F489552

General Info

Members Datasets Scaffolds Average Seq Length
1075 286 1075 100

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_101356366|Ga0070670_1013563661
Length 118
Sequence LGLSIVHWVIGHCSRMSGMGKLKSEIEVQCPCCDAILIIDSNLGRIVSHREPDRRDKPELSDAQRILAQQAARRDALFEQSVEAEKTRDDALTRRFEEALRQANDEPITRPTRDFDLD

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
6 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
7 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
96 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
97 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
113 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
196 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
197 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
198 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
199 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
200 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
201 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
202 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
203 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
206 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
207 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
208 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
209 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
210 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
211 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
212 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
213 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
214 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
215 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
216 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
217 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
218 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
219 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
220 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
221 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
222 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
223 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
224 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
225 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
226 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
227 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
228 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
229 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
230 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
231 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
232 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
233 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
234 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
235 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
236 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
237 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
238 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
239 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
240 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
241 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
252 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
253 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
262 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
263 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
264 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
265 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
266 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
267 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
268 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
269 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
270 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
271 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
272 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
273 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
274 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
276 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
277 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
278 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
279 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
280 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
281 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
282 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
283 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
284 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
285 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
286 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.91
Metatranscriptomes 0.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 2.42
Rhizosphere 97.02
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_4260674 2162886006 Unclassified 862
2 SwRhRL2b_contig_2303194 2162886007 Bacteria 1545
3 JGI24745J21846_1006703 3300002073 Bacteria 1283
4 JGI24749J21850_1045341 3300002076 Bacteria 649
5 JGI24035J26624_1004317 3300002126 Bacteria 1349
6 JGI24033J26618_1069457 3300002155 Unclassified 528
7 Ga0058859_11517576 3300004798 Bacteria 628
8 Ga0065704_10232228 3300005289 Bacteria 1039
9 Ga0065704_10503292 3300005289 Unclassified 665
10 Ga0065712_10002683 3300005290 Bacteria 5145
11 Ga0065712_10007329 3300005290 Bacteria 2604
12 Ga0065712_10453736 3300005290 Bacteria 671
13 Ga0065715_10091986 3300005293 Bacteria 5408
14 Ga0065715_10294244 3300005293 Unclassified 1051
15 Ga0065715_10524328 3300005293 Bacteria 761
16 Ga0065715_10816696 3300005293 Bacteria 604
17 Ga0065707_10004395 3300005295 Bacteria 6260
18 Ga0065707_10123479 3300005295 Bacteria 2064
19 Ga0065707_10130896 3300005295 Unclassified 1922
20 Ga0065707_10279394 3300005295 Unclassified 1051
21 Ga0065707_10425128 3300005295 Unclassified 826
22 Ga0065707_10731062 3300005295 Bacteria 626
23 Ga0070658_10645531 3300005327 Unclassified 918
24 Ga0070676_10026486 3300005328 Bacteria 3283
25 Ga0070676_10027667 3300005328 Bacteria 3217
26 Ga0070676_10099791 3300005328 Bacteria 1792
27 Ga0070676_10410948 3300005328 Bacteria 944
28 Ga0070683_100002803 3300005329 Bacteria 13943
29 Ga0070683_100532077 3300005329 Bacteria 1123
30 Ga0070683_101611383 3300005329 Bacteria 624
31 Ga0070690_100041309 3300005330 Bacteria 2920
32 Ga0070690_100110115 3300005330 Bacteria 1836
33 Ga0070690_100223065 3300005330 Bacteria 1321
34 Ga0070690_101527319 3300005330 Bacteria 540
35 Ga0070670_100002610 3300005331 Bacteria 14900
36 Ga0070670_100067854 3300005331 Bacteria 3060
37 Ga0070670_100145406 3300005331 Bacteria 2051
38 Ga0070670_100235266 3300005331 Bacteria 1595
39 Ga0070670_100432930 3300005331 Bacteria 1164
40 Ga0070670_101356366 3300005331 Bacteria 652
41 Ga0070677_10070514 3300005333 Bacteria 1469
42 Ga0070677_10072127 3300005333 Bacteria 1455
43 Ga0070677_10134492 3300005333 Bacteria 1133
44 Ga0070677_10185158 3300005333 Bacteria 995
45 Ga0070677_10219892 3300005333 Bacteria 927
46 Ga0070677_10338436 3300005333 Unclassified 776
47 Ga0070677_10565238 3300005333 Unclassified 625
48 Ga0068869_100006778 3300005334 Bacteria 7281
49 Ga0068869_100016609 3300005334 Bacteria 4963
50 Ga0068869_100453107 3300005334 Unclassified 1064
51 Ga0068869_101105787 3300005334 Unclassified 693
52 Ga0068869_101211367 3300005334 Bacteria 664
53 Ga0068869_101317159 3300005334 Unclassified 637
54 Ga0068869_101828185 3300005334 Bacteria 543
55 Ga0070666_10006433 3300005335 Bacteria 7220
56 Ga0070666_10071955 3300005335 Unclassified 2354
57 Ga0070666_11231800 3300005335 Unclassified 558
58 Ga0070666_11414991 3300005335 Unclassified 520
59 Ga0070680_101415984 3300005336 Bacteria 602
60 Ga0070680_101638080 3300005336 Bacteria 558
61 Ga0068868_100031792 3300005338 Bacteria 4058
62 Ga0068868_100035225 3300005338 Bacteria 3868
63 Ga0068868_100614228 3300005338 Bacteria 964
64 Ga0068868_100794060 3300005338 Bacteria 854
65 Ga0068868_101996542 3300005338 Unclassified 550
66 Ga0070660_100622529 3300005339 Bacteria 903
67 Ga0070689_100016365 3300005340 Bacteria 5427
68 Ga0070689_100021825 3300005340 Unclassified 4772
69 Ga0070689_100130205 3300005340 Bacteria 2017
70 Ga0070689_100143638 3300005340 Unclassified 1921
71 Ga0070689_100278871 3300005340 Bacteria 1386
72 Ga0070689_101348524 3300005340 Bacteria 643
73 Ga0070687_100049891 3300005343 Bacteria 2159
74 Ga0070687_100060473 3300005343 Bacteria 1998
75 Ga0070687_100073614 3300005343 Bacteria 1842
76 Ga0070687_101411548 3300005343 Unclassified 521
77 Ga0070661_100019728 3300005344 Bacteria 4805
78 Ga0070661_100096285 3300005344 Unclassified 2196
79 Ga0070661_100539573 3300005344 Unclassified 937
80 Ga0070661_100820975 3300005344 Bacteria 764
81 Ga0070692_10124233 3300005345 Bacteria 1443
82 Ga0070692_10321190 3300005345 Bacteria 952
83 Ga0070692_10347027 3300005345 Unclassified 921
84 Ga0070668_100058877 3300005347 Unclassified 2973
85 Ga0070668_100069279 3300005347 Bacteria 2744
86 Ga0070668_100120255 3300005347 Bacteria 2099
87 Ga0070668_100448333 3300005347 Unclassified 1109
88 Ga0070668_101836662 3300005347 Bacteria 558
89 Ga0070669_100001020 3300005353 Bacteria 20403
90 Ga0070669_100014861 3300005353 Bacteria 5547
91 Ga0070669_100032145 3300005353 Bacteria 3790
92 Ga0070669_100076506 3300005353 Bacteria 2484
93 Ga0070669_100126936 3300005353 Unclassified 1953
94 Ga0070669_100135039 3300005353 Bacteria 1897
95 Ga0070669_100249279 3300005353 Bacteria 1413
