacteria 2513237103 2513708592 373
162 iso_pu_bacteria 2513237138 2513864761 373
163 iso_pu_bacteria 2513237140 2513881255 373
164 iso_pu_bacteria 2513237143 2513902386 373
165 iso_pu_bacteria 2513237144 2513914111 373
166 iso_pu_bacteria 2513237146 2513926064 373
167 iso_pu_bacteria 2513237156 2513984594 373
168 iso_pu_bacteria 2513237159 2513997064 373
169 iso_pu_bacteria 2513237160 2514007604 373
170 iso_pu_bacteria 2513237162 2514021957 373
171 iso_pu_bacteria 2513237351 2514586446 373
172 iso_pu_bacteria 2515075009 2515112410 373
173 iso_pu_bacteria 2515154107 2515608764 373
174 iso_pu_bacteria 2515154113 2515632759 373
175 iso_pu_bacteria 2515154114 2515639907 373
176 iso_pu_bacteria 2515154116 2515655888 373
177 iso_pu_bacteria 2515154134 2515740324 373
178 iso_pu_bacteria 2516143018 2516209691 373
179 iso_pu_bacteria 2516653046 2516893267 373
180 iso_pu_bacteria 2516653077 2517036142 373
181 iso_pu_bacteria 2516653085 2517076532 373
182 iso_pu_bacteria 2517093000 2517095299 373
183 iso_pu_bacteria 2517287029 2517406903 373
184 iso_pu_bacteria 2517487022 2517570024 373
185 iso_pu_bacteria 2519899620 2520379231 373
186 iso_pu_bacteria 2524023207 2524448833 373
187 iso_pu_bacteria 2524023209 2524460267 373
188 iso_pu_bacteria 2529292951 2530645651 373
189 iso_pu_bacteria 2534681796 2535516606 373
190 iso_pu_bacteria 2537561587 2537877764 373
191 iso_pu_bacteria 2551306084 2551675155 373
192 iso_pu_bacteria 2551306084 2551680519 373
193 iso_pu_bacteria 2551306085 2551688052 373
194 iso_pu_bacteria 2551306086 2551691140 373
195 iso_pu_bacteria 2551306086 2551693966 373
196 iso_pu_bacteria 2551306087 2551698099 373
197 iso_pu_bacteria 2551306087 2551699980 373
198 iso_pu_bacteria 2551306089 2551713206 373
199 iso_pu_bacteria 2551306090 2551722514 373
200 iso_pu_bacteria 2551306091 2551727853 373
201 iso_pu_bacteria 2551306092 2551736514 373
202 iso_pu_bacteria 2551306093 2551745075 373
203 iso_pu_bacteria 2554235003 2554245552 373
204 iso_pu_bacteria 2558860100 2558867981 373
205 iso_pu_bacteria 2558860242 2559296618 373
206 iso_pu_bacteria 2558860983 2561468294 373
207 iso_pu_bacteria 2582581283 2585166135 373
208 iso_pu_bacteria 2582581294 2585200287 373
209 iso_pu_bacteria 2582581298 2585222631 373
210 iso_pu_bacteria 2582581299 2585229894 373
211 iso_pu_bacteria 2582581304 2585254873 373
212 iso_pu_bacteria 2582581306 2585267661 373
213 iso_pu_bacteria 2582581307 2585270866 373
214 iso_pu_bacteria 2582581308 2585277214 373
215 iso_pu_bacteria 2582581315 2585323777 373
216 iso_pu_bacteria 2582581316 2585331756 373
217 iso_pu_bacteria 2582581865 2585386720 373
218 iso_pu_bacteria 2582581866 2585393050 373
219 iso_pu_bacteria 2582581867 2585402123 373
220 iso_pu_bacteria 2585427526 2585527771 373
221 iso_pu_bacteria 2585427527 2585534050 373
222 iso_pu_bacteria 2585427528 2585537666 373
223 iso_pu_bacteria 2585427529 2585545214 373
224 iso_pu_bacteria 2585427530 2585552099 373
225 iso_pu_bacteria 2585427531 2585558590 373
226 iso_pu_bacteria 2585427590 2585821908 373
227 iso_pu_bacteria 2585427593 2585835616 373
228 iso_pu_bacteria 2585427594 2585846832 373
229 iso_pu_bacteria 2585427608 2585897953 373
230 iso_pu_bacteria 2585427609 2585904441 373
231 iso_pu_bacteria 2585427633 2585996024 373
232 iso_pu_bacteria 2585427634 2586000628 373
233 iso_pu_bacteria 2585428125 2587980442 373
234 iso_pu_bacteria 2599185156 2599331585 373
235 iso_pu_bacteria 2599185170 2599417540 373
236 iso_pu_bacteria 2599185210 2599602889 373
237 iso_pu_bacteria 2599185236 2599720978 373
238 iso_pu_bacteria 2599185352 2600193090 373
239 iso_pu_bacteria 2600254933 2600375704 373
240 iso_pu_bacteria 2600255279 2601610498 373
241 iso_pu_bacteria 2600255308 2601747172 373
242 iso_pu_bacteria 2615840624 2616292344 373
243 iso_pu_bacteria 2615840626 2616308592 373
244 iso_pu_bacteria 2615840698 2616557103 373
245 iso_pu_bacteria 2617270742 2617385655 373
246 iso_pu_bacteria 2643221557 2643803590 373
247 iso_pu_bacteria 2643221558 2643812592 373
248 iso_pu_bacteria 2643221568 2643854247 373
249 iso_pu_bacteria 2643221580 2643910295 373
250 iso_pu_bacteria 2643221582 2643917409 373
251 iso_pu_bacteria 2643221591 2643963846 373
252 iso_pu_bacteria 2643221599 2644003875 373
253 iso_pu_bacteria 2643221607 2644050732 373
254 iso_pu_bacteria 2643221610 2644067557 373
255 iso_pu_bacteria 2643221618 2644107703 373
256 iso_pu_bacteria 2643221623 2644133778 373
257 iso_pu_bacteria 2643221626 2644148626 373
258 iso_pu_bacteria 2643221634 2644192600 373
259 iso_pu_bacteria 2643221636 2644205206 373
260 iso_pu_bacteria 2643221637 2644210225 373
261 iso_pu_bacteria 2643221643 2644239683 373
262 iso_pu_bacteria 2643221653 2644298399 373
263 iso_pu_bacteria 2643221655 2644309097 373
264 iso_pu_bacteria 2643221659 2644332925 373
265 iso_pu_bacteria 2643221668 2644375237 373
266 iso_pu_bacteria 2643221674 2644410790 373
267 iso_pu_bacteria 2643221675 2644418610 373
268 iso_pu_bacteria 2643221680 2644451977 373
269 iso_pu_bacteria 2643221686 2644483650 373
270 iso_pu_bacteria 2643221688 2644491799 373
271 iso_pu_bacteria 2643221689 2644501351 373
272 iso_pu_bacteria 2643221693 2644520747 373
273 iso_pu_bacteria 2643221698 2644545903 373
274 iso_pu_bacteria 2643221712 2644615039 373
275 iso_pu_bacteria 2643221718 2644653777 373
276 iso_pu_bacteria 2643221719 2644656628 373
277 iso_pu_bacteria 2643221723 2644676576 373
278 iso_pu_bacteria 2643221726 2644690739 373
279 iso_pu_bacteria 2657244999 2657681194 373
280 iso_pu_bacteria 2667528174 2671111704 373
281 iso_pu_bacteria 2718217882 2719181301 373
282 iso_pu_bacteria 2718217927 2719385909 373
283 iso_pu_bacteria 2718217997 2719665725 373
284 iso_pu_bacteria 2718218009 2719732050 373
285 iso_pu_bacteria 2718218199 2720492145 373
286 iso_pu_bacteria 2718218232 2720613410 373
287 iso_pu_bacteria 2718218233 2720620288 373
288 iso_pu_bacteria 2718218235 2720631712 373
289 iso_pu_bacteria 2718218269 2720775440 373
290 iso_pu_bacteria 2718218363 2721147395 373
291 iso_pu_bacteria 2718218365 2721158929 373
292 iso_pu_bacteria 2718218366 2721164313 373
293 iso_pu_bacteria 2718218423 2721399688 373
294 iso_pu_bacteria 2721755514 2722840483 373
295 iso_pu_bacteria 2721755556 2723027058 373
296 iso_pu_bacteria 2721755684 2723560670 373
297 iso_pu_bacteria 2721755685 2723567259 373
298 iso_pu_bacteria 2721755809 2724038501 373
299 iso_pu_bacteria 2721755810 2724044806 373
300 iso_pu_bacteria 2721755819 2724090047 373
301 iso_pu_bacteria 2721755822 2724104524 373
302 iso_pu_bacteria 2721755823 2724110318 373
303 iso_pu_bacteria 2724679232 2725948586 373
304 iso_pu_bacteria 2728369352 2730107994 373
305 iso_pu_bacteria 2728369365 2730164538 373
306 iso_pu_bacteria 2728369397 2730298561 373
307 iso_pu_bacteria 2738541293 2738804206 373