96 Ga0070669_101169083 3300005353 Unclassified 664
97 Ga0070669_101548753 3300005353 Unclassified 577
98 Ga0070669_101551225 3300005353 Unclassified 576
99 Ga0070675_100000033 3300005354 Bacteria 94281
100 Ga0070675_100002075 3300005354 Bacteria 14827
101 Ga0070675_100009814 3300005354 Bacteria 7460
102 Ga0070675_100017656 3300005354 Bacteria 5674
103 Ga0070675_100024575 3300005354 Bacteria 4825
104 Ga0070675_100050630 3300005354 Bacteria 3411
105 Ga0070675_100055048 3300005354 Bacteria 3274
106 Ga0070675_100147359 3300005354 Bacteria 2016
107 Ga0070675_100171437 3300005354 Unclassified 1871
108 Ga0070675_100329580 3300005354 Bacteria 1350
109 Ga0070675_100331383 3300005354 Bacteria 1346
110 Ga0070675_100465320 3300005354 Bacteria 1136
111 Ga0070675_100542918 3300005354 Unclassified 1051
112 Ga0070675_100741178 3300005354 Unclassified 896
113 Ga0070675_101870439 3300005354 Bacteria 554
114 Ga0070671_100014984 3300005355 Bacteria 6260
115 Ga0070671_100027299 3300005355 Bacteria 4697
116 Ga0070671_100045499 3300005355 Unclassified 3649
117 Ga0070671_100940752 3300005355 Bacteria 756
118 Ga0070674_100000184 3300005356 Bacteria 29352
119 Ga0070674_100015356 3300005356 Bacteria 4780
120 Ga0070674_100126255 3300005356 Bacteria 1901
121 Ga0070674_100286588 3300005356 Bacteria 1308
122 Ga0070674_100345011 3300005356 Unclassified 1201
123 Ga0070674_100589651 3300005356 Bacteria 938
124 Ga0070673_100007303 3300005364 Bacteria 7274
125 Ga0070673_100027094 3300005364 Bacteria 4244
126 Ga0070673_100109560 3300005364 Bacteria 2288
127 Ga0070673_100114781 3300005364 Bacteria 2239
128 Ga0070673_100139394 3300005364 Unclassified 2044
129 Ga0070673_100142185 3300005364 Unclassified 2025
130 Ga0070673_100567349 3300005364 Bacteria 1032
131 Ga0070673_100654649 3300005364 Unclassified 962
132 Ga0070673_100908925 3300005364 Bacteria 817
133 Ga0070673_101226075 3300005364 Bacteria 703
134 Ga0070673_101668593 3300005364 Bacteria 603
135 Ga0070688_100004930 3300005365 Bacteria 6983
136 Ga0070688_100055491 3300005365 Bacteria 2485
137 Ga0070688_100150967 3300005365 Bacteria 1588
138 Ga0070688_100222147 3300005365 Bacteria 1332
139 Ga0070688_101060952 3300005365 Unclassified 646
140 Ga0070659_100110728 3300005366 Bacteria 2216
141 Ga0070659_100170995 3300005366 Bacteria 1780
142 Ga0070659_101459563 3300005366 Unclassified 609
143 Ga0070667_100034500 3300005367 Bacteria 4233
144 Ga0070667_100592740 3300005367 Bacteria 1021
145 Ga0070667_100796710 3300005367 Bacteria 877
146 Ga0070667_100856947 3300005367 Unclassified 845
147 Ga0070667_100896067 3300005367 Unclassified 826
148 Ga0070667_101262473 3300005367 Bacteria 692
149 Ga0070667_102029584 3300005367 Bacteria 542
150 Ga0070703_10014649 3300005406 Bacteria 2236
151 Ga0070703_10066528 3300005406 Unclassified 1192
152 Ga0070703_10081745 3300005406 Bacteria 1102
153 Ga0070701_10012396 3300005438 Bacteria 3845
154 Ga0070701_10329742 3300005438 Bacteria 947
155 Ga0070701_10422344 3300005438 Unclassified 850
156 Ga0070701_10649926 3300005438 Unclassified 704
157 Ga0070705_100001709 3300005440 Bacteria 11435
158 Ga0070705_100192667 3300005440 Unclassified 1391
159 Ga0070705_100239925 3300005440 Bacteria 1266
160 Ga0070705_100391841 3300005440 Bacteria 1026
161 Ga0070705_100471178 3300005440 Bacteria 947
162 Ga0070705_100665454 3300005440 Unclassified 814
163 Ga0070705_100798232 3300005440 Unclassified 751
164 Ga0070705_100963910 3300005440 Unclassified 690
165 Ga0070700_100014659 3300005441 Bacteria 4430
166 Ga0070700_100068591 3300005441 Unclassified 2255
167 Ga0070700_100110973 3300005441 Unclassified 1823
168 Ga0070700_100301545 3300005441 Bacteria 1170
169 Ga0070700_100669286 3300005441 Unclassified 822
170 Ga0070700_101669801 3300005441 Unclassified 546
171 Ga0070694_100267311 3300005444 Unclassified 1299
172 Ga0070694_100279106 3300005444 Bacteria 1273
173 Ga0070694_100288427 3300005444 Bacteria 1254
174 Ga0070694_100371181 3300005444 Unclassified 1113
175 Ga0070694_100447963 3300005444 Bacteria 1019
176 Ga0070694_100765992 3300005444 Bacteria 789
177 Ga0070694_101065918 3300005444 Bacteria 673
178 Ga0070694_101289739 3300005444 Bacteria 614
179 Ga0070694_101498939 3300005444 Unclassified 571
180 Ga0070708_100121916 3300005445 Bacteria 2406
181 Ga0070708_101344902 3300005445 Unclassified 667
182 Ga0070678_100056358 3300005456 Bacteria 2874
183 Ga0070678_100301496 3300005456 Bacteria 1362
184 Ga0070678_100490899 3300005456 Bacteria 1082
185 Ga0070662_100004740 3300005457 Bacteria 8618
186 Ga0070662_100182556 3300005457 Bacteria 1655
187 Ga0070662_100238738 3300005457 Bacteria 1457
188 Ga0070662_100669426 3300005457 Unclassified 877
189 Ga0070662_100874593 3300005457 Bacteria 766
190 Ga0070662_101380581 3300005457 Unclassified 607
191 Ga0070681_10067907 3300005458 Bacteria 3532
192 Ga0070681_11243663 3300005458 Unclassified 667
193 Ga0070681_11354336 3300005458 Bacteria 635
194 Ga0068867_100008404 3300005459 Bacteria 7280
195 Ga0068867_100012506 3300005459 Bacteria 6007
196 Ga0068867_100028197 3300005459 Bacteria 4041
197 Ga0068867_100096872 3300005459 Unclassified 2247
198 Ga0068867_100535522 3300005459 Bacteria 1012
199 Ga0068867_101441696 3300005459 Unclassified 639
200 Ga0068867_102217931 3300005459 Unclassified 521
201 Ga0070685_10007510 3300005466 Bacteria 5579
202 Ga0070685_10278822 3300005466 Bacteria 1118
203 Ga0070685_10346887 3300005466 Bacteria 1014
204 Ga0070685_10712521 3300005466 Bacteria 733
205 Ga0070685_10964521 3300005466 Unclassified 638
206 Ga0070685_11206830 3300005466 Bacteria 575
207 Ga0070685_11380998 3300005466 Unclassified 540
208 Ga0070706_100351426 3300005467 Bacteria 1374
209 Ga0070706_100533063 3300005467 Unclassified 1092
210 Ga0070707_100062698 3300005468 Unclassified 3567
211 Ga0070707_100080412 3300005468 Bacteria 3145
212 Ga0070707_100097528 3300005468 Bacteria 2847
213 Ga0070698_100037618 3300005471 Bacteria 4988
214 Ga0070698_100304644 3300005471 Bacteria 1524
215 Ga0070698_101702111 3300005471 Unclassified 583
216 Ga0070699_100020817 3300005518 Bacteria 5656
217 Ga0070699_100033499 3300005518 Unclassified 4439
218 Ga0070699_100215043 3300005518 Bacteria 1712
219 Ga0070699_100411696 3300005518 Unclassified 1223
220 Ga0070699_101756487 3300005518 Unclassified 568
221 Ga0070679_100415881 3300005530 Unclassified 1290
222 Ga0070679_100493789 3300005530 Bacteria 1168
223 Ga0070679_101239747 3300005530 Unclassified 691
224 Ga0070684_100003808 3300005535 Bacteria 11401
225 Ga0070684_102313211 3300005535 Bacteria 507
226 Ga0070697_100037352 3300005536 Bacteria 3923
227 Ga0070697_100192357 3300005536 Unclassified 1732
228 Ga0070697_100315975 3300005536 Bacteria 1344
229 Ga0068853_100962420 3300005539 Bacteria 821
230 Ga0070672_100014219 3300005543 Bacteria 5634
231 Ga0070672_100028789 3300005543 Bacteria 4159
232 Ga0070672_100033294 3300005543 Bacteria 3901
233 Ga0070672_100043970 3300005543 Bacteria 3448
234 Ga0070672_100160688 3300005543 Bacteria 1864
235 Ga0070672_100218642 3300005543 Bacteria 1597
236 Ga0070672_100304570 3300005543 Unclassified 1351
237 Ga0070672_100363966 3300005543 Bacteria 1235
238 Ga0070672_101033709 3300005543 Unclassified 729
239 Ga0070672_102109601 3300005543 Bacteria 508
240 Ga0070686_100006803 3300005544 Bacteria 6367
241 Ga0070686_100042188 3300005544 Bacteria 2856
242 Ga0070686_100224486 3300005544 Bacteria 1359
243 Ga0070686_100457393 3300005544 Bacteria 983
244 Ga0070686_100813783 3300005544 Bacteria 754
245 Ga0070686_100922188 3300005544 Unclassified 712
246 Ga0070686_101039601 3300005544 Unclassified 674
247 Ga0070686_101048637 3300005544 Bacteria 671
248 Ga0070695_100006594 3300005545 Bacteria 6859
249 Ga0070695_100257074 3300005545 Bacteria 1274
250 Ga0070695_100550063 3300005545 Unclassified 900
251 Ga0070695_100550693 3300005545 Bacteria 899
252 Ga0070695_101097374 3300005545 Unclassified 651
253 Ga0070695_101098946 3300005545 Unclassified 651
254 Ga0070695_101285312 3300005545 Unclassified 604
255 Ga0070696_100003487 3300005546 Bacteria 10456
256 Ga0070696_100006665 3300005546 Bacteria 7714
257 Ga0070696_100272203 3300005546 Unclassified 1288
258 Ga0070696_100485322 3300005546 Bacteria 981
259 Ga0070696_100489319 3300005546 Bacteria 977
260 Ga0070696_100712432 3300005546 Bacteria 819
261 Ga0070696_100730212 3300005546 Bacteria 810
262 Ga0070696_100872536 3300005546 Unclassified 745
263 Ga0070696_101692395 3300005546 Unclassified 545
264 Ga0070693_100012874 3300005547 Bacteria 4246
265 Ga0070665_100001707 3300005548 Bacteria 25226
266 Ga0070665_100178177 3300005548 Bacteria 2126
267 Ga0070665_100254981 3300005548 Bacteria 1755
268 Ga0070704_100000343 3300005549 Bacteria 21179
269 Ga0070704_100111611 3300005549 Unclassified 2082
270 Ga0070704_100120098 3300005549 Bacteria 2017
271 Ga0070704_100239621 3300005549 Unclassified 1484
272 Ga0070704_100247088 3300005549 Unclassified 1463
273 Ga0070704_100352974 3300005549 Bacteria 1242
274 Ga0070704_100402920 3300005549 Unclassified 1168
275 Ga0070704_100476006 3300005549 Bacteria 1080
276 Ga0070704_100523110 3300005549 Bacteria 1033
277 Ga0070704_100532649 3300005549 Bacteria 1024
278 Ga0070704_100594585 3300005549 Unclassified 972
279 Ga0070704_101178029 3300005549 Bacteria 698
280 Ga0070704_101780447 3300005549 Bacteria 570
281 Ga0068855_100560438 3300005563 Unclassified 1236
282 Ga0070664_100001327 3300005564 Bacteria 19736
283 Ga0070664_100079188 3300005564 Bacteria 2828
284 Ga0070664_100299092 3300005564 Bacteria 1454
285 Ga0070664_100841919 3300005564 Bacteria 859