308 iso_pu_bacteria 2738541317 2738946063 373
309 iso_pu_bacteria 2738541333 2739036629 373
310 iso_pu_bacteria 2751185821 2753461861 373
311 iso_pu_bacteria 2757320392 2757572114 373
312 iso_pu_bacteria 2765235802 2765468597 373
313 iso_pu_bacteria 2765235942 2766067422 373
314 iso_pu_bacteria 2767802442 2770198895 373
315 iso_pu_bacteria 2775506902 2776272878 373
316 iso_pu_bacteria 2775506904 2776282279 373
317 iso_pu_bacteria 2775507049 2776913544 373
318 iso_pu_bacteria 2775507266 2778174030 373
319 iso_pu_bacteria 2791355082 2792581763 373
320 iso_pu_bacteria 2791355091 2792620167 373
321 iso_pu_bacteria 2791355092 2792626413 373
322 iso_pu_bacteria 2791355094 2792639362 373
323 iso_pu_bacteria 2791355256 2793294802 373
324 iso_pu_bacteria 2791355259 2793312380 373
325 iso_pu_bacteria 2791355260 2793322919 373
326 iso_pu_bacteria 2791355261 2793331014 373
327 iso_pu_bacteria 2791355262 2793335932 373
328 iso_pu_bacteria 2791355263 2793341644 373
329 iso_pu_bacteria 2791355264 2793348950 373
330 iso_pu_bacteria 2791355265 2793352948 373
331 iso_pu_bacteria 2791355266 2793364349 373
332 iso_pu_bacteria 2791355267 2793366860 373
333 iso_pu_bacteria 2802428858 2802719519 373
334 iso_pu_bacteria 2802428859 2802726888 373
335 iso_pu_bacteria 2802428860 2802732253 373
336 iso_pu_bacteria 2802428861 2802739856 373
337 iso_pu_bacteria 2802428862 2802745362 373
338 iso_pu_bacteria 2802428863 2802752754 373
339 iso_pu_bacteria 2802429268 2804752394 373
340 iso_pu_bacteria 2802429605 2805925824 373
341 iso_pu_bacteria 2802429606 2805933456 373
342 iso_pu_bacteria 2802429633 2806046179 373
343 iso_pu_bacteria 2802429634 2806054559 373
344 iso_pu_bacteria 2802429635 2806060563 373
345 iso_pu_bacteria 2802429636 2806064979 373
346 iso_pu_bacteria 2802429637 2806072238 373
347 iso_pu_bacteria 2808606387 2808987071 373
348 iso_pu_bacteria 2818991272 2819241740 373
349 iso_pu_bacteria 2818991439 2819560626 373
350 iso_pu_bacteria 2818991448 2819612784 373
351 iso_pu_bacteria 2818991453 2819637897 373
352 iso_pu_bacteria 2818991461 2819684749 373
353 iso_pu_bacteria 2821123053 2821129480 373
354 iso_pu_bacteria 2838016132 2838018087 373
355 iso_pu_bacteria 2838022645 2838026294 373
356 iso_pu_bacteria 2838029111 2838030078 373
357 iso_pu_bacteria 2838035591 2838038247 373
358 iso_pu_bacteria 2838042994 2838043567 373
359 iso_pu_bacteria 2838048938 2838053484 373
360 iso_pu_bacteria 2838061910 2838065685 373
361 iso_pu_bacteria 2838068647 2838074400 373
362 iso_pu_bacteria 2838661181 2838661876 373
363 iso_pu_bacteria 2838668709 2838673740 373
364 iso_pu_bacteria 2838675328 2838677881 373
365 iso_pu_bacteria 2838680041 2838682086 373
366 iso_pu_bacteria 2838686498 2838691916 373
367 iso_pu_bacteria 2838694306 2838696658 373
368 iso_pu_bacteria 2838701080 2838706242 373
369 iso_pu_bacteria 2838707686 2838710103 373
370 iso_pu_bacteria 2838714209 2838717214 373
371 iso_pu_bacteria 2838719591 2838722176 373
372 iso_pu_bacteria 2838724970 2838727963 373
373 iso_pu_bacteria 2838729681 2838732937 373
374 iso_pu_bacteria 2838736955 2838738488 373
375 iso_pu_bacteria 2838742623 2838745815 373
376 iso_pu_bacteria 2839993093 2839996553 373
377 iso_pu_bacteria 2840764183 2840770302 373
378 iso_pu_bacteria 2841840854 2841841143 373
379 iso_pu_bacteria 2841846520 2841849622 373
380 iso_pu_bacteria 2841851746 2841855726 373
381 iso_pu_bacteria 2841859092 2841861342 373
382 iso_pu_bacteria 2841864319 2841864410 373
383 iso_pu_bacteria 2842077413 2842078276 373
384 iso_pu_bacteria 2842110456 2842114274 373
385 iso_pu_bacteria 2842118031 2842119216 373
386 iso_pu_bacteria 2842124991 2842127630 373
387 iso_pu_bacteria 2842130223 2842132774 373
388 iso_pu_bacteria 2842140634 2842140921 373
389 iso_pu_bacteria 2842146304 2842150996 373
390 iso_pu_bacteria 2842152218 2842154767 373
391 iso_pu_bacteria 2842156927 2842157282 373
392 iso_pu_bacteria 2842163707 2842167940 373
393 iso_pu_bacteria 2842170452 2842173266 373
394 iso_pu_bacteria 2842175837 2842178388 373
395 iso_pu_bacteria 2842180545 2842181134 373
396 iso_pu_bacteria 2842187318 2842190322 373
397 iso_pu_bacteria 2842192696 2842194395 373
398 iso_pu_bacteria 2842198810 2842201773 373
399 iso_pu_bacteria 2842205361 2842205913 373
400 iso_pu_bacteria 2842211629 2842214636 373
401 iso_pu_bacteria 2842217011 2842217377 373
402 iso_pu_bacteria 2842224351 2842227355 373
403 iso_pu_bacteria 2842229732 2842230808 373
404 iso_pu_bacteria 2842237096 2842239515 373
405 iso_pu_bacteria 2842243621 2842245086 373
406 iso_pu_bacteria 2842250916 2842255858 373
407 iso_pu_bacteria 2842257432 2842258899 373
408 iso_pu_bacteria 2842264693 2842265920 373
409 iso_pu_bacteria 2842271015 2842276431 373
410 iso_pu_bacteria 2842278818 2842279370 373
411 iso_pu_bacteria 2842285085 2842286020 373
412 iso_pu_bacteria 2842291075 2842291938 373
413 iso_pu_bacteria 2842298080 2842302030 373
414 iso_pu_bacteria 2842304105 2842304429 373
415 iso_pu_bacteria 2842311132 2842314360 373
416 iso_pu_bacteria 2842317721 2842317791 373
417 iso_pu_bacteria 2842341865 2842345240 373
418 iso_pu_bacteria 2842357229 2842357503 373
419 iso_pu_bacteria 2842363717 2842364686 373
420 iso_pu_bacteria 2842370503 2842372653 373
421 iso_pu_bacteria 2842377471 2842378334 373
422 iso_pu_bacteria 2842384541 2842385725 373
423 iso_pu_bacteria 2842395702 2842398807 373
424 iso_pu_bacteria 2842402390 2842403380 373
425 iso_pu_bacteria 2842409023 2842409247 373
426 iso_pu_bacteria 2842415677 2842415901 373
427 iso_pu_bacteria 2842422224 2842427484 373
428 iso_pu_bacteria 2842428310 2842429443 373
429 iso_pu_bacteria 2842434925 2842436056 373
430 iso_pu_bacteria 2842441272 2842442403 373
431 iso_pu_bacteria 2842447887 2842450694 373
432 iso_pu_bacteria 2842462802 2842463864 373
433 iso_pu_bacteria 2842469257 2842470385 373
434 iso_pu_bacteria 2842475841 2842476637 373
435 iso_pu_bacteria 2842482326 2842484823 373
436 iso_pu_bacteria 2842489311 2842490142 373
437 iso_pu_bacteria 2842495871 2842496062 373
438 iso_pu_bacteria 2842502639 2842503606 373
439 iso_pu_bacteria 2842509118 2842511422 373
440 iso_pu_bacteria 2842515876 2842518391 373
441 iso_pu_bacteria 2842521101 2842522694 373
442 iso_pu_bacteria 2842871566 2842874223 373
443 iso_pu_bacteria 2842922631 2842923983 373
444 iso_pu_bacteria 2844163670 2844167584 373
445 iso_pu_bacteria 2844454524 2844459028 373
446 iso_pu_bacteria 2847417321 2847419087 373
447 iso_pu_bacteria 2848992105 2848994117 373
448 iso_pu_bacteria 2850079185 2850081159 373
449 iso_pu_bacteria 2852387548 2852389912 373
450 iso_pu_bacteria 2854896431 2854899355 373
451 iso_pu_bacteria 2854911287 2854913492 373
452 iso_pu_bacteria 2854916844 2854917967 373
453 iso_pu_bacteria 2855825444 2855825990 373
454 iso_pu_bacteria 2855839649 2855841335 373
455 iso_pu_bacteria 2855872281 2855876762 373
456 iso_pu_bacteria 2857516855 2857519840 373
457 iso_pu_bacteria 2857531043 2857535118 373
458 iso_pu_bacteria 2858800743 2858802322 373
459 iso_pu_bacteria 2891048133 2891050897 373
460 iso_pu_bacteria 2894652903 2894656810 373
461 iso_pu_bacteria 2899792073 2899795598 373
462 iso_pu_bacteria 2899803654 2899809011 373
463 iso_pu_bacteria 2899845264 2899849924 373
464 iso_pu_bacteria 2904578770 2904582500 373
465 iso_pu_bacteria 2913295892 2913300839 373
466 iso_pu_bacteria 2913308742 2913311354 373
467 iso_pu_bacteria 2915980308 2915981888 373
468 iso_pu_bacteria 2915986958 2915991339 373
469 iso_pu_bacteria 2915993759 2915994363 373
470 iso_pu_bacteria 2916000859 2916004384 373
471 iso_pu_bacteria 2916007675 2916008148 373
472 iso_pu_bacteria 2916014648 2916015087 373
473 iso_pu_bacteria 2916021584 2916024234 373
474 iso_pu_bacteria 2916028427 2916031766 373
475 iso_pu_bacteria 2916035215 2916041272 373
476 iso_pu_bacteria 2916041962 2916042734 373
477 iso_pu_bacteria 2916048683 2916052278 373
478 iso_pu_bacteria 2916055098 2916056435 373
479 iso_pu_bacteria 2916061851 2916067574 373
480 iso_pu_bacteria 2916076590 2916080865 373
481 iso_pu_bacteria 2919100787 2919106514 373
482 iso_pu_bacteria 2919114240 2919117472 373
483 iso_pu_bacteria 2919119836 2919123979 373
484 iso_pu_bacteria 2919166419 2919168634 373
485 iso_pu_bacteria 2919171160 2919174963 373
486 iso_pu_bacteria 2919408235 2919411676 373
487 iso_pu_bacteria 2920822456 2920824723 373
488 iso_pu_bacteria 2921201388 2921201936 373
489 iso_pu_bacteria 2921208531 2921211206 373
490 iso_pu_bacteria 2921237296 2921240725 373
491 iso_pu_bacteria 2921244191 2921244636 373
492 iso_pu_bacteria 2921250672 2921251171 373
493 iso_pu_bacteria 2921257292 2921262466 373
494 iso_pu_bacteria 2921263974 2921265114 373
495 iso_pu_bacteria 2921282425 2921283769 373
496 iso_pu_bacteria 2921289301 2921296323 373
497 iso_pu_bacteria 2921296804 2921299373 373
498 iso_pu_bacteria 2923556063 2923558042 373
499 iso_pu_bacteria 2924144063 2924147100 373
500 iso_pu_bacteria 2924150972 2924155256 373
501 iso_pu_bacteria 2924158325 2924160765 373
502 iso_pu_bacteria 2924165586 2924167343 373
503 iso_pu_bacteria 2924172951 2924178984 373
504 iso_pu_bacteria 2924179722 2924184072 373
505 iso_pu_bacteria 2924186466 2924189067 373
506 iso_pu_bacteria 2924193448 2924194794 373
507 iso_pu_bacteria 2924200457 2924203358 373
508 iso_pu_bacteria 2924207177 2924208832 373
509 iso_pu_bacteria 2924214083 2924217922 373
510 iso_pu_bacteria 2924221636 2924226510 373
511 iso_pu_bacteria 2924228884 2924229948 373
512 iso_pu_bacteria 2926754445 2926758918 373
513 iso_pu_bacteria 2926760298 2926763570 373
514 iso_pu_bacteria 2929138655 2929138835 373
515 iso_pu_bacteria 2932401849 2932403597 373
516 iso_pu_bacteria 2933006813 2933009850 373
517 iso_pu_bacteria 2933011516 2933014018 373
518 iso_pu_bacteria 2933016740 2933018400 373
519 iso_pu_bacteria 2933570622 2933571703 373
520 iso_pu_bacteria 2933586486 2933590369 373
521 iso_pu_bacteria 2933594066 2933595805 373
522 iso_pu_bacteria 2933599457 2933604856 373
523 iso_pu_bacteria 2935894831 2935897487 373
524 iso_pu_bacteria 2935901341 2935905549 373
525 iso_pu_bacteria 2936367885 2936372565 373
526 iso_pu_bacteria 2936375103 2936376439 373
527 iso_pu_bacteria 2936381700 2936387229 373
528 iso_pu_bacteria 2936996657 2936998122 373
529 iso_pu_bacteria 2937002841 2937005066 373
530 iso_pu_bacteria 2937009748 2937012206 373
531 iso_pu_bacteria 2937016420 2937018635 373
532 iso_pu_bacteria 2937023124 2937028974 373
533 iso_pu_bacteria 2937029754 2937031278 373
534 iso_pu_bacteria 2937036028 2937038581 373
535 iso_pu_bacteria 2937042894 2937045883 373
536 iso_pu_bacteria 2937049772 2937050948 373
537 iso_pu_bacteria 2937056579 2937061542 373
538 iso_pu_bacteria 2937063883 2937065227 373
539 iso_pu_bacteria 2937071275 2937073050 373
540 iso_pu_bacteria 2937078374 2937079800 373
541 iso_pu_bacteria 2937091812 2937097590 373
542 iso_pu_bacteria 2937098957 2937099537 373
543 iso_pu_bacteria 2937106411 2937110011 373
544 iso_pu_bacteria 2937113482 2937116267 373
545 iso_pu_bacteria 2937119839 2937123077 373
546 iso_pu_bacteria 2937126314 2937128710 373
547 iso_pu_bacteria 2941499720 2941504975 373
548 iso_pu_bacteria 2954011201 2954011343 373
549 iso_pu_bacteria 2957375807 2957376586 373
550 iso_pu_bacteria 2957382221 2957384804 373
551 iso_pu_bacteria 2957388812 2957394846 373
552 iso_pu_bacteria 2957395598 2957398268 373
553 iso_pu_bacteria 2957402308 2957403204 373
554 iso_pu_bacteria 2957408893 2957411597 373
555 iso_pu_bacteria 2957415311 2957418321 373
556 iso_pu_bacteria 2957422303 2957423294 373
557 iso_pu_bacteria 2957430029 2957432801 373
558 iso_pu_bacteria 2957437181 2957441266 373
559 iso_pu_bacteria 2957443900 2957444990 373
560 iso_pu_bacteria 2957450854 2957455971 373
561 iso_pu_bacteria 2957457609 2957459918 373
562 iso_pu_bacteria 2957464669 2957465994 373
563 iso_pu_bacteria 2957471148 2957477089 373
564 iso_pu_bacteria 2957478035 2957479217 373
565 iso_pu_bacteria 2957484790 2957486258 373
566 iso_pu_bacteria 2957491536 2957498037 373
567 iso_pu_bacteria 2957498199 2957498694 373
568 iso_pu_bacteria 2957505466 2957507655 373
569 iso_pu_bacteria 2960584000 2960584305 373
570 iso_pu_bacteria 2960591022 2960592715 373
571 iso_pu_bacteria 2960597568 2960602685 373
572 iso_pu_bacteria 2960603979 2960605936 373
573 iso_pu_bacteria 2960610863 2960612422 373
574 iso_pu_bacteria 2960617483 2960620012 373
575 iso_pu_bacteria 2960624210 2960630922 373
576 iso_pu_bacteria 2960631154 2960632832 373
577 iso_pu_bacteria 2960637947 2960639854 373
578 iso_pu_bacteria 2960645483 2960650506 373
579 iso_pu_bacteria 2960652885 2960660037 373
580 iso_pu_bacteria 2960660292 2960660848 373
581 iso_pu_bacteria 2960667422 2960670968 373
582 iso_pu_bacteria 2960674078 2960675911 373
583 iso_pu_bacteria 2960680706 2960681861 373
584 iso_pu_bacteria 2960687367 2960689952 373
585 iso_pu_bacteria 2960693952 2960694659 373
586 iso_pu_bacteria 2964607997 2964609193 373
587 iso_pu_bacteria 2964615318 2964616578 373
588 iso_pu_bacteria 2964621998 2964622580 373
589 iso_pu_bacteria 2964628898 2964635801 373
590 iso_pu_bacteria 2964636051 2964640949 373
591 iso_pu_bacteria 2964643177 2964649475 373
592 iso_pu_bacteria 2964649959 2964651785 373
593 iso_pu_bacteria 2964656573 2964661009 373
594 iso_pu_bacteria 2964663802 2964667045 373
595 iso_pu_bacteria 2964670856 2964677503 373
596 iso_pu_bacteria 2964678106 2964684093 373
597 iso_pu_bacteria 2964685014 2964687287 373
598 iso_pu_bacteria 2964691889 2964692861 373
599 iso_pu_bacteria 2964698721 2964702320 373
600 iso_pu_bacteria 2964705432 2964711846 373
601 iso_pu_bacteria 2964712639 2964716769 373