286 Ga0070664_100848654 3300005564 Bacteria 855
287 Ga0070664_101152881 3300005564 Bacteria 731
288 Ga0070664_101237113 3300005564 Bacteria 705
289 Ga0070664_101528581 3300005564 Unclassified 632
290 Ga0070664_102110802 3300005564 Unclassified 535
291 Ga0068857_100118789 3300005577 Unclassified 2380
292 Ga0068857_101585569 3300005577 Bacteria 639
293 Ga0068854_100254274 3300005578 Unclassified 1404
294 Ga0068854_100294909 3300005578 Bacteria 1310
295 Ga0068854_100901357 3300005578 Bacteria 777
296 Ga0068854_101346857 3300005578 Bacteria 644
297 Ga0068856_100342148 3300005614 Bacteria 1514
298 Ga0070702_100071552 3300005615 Unclassified 2050
299 Ga0070702_100109339 3300005615 Bacteria 1711
300 Ga0070702_100254710 3300005615 Bacteria 1192
301 Ga0068852_100148816 3300005616 Unclassified 2175
302 Ga0068852_101262355 3300005616 Unclassified 760
303 Ga0068859_100004737 3300005617 Bacteria 13820
304 Ga0068859_100008005 3300005617 Bacteria 10715
305 Ga0068859_100029471 3300005617 Bacteria 5506
306 Ga0068859_100195030 3300005617 Bacteria 2109
307 Ga0068859_100242799 3300005617 Bacteria 1891
308 Ga0068859_101537581 3300005617 Unclassified 735
309 Ga0068859_101871300 3300005617 Bacteria 663
310 Ga0068859_102575170 3300005617 Bacteria 560
311 Ga0068859_102728551 3300005617 Unclassified 543
312 Ga0068864_100048934 3300005618 Bacteria 3635
313 Ga0068864_100056442 3300005618 Bacteria 3393
314 Ga0068864_100100497 3300005618 Bacteria 2564
315 Ga0068864_100328606 3300005618 Bacteria 1438
316 Ga0068864_100642660 3300005618 Bacteria 1032
317 Ga0068864_100659115 3300005618 Unclassified 1020
318 Ga0068866_10019977 3300005718 Bacteria 3061
319 Ga0068866_10154078 3300005718 Unclassified 1334
320 Ga0068866_11009163 3300005718 Unclassified 592
321 Ga0068861_100071501 3300005719 Bacteria 2689
322 Ga0068861_100166789 3300005719 Bacteria 1821
323 Ga0068861_100226074 3300005719 Bacteria 1584
324 Ga0068861_100392759 3300005719 Bacteria 1229
325 Ga0068861_100457709 3300005719 Unclassified 1145
326 Ga0068861_100666669 3300005719 Bacteria 963
327 Ga0068861_100673018 3300005719 Unclassified 959
328 Ga0068861_102211342 3300005719 Unclassified 551
329 Ga0068851_10058013 3300005834 Bacteria 1977
330 Ga0068851_10194288 3300005834 Bacteria 1130
331 Ga0068851_10779575 3300005834 Bacteria 593
332 Ga0068851_10859690 3300005834 Bacteria 566
333 Ga0068870_10009944 3300005840 Bacteria 4346
334 Ga0068870_10011318 3300005840 Bacteria 4133
335 Ga0068870_10020009 3300005840 Bacteria 3253
336 Ga0068870_10061184 3300005840 Unclassified 2023
337 Ga0068870_10165793 3300005840 Unclassified 1314
338 Ga0068870_10321045 3300005840 Bacteria 984
339 Ga0068870_10456880 3300005840 Unclassified 843
340 Ga0068870_10575754 3300005840 Bacteria 762
341 Ga0068870_11184189 3300005840 Bacteria 553
342 Ga0068863_100023408 3300005841 Bacteria 5899
343 Ga0068863_100027198 3300005841 Bacteria 5454
344 Ga0068863_100736499 3300005841 Bacteria 981
345 Ga0068863_100938243 3300005841 Bacteria 867
346 Ga0068863_101096089 3300005841 Unclassified 801
347 Ga0068863_101126947 3300005841 Bacteria 789
348 Ga0068863_102645197 3300005841 Bacteria 511
349 Ga0068858_100021214 3300005842 Bacteria 6066
350 Ga0068858_100038893 3300005842 Bacteria 4412
351 Ga0068858_100042104 3300005842 Bacteria 4235
352 Ga0068858_100061755 3300005842 Bacteria 3464
353 Ga0068858_100074228 3300005842 Unclassified 3158
354 Ga0068858_100360781 3300005842 Unclassified 1393
355 Ga0068858_100627920 3300005842 Bacteria 1043
356 Ga0068858_101211263 3300005842 Unclassified 742
357 Ga0068860_100069371 3300005843 Bacteria 3350
358 Ga0068860_100071856 3300005843 Bacteria 3287
359 Ga0068860_100262337 3300005843 Unclassified 1684
360 Ga0068860_100326915 3300005843 Bacteria 1505
361 Ga0068860_100363828 3300005843 Unclassified 1425
362 Ga0068860_100640107 3300005843 Bacteria 1071
363 Ga0068860_100680183 3300005843 Bacteria 1038
364 Ga0068860_102089522 3300005843 Unclassified 588
365 Ga0068862_100002588 3300005844 Bacteria 15970
366 Ga0068862_100002657 3300005844 Bacteria 15725
367 Ga0068862_100010700 3300005844 Bacteria 7575
368 Ga0068862_100099714 3300005844 Bacteria 2539
369 Ga0068862_100206861 3300005844 Unclassified 1772
370 Ga0068862_100380938 3300005844 Unclassified 1316
371 Ga0068862_100415816 3300005844 Unclassified 1261
372 Ga0068862_101013437 3300005844 Unclassified 822
373 Ga0068862_101099749 3300005844 Unclassified 790
374 Ga0068862_101463828 3300005844 Bacteria 688
375 Ga0070717_10036827 3300006028 Bacteria 3970
376 Ga0075432_10018649 3300006058 Bacteria 2367
377 Ga0075432_10022440 3300006058 Bacteria 2159
378 Ga0075432_10042709 3300006058 Unclassified 1587
379 Ga0075432_10196518 3300006058 Bacteria 796
380 Ga0070712_100070265 3300006175 Bacteria 2501
381 Ga0097621_100196812 3300006237 Bacteria 1748
382 Ga0097621_100249713 3300006237 Bacteria 1553
383 Ga0097621_100660923 3300006237 Unclassified 960
384 Ga0075370_10492590 3300006353 Unclassified 739
385 Ga0068871_100032412 3300006358 Bacteria 4128
386 Ga0068871_100088291 3300006358 Unclassified 2579
387 Ga0068871_100311933 3300006358 Bacteria 1383
388 Ga0068871_100804422 3300006358 Unclassified 867
389 Ga0068871_101894518 3300006358 Unclassified 567
390 Ga0075428_100000377 3300006844 Bacteria 44160
391 Ga0075428_100002001 3300006844 Bacteria 21952
392 Ga0075428_100009521 3300006844 Bacteria 10787
393 Ga0075428_100020830 3300006844 Bacteria 7261
394 Ga0075428_100033834 3300006844 Bacteria 5639
395 Ga0075428_100132740 3300006844 Unclassified 2708
396 Ga0075428_100306215 3300006844 Bacteria 1708
397 Ga0075428_100648611 3300006844 Unclassified 1126
398 Ga0075428_101294535 3300006844 Unclassified 767
399 Ga0075428_101297249 3300006844 Unclassified 766
400 Ga0075428_102195098 3300006844 Bacteria 570
401 Ga0075430_100003207 3300006846 Bacteria 13694
402 Ga0075430_100038491 3300006846 Bacteria 4050
403 Ga0075430_100097632 3300006846 Bacteria 2455
404 Ga0075431_100000943 3300006847 Bacteria 25642
405 Ga0075431_100052605 3300006847 Bacteria 4199
406 Ga0075431_100066018 3300006847 Bacteria 3736
407 Ga0075431_100073720 3300006847 Bacteria 3522
408 Ga0075431_100097501 3300006847 Unclassified 3036
409 Ga0075433_10001576 3300006852 Bacteria 16882
410 Ga0075433_10122925 3300006852 Bacteria 2305
411 Ga0075433_10137231 3300006852 Bacteria 2174
412 Ga0075433_10335777 3300006852 Bacteria 1336
413 Ga0075433_10635860 3300006852 Bacteria 936
414 Ga0075433_10794390 3300006852 Unclassified 827
415 Ga0075433_11500019 3300006852 Bacteria 582
416 Ga0075434_100008841 3300006871 Bacteria 9374
417 Ga0075434_100049640 3300006871 Bacteria 4167
418 Ga0075434_100114950 3300006871 Bacteria 2704
419 Ga0075434_100449529 3300006871 Bacteria 1310
420 Ga0075434_100848057 3300006871 Unclassified 929
421 Ga0075434_101048974 3300006871 Bacteria 829
422 Ga0075434_102086689 3300006871 Unclassified 571
423 Ga0075429_100004661 3300006880 Bacteria 11801
424 Ga0075429_100014110 3300006880 Bacteria 6922
425 Ga0075429_100082650 3300006880 Bacteria 2799
426 Ga0075429_100127727 3300006880 Bacteria 2223
427 Ga0068865_100000314 3300006881 Bacteria 26796
428 Ga0068865_100012120 3300006881 Bacteria 5420
429 Ga0068865_100180548 3300006881 Bacteria 1625
430 Ga0068865_100399117 3300006881 Bacteria 1126
431 Ga0068865_100730737 3300006881 Bacteria 848
432 Ga0068865_101652302 3300006881 Unclassified 577
433 Ga0075436_100133015 3300006914 Bacteria 1745
434 Ga0097620_100004737 3300006931 Bacteria 13820
435 Ga0097620_100008005 3300006931 Bacteria 10715
436 Ga0097620_100029472 3300006931 Bacteria 5506
437 Ga0097620_100195026 3300006931 Bacteria 2109
438 Ga0097620_100242785 3300006931 Bacteria 1891
439 Ga0097620_101537587 3300006931 Unclassified 735
440 Ga0097620_101871603 3300006931 Bacteria 663
441 Ga0097620_102574695 3300006931 Bacteria 560
442 Ga0097620_102727647 3300006931 Unclassified 543
443 Ga0075435_100003605 3300007076 Bacteria 10528
444 Ga0075435_100041793 3300007076 Bacteria 3665
445 Ga0075435_100057999 3300007076 Unclassified 3134
446 Ga0075435_100230262 3300007076 Bacteria 1574
447 Ga0075435_100261351 3300007076 Unclassified 1475
448 Ga0075435_101071859 3300007076 Unclassified 704
449 Ga0099794_10192820 3300007265 Bacteria 1042
450 Ga0105251_10113876 3300009011 Bacteria 1231
451 Ga0105250_10312269 3300009092 Unclassified 682
452 Ga0105250_10381175 3300009092 Unclassified 622
453 Ga0105240_10301966 3300009093 Bacteria 1831
454 Ga0111539_10003861 3300009094 Bacteria 19727
455 Ga0111539_10007889 3300009094 Bacteria 13584
456 Ga0111539_10009953 3300009094 Bacteria 11989
457 Ga0111539_10041369 3300009094 Bacteria 5541
458 Ga0111539_10070401 3300009094 Bacteria 4130
459 Ga0111539_10120027 3300009094 Unclassified 3080
460 Ga0111539_10150487 3300009094 Bacteria 2724
461 Ga0111539_10297580 3300009094 Bacteria 1878
462 Ga0111539_10606797 3300009094 Bacteria 1274
463 Ga0111539_10675451 3300009094 Bacteria 1203
464 Ga0111539_10772541 3300009094 Bacteria 1118
465 Ga0111539_10815489 3300009094 Bacteria 1086
466 Ga0111539_11371304 3300009094 Unclassified 820
467 Ga0105245_10053254 3300009098 Bacteria 3632
468 Ga0105245_10207295 3300009098 Unclassified 1885
469 Ga0105245_11063816 3300009098 Bacteria 855
470 Ga0105245_11067771 3300009098 Bacteria 853
471 Ga0105245_11383675 3300009098 Bacteria 753
472 Ga0105247_10012480 3300009101 Bacteria 5103
473 Ga0105247_10172239 3300009101 Bacteria 1440
474 Ga0105247_10201992 3300009101 Bacteria 1336
475 Ga0114129_10000090 3300009147 Bacteria 86472