602 iso_pu_bacteria 2964719344 2964723892 373
603 iso_pu_bacteria 2967664464 2967665499 373
604 iso_pu_bacteria 2967671571 2967672562 373
605 iso_pu_bacteria 2967678726 2967681855 373
606 iso_pu_bacteria 2967686174 2967691702 373
607 iso_pu_bacteria 2967693043 2967695253 373
608 iso_pu_bacteria 2967699805 2967703247 373
609 iso_pu_bacteria 2967706974 2967707790 373
610 iso_pu_bacteria 2967714385 2967716663 373
611 iso_pu_bacteria 2967721400 2967721664 373
612 iso_pu_bacteria 2967728569 2967734985 373
613 iso_pu_bacteria 2967735183 2967736862 373
614 iso_pu_bacteria 2967742019 2967744126 373
615 iso_pu_bacteria 2967748971 2967755483 373
616 iso_pu_bacteria 2967755722 2967758751 373
617 iso_pu_bacteria 2967762386 2967765381 373
618 iso_pu_bacteria 2967769361 2967775659 373
619 iso_pu_bacteria 2967775926 2967782290 373
620 iso_pu_bacteria 2970019648 2970026517 373
621 iso_pu_bacteria 2970026789 2970031009 373
622 iso_pu_bacteria 2970033650 2970039723 373
623 iso_pu_bacteria 2970040964 2970041330 373
624 iso_pu_bacteria 2970047711 2970054423 373
625 iso_pu_bacteria 2970054988 2970057810 373
626 iso_pu_bacteria 2970061556 2970066699 373
627 iso_pu_bacteria 2970068827 2970072998 373
628 iso_pu_bacteria 2970076120 2970077460 373
629 iso_pu_bacteria 2970082768 2970086195 373
630 iso_pu_bacteria 2970088815 2970091171 373
631 iso_pu_bacteria 2970095765 2970097290 373
632 iso_pu_bacteria 2970102677 2970107501 373
633 iso_pu_bacteria 2970109326 2970110864 373
634 iso_pu_bacteria 2970116247 2970122164 373
635 iso_pu_bacteria 2970122695 2970122982 373
636 iso_pu_bacteria 2970129317 2970131685 373
637 iso_pu_bacteria 2970136068 2970138583 373
638 iso_pu_bacteria 2970143518 2970144098 373
639 iso_pu_bacteria 2970149975 2970154254 373
640 iso_pu_bacteria 2970156795 2970160215 373
641 iso_pu_bacteria 2970164137 2970167124 373
642 iso_pu_bacteria 2970170962 2970173282 373
643 iso_pu_bacteria 2970177841 2970180319 373
644 iso_pu_bacteria 2970184632 2970187581 373
645 iso_pu_bacteria 2970191845 2970193338 373
646 iso_pu_bacteria 2977516862 2977522401 373
647 iso_pu_bacteria 2977523885 2977529041 373
648 iso_pu_bacteria 2977530762 2977531671 373
649 iso_pu_bacteria 2977537788 2977540562 373
650 iso_pu_bacteria 2977544691 2977549086 373
651 iso_pu_bacteria 2977551784 2977554416 373
652 iso_pu_bacteria 2977558990 2977560184 373
653 iso_pu_bacteria 2977565890 2977572258 373
654 iso_pu_bacteria 2977572785 2977575291 373
655 iso_pu_bacteria 2977579622 2977580175 373
656 iso_pu_bacteria 2978969890 2978971324 373
657 iso_pu_bacteria 2979089926 2979091390 373
658 iso_pu_bacteria 2979095461 2979096913 373
659 iso_pu_bacteria 2979100975 2979101416 373
660 iso_pu_bacteria 2984509177 2984510632 373
661 iso_pu_bacteria 2984518228 2984518665 373
662 iso_pu_bacteria 2984537506 2984538981 373
663 iso_pu_bacteria 2984587000 2984588469 373
664 iso_pu_bacteria 2984601300 2984605678 373
665 iso_pu_bacteria 2989776772 2989778927 373
666 iso_pu_bacteria 2996310559 2996316101 373
667 iso_pu_bacteria 2996887358 2996891821 373
668 iso_pu_bacteria 2996893221 2996894043 373
669 iso_pu_bacteria 3002141150 3002145524 373
670 iso_pu_bacteria 3003930520 3003933777 373
671 iso_pu_bacteria 3005409236 3005414979 373
672 iso_pu_bacteria 3005416602 3005420093 373
673 iso_pu_bacteria 3005445848 3005448249 373
674 iso_pu_bacteria 3005452660 3005454356 373
675 iso_pu_bacteria 639633055 639648668 373
676 iso_pu_bacteria 643692032 643825977 373
677 iso_pu_bacteria 648276728 648739559 373
678 iso_pu_bacteria 650716007 650843040 373
679 iso_pu_bacteria 8003570095 8003574251 373
680 iso_pu_bacteria 8003992118 8003993850 373
681 iso_pu_bacteria 8003999396 8004001395 373
682 iso_pu_bacteria 8005246636 8005248480 373
683 iso_pu_bacteria 8005258706 8005263152 373
684 iso_pu_bacteria 8005275841 8005280690 373
685 iso_pu_bacteria 8005282627 8005287091 373
686 iso_pu_bacteria 8005289223 8005293213 373
687 iso_pu_bacteria 8005301065 8005302676 373
688 iso_pu_bacteria 8005307578 8005309858 373
689 iso_pu_bacteria 8005314921 8005317044 373
690 iso_pu_bacteria 8005321885 8005326348 373
691 iso_pu_bacteria 8005376324 8005379355 373
692 iso_pu_bacteria 8005382845 8005385359 373
693 iso_pu_bacteria 8005395548 8005396648 373
694 iso_pu_bacteria 8005430974 8005435937 373
695 iso_pu_bacteria 8005460587 8005463081 373
696 iso_pu_bacteria 8005484373 8005485161 373
697 iso_pu_bacteria 8005497431 8005500456 373
698 iso_pu_bacteria 8005542996 8005545264 373
699 iso_pu_bacteria 8005556819 8005557578 373
700 iso_pu_bacteria 8005563573 8005568749 373
701 iso_pu_bacteria 8005570704 8005574366 373
702 iso_pu_bacteria 8005619151 8005621834 373
703 iso_pu_bacteria 8005626139 8005627076 373
704 iso_pu_bacteria 8005645114 8005645324 373
705 iso_pu_bacteria 8005658619 8005659559 373
706 iso_pu_bacteria 8005668836 8005671874 373
707 iso_pu_bacteria 8005682033 8005683175 373
708 iso_pu_bacteria 8005688590 8005694692 373
709 iso_pu_bacteria 8005695170 8005699886 373
710 iso_pu_bacteria 8018127388 8018130034 373
711 iso_pu_bacteria 8018150411 8018152648 373
712 iso_pu_bacteria 8018163183 8018166665 373
713 iso_pu_bacteria 8018176218 8018179713 373
714 iso_pu_bacteria 8023680758 8023685251 373
715 iso_pu_bacteria 8024479707 8024483409 373
716 iso_pu_bacteria 8024486573 8024492252 373
717 iso_pu_bacteria 8024501048 8024501523 373
718 iso_pu_bacteria 8046767195 8046773778 373
719 iso_pu_bacteria 8049293176 8049294961 373
720 iso_pu_bacteria 8054460903 8054464583 373
721 iso_pu_bacteria 8056375014 8056376745 373
722 iso_pu_bacteria 8056382006 8056387956 373
723 iso_pu_bacteria 8056875544 8056877779 373
724 iso_pu_bacteria 8057575449 8057576847 373
725 iso_pu_bacteria 8057874678 8057874928 373
726 iso_pu_bacteria 2838074704 2838079592 374
727 iso_pu_bacteria 2896384573 2896384844 374
728 iso_pu_bacteria 2920760137 2920766093 374
729 3300005937 Ga0081455_10115747 Ga0081455_101157472 376
730 3300039062 Ga0400483_290121 Ga0400483_290121_1202_2338 376
731 3300001979 JGI24740J21852_10000136 JGI24740J21852_100001363 377
732 3300002704 JGI25155J39150_1000001 JGI25155J39150_100000129 377
733 3300002705 JGI25156J39149_1000001 JGI25156J39149_1000001303 377
734 3300002738 JGI25154J39366_1000011 JGI25154J39366_100001180 377
735 3300002739 JGI25158J39367_1000114 JGI25158J39367_100011413 377
736 3300002741 JGI25157J39369_1000030 JGI25157J39369_1000030105 377
737 3300002773 JGI25152J39213_1000570 JGI25152J39213_10005701 377
738 3300002773 JGI25152J39213_1001028 JGI25152J39213_10010287 377
739 3300002773 JGI25152J39213_1005380 JGI25152J39213_10053802 377
740 3300002774 JGI25150J39212_1000326 JGI25150J39212_100032619 377
741 3300002987 JGI25159J45721_1000078 JGI25159J45721_100007838 377
742 3300002987 JGI25159J45721_1000199 JGI25159J45721_10001993 377