476 Ga0114129_10000961 3300009147 Bacteria 37631
477 Ga0114129_10003363 3300009147 Bacteria 22462
478 Ga0114129_10003850 3300009147 Bacteria 21164
479 Ga0114129_10045668 3300009147 Bacteria 6157
480 Ga0114129_10068730 3300009147 Bacteria 4939
481 Ga0114129_10161503 3300009147 Bacteria 3060
482 Ga0114129_10186504 3300009147 Unclassified 2819
483 Ga0114129_10196129 3300009147 Unclassified 2738
484 Ga0114129_10629430 3300009147 Unclassified 1387
485 Ga0114129_10857819 3300009147 Bacteria 1154
486 Ga0114129_11344972 3300009147 Unclassified 883
487 Ga0105243_10047234 3300009148 Bacteria 3388
488 Ga0105243_10065887 3300009148 Bacteria 2911
489 Ga0105243_10203651 3300009148 Bacteria 1737
490 Ga0105243_10224491 3300009148 Unclassified 1662
491 Ga0105243_10318624 3300009148 Unclassified 1416
492 Ga0105243_10467714 3300009148 Bacteria 1187
493 Ga0105243_10547711 3300009148 Bacteria 1105
494 Ga0105243_11140309 3300009148 Unclassified 790
495 Ga0105243_11149424 3300009148 Unclassified 787
496 Ga0105241_12105352 3300009174 Unclassified 558
497 Ga0105242_10024625 3300009176 Bacteria 4755
498 Ga0105242_10041293 3300009176 Bacteria 3720
499 Ga0105242_10097517 3300009176 Bacteria 2485
500 Ga0105248_10009073 3300009177 Bacteria 10937
501 Ga0105248_10440767 3300009177 Bacteria 1467
502 Ga0105248_10587765 3300009177 Bacteria 1256
503 Ga0105248_10896976 3300009177 Bacteria 1001
504 Ga0105248_12124062 3300009177 Unclassified 639
505 Ga0105248_12509649 3300009177 Bacteria 587
506 Ga0105248_12920207 3300009177 Bacteria 545
507 Ga0105237_10199839 3300009545 Unclassified 1998
508 Ga0105237_12308417 3300009545 Unclassified 548
509 Ga0105238_10052352 3300009551 Bacteria 4103
510 Ga0105238_11326259 3300009551 Bacteria 746
511 Ga0105249_10002499 3300009553 Bacteria 15917
512 Ga0105249_10061572 3300009553 Bacteria 3445
513 Ga0105249_10061612 3300009553 Bacteria 3444
514 Ga0105249_10982670 3300009553 Bacteria 913
515 Ga0105249_11004824 3300009553 Bacteria 903
516 Ga0105249_11142213 3300009553 Unclassified 849
517 Ga0105249_11551495 3300009553 Bacteria 735
518 Ga0105249_11836706 3300009553 Unclassified 679
519 Ga0105249_11991919 3300009553 Unclassified 653
520 Ga0105249_12991184 3300009553 Bacteria 543
521 Ga0105239_11203617 3300010375 Unclassified 873
522 Ga0105246_10010255 3300011119 Bacteria 5789
523 Ga0105246_10383606 3300011119 Unclassified 1162
524 Ga0105246_10474260 3300011119 Unclassified 1057
525 Ga0105246_11617527 3300011119 Unclassified 613
526 Ga0157339_1019946 3300012505 Unclassified 703
527 Ga0157316_1006121 3300012510 Bacteria 976
528 Ga0157371_10268218 3300013102 Bacteria 1231
529 Ga0157374_10034263 3300013296 Bacteria 4636
530 Ga0157374_10154302 3300013296 Bacteria 2234
531 Ga0157374_10660104 3300013296 Bacteria 1058
532 Ga0157374_11230454 3300013296 Bacteria 770
533 Ga0157374_12773698 3300013296 Unclassified 518
534 Ga0157378_10382608 3300013297 Unclassified 1382
535 Ga0157378_10432808 3300013297 Unclassified 1302
536 Ga0157378_11115715 3300013297 Unclassified 826
537 Ga0163162_10023495 3300013306 Bacteria 6084
538 Ga0163162_10305796 3300013306 Unclassified 1722
539 Ga0163162_10337290 3300013306 Unclassified 1640
540 Ga0163162_10902576 3300013306 Unclassified 997
541 Ga0163162_12052709 3300013306 Unclassified 655
542 Ga0157372_12971316 3300013307 Unclassified 542
543 Ga0157375_10035668 3300013308 Bacteria 4749
544 Ga0157375_10579778 3300013308 Unclassified 1282
545 Ga0157375_10715247 3300013308 Bacteria 1155
546 Ga0157375_11025845 3300013308 Unclassified 964
547 Ga0157375_12119837 3300013308 Unclassified 669
548 Ga0157375_12791686 3300013308 Unclassified 584
549 Ga0157375_13648500 3300013308 Bacteria 512
550 Ga0163163_10002016 3300014325 Bacteria 17149
551 Ga0163163_10077716 3300014325 Bacteria 3314
552 Ga0163163_10167906 3300014325 Bacteria 2241
553 Ga0163163_10220250 3300014325 Bacteria 1946
554 Ga0163163_10471771 3300014325 Bacteria 1316
555 Ga0163163_10495844 3300014325 Unclassified 1283
556 Ga0163163_10500081 3300014325 Unclassified 1277
557 Ga0163163_10969843 3300014325 Unclassified 913
558 Ga0163163_11176836 3300014325 Bacteria 829
559 Ga0163163_12447103 3300014325 Unclassified 580
560 Ga0157380_10035309 3300014326 Bacteria 3861
561 Ga0157380_10081419 3300014326 Bacteria 2648
562 Ga0157380_10202531 3300014326 Unclassified 1762
563 Ga0157380_10281129 3300014326 Bacteria 1523
564 Ga0157380_10340602 3300014326 Bacteria 1399
565 Ga0157380_10709635 3300014326 Bacteria 1012
566 Ga0157380_10803286 3300014326 Bacteria 958
567 Ga0157380_10843851 3300014326 Unclassified 937
568 Ga0157380_10924763 3300014326 Bacteria 900
569 Ga0157380_11299914 3300014326 Bacteria 774
570 Ga0157380_11414201 3300014326 Bacteria 746
571 Ga0157380_12711086 3300014326 Bacteria 562
572 Ga0157377_10007500 3300014745 Bacteria 5271
573 Ga0157377_10019853 3300014745 Bacteria 3514
574 Ga0157377_10060632 3300014745 Unclassified 2160
575 Ga0157377_10080786 3300014745 Bacteria 1900
576 Ga0157377_10686191 3300014745 Unclassified 742
577 Ga0157377_11122191 3300014745 Bacteria 604
578 Ga0157379_10011139 3300014968 Bacteria 7839
579 Ga0157379_10361242 3300014968 Unclassified 1331
580 Ga0157379_10857228 3300014968 Unclassified 860
581 Ga0157379_11026268 3300014968 Unclassified 787
582 Ga0157376_10079266 3300014969 Bacteria 2815
583 Ga0157376_10090388 3300014969 Unclassified 2650
584 Ga0157376_10560107 3300014969 Unclassified 1132
585 Ga0157376_11704053 3300014969 Bacteria 666
586 Ga0163161_10054290 3300017792 Bacteria 2907
587 Ga0163161_10423845 3300017792 Unclassified 1071
588 Ga0163161_10808943 3300017792 Unclassified 788
589 Ga0163161_10886326 3300017792 Unclassified 755
590 Ga0207666_1073018 3300025271 Unclassified 553
591 Ga0207673_1002600 3300025290 Bacteria 2069
592 Ga0207697_10005501 3300025315 Bacteria 5880
593 Ga0207697_10097542 3300025315 Unclassified 1250
594 Ga0207697_10104081 3300025315 Bacteria 1212
595 Ga0207697_10368866 3300025315 Unclassified 637
596 Ga0207656_10007252 3300025321 Bacteria 4028
597 Ga0207656_10258355 3300025321 Bacteria 855
598 Ga0207656_10494942 3300025321 Unclassified 620
599 Ga0207653_10046610 3300025885 Bacteria 1434
600 Ga0207653_10076824 3300025885 Unclassified 1150
601 Ga0207653_10136900 3300025885 Bacteria 893
602 Ga0207653_10281698 3300025885 Bacteria 642
603 Ga0207682_10001224 3300025893 Bacteria 11865
604 Ga0207682_10035154 3300025893 Unclassified 2023
605 Ga0207682_10063942 3300025893 Bacteria 1545
606 Ga0207682_10109851 3300025893 Bacteria 1213
607 Ga0207682_10165642 3300025893 Unclassified 1004
608 Ga0207682_10270733 3300025893 Bacteria 793
609 Ga0207642_10407204 3300025899 Unclassified 815
610 Ga0207642_11068670 3300025899 Unclassified 521
611 Ga0207710_10021883 3300025900 Bacteria 2743
612 Ga0207710_10768844 3300025900 Unclassified 506
613 Ga0207688_10009371 3300025901 Bacteria 5333
614 Ga0207688_10254198 3300025901 Bacteria 1065
615 Ga0207688_10261755 3300025901 Bacteria 1050
616 Ga0207688_10315656 3300025901 Bacteria 958
617 Ga0207688_10713712 3300025901 Bacteria 634
618 Ga0207680_10036782 3300025903 Bacteria 2821
619 Ga0207680_10226464 3300025903 Unclassified 1284
620 Ga0207680_10240601 3300025903 Unclassified 1247
621 Ga0207647_10469422 3300025904 Bacteria 704
622 Ga0207645_10002078 3300025907 Bacteria 16024
623 Ga0207645_10009110 3300025907 Bacteria 6883
624 Ga0207645_10143363 3300025907 Bacteria 1557
625 Ga0207645_10215518 3300025907 Bacteria 1265
626 Ga0207645_10277005 3300025907 Bacteria 1113
627 Ga0207645_10313563 3300025907 Bacteria 1045
628 Ga0207645_10597391 3300025907 Bacteria 749
629 Ga0207643_10000832 3300025908 Bacteria 18731
630 Ga0207643_10015722 3300025908 Bacteria 4122
631 Ga0207643_10026631 3300025908 Bacteria 3201
632 Ga0207643_10100971 3300025908 Bacteria 1692
633 Ga0207643_10452927 3300025908 Bacteria 817
634 Ga0207643_10529557 3300025908 Bacteria 755
635 Ga0207643_10571905 3300025908 Unclassified 726
636 Ga0207643_10577646 3300025908 Unclassified 722
637 Ga0207684_10439570 3300025910 Unclassified 1120
638 Ga0207654_10466269 3300025911 Unclassified 888
639 Ga0207707_10122110 3300025912 Bacteria 2278
640 Ga0207660_10707203 3300025917 Bacteria 822
641 Ga0207662_10003136 3300025918 Bacteria 8450
642 Ga0207662_10026040 3300025918 Unclassified 3372
643 Ga0207662_10040344 3300025918 Bacteria 2743
644 Ga0207662_10482942 3300025918 Bacteria 851
645 Ga0207662_10867409 3300025918 Unclassified 638
646 Ga0207657_10659863 3300025919 Bacteria 814
647 Ga0207649_10029447 3300025920 Bacteria 3242
648 Ga0207649_10210507 3300025920 Bacteria 1379
649 Ga0207649_10509554 3300025920 Bacteria 916
650 Ga0207646_10064574 3300025922 Unclassified 3268
651 Ga0207646_10595071 3300025922 Bacteria 993
652 Ga0207646_10799295 3300025922 Unclassified 840
653 Ga0207681_10012433 3300025923 Bacteria 5254
654 Ga0207681_10012857 3300025923 Bacteria 5176
655 Ga0207681_10060309 3300025923 Bacteria 2604
656 Ga0207681_10139883 3300025923 Bacteria 1801
657 Ga0207681_10149521 3300025923 Bacteria 1748
658 Ga0207681_10177750 3300025923 Bacteria 1618
659 Ga0207681_10946909 3300025923 Bacteria 722
660 Ga0207681_11072158 3300025923 Unclassified 676
661 Ga0207681_11141776 3300025923 Bacteria 654
662 Ga0207694_10003836 3300025924 Bacteria 11890
663 Ga0207650_10006164 3300025925 Bacteria 8172
664 Ga0207650_10061509 3300025925 Bacteria 2804
665 Ga0207650_10077835 3300025925 Bacteria 2508
666 Ga0207650_10676109 3300025925 Unclassified 871
667 Ga0207650_10908238 3300025925 Unclassified 748
668 Ga0207659_10002642 3300025926 Bacteria 10672
669 Ga0207659_10009199 3300025926 Bacteria 6170
670 Ga0207659_10021667 3300025926 Bacteria 4270
671 Ga0207659_10025297 3300025926 Bacteria 3987
672 Ga0207659_10032932 3300025926 Bacteria 3561
673 Ga0207659_10106017 3300025926 Unclassified 2127
674 Ga0207659_10197810 3300025926 Bacteria 1603
675 Ga0207659_10219883 3300025926 Unclassified 1527
676 Ga0207659_10220441 3300025926 Unclassified 1525
677 Ga0207659_10260618 3300025926 Unclassified 1410
678 Ga0207659_10514744 3300025926 Unclassified 1014
679 Ga0207659_10587441 3300025926 Unclassified 949
680 Ga0207659_10623932 3300025926 Bacteria 920
681 Ga0207687_10039014 3300025927 Bacteria 3250
682 Ga0207687_10517243 3300025927 Bacteria 998
683 Ga0207687_10623804 3300025927 Bacteria 910
684 Ga0207700_10003456 3300025928 Bacteria 9192
685 Ga0207644_10013059 3300025931 Bacteria 5527
686 Ga0207644_10018847 3300025931 Bacteria 4675
687 Ga0207644_10055749 3300025931 Unclassified 2850
688 Ga0207690_10797450 3300025932 Unclassified 780
689 Ga0207690_11071639 3300025932 Unclassified 671
690 Ga0207690_11119248 3300025932 Bacteria 657
691 Ga0207690_11700703 3300025932 Unclassified 527
692 Ga0207706_10029018 3300025933 Bacteria 4940
693 Ga0207706_10127780 3300025933 Bacteria 2235
694 Ga0207706_10149111 3300025933 Unclassified 2057
695 Ga0207706_10235777 3300025933 Bacteria 1600
696 Ga0207706_10321647 3300025933 Bacteria 1346
697 Ga0207686_10011465 3300025934 Bacteria 4855
698 Ga0207686_10046529 3300025934 Bacteria 2677
699 Ga0207686_10152844 3300025934 Unclassified 1609
700 Ga0207709_10039347 3300025935 Unclassified 2824
701 Ga0207709_10116053 3300025935 Bacteria 1799
702 Ga0207709_10164768 3300025935 Bacteria 1550
703 Ga0207709_10346675 3300025935 Unclassified 1120
704 Ga0207709_10348594 3300025935 Bacteria 1117
705 Ga0207709_10778738 3300025935 Unclassified 771
706 Ga0207709_11457513 3300025935 Unclassified 567
707 Ga0207670_10023111 3300025936 Bacteria 3864
708 Ga0207670_10039201 3300025936 Bacteria 3101
709 Ga0207670_10326378 3300025936 Bacteria 1209
710 Ga0207670_10673746 3300025936 Bacteria 854
711 Ga0207670_11935473 3300025936 Unclassified 501
712 Ga0207669_10000046 3300025937 Bacteria 62654
713 Ga0207669_10041347 3300025937 Bacteria 2682
714 Ga0207669_10046745 3300025937 Bacteria 2560
715 Ga0207669_11235858 3300025937 Bacteria 633
716 Ga0207669_11575813 3300025937 Unclassified 560
717 Ga0207704_10001922 3300025938 Bacteria 9301
718 Ga0207704_10223773 3300025938 Bacteria 1394
719 Ga0207704_10244874 3300025938 Bacteria 1342
720 Ga0207704_10480800 3300025938 Bacteria 997
721 Ga0207691_10021362 3300025940 Bacteria 6114
722 Ga0207691_10026097 3300025940 Bacteria 5483
723 Ga0207691_10038423 3300025940 Bacteria 4430
724 Ga0207691_10065552 3300025940 Bacteria 3287
725 Ga0207691_10108300 3300025940 Bacteria 2473
726 Ga0207691_10142131 3300025940 Unclassified 2115
727 Ga0207691_10151703 3300025940 Bacteria 2037
728 Ga0207691_10201413 3300025940 Bacteria 1732
729 Ga0207691_10237015 3300025940 Bacteria 1578
730 Ga0207691_10383129 3300025940 Unclassified 1200
731 Ga0207711_10007787 3300025941 Bacteria 8955
732 Ga0207711_10192278 3300025941 Bacteria 1860
733 Ga0207711_10200902 3300025941 Bacteria 1819
734 Ga0207711_10302693 3300025941 Unclassified 1475
735 Ga0207711_10375609 3300025941 Bacteria 1319
736 Ga0207689_10002481 3300025942 Bacteria 17146
737 Ga0207689_10009132 3300025942 Bacteria 8579
738 Ga0207689_10040878 3300025942 Bacteria 3836
739 Ga0207689_10397250 3300025942 Bacteria 1149
740 Ga0207689_10614555 3300025942 Bacteria 915
741 Ga0207689_10830430 3300025942 Unclassified 780
742 Ga0207661_10091394 3300025944 Bacteria 2536
743 Ga0207661_10325954 3300025944 Bacteria 1382
744 Ga0207679_10001898 3300025945 Bacteria 12983
745 Ga0207679_10106687 3300025945 Bacteria 2202
746 Ga0207679_10127605 3300025945 Bacteria 2035
747 Ga0207679_10132030 3300025945 Bacteria 2005
748 Ga0207679_10174152 3300025945 Bacteria 1774
749 Ga0207679_10225488 3300025945 Bacteria 1579
750 Ga0207679_10440137 3300025945 Unclassified 1154
751 Ga0207679_10554977 3300025945 Bacteria 1031
752 Ga0207679_10586570 3300025945 Bacteria 1003
753 Ga0207651_10002368 3300025960 Bacteria 8995
754 Ga0207651_10087453 3300025960 Bacteria 2268
755 Ga0207651_10087876 3300025960 Bacteria 2264
756 Ga0207651_10283029 3300025960 Bacteria 1371
757 Ga0207651_10305470 3300025960 Unclassified 1324
758 Ga0207651_10489724 3300025960 Unclassified 1061
759 Ga0207651_10561304 3300025960 Unclassified 994
760 Ga0207651_10606181 3300025960 Bacteria 957
761 Ga0207651_10788057 3300025960 Unclassified 842
762 Ga0207651_11547566 3300025960 Bacteria 597
763 Ga0207712_10084558 3300025961 Bacteria 2319
764 Ga0207712_10113506 3300025961 Bacteria 2036
765 Ga0207712_10389670 3300025961 Bacteria 1168
766 Ga0207712_10622644 3300025961 Unclassified 936
767 Ga0207712_11305750 3300025961 Bacteria 648
768 Ga0207712_11330329 3300025961 Unclassified 642
769 Ga0207712_11985506 3300025961 Unclassified 521
770 Ga0207712_12048898 3300025961 Bacteria 512
771 Ga0207668_10041120 3300025972 Bacteria 3123
772 Ga0207668_10140863 3300025972 Bacteria 1854
773 Ga0207668_11015618 3300025972 Unclassified 742
774 Ga0207640_10089575 3300025981 Bacteria 2127
775 Ga0207640_10504343 3300025981 Unclassified 1008
776 Ga0207640_10972266 3300025981 Bacteria 745
777 Ga0207640_11328704 3300025981 Unclassified 642
778 Ga0207658_10150843 3300025986 Unclassified 1893
779 Ga0207658_10356135 3300025986 Unclassified 1276
780 Ga0207658_10382021 3300025986 Bacteria 1234
781 Ga0207658_11097971 3300025986 Unclassified 727
782 Ga0207677_10131622 3300026023 Bacteria 1900
783 Ga0207677_10223879 3300026023 Unclassified 1511
784 Ga0207677_10636755 3300026023 Unclassified 939
785 Ga0207677_10739419 3300026023 Unclassified 876
786 Ga0207677_11190820 3300026023 Bacteria 697
787 Ga0207677_11315868 3300026023 Unclassified 664
788 Ga0207703_10004570 3300026035 Bacteria 11347
789 Ga0207703_10024306 3300026035 Bacteria 4767
790 Ga0207703_10072739 3300026035 Bacteria 2842
791 Ga0207703_10076145 3300026035 Bacteria 2782
792 Ga0207703_10113204 3300026035 Bacteria 2319
793 Ga0207703_10203157 3300026035 Unclassified 1762
794 Ga0207703_10428772 3300026035 Bacteria 1232
795 Ga0207703_10931227 3300026035 Bacteria 832
796 Ga0207703_11203226 3300026035 Unclassified 728
797 Ga0207639_10110541 3300026041 Bacteria 2239
798 Ga0207639_12157191 3300026041 Unclassified 518
799 Ga0207678_10529561 3300026067 Bacteria 1029
800 Ga0207678_11173879 3300026067 Bacteria 680
801 Ga0207708_10018541 3300026075 Bacteria 5242
802 Ga0207708_10056988 3300026075 Unclassified 2981
803 Ga0207708_10060815 3300026075 Unclassified 2884
804 Ga0207708_10083623 3300026075 Bacteria 2454
805 Ga0207708_10100083 3300026075 Bacteria 2243
806 Ga0207708_10277555 3300026075 Bacteria 1357
807 Ga0207708_10639315 3300026075 Bacteria 905
808 Ga0207708_10958416 3300026075 Bacteria 742
809 Ga0207702_10552079 3300026078 Bacteria 1127
810 Ga0207641_10021850 3300026088 Bacteria 5260
811 Ga0207641_10200323 3300026088 Bacteria 1840
812 Ga0207641_10790200 3300026088 Bacteria 938
813 Ga0207641_10850142 3300026088 Bacteria 904
814 Ga0207641_11019141 3300026088 Bacteria 825
815 Ga0207641_11523910 3300026088 Unclassified 670
816 Ga0207641_12038310 3300026088 Bacteria 575
817 Ga0207648_10000198 3300026089 Bacteria 63567
818 Ga0207648_10004539 3300026089 Bacteria 14234
819 Ga0207648_10093868 3300026089 Bacteria 2624
820 Ga0207648_10151552 3300026089 Bacteria 2046
821 Ga0207648_11242031 3300026089 Unclassified 700
822 Ga0207648_11307545 3300026089 Bacteria 681
823 Ga0207648_11777136 3300026089 Unclassified 578
824 Ga0207676_10002483 3300026095 Bacteria 13142
825 Ga0207676_10033829 3300026095 Bacteria 3866
826 Ga0207676_10086796 3300026095 Bacteria 2557
827 Ga0207676_10092542 3300026095 Bacteria 2487
828 Ga0207676_10157578 3300026095 Unclassified 1963
829 Ga0207676_10438501 3300026095 Bacteria 1229
830 Ga0207676_10460303 3300026095 Bacteria 1201
831 Ga0207676_10593730 3300026095 Bacteria 1063
832 Ga0207676_10737620 3300026095 Unclassified 957
833 Ga0207676_11096224 3300026095 Unclassified 787
834 Ga0207676_11761503 3300026095 Unclassified 618
835 Ga0207674_10031401 3300026116 Bacteria 5581
836 Ga0207674_10698884 3300026116 Bacteria 979
837 Ga0207674_10992711 3300026116 Bacteria 809
838 Ga0207674_11144495 3300026116 Unclassified 748
839 Ga0207675_100001270 3300026118 Bacteria 25243
840 Ga0207675_100003798 3300026118 Bacteria 14710
841 Ga0207675_100009919 3300026118 Bacteria 8914
842 Ga0207675_100375130 3300026118 Unclassified 1398
843 Ga0207675_100476539 3300026118 Unclassified 1240
844 Ga0207675_100580742 3300026118 Unclassified 1122
845 Ga0207675_101692882 3300026118 Unclassified 652
846 Ga0207675_101702041 3300026118 Unclassified 651
847 Ga0207675_102522021 3300026118 Bacteria 525
848 Ga0207683_10059342 3300026121 Bacteria 3361
849 Ga0207683_10075217 3300026121 Bacteria 2989
850 Ga0207683_10188902 3300026121 Bacteria 1870
851 Ga0207683_10412119 3300026121 Bacteria 1244
852 Ga0207683_10912229 3300026121 Bacteria 816
853 Ga0207698_10118651 3300026142 Bacteria 2235
854 Ga0210000_1002849 3300027462 Bacteria 2470
855 Ga0209970_1013396 3300027614 Bacteria 1360
856 Ga0209974_10443810 3300027876 Unclassified 514
857 Ga0207428_10000510 3300027907 Bacteria 46433
858 Ga0207428_10003032 3300027907 Bacteria 16532
859 Ga0207428_10004234 3300027907 Bacteria 13740
860 Ga0207428_10263731 3300027907 Bacteria 1282
861 Ga0268266_10013971 3300028379 Bacteria 6913