743 3300002987 JGI25159J45721_1008988 JGI25159J45721_10089883 377
744 3300003187 JGI25151J46595_10000083 JGI25151J46595_1000008374 377
745 3300003187 JGI25151J46595_10000603 JGI25151J46595_1000060327 377
746 3300003187 JGI25151J46595_10014053 JGI25151J46595_100140533 377
747 3300003214 JGI25165J46597_1004159 JGI25165J46597_10041593 377
748 3300003215 JGI25153J46596_10002343 JGI25153J46596_1000234311 377
749 3300003215 JGI25153J46596_10005742 JGI25153J46596_100057425 377
750 3300003215 JGI25153J46596_10008791 JGI25153J46596_100087913 377
751 3300003354 JGI25160J50197_1000010 JGI25160J50197_100001091 377
752 3300003354 JGI25160J50197_1000216 JGI25160J50197_100021613 377
753 3300003354 JGI25160J50197_1008518 JGI25160J50197_10085183 377
754 3300003354 JGI25160J50197_1012212 JGI25160J50197_10122122 377
755 3300003354 JGI25160J50197_1012905 JGI25160J50197_10129053 377
756 3300003374 JGI25161J50226_1000006 JGI25161J50226_100000691 377
757 3300003374 JGI25161J50226_1000138 JGI25161J50226_100013812 377
758 3300003374 JGI25161J50226_1000412 JGI25161J50226_100041221 377
759 3300003374 JGI25161J50226_1000583 JGI25161J50226_100058313 377
760 3300003374 JGI25161J50226_1001023 JGI25161J50226_10010235 377
761 3300003771 Ga0055526_1000594 Ga0055526_100059415 377
762 3300003771 Ga0055526_1000998 Ga0055526_100099819 377
763 3300003771 Ga0055526_1006006 Ga0055526_10060063 377
764 3300003771 Ga0055526_1014891 Ga0055526_10148913 377
765 3300003775 Ga0055524_1000866 Ga0055524_10008666 377
766 3300003775 Ga0055524_1001805 Ga0055524_10018052 377
767 3300003775 Ga0055524_1001872 Ga0055524_10018725 377
768 3300003775 Ga0055524_1004012 Ga0055524_10040124 377
769 3300003790 Ga0055528_1000358 Ga0055528_100035815 377
770 3300003790 Ga0055528_1000676 Ga0055528_10006763 377
771 3300003790 Ga0055528_1001985 Ga0055528_10019856 377
772 3300003790 Ga0055528_1005700 Ga0055528_10057003 377
773 3300003790 Ga0055528_1007582 Ga0055528_10075822 377
774 3300003792 Ga0055540_1000354 Ga0055540_100035415 377
775 3300003792 Ga0055540_1013619 Ga0055540_10136192 377
776 3300003794 Ga0055531_10018855 Ga0055531_100188553 377
777 3300003794 Ga0055531_10019507 Ga0055531_100195071 377
778 3300003856 Ga0058692_1002834 Ga0058692_10028346 377
779 3300004625 Ga0055543_1000053 Ga0055543_100005343 377
780 3300004625 Ga0055543_1000301 Ga0055543_100030138 377
781 3300004625 Ga0055543_1001332 Ga0055543_10013323 377
782 3300005262 Ga0065165_1000717 Ga0065165_100071713 377
783 3300005262 Ga0065165_1009792 Ga0065165_10097924 377
784 3300005262 Ga0065165_1012321 Ga0065165_10123213 377
785 3300005331 Ga0070670_100001771 Ga0070670_1000017715 377
786 3300005339 Ga0070660_100021341 Ga0070660_1000213413 377
787 3300005344 Ga0070661_100048108 Ga0070661_1000481082 377
788 3300005344 Ga0070661_100228306 Ga0070661_1002283061 377
789 3300005347 Ga0070668_100122993 Ga0070668_1001229932 377
790 3300005347 Ga0070668_100259398 Ga0070668_1002593982 377
791 3300005355 Ga0070671_100220808 Ga0070671_1002208082 377
792 3300005366 Ga0070659_100004052 Ga0070659_1000040524 377
793 3300005366 Ga0070659_100333682 Ga0070659_1003336821 377
794 3300005539 Ga0068853_100024802 Ga0068853_1000248023 377
795 3300005548 Ga0070665_100097786 Ga0070665_1000977862 377
796 3300005563 Ga0068855_100175558 Ga0068855_1001755581 377
797 3300005563 Ga0068855_100289863 Ga0068855_1002898631 377
798 3300005614 Ga0068856_100055765 Ga0068856_1000557653 377
799 3300005614 Ga0068856_100100092 Ga0068856_1001000923 377
800 3300005614 Ga0068856_100130470 Ga0068856_1001304702 377
801 3300005616 Ga0068852_100002681 Ga0068852_1000026816 377
802 3300005616 Ga0068852_100013007 Ga0068852_1000130073 377
803 3300006038 Ga0075365_10000306 Ga0075365_1000030610 377
804 3300006038 Ga0075365_10000404 Ga0075365_100004046 377
805 3300006038 Ga0075365_10015261 Ga0075365_100152613 377
806 3300006048 Ga0075363_100039411 Ga0075363_1000394113 377
807 3300006051 Ga0075364_10000091 Ga0075364_1000009132 377
808 3300006051 Ga0075364_10011277 Ga0075364_100112774 377
809 3300006177 Ga0075362_10004177 Ga0075362_100041776 377
810 3300006178 Ga0075367_10001214 Ga0075367_100012148 377
811 3300006178 Ga0075367_10003637 Ga0075367_100036374 377
812 3300006195 Ga0075366_10001037 Ga0075366_100010372 377
813 3300006195 Ga0075366_10054185 Ga0075366_100541852 377
814 3300006946 Ga0079104_1000610 Ga0079104_100061017 377
815 3300006946 Ga0079104_1013220 Ga0079104_10132202 377
816 3300006948 Ga0099826_10000054 Ga0099826_1000005422 377
817 3300009011 Ga0105251_10023177 Ga0105251_100231773 377
818 3300009093 Ga0105240_10000005 Ga0105240_10000005607 377
819 3300009093 Ga0105240_10009447 Ga0105240_100094475 377
820 3300009148 Ga0105243_10039379 Ga0105243_100393794 377
821 3300009174 Ga0105241_10031587 Ga0105241_100315873 377
822 3300009177 Ga0105248_10191206 Ga0105248_101912062 377
823 3300009545 Ga0105237_10000809 Ga0105237_100008097 377
824 3300009551 Ga0105238_10073212 Ga0105238_100732122 377
825 3300009765 Ga0123341_1000188 Ga0123341_100018825 377
826 3300009766 Ga0123342_1014890 Ga0123342_10148904 377
827 3300009766 Ga0123342_1033521 Ga0123342_10335212 377
828 3300013100 Ga0157373_10015740 Ga0157373_100157408 377
829 3300013100 Ga0157373_10133085 Ga0157373_101330852 377
830 3300013102 Ga0157371_10000002 Ga0157371_10000002432 377
831 3300013102 Ga0157371_10015741 Ga0157371_100157412 377
832 3300013104 Ga0157370_10000286 Ga0157370_1000028612 377
833 3300013104 Ga0157370_10001170 Ga0157370_100011705 377
834 3300013104 Ga0157370_10108215 Ga0157370_101082152 377
835 3300013105 Ga0157369_10058539 Ga0157369_100585392 377
836 3300013249 Ga0171463_1003 Ga0171463_1003638 377
837 3300015262 Ga0182007_10004491 Ga0182007_100044912 377
838 3300015690 Ga0183363_1047 Ga0183363_104720 377
839 3300021320 Ga0214544_1001682 Ga0214544_100168220 377
840 3300021321 Ga0214542_1001614 Ga0214542_100161419 377
841 3300021327 Ga0214543_1001395 Ga0214543_100139519 377
842 3300025206 Ga0209435_100012 Ga0209435_10001279 377
843 3300025208 Ga0209436_100085 Ga0209436_10008530 377
844 3300025231 Ga0207427_101277 Ga0207427_1012777 377
845 3300025233 Ga0209437_100047 Ga0209437_100047215 377
846 3300025233 Ga0209437_100165 Ga0209437_100165119 377
847 3300025245 Ga0207425_1000024 Ga0207425_1000024176 377
848 3300025245 Ga0207425_1003357 Ga0207425_10033573 377
849 3300025245 Ga0207425_1004232 Ga0207425_10042323 377
850 3300025245 Ga0207425_1016370 Ga0207425_10163702 377
851 3300025246 Ga0209646_1000026 Ga0209646_100002679 377
852 3300025250 Ga0209026_1000014 Ga0209026_100001479 377
853 3300025253 Ga0209677_103130 Ga0209677_1031302 377
854 3300025256 Ga0209759_1000012 Ga0209759_100001279 377
855 3300025258 Ga0209129_1000069 Ga0209129_10000695 377
856 3300025258 Ga0209129_1000184 Ga0209129_100018464 377
857 3300025258 Ga0209129_1000376 Ga0209129_100037638 377
858 3300025258 Ga0209129_1000703 Ga0209129_10007037 377
859 3300025258 Ga0209129_1000735 Ga0209129_100073520 377
860 3300025258 Ga0209129_1003238 Ga0209129_10032383 377
861 3300025261 Ga0209233_1000048 Ga0209233_1000048187 377
862 3300025261 Ga0209233_1000069 Ga0209233_1000069249 377
863 3300025261 Ga0209233_1000195 Ga0209233_100019523 377
864 3300025273 Ga0209673_1000010 Ga0209673_100001015 377
865 3300025273 Ga0209673_1000013 Ga0209673_1000013312 377
866 3300025273 Ga0209673_1000296 Ga0209673_100029642 377
867 3300025273 Ga0209673_1000850 Ga0209673_100085018 377
868 3300025273 Ga0209673_1002846 Ga0209673_10028464 377
869 3300025273 Ga0209673_1005667 Ga0209673_10056673 377
870 3300025273 Ga0209673_1008745 Ga0209673_10087451 377
871 3300025284 Ga0209130_1000021 Ga0209130_1000021176 377
872 3300025284 Ga0209130_1000029 Ga0209130_1000029285 377
873 3300025284 Ga0209130_1000081 Ga0209130_100008146 377
874 3300025292 Ga0209676_1007150 Ga0209676_10071502 377
875 3300025292 Ga0209676_1009134 Ga0209676_10091343 377
876 3300025294 Ga0209025_1000050 Ga0209025_1000050151 377
877 3300025294 Ga0209025_1000166 Ga0209025_1000166145 377
878 3300025294 Ga0209025_1000959 Ga0209025_10009597 377
879 3300025294 Ga0209025_1001225 Ga0209025_100122523 377
880 3300025294 Ga0209025_1001950 Ga0209025_100195012 377
881 3300025294 Ga0209025_1004412 Ga0209025_10044123 377
882 3300025294 Ga0209025_1022035 Ga0209025_10220353 377
883 3300025295 Ga0209564_1000260 Ga0209564_100026067 377
884 3300025295 Ga0209564_1000278 Ga0209564_100027883 377
885 3300025295 Ga0209564_1000584 Ga0209564_100058451 377
886 3300025295 Ga0209564_1000920 Ga0209564_100092035 377
887 3300025295 Ga0209564_1004501 Ga0209564_10045013 377
888 3300025295 Ga0209564_1016076 Ga0209564_10160761 377
889 3300025295 Ga0209564_1016737 Ga0209564_10167372 377
890 3300025295 Ga0209564_1021031 Ga0209564_10210312 377
891 3300025297 Ga0209758_1000083 Ga0209758_1000083106 377
892 3300025297 Ga0209758_1000418 Ga0209758_100041813 377
893 3300025297 Ga0209758_1001270 Ga0209758_10012703 377
894 3300025297 Ga0209758_1001487 Ga0209758_10014873 377
895 3300025297 Ga0209758_1001756 Ga0209758_10017567 377
896 3300025297 Ga0209758_1005225 Ga0209758_10052253 377
897 3300025298 Ga0209050_1003249 Ga0209050_10032498 377
898 3300025298 Ga0209050_1031523 Ga0209050_10315231 377
899 3300025299 Ga0209256_1000042 Ga0209256_100004225 377
900 3300025299 Ga0209256_1000383 Ga0209256_100038354 377
901 3300025299 Ga0209256_1000588 Ga0209256_100058835 377
902 3300025299 Ga0209256_1001127 Ga0209256_100112715 377
903 3300025299 Ga0209256_1002941 Ga0209256_10029414 377
904 3300025299 Ga0209256_1010688 Ga0209256_10106883 377
905 3300025299 Ga0209256_1031368 Ga0209256_10313682 377
906 3300025302 Ga0207426_1000008 Ga0207426_1000008526 377
907 3300025302 Ga0207426_1000010 Ga0207426_1000010182 377
908 3300025302 Ga0207426_1000039 Ga0207426_1000039234 377
909 3300025302 Ga0207426_1000074 Ga0207426_100007413 377
910 3300025302 Ga0207426_1000952 Ga0207426_10009529 377
911 3300025303 Ga0209051_1000611 Ga0209051_100061128 377
912 3300025303 Ga0209051_1002092 Ga0209051_10020926 377
913 3300025303 Ga0209051_1010035 Ga0209051_10100353 377
914 3300025303 Ga0209051_1016142 Ga0209051_10161422 377
915 3300025304 Ga0209257_1002801 Ga0209257_100280111 377
916 3300025304 Ga0209257_1007900 Ga0209257_10079002 377
917 3300025909 Ga0207705_10041547 Ga0207705_100415472 377
918 3300025913 Ga0207695_10000011 Ga0207695_10000011311 377
919 3300025913 Ga0207695_10038263 Ga0207695_100382633 377
920 3300025914 Ga0207671_10000804 Ga0207671_100008043 377
921 3300025919 Ga0207657_10046011 Ga0207657_100460112 377
922 3300025920 Ga0207649_10008450 Ga0207649_100084503 377
923 3300025925 Ga0207650_10002483 Ga0207650_100024837 377
924 3300025931 Ga0207644_10202029 Ga0207644_102020292 377
925 3300025949 Ga0207667_10016213 Ga0207667_100162134 377
926 3300025949 Ga0207667_10071066 Ga0207667_100710661 377
927 3300025972 Ga0207668_10274457 Ga0207668_102744571 377
928 3300025972 Ga0207668_10331068 Ga0207668_103310682 377
929 3300025981 Ga0207640_10053445 Ga0207640_100534453 377
930 3300026078 Ga0207702_10076174 Ga0207702_100761742 377
931 3300026078 Ga0207702_10099294 Ga0207702_100992942 377
932 3300026078 Ga0207702_10184388 Ga0207702_101843882 377
933 3300026142 Ga0207698_10202097 Ga0207698_102020972 377
934 3300027111 Ga0209281_1000036 Ga0209281_1000036264 377
935 3300027111 Ga0209281_1000047 Ga0209281_1000047206 377
936 3300027111 Ga0209281_1000453 Ga0209281_10004534 377
937 3300027312 Ga0209371_1000012 Ga0209371_1000012177 377
938 3300027312 Ga0209371_1002509 Ga0209371_10025097 377
939 3300027312 Ga0209371_1003859 Ga0209371_10038594 377
940 3300027666 Ga0209282_1000140 Ga0209282_10001404 377
941 3300027866 Ga0209813_10005946 Ga0209813_100059463 377
942 3300028379 Ga0268266_10074885 Ga0268266_100748852 377
943 3300028379 Ga0268266_10139096 Ga0268266_101390962 377
944 3300028794 Ga0307515_10000023 Ga0307515_10000023290 377
945 3300028794 Ga0307515_10046287 Ga0307515_100462873 377
946 3300028794 Ga0307515_10080288 Ga0307515_100802883 377
947 3300030500 Ga0268256_1000013 Ga0268256_1000013177 377
948 3300030500 Ga0268256_1003570 Ga0268256_10035703 377
949 3300030744 Ga0316181_1124615 Ga0316181_11246153 377
950 3300031456 Ga0307513_10003030 Ga0307513_100030306 377
951 3300031548 Ga0307408_100122433 Ga0307408_1001224331 377
952 3300031731 Ga0307405_10000781 Ga0307405_1000078110 377
953 3300031731 Ga0307405_10061347 Ga0307405_100613472 377
954 3300031731 Ga0307405_10152944 Ga0307405_101529442 377
955 3300031903 Ga0307407_10191787 Ga0307407_101917872 377
956 3300032002 Ga0307416_100085503 Ga0307416_1000855033 377
957 3300032004 Ga0307414_10100666 Ga0307414_101006662 377
958 3300032005 Ga0307411_10119669 Ga0307411_101196692 377
959 3300038443 Ga0395901_0264505 Ga0395901_0264505_594_1733 377
960 3300041404 Ga0439436_0001642 Ga0439436_0001642_20_1153 377
961 3300041406 Ga0439439_0010918 Ga0439439_0010918_203_1336 377
962 3300041441 Ga0451787_009192 Ga0451787_009192_1355_2488 377
963 3300041491 Ga0451833_0028360 Ga0451833_0028360_362_1495 377
964 3300041498 Ga0451841_0180374 Ga0451841_0180374_148_1281 377
965 3300041501 Ga0451845_0316168 Ga0451845_0316168_1966_3099 377
966 3300041505 Ga0451849_0293555 Ga0451849_0293555_139_1272 377
967 3300041507 Ga0451851_0510789 Ga0451851_0510789_148_1281 377
968 3300041509 Ga0451843_0517638 Ga0451843_0517638_223_1356 377
969 3300041512 Ga0451853_0469856 Ga0451853_0469856_161_1294 377
970 3300046459 Ga0495629_0065953 Ga0495629_0065953_1119_2252 377
971 3300046460 Ga0495638_0001984 Ga0495638_0001984_1873_3006 377
972 3300046492 Ga0495585_0046485 Ga0495585_0046485_269_1402 377
973 3300046507 Ga0495606_0089977 Ga0495606_0089977_722_1855 377