862 Ga0268266_10417416 3300028379 Bacteria 1271
863 Ga0268266_12221360 3300028379 Bacteria 521
864 Ga0268265_10000767 3300028380 Bacteria 31011
865 Ga0268265_10075231 3300028380 Bacteria 2644
866 Ga0268265_10251782 3300028380 Bacteria 1565
867 Ga0268265_10262384 3300028380 Bacteria 1536
868 Ga0268265_10294777 3300028380 Bacteria 1458
869 Ga0268265_10312020 3300028380 Bacteria 1420
870 Ga0268265_10352055 3300028380 Bacteria 1345
871 Ga0268265_10352470 3300028380 Unclassified 1344
872 Ga0268265_10780979 3300028380 Unclassified 929
873 Ga0268265_10948111 3300028380 Bacteria 847
874 Ga0268265_10984993 3300028380 Unclassified 832
875 Ga0268265_11428253 3300028380 Unclassified 694
876 Ga0268265_12702755 3300028380 Bacteria 502
877 Ga0268264_10030150 3300028381 Bacteria 4447
878 Ga0268264_10057330 3300028381 Bacteria 3258
879 Ga0268264_10098065 3300028381 Bacteria 2541
880 Ga0268264_10159438 3300028381 Bacteria 2031
881 Ga0268264_10245646 3300028381 Bacteria 1660
882 Ga0268264_10755889 3300028381 Bacteria 969
883 Ga0268264_10947585 3300028381 Unclassified 866
884 Ga0268264_12219417 3300028381 Bacteria 557
885 Ga0307408_100497660 3300031548 Bacteria 1066
886 Ga0307408_100780086 3300031548 Bacteria 866
887 Ga0307406_11100810 3300031901 Unclassified 686
888 Ga0307409_100539355 3300031995 Unclassified 1143
889 Ga0307416_100543392 3300032002 Bacteria 1234
890 Ga0307416_101044015 3300032002 Unclassified 921
891 Ga0307416_103272197 3300032002 Bacteria 542
892 Ga0307416_103509611 3300032002 Bacteria 525
893 Ga0307411_10444698 3300032005 Bacteria 1083
894 Ga0307411_10960992 3300032005 Unclassified 763
895 Ga0373948_0013431 3300034817 Unclassified 1479
896 Ga0373948_0063876 3300034817 Unclassified 813
897 Ga0373928_0031217 3300035084 Bacteria 1182
898 Ga0373940_0009982 3300035088 Unclassified 2221
899 Ga0373951_0085893 3300035091 Bacteria 820
900 Ga0373952_0034602 3300035092 Bacteria 1140
901 Ga0373939_0182272 3300035114 Bacteria 784
902 Ga0373957_0458749 3300035120 Unclassified 552
903 Ga0373960_0023324 3300035121 Bacteria 1665
904 Ga0373943_0450629 3300035170 Bacteria 748
905 Ga0373961_0105539 3300035241 Bacteria 917
906 Ga0373962_0029537 3300035242 Bacteria 1494
907 Ga0373931_0057702 3300035691 Bacteria 2083
908 Ga0395898_0156379 3300037466 Bacteria 2181
909 Ga0395905_0007149 3300037471 Bacteria 11156
910 Ga0395905_0392493 3300037471 Bacteria 1282
911 Ga0395905_1125915 3300037471 Unclassified 688
912 Ga0439453_0023334 3300041408 Unclassified 1128
913 Ga0451855_0304849 3300041511 Unclassified 763
914 Ga0451853_1394807 3300041512 Unclassified 745
915 Ga0439450_005251 3300042008 Bacteria 2268
916 Ga0439454_008248 3300042011 Bacteria 1327
917 Ga0450908_065796 3300042184 Bacteria 640
918 Ga0439435_0005021 3300042436 Bacteria 2885
919 Ga0439464_0262658 3300042439 Unclassified 559
920 Ga0439460_0136469 3300042461 Unclassified 811
921 Ga0450916_000508 3300042530 Bacteria 3417
922 Ga0451577_0395950 3300042876 Bacteria 1253
923 Ga0439440_0040261 3300042993 Unclassified 1137
924 Ga0453683_0559799 3300044673 Bacteria 744
925 Ga0451576_0015279 3300045051 Bacteria 8511
926 Ga0451576_0025358 3300045051 Bacteria 6386
927 Ga0451576_0136760 3300045051 Unclassified 2555
928 Ga0451576_0296849 3300045051 Bacteria 1689
929 Ga0451576_0461962 3300045051 Unclassified 1333
930 Ga0451576_0798617 3300045051 Unclassified 991
931 Ga0451576_2671451 3300045051 Unclassified 508
932 Ga0451576_2713153 3300045051 Unclassified 504
933 Ga0495603_0187959 3300046455 Unclassified 1194
934 Ga0495580_0127709 3300046472 Unclassified 1765
935 Ga0495582_0105123 3300046473 Bacteria 1583
936 Ga0495584_0269337 3300046491 Unclassified 866
937 Ga0495594_0119481 3300046499 Unclassified 1489
938 Ga0495643_0407409 3300046522 Unclassified 599
939 Ga0495644_0350931 3300046523 Bacteria 581
940 Ga0495642_0019218 3300046528 Bacteria 2678
941 Ga0495598_0015644 3300046537 Bacteria 1920
942 Ga0495598_0052951 3300046537 Bacteria 1228
943 Ga0495621_0003986 3300046539 Unclassified 4108
944 Ga0495621_0027536 3300046539 Bacteria 1925
945 Ga0495621_0149592 3300046539 Unclassified 918
946 Ga0495621_0164603 3300046539 Bacteria 879
947 Ga0495668_0842339 3300046616 Unclassified 508
948 Ga0495611_0575908 3300046648 Unclassified 509
949 Ga0495659_0043359 3300046664 Bacteria 1614
950 Ga0495659_0128935 3300046664 Unclassified 1002
951 Ga0495588_0017456 3300046674 Unclassified 3486
952 Ga0495588_0310439 3300046674 Unclassified 830
953 Ga0495669_0023891 3300046684 Unclassified 2663
954 Ga0495670_0365774 3300046691 Bacteria 777
955 Ga0495685_007328 3300047447 Bacteria 3640
956 Ga0496100_1123756 3300048903 Unclassified 619
957 Ga0496102_0811128 3300048905 Bacteria 858
958 Ga0496103_0249263 3300048906 Bacteria 1143
959 Ga0496104_1139524 3300048907 Unclassified 683
960 Ga0496106_0413510 3300048909 Unclassified 1084
961 Ga0496106_0424775 3300048909 Unclassified 1068
962 Ga0496106_0498865 3300048909 Bacteria 978
963 Ga0496106_0673437 3300048909 Bacteria 826
964 Ga0496106_0923624 3300048909 Bacteria 688
965 Ga0496108_0012075 3300048911 Bacteria 7024
966 Ga0496108_0613048 3300048911 Bacteria 948
967 Ga0496109_0048968 3300048912 Bacteria 3846
968 Ga0496109_0288894 3300048912 Unclassified 1546
969 Ga0496110_0411574 3300048913 Unclassified 1233
970 Ga0496110_0417667 3300048913 Bacteria 1223
971 Ga0496110_0941518 3300048913 Bacteria 770
972 Ga0496111_0971003 3300048914 Bacteria 610
973 Ga0496112_0032678 3300048915 Bacteria 5052
974 Ga0496112_0282770 3300048915 Bacteria 1606
975 Ga0496112_1529119 3300048915 Bacteria 581
976 Ga0496113_0062438 3300048916 Unclassified 2813
977 Ga0496113_0238777 3300048916 Bacteria 1450
978 Ga0496113_0558702 3300048916 Bacteria 918
979 Ga0496113_1426056 3300048916 Unclassified 536
980 Ga0496114_0157966 3300048917 Unclassified 1970
981 Ga0496114_0162749 3300048917 Bacteria 1941
982 Ga0501032_0484185 3300049569 Bacteria 791
983 Ga0501036_0136152 3300049572 Bacteria 2073
984 Ga0501039_0241187 3300049575 Unclassified 1421
985 Ga0501040_0015108 3300049576 Bacteria 5101
986 Ga0501040_0470679 3300049576 Unclassified 905
987 Ga0501041_0025616 3300049577 Unclassified 3545
988 Ga0501041_0468819 3300049577 Bacteria 800
989 Ga0501041_0615566 3300049577 Unclassified 693
990 Ga0501042_0040657 3300049578 Bacteria 3305
991 Ga0501042_0448264 3300049578 Bacteria 936
992 Ga0501046_0123338 3300049580 Unclassified 1970
993 Ga0501048_0092382 3300049582 Unclassified 2134
994 Ga0501067_0047049 3300049583 Bacteria 2394
995 Ga0501068_0195566 3300049584 Bacteria 1282
996 Ga0501068_0973622 3300049584 Unclassified 559
997 Ga0501069_0661712 3300049585 Unclassified 629
998 Ga0501071_0014605 3300049587 Bacteria 5374
999 Ga0501072_0111349 3300049588 Unclassified 2179
1000 Ga0501073_0196467 3300049589 Unclassified 1395
1001 Ga0501075_0415886 3300049591 Bacteria 1025
1002 Ga0501075_0761614 3300049591 Unclassified 737
1003 Ga0501076_0015576 3300049592 Bacteria 5751
1004 Ga0501077_0065109 3300049593 Bacteria 2312
1005 Ga0501216_189627 3300049660 Bacteria 504
1006 Ga0501079_0541301 3300049741 Bacteria 916
1007 Ga0501080_0157308 3300049742 Unclassified 2099
1008 Ga0501081_0087638 3300049743 Unclassified 2186
1009 Ga0501081_1365077 3300049743 Unclassified 538
1010 Ga0501035_0489901 3300049822 Bacteria 1013
1011 Ga0501045_0084317 3300049824 Unclassified 2344
1012 Ga0501045_0754509 3300049824 Unclassified 717
1013 nmdc:mga06z11_984731_c1 3300050494 Unclassified 514
1014 nmdc:mga05p37_154896_c1 3300050507 Bacteria 2801
1015 nmdc:mga05p37_316351_c1 3300050507 Bacteria 1849
1016 nmdc:mga05p37_31798_c1 3300050507 Bacteria 6449
1017 nmdc:mga05p37_424054_c1 3300050507 Bacteria 1547
1018 nmdc:mga05p37_45770_c1 3300050507 Bacteria 5380
1019 nmdc:mga05p37_46638_c1 3300050507 Bacteria 5328
1020 nmdc:mga05p37_6944_c1 3300050507 Bacteria 13340
1021 nmdc:mga05p37_80881_c1 3300050507 Bacteria 4002
1022 nmdc:mga05p37_82470_c1 3300050507 Bacteria 3962
1023 nmdc:mga05p37_9343_c1 3300050507 Bacteria 11600
1024 nmdc:mga05p37_963354_c1 3300050507 Unclassified 911
1025 nmdc:mga09592_141643_c1 3300050508 Bacteria 2073
1026 nmdc:mga09592_1434034_c1 3300050508 Unclassified 564
1027 nmdc:mga09592_27707_c1 3300050508 Bacteria 4703
1028 nmdc:mga09592_41975_c1 3300050508 Bacteria 3848
1029 nmdc:mga09592_7964_c1 3300050508 Bacteria 8610
1030 nmdc:mga0qj67_2661_c1 3300050509 Bacteria 12798
1031 nmdc:mga0qj67_4487_c1 3300050509 Bacteria 10111
1032 nmdc:mga0qj67_48108_c1 3300050509 Bacteria 3369
1033 nmdc:mga0qj67_81590_c1 3300050509 Unclassified 2593
1034 nmdc:mga0qj67_944362_c1 3300050509 Bacteria 678
1035 nmdc:mga06r32_30562_c1 3300050510 Bacteria 5054
1036 nmdc:mga06r32_321167_c1 3300050510 Bacteria 1534
1037 nmdc:mga06r32_341466_c1 3300050510 Unclassified 1482
1038 nmdc:mga06r32_3807_c1 3300050510 Bacteria 13505
1039 nmdc:mga06r32_769888_c1 3300050510 Bacteria 925
1040 nmdc:mga06r32_961683_c1 3300050510 Unclassified 808
1041 nmdc:mga08y16_186481_c1 3300050511 Bacteria 2152
1042 nmdc:mga08y16_211392_c1 3300050511 Unclassified 2009
1043 nmdc:mga08y16_2170387_c1 3300050511 Unclassified 502
1044 nmdc:mga08y16_2418_c1 3300050511 Bacteria 19189
1045 nmdc:mga08y16_317680_c1 3300050511 Bacteria 1604
1046 nmdc:mga08y16_438934_c1 3300050511 Bacteria 1333
1047 nmdc:mga08y16_470786_c1 3300050511 Bacteria 1279
1048 nmdc:mga08y16_65165_c1 3300050511 Bacteria 3804
1049 nmdc:mga08y16_66472_c1 3300050511 Bacteria 3762
1050 nmdc:mga0n895_1010297_c1 3300050512 Unclassified 812
1051 nmdc:mga0n895_113337_c1 3300050512 Bacteria 2729