974 3300046518 Ga0495631_0011061 Ga0495631_0011061_3160_4293 377
975 3300046530 Ga0495654_0000090 Ga0495654_0000090_60976_62109 377
976 3300046536 Ga0495587_0126025 Ga0495587_0126025_231_1364 377
977 3300046557 Ga0495622_0005922 Ga0495622_0005922_1653_2786 377
978 3300046660 Ga0495625_0050368 Ga0495625_0050368_1476_2609 377
979 3300046674 Ga0495588_0011344 Ga0495588_0011344_2162_3295 377
980 3300046690 Ga0495624_0069428 Ga0495624_0069428_69_1202 377
981 3300046694 Ga0495649_0041615 Ga0495649_0041615_770_1903 377
982 3300047317 Ga0495604_0048763 Ga0495604_0048763_1210_2343 377
983 3300047470 Ga0495681_0000886 Ga0495681_0000886_2040_3173 377
984 3300048903 Ga0496100_0042674 Ga0496100_0042674_1435_2568 377
985 3300048905 Ga0496102_0109133 Ga0496102_0109133_158_1291 377
986 3300048913 Ga0496110_0184017 Ga0496110_0184017_727_1869 377
987 3300048914 Ga0496111_0012743 Ga0496111_0012743_527_1660 377
988 3300048914 Ga0496111_0056372 Ga0496111_0056372_437_1579 377
989 3300048916 Ga0496113_0022885 Ga0496113_0022885_1566_2699 377
990 3300048919 Ga0496116_0000061 Ga0496116_0000061_255314_256447 377
991 3300048919 Ga0496116_0018700 Ga0496116_0018700_327_1460 377
992 3300048919 Ga0496116_0067462 Ga0496116_0067462_989_2122 377
993 3300048920 Ga0496117_0000016 Ga0496117_0000016_313114_314247 377
994 3300048921 Ga0496118_0000535 Ga0496118_0000535_5485_6618 377
995 3300048921 Ga0496118_0016390 Ga0496118_0016390_753_1886 377
996 3300048921 Ga0496118_0025170 Ga0496118_0025170_3913_5046 377
997 3300048921 Ga0496118_0035617 Ga0496118_0035617_2496_3629 377
998 3300048921 Ga0496118_0036469 Ga0496118_0036469_2446_3579 377
999 3300048922 Ga0496119_0021558 Ga0496119_0021558_2364_3497 377
1000 3300048922 Ga0496119_0083943 Ga0496119_0083943_546_1679 377
1001 3300048923 Ga0496120_0000056 Ga0496120_0000056_2091_3224 377
1002 3300048923 Ga0496120_0055452 Ga0496120_0055452_556_1689 377
1003 3300048924 Ga0496121_0000001 Ga0496121_0000001_276793_277926 377
1004 3300048924 Ga0496121_0003418 Ga0496121_0003418_3355_4488 377
1005 3300048924 Ga0496121_0025293 Ga0496121_0025293_1123_2256 377
1006 3300048924 Ga0496121_0049063 Ga0496121_0049063_948_2087 377
1007 3300048924 Ga0496121_0051938 Ga0496121_0051938_1043_2182 377
1008 3300048925 Ga0496122_0000002 Ga0496122_0000002_313775_314908 377
1009 3300048925 Ga0496122_0000369 Ga0496122_0000369_86921_88084 377
1010 3300048925 Ga0496122_0019117 Ga0496122_0019117_3011_4144 377
1011 3300048925 Ga0496122_0049793 Ga0496122_0049793_952_2085 377
1012 3300048925 Ga0496122_0053662 Ga0496122_0053662_282_1415 377
1013 3300048925 Ga0496122_0171475 Ga0496122_0171475_30_1163 377
1014 3300048926 Ga0496123_0000002 Ga0496123_0000002_1496775_1497908 377
1015 3300048926 Ga0496123_0000002 Ga0496123_0000002_313775_314908 377
1016 3300048926 Ga0496123_0000054 Ga0496123_0000054_145237_146400 377
1017 3300048926 Ga0496123_0045707 Ga0496123_0045707_561_1694 377
1018 3300048926 Ga0496123_0073509 Ga0496123_0073509_609_1742 377
1019 3300048927 Ga0496124_0000091 Ga0496124_0000091_63336_64469 377
1020 3300048927 Ga0496124_0002629 Ga0496124_0002629_974_2107 377
1021 3300048927 Ga0496124_0010219 Ga0496124_0010219_218_1351 377
1022 3300048927 Ga0496124_0060519 Ga0496124_0060519_965_2098 377
1023 3300048927 Ga0496124_0124752 Ga0496124_0124752_191_1333 377
1024 3300048927 Ga0496124_0158031 Ga0496124_0158031_365_1498 377
1025 3300048928 Ga0496125_0000001 Ga0496125_0000001_388819_389952 377
1026 3300048928 Ga0496125_0000301 Ga0496125_0000301_15806_16948 377
1027 3300048929 Ga0496126_0000059 Ga0496126_0000059_166229_167362 377
1028 3300048929 Ga0496126_0024626 Ga0496126_0024626_687_1832 377
1029 3300049568 Ga0501031_0000831 Ga0501031_0000831_9597_10748 377
1030 3300049569 Ga0501032_0000019 Ga0501032_0000019_73074_74225 377
1031 3300049569 Ga0501032_0010722 Ga0501032_0010722_1557_2702 377
1032 3300049570 Ga0501033_0003165 Ga0501033_0003165_4723_5874 377
1033 3300049571 Ga0501034_0000130 Ga0501034_0000130_57474_58625 377
1034 3300049571 Ga0501034_0001091 Ga0501034_0001091_30437_31579 377
1035 3300049571 Ga0501034_0127961 Ga0501034_0127961_397_1530 377
1036 3300049572 Ga0501036_0000635 Ga0501036_0000635_24305_25456 377
1037 3300049572 Ga0501036_0153858 Ga0501036_0153858_765_1898 377
1038 3300049573 Ga0501037_0005590 Ga0501037_0005590_34_1185 377
1039 3300049573 Ga0501037_0086156 Ga0501037_0086156_187_1329 377
1040 3300049574 Ga0501038_0000478 Ga0501038_0000478_20219_21370 377
1041 3300049575 Ga0501039_0000028 Ga0501039_0000028_80944_82095 377
1042 3300049577 Ga0501041_0106345 Ga0501041_0106345_488_1639 377
1043 3300049579 Ga0501043_0003505 Ga0501043_0003505_1351_2502 377
1044 3300049580 Ga0501046_0140291 Ga0501046_0140291_548_1699 377
1045 3300049581 Ga0501047_0272208 Ga0501047_0272208_104_1255 377
1046 3300049585 Ga0501069_0125237 Ga0501069_0125237_306_1457 377
1047 3300049589 Ga0501073_0157453 Ga0501073_0157453_421_1560 377
1048 3300049590 Ga0501074_0209435 Ga0501074_0209435_43_1182 377
1049 3300049776 Ga0501280_005335 Ga0501280_005335_679_1812 377
1050 3300049822 Ga0501035_0000143 Ga0501035_0000143_80928_82079 377
1051 3300049823 Ga0501044_0008899 Ga0501044_0008899_5134_6285 377
1052 3300050491 nmdc:mga00v17_156_c1 nmdc:mga00v17_156_c1_11177_12310 377
1053 3300050491 nmdc:mga00v17_3_c1 nmdc:mga00v17_3_c1_92983_94116 377
1054 3300050491 nmdc:mga00v17_8320_c1 nmdc:mga00v17_8320_c1_2029_3162 377
1055 3300050495 nmdc:mga04h51_41482_c1 nmdc:mga04h51_41482_c1_337_1470 377
1056 3300050516 nmdc:mga0sz30_2395_c1 nmdc:mga0sz30_2395_c1_2688_3821 377
1057 3300053111 Ga0500572_011708 Ga0500572_011708_846_1979 377
1058 3300053125 Ga0500618_002658 Ga0500618_002658_1128_2261 377
1059 3300053134 Ga0500658_0017602 Ga0500658_0017602_710_1843 377
1060 3300053139 Ga0500568_0035223 Ga0500568_0035223_777_1919 377
1061 3300053140 Ga0500573_0000259 Ga0500573_0000259_6800_7933 377
1062 3300053151 Ga0500604_0000146 Ga0500604_0000146_19337_20476 377
1063 3300053153 Ga0500616_0000301 Ga0500616_0000301_68880_70013 377
1064 3300053153 Ga0500616_0006977 Ga0500616_0006977_4697_5830 377
1065 3300053153 Ga0500616_0009464 Ga0500616_0009464_2103_3236 377
1066 3300053157 Ga0500624_000733 Ga0500624_000733_4847_5980 377
1067 3300053161 Ga0500634_0000004 Ga0500634_0000004_39831_40973 377
1068 3300053161 Ga0500634_0001667 Ga0500634_0001667_41_1174 377
1069 3300053177 Ga0500636_0000034 Ga0500636_0000034_29549_30682 377
1070 3300053177 Ga0500636_0029235 Ga0500636_0029235_2083_3216 377
1071 3300059493 Ga0587077_008812 Ga0587077_008812_244_1386 377
1072 3300059604 Ga0587098_001071 Ga0587098_001071_707_1840 377
1073 3300059643 Ga0587072_004741 Ga0587072_004741_465_1598 377
1074 3300059645 Ga0587076_009010 Ga0587076_009010_23_1165 377
1075 iso_pu_bacteria 2791355253 2793279937 377