1052 nmdc:mga0n895_13174_c1 3300050512 Bacteria 7448
1053 nmdc:mga0n895_1607549_c1 3300050512 Unclassified 614
1054 nmdc:mga0n895_176532_c1 3300050512 Bacteria 2167
1055 nmdc:mga0n895_23506_c1 3300050512 Bacteria 5794
1056 nmdc:mga0n895_334878_c1 3300050512 Unclassified 1533
1057 nmdc:mga0n895_37953_c1 3300050512 Bacteria 3986
1058 nmdc:mga0n895_55203_c1 3300050512 Bacteria 3910
1059 nmdc:mga0n895_763631_c1 3300050512 Unclassified 959
1060 nmdc:mga0n895_846048_c1 3300050512 Unclassified 903
1061 nmdc:mga0rr50_1011122_c1 3300050513 Unclassified 708
1062 nmdc:mga0rr50_111659_c1 3300050513 Bacteria 2164
1063 nmdc:mga0rr50_1466745_c1 3300050513 Unclassified 577
1064 nmdc:mga0rr50_345131_c1 3300050513 Bacteria 1251
1065 nmdc:mga0rr50_615268_c1 3300050513 Bacteria 926
1066 nmdc:mga0rr50_74018_c1 3300050513 Bacteria 2606
1067 nmdc:mga0a205_1393380_c1 3300050515 Bacteria 549
1068 nmdc:mga0a205_1514780_c1 3300050515 Unclassified 519
1069 nmdc:mga0a205_170121_c1 3300050515 Bacteria 2075
1070 nmdc:mga0a205_1825_c2 3300050515 Bacteria 14714
1071 nmdc:mga0a205_186754_c1 3300050515 Bacteria 1965
1072 nmdc:mga0a205_3581_c1 3300050515 Bacteria 13902
1073 nmdc:mga0a205_968536_c1 3300050515 Unclassified 698
1074 Ga0500555_121089 3300053103 Unclassified 654
1075 Ga0501082_0167734 3300060353 Unclassified 1908

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006028 Ga0070717_10036827 Ga0070717_100368273 79
2 3300006175 Ga0070712_100070265 Ga0070712_1000702653 79
3 3300025928 Ga0207700_10003456 Ga0207700_1000345610 79
4 3300005327 Ga0070658_10645531 Ga0070658_106455312 97
5 3300005336 Ga0070680_101415984 Ga0070680_1014159842 97
6 3300005530 Ga0070679_100415881 Ga0070679_1004158812 97
7 3300037466 Ga0395898_0156379 Ga0395898_0156379_552_869 97
8 3300037471 Ga0395905_0007149 Ga0395905_0007149_1625_1942 97
9 3300037471 Ga0395905_0392493 Ga0395905_0392493_666_983 97
10 3300037471 Ga0395905_1125915 Ga0395905_1125915_99_416 97
11 3300005353 Ga0070669_101551225 Ga0070669_1015512251 99
12 3300005366 Ga0070659_100110728 Ga0070659_1001107282 99
13 3300005440 Ga0070705_100963910 Ga0070705_1009639102 99
14 3300005539 Ga0068853_100962420 Ga0068853_1009624202 99
15 3300005544 Ga0070686_100922188 Ga0070686_1009221881 99
16 3300005546 Ga0070696_100272203 Ga0070696_1002722032 99
17 3300005547 Ga0070693_100012874 Ga0070693_1000128745 99
18 3300005549 Ga0070704_100352974 Ga0070704_1003529742 99
19 3300009094 Ga0111539_10772541 Ga0111539_107725413 99
20 3300009148 Ga0105243_11140309 Ga0105243_111403091 99
21 3300009553 Ga0105249_11991919 Ga0105249_119919191 99
22 3300011119 Ga0105246_11617527 Ga0105246_116175272 99
23 3300025315 Ga0207697_10368866 Ga0207697_103688661 99
24 3300025911 Ga0207654_10466269 Ga0207654_104662693 99
25 3300025932 Ga0207690_10797450 Ga0207690_107974502 99
26 3300026041 Ga0207639_10110541 Ga0207639_101105413 99
27 3300031995 Ga0307409_100539355 Ga0307409_1005393553 99
28 3300032005 Ga0307411_10960992 Ga0307411_109609922 99
29 3300048905 Ga0496102_0811128 Ga0496102_0811128_53_352 99
30 3300048909 Ga0496106_0413510 Ga0496106_0413510_627_926 99
31 3300050512 nmdc:mga0n895_846048_c1 nmdc:mga0n895_846048_c1_501_800 99
32 2162886006 SwRhRL3b_contig_4260674 SwRhRL3b_0106.00001770 100
33 2162886007 SwRhRL2b_contig_2303194 SwRhRL2b_0124.00003100 100
34 3300002073 JGI24745J21846_1006703 JGI24745J21846_10067032 100
35 3300002076 JGI24749J21850_1045341 JGI24749J21850_10453411 100
36 3300002126 JGI24035J26624_1004317 JGI24035J26624_10043172 100
37 3300002155 JGI24033J26618_1069457 JGI24033J26618_10694572 100
38 3300004798 Ga0058859_11517576 Ga0058859_115175761 100
39 3300005289 Ga0065704_10232228 Ga0065704_102322281 100
40 3300005289 Ga0065704_10503292 Ga0065704_105032922 100
41 3300005290 Ga0065712_10002683 Ga0065712_100026835 100
42 3300005290 Ga0065712_10007329 Ga0065712_100073294 100
43 3300005290 Ga0065712_10453736 Ga0065712_104537361 100
44 3300005293 Ga0065715_10091986 Ga0065715_100919865 100
45 3300005293 Ga0065715_10294244 Ga0065715_102942442 100
46 3300005293 Ga0065715_10524328 Ga0065715_105243282 100
47 3300005293 Ga0065715_10816696 Ga0065715_108166961 100
48 3300005295 Ga0065707_10004395 Ga0065707_100043957 100
49 3300005295 Ga0065707_10123479 Ga0065707_101234793 100
50 3300005295 Ga0065707_10130896 Ga0065707_101308961 100
51 3300005295 Ga0065707_10279394 Ga0065707_102793942 100
52 3300005295 Ga0065707_10425128 Ga0065707_104251281 100
53 3300005295 Ga0065707_10731062 Ga0065707_107310621 100
54 3300005328 Ga0070676_10026486 Ga0070676_100264866 100
55 3300005328 Ga0070676_10027667 Ga0070676_100276672 100
56 3300005328 Ga0070676_10099791 Ga0070676_100997912 100
57 3300005328 Ga0070676_10410948 Ga0070676_104109482 100
58 3300005329 Ga0070683_100002803 Ga0070683_1000028034 100
59 3300005329 Ga0070683_100532077 Ga0070683_1005320772 100
60 3300005329 Ga0070683_101611383 Ga0070683_1016113832 100
61 3300005330 Ga0070690_100041309 Ga0070690_1000413093 100
62 3300005330 Ga0070690_100110115 Ga0070690_1001101153 100
63 3300005330 Ga0070690_100223065 Ga0070690_1002230652 100
64 3300005330 Ga0070690_101527319 Ga0070690_1015273191 100
65 3300005331 Ga0070670_100002610 Ga0070670_1000026105 100
66 3300005331 Ga0070670_100067854 Ga0070670_1000678543 100
67 3300005331 Ga0070670_100145406 Ga0070670_1001454063 100
68 3300005331 Ga0070670_100235266 Ga0070670_1002352663 100
69 3300005331 Ga0070670_100432930 Ga0070670_1004329301 100
70 3300005331 Ga0070670_101356366 Ga0070670_1013563661 100
71 3300005333 Ga0070677_10070514 Ga0070677_100705141 100
72 3300005333 Ga0070677_10072127 Ga0070677_100721273 100
73 3300005333 Ga0070677_10134492 Ga0070677_101344922 100
74 3300005333 Ga0070677_10185158 Ga0070677_101851582 100
75 3300005333 Ga0070677_10219892 Ga0070677_102198922 100
76 3300005333 Ga0070677_10338436 Ga0070677_103384362 100
77 3300005333 Ga0070677_10565238 Ga0070677_105652381 100
78 3300005334 Ga0068869_100006778 Ga0068869_1000067784 100
79 3300005334 Ga0068869_100016609 Ga0068869_1000166095 100
80 3300005334 Ga0068869_100453107 Ga0068869_1004531072 100
81 3300005334 Ga0068869_101105787 Ga0068869_1011057872 100
82 3300005334 Ga0068869_101211367 Ga0068869_1012113672 100
83 3300005334 Ga0068869_101317159 Ga0068869_1013171592 100
84 3300005334 Ga0068869_101828185 Ga0068869_1018281851 100
85 3300005335 Ga0070666_10006433 Ga0070666_100064337 100
86 3300005335 Ga0070666_10071955 Ga0070666_100719553 100
87 3300005335 Ga0070666_11231800 Ga0070666_112318001 100
88 3300005335 Ga0070666_11414991 Ga0070666_114149911 100
89 3300005336 Ga0070680_101638080 Ga0070680_1016380801 100
90 3300005338 Ga0068868_100031792 Ga0068868_1000317926 100
91 3300005338 Ga0068868_100035225 Ga0068868_1000352252 100
92 3300005338 Ga0068868_100614228 Ga0068868_1006142282 100
93 3300005338 Ga0068868_100794060 Ga0068868_1007940603 100
94 3300005338 Ga0068868_101996542 Ga0068868_1019965421 100
95 3300005339 Ga0070660_100622529 Ga0070660_1006225292 100
96 3300005340 Ga0070689_100016365 Ga0070689_1000163652 100
97 3300005340 Ga0070689_100021825 Ga0070689_1000218254 100
98 3300005340 Ga0070689_100130205 Ga0070689_1001302052 100
99 3300005340 Ga0070689_100143638 Ga0070689_1001436383 100
100 3300005340 Ga0070689_100278871 Ga0070689_1002788712 100
101 3300005340 Ga0070689_101348524 Ga0070689_1013485242 100
102 3300005343 Ga0070687_100049891 Ga0070687_1000498912 100
103 3300005343 Ga0070687_100060473 Ga0070687_1000604732 100
104 3300005343 Ga0070687_100073614 Ga0070687_1000736143 100
105 3300005343 Ga0070687_101411548 Ga0070687_1014115481 100
106 3300005344 Ga0070661_100019728 Ga0070661_1000197285 100
107 3300005344 Ga0070661_100096285 Ga0070661_1000962853 100
108 3300005344 Ga0070661_100539573 Ga0070661_1005395732 100
109 3300005344 Ga0070661_100820975 Ga0070661_1008209752 100
110 3300005345 Ga0070692_10124233 Ga0070692_101242332 100
111 3300005345 Ga0070692_10321190 Ga0070692_103211902 100
112 3300005345 Ga0070692_10347027 Ga0070692_103470272 100
113 3300005347 Ga0070668_100058877 Ga0070668_1000588772 100
114 3300005347 Ga0070668_100069279 Ga0070668_1000692795 100
115 3300005347 Ga0070668_100120255 Ga0070668_1001202553 100
116 3300005347 Ga0070668_100448333 Ga0070668_1004483331 100
117 3300005347 Ga0070668_101836662 Ga0070668_1018366621 100
118 3300005353 Ga0070669_100001020 Ga0070669_10000102011 100
119 3300005353 Ga0070669_100014861 Ga0070669_1000148611 100
120 3300005353 Ga0070669_100032145 Ga0070669_1000321454 100
121 3300005353 Ga0070669_100076506 Ga0070669_1000765063 100
122 3300005353 Ga0070669_100126936 Ga0070669_1001269362 100
123 3300005353 Ga0070669_100135039 Ga0070669_1001350392 100
124 3300005353 Ga0070669_100249279 Ga0070669_1002492792 100
125 3300005353 Ga0070669_101169083 Ga0070669_1011690832 100
126 3300005353 Ga0070669_101548753 Ga0070669_1015487532 100
127 3300005354 Ga0070675_100000033 Ga0070675_10000003322 100
128 3300005354 Ga0070675_100002075 Ga0070675_10000207516 100
129 3300005354 Ga0070675_100009814 Ga0070675_1000098145 100
130 3300005354 Ga0070675_100017656 Ga0070675_1000176569 100
131 3300005354 Ga0070675_100024575 Ga0070675_1000245755 100
132 3300005354 Ga0070675_100050630 Ga0070675_1000506304 100
133 3300005354 Ga0070675_100055048 Ga0070675_1000550483 100
134 3300005354 Ga0070675_100147359 Ga0070675_1001473592 100
135 3300005354 Ga0070675_100171437 Ga0070675_1001714372 100
136 3300005354 Ga0070675_100329580 Ga0070675_1003295803 100
137 3300005354 Ga0070675_100331383 Ga0070675_1003313832 100
138 3300005354 Ga0070675_100465320 Ga0070675_1004653202 100