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

31

147

0.96

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

156

291

0.94

PF03447

NAD_binding_3

Homoserine dehydrogenase, NAD binding domain

37

146

0.88

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

160

373

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rye-assembly1.cif.gz_D crystal structure of the shifted form of the glucose-fructose oxidoreductase from zymomonas mobilis 0.8727 3 358
7bvk-assembly2.cif.gz_B udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p212121) 0.8572 4 351
7bvj-assembly3.cif.gz_C udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.8547 4 351
2glx-assembly1.cif.gz_A crystal structure analysis of bacterial 1,5-af reductase 0.8513 6 358
4gqa-assembly1.cif.gz_A-2 crystal structure of nad binding oxidoreductase from klebsiella pneumoniae 0.851 4 359
ID Description Score Start End Superfamily
3e18B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9372 3 122 3.40.50.720
3e18A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9354 3 120 3.40.50.720
af_Q9VJH7_91_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9334 5 118 3.40.50.720
3e18B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9298 3 122 3.40.50.720
af_M9PE54_6_126_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9271 4 118 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A504B0T3-F1-model_v4 deleted 0.9677 1 377
AF-A0A504B0T3-F1-model_v4 deleted 0.9652 1 377
AF-A0A6B1H9B9-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9648 1 119 GO:0000166
AF-A0A3B8VPJ9-F1-model_v4 Oxidoreductase 0.9608 27 251 GO:0000166
GO:0016491
AF-A0A0Q7DUK4-F1-model_v4 Oxidoreductase 0.9588 1 377 GO:0000166
GO:0016491

Feature Viewer

pLDDT pTM Quality
94.33 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map