139 3300005354 Ga0070675_100542918 Ga0070675_1005429182 100
140 3300005354 Ga0070675_100741178 Ga0070675_1007411781 100
141 3300005354 Ga0070675_101870439 Ga0070675_1018704392 100
142 3300005355 Ga0070671_100014984 Ga0070671_1000149843 100
143 3300005355 Ga0070671_100027299 Ga0070671_1000272992 100
144 3300005355 Ga0070671_100045499 Ga0070671_1000454996 100
145 3300005355 Ga0070671_100940752 Ga0070671_1009407522 100
146 3300005356 Ga0070674_100000184 Ga0070674_10000018418 100
147 3300005356 Ga0070674_100015356 Ga0070674_1000153561 100
148 3300005356 Ga0070674_100126255 Ga0070674_1001262551 100
149 3300005356 Ga0070674_100286588 Ga0070674_1002865882 100
150 3300005356 Ga0070674_100345011 Ga0070674_1003450111 100
151 3300005356 Ga0070674_100589651 Ga0070674_1005896512 100
152 3300005364 Ga0070673_100007303 Ga0070673_1000073039 100
153 3300005364 Ga0070673_100027094 Ga0070673_1000270946 100
154 3300005364 Ga0070673_100109560 Ga0070673_1001095602 100
155 3300005364 Ga0070673_100114781 Ga0070673_1001147813 100
156 3300005364 Ga0070673_100139394 Ga0070673_1001393943 100
157 3300005364 Ga0070673_100142185 Ga0070673_1001421853 100
158 3300005364 Ga0070673_100567349 Ga0070673_1005673492 100
159 3300005364 Ga0070673_100654649 Ga0070673_1006546492 100
160 3300005364 Ga0070673_100908925 Ga0070673_1009089251 100
161 3300005364 Ga0070673_101226075 Ga0070673_1012260752 100
162 3300005364 Ga0070673_101668593 Ga0070673_1016685932 100
163 3300005365 Ga0070688_100004930 Ga0070688_1000049308 100
164 3300005365 Ga0070688_100055491 Ga0070688_1000554914 100
165 3300005365 Ga0070688_100150967 Ga0070688_1001509672 100
166 3300005365 Ga0070688_100222147 Ga0070688_1002221472 100
167 3300005365 Ga0070688_101060952 Ga0070688_1010609521 100
168 3300005366 Ga0070659_100170995 Ga0070659_1001709952 100
169 3300005366 Ga0070659_101459563 Ga0070659_1014595632 100
170 3300005367 Ga0070667_100034500 Ga0070667_1000345005 100
171 3300005367 Ga0070667_100592740 Ga0070667_1005927402 100
172 3300005367 Ga0070667_100796710 Ga0070667_1007967101 100
173 3300005367 Ga0070667_100856947 Ga0070667_1008569471 100
174 3300005367 Ga0070667_100896067 Ga0070667_1008960672 100
175 3300005367 Ga0070667_101262473 Ga0070667_1012624731 100
176 3300005367 Ga0070667_102029584 Ga0070667_1020295841 100
177 3300005406 Ga0070703_10014649 Ga0070703_100146493 100
178 3300005406 Ga0070703_10066528 Ga0070703_100665282 100
179 3300005406 Ga0070703_10081745 Ga0070703_100817451 100
180 3300005438 Ga0070701_10012396 Ga0070701_100123965 100
181 3300005438 Ga0070701_10329742 Ga0070701_103297421 100
182 3300005438 Ga0070701_10422344 Ga0070701_104223442 100
183 3300005438 Ga0070701_10649926 Ga0070701_106499262 100
184 3300005440 Ga0070705_100001709 Ga0070705_1000017098 100
185 3300005440 Ga0070705_100192667 Ga0070705_1001926671 100
186 3300005440 Ga0070705_100239925 Ga0070705_1002399252 100
187 3300005440 Ga0070705_100391841 Ga0070705_1003918412 100
188 3300005440 Ga0070705_100471178 Ga0070705_1004711782 100
189 3300005440 Ga0070705_100665454 Ga0070705_1006654541 100
190 3300005440 Ga0070705_100798232 Ga0070705_1007982321 100
191 3300005441 Ga0070700_100014659 Ga0070700_1000146595 100
192 3300005441 Ga0070700_100068591 Ga0070700_1000685914 100
193 3300005441 Ga0070700_100110973 Ga0070700_1001109733 100
194 3300005441 Ga0070700_100301545 Ga0070700_1003015451 100
195 3300005441 Ga0070700_100669286 Ga0070700_1006692862 100
196 3300005441 Ga0070700_101669801 Ga0070700_1016698012 100
197 3300005444 Ga0070694_100267311 Ga0070694_1002673112 100
198 3300005444 Ga0070694_100279106 Ga0070694_1002791062 100
199 3300005444 Ga0070694_100288427 Ga0070694_1002884271 100
200 3300005444 Ga0070694_100371181 Ga0070694_1003711812 100
201 3300005444 Ga0070694_100447963 Ga0070694_1004479632 100
202 3300005444 Ga0070694_100765992 Ga0070694_1007659921 100
203 3300005444 Ga0070694_101065918 Ga0070694_1010659182 100
204 3300005444 Ga0070694_101289739 Ga0070694_1012897392 100
205 3300005444 Ga0070694_101498939 Ga0070694_1014989391 100
206 3300005445 Ga0070708_100121916 Ga0070708_1001219164 100
207 3300005445 Ga0070708_101344902 Ga0070708_1013449022 100
208 3300005456 Ga0070678_100056358 Ga0070678_1000563582 100
209 3300005456 Ga0070678_100301496 Ga0070678_1003014963 100
210 3300005456 Ga0070678_100490899 Ga0070678_1004908992 100
211 3300005457 Ga0070662_100004740 Ga0070662_1000047406 100
212 3300005457 Ga0070662_100182556 Ga0070662_1001825562 100
213 3300005457 Ga0070662_100238738 Ga0070662_1002387383 100
214 3300005457 Ga0070662_100669426 Ga0070662_1006694262 100
215 3300005457 Ga0070662_100874593 Ga0070662_1008745931 100
216 3300005457 Ga0070662_101380581 Ga0070662_1013805812 100
217 3300005458 Ga0070681_10067907 Ga0070681_100679072 100
218 3300005458 Ga0070681_11243663 Ga0070681_112436631 100
219 3300005458 Ga0070681_11354336 Ga0070681_113543361 100
220 3300005459 Ga0068867_100008404 Ga0068867_1000084044 100
221 3300005459 Ga0068867_100012506 Ga0068867_1000125065 100
222 3300005459 Ga0068867_100028197 Ga0068867_1000281972 100
223 3300005459 Ga0068867_100096872 Ga0068867_1000968721 100
224 3300005459 Ga0068867_100535522 Ga0068867_1005355222 100
225 3300005459 Ga0068867_101441696 Ga0068867_1014416961 100
226 3300005459 Ga0068867_102217931 Ga0068867_1022179312 100
227 3300005466 Ga0070685_10007510 Ga0070685_100075104 100
228 3300005466 Ga0070685_10278822 Ga0070685_102788222 100
229 3300005466 Ga0070685_10346887 Ga0070685_103468872 100
230 3300005466 Ga0070685_10712521 Ga0070685_107125212 100
231 3300005466 Ga0070685_10964521 Ga0070685_109645212 100
232 3300005466 Ga0070685_11206830 Ga0070685_112068302 100
233 3300005466 Ga0070685_11380998 Ga0070685_113809982 100
234 3300005467 Ga0070706_100351426 Ga0070706_1003514262 100
235 3300005467 Ga0070706_100533063 Ga0070706_1005330631 100
236 3300005468 Ga0070707_100062698 Ga0070707_1000626982 100
237 3300005468 Ga0070707_100080412 Ga0070707_1000804123 100
238 3300005468 Ga0070707_100097528 Ga0070707_1000975281 100
239 3300005471 Ga0070698_100037618 Ga0070698_1000376184 100
240 3300005471 Ga0070698_100304644 Ga0070698_1003046442 100
241 3300005471 Ga0070698_101702111 Ga0070698_1017021112 100
242 3300005518 Ga0070699_100020817 Ga0070699_1000208173 100
243 3300005518 Ga0070699_100033499 Ga0070699_1000334993 100
244 3300005518 Ga0070699_100215043 Ga0070699_1002150432 100
245 3300005518 Ga0070699_100411696 Ga0070699_1004116962 100
246 3300005518 Ga0070699_101756487 Ga0070699_1017564872 100
247 3300005530 Ga0070679_100493789 Ga0070679_1004937892 100
248 3300005530 Ga0070679_101239747 Ga0070679_1012397471 100
249 3300005535 Ga0070684_100003808 Ga0070684_1000038083 100
250 3300005535 Ga0070684_102313211 Ga0070684_1023132112 100
251 3300005536 Ga0070697_100037352 Ga0070697_1000373525 100
252 3300005536 Ga0070697_100192357 Ga0070697_1001923572 100
253 3300005536 Ga0070697_100315975 Ga0070697_1003159753 100
254 3300005543 Ga0070672_100014219 Ga0070672_1000142198 100
255 3300005543 Ga0070672_100028789 Ga0070672_1000287894 100
256 3300005543 Ga0070672_100033294 Ga0070672_1000332946 100
257 3300005543 Ga0070672_100043970 Ga0070672_1000439702 100
258 3300005543 Ga0070672_100160688 Ga0070672_1001606883 100
259 3300005543 Ga0070672_100218642 Ga0070672_1002186422 100
260 3300005543 Ga0070672_100304570 Ga0070672_1003045703 100
261 3300005543 Ga0070672_100363966 Ga0070672_1003639663 100
262 3300005543 Ga0070672_101033709 Ga0070672_1010337091 100
263 3300005543 Ga0070672_102109601 Ga0070672_1021096012 100
264 3300005544 Ga0070686_100006803 Ga0070686_1000068032 100
265 3300005544 Ga0070686_100042188 Ga0070686_1000421883 100
266 3300005544 Ga0070686_100224486 Ga0070686_1002244862 100
267 3300005544 Ga0070686_100457393 Ga0070686_1004573932 100
268 3300005544 Ga0070686_100813783 Ga0070686_1008137832 100
269 3300005544 Ga0070686_101039601 Ga0070686_1010396011 100
270 3300005544 Ga0070686_101048637 Ga0070686_1010486371 100
271 3300005545 Ga0070695_100006594 Ga0070695_1000065948 100
272 3300005545 Ga0070695_100257074 Ga0070695_1002570743 100
273 3300005545 Ga0070695_100550063 Ga0070695_1005500632 100
274 3300005545 Ga0070695_100550693 Ga0070695_1005506931 100
275 3300005545 Ga0070695_101097374 Ga0070695_1010973742 100
276 3300005545 Ga0070695_101098946 Ga0070695_1010989461 100
277 3300005545 Ga0070695_101285312 Ga0070695_1012853121 100
278 3300005546 Ga0070696_100003487 Ga0070696_1000034876 100
279 3300005546 Ga0070696_100006665 Ga0070696_1000066653 100
280 3300005546 Ga0070696_100485322 Ga0070696_1004853222 100
281 3300005546 Ga0070696_100489319 Ga0070696_1004893192 100
282 3300005546 Ga0070696_100712432 Ga0070696_1007124321 100
283 3300005546 Ga0070696_100730212 Ga0070696_1007302122 100
284 3300005546 Ga0070696_100872536 Ga0070696_1008725361 100
285 3300005546 Ga0070696_101692395 Ga0070696_1016923952 100
286 3300005548 Ga0070665_100001707 Ga0070665_10000170715 100
287 3300005548 Ga0070665_100178177 Ga0070665_1001781772 100
288 3300005548 Ga0070665_100254981 Ga0070665_1002549811 100
289 3300005549 Ga0070704_100000343 Ga0070704_1000003437 100
290 3300005549 Ga0070704_100111611 Ga0070704_1001116114 100
291 3300005549 Ga0070704_100120098 Ga0070704_1001200983 100
292 3300005549 Ga0070704_100239621 Ga0070704_1002396213 100
293 3300005549 Ga0070704_100247088 Ga0070704_1002470882 100
294 3300005549 Ga0070704_100402920 Ga0070704_1004029201 100
295 3300005549 Ga0070704_100476006 Ga0070704_1004760062 100
296 3300005549 Ga0070704_100523110 Ga0070704_1005231102 100
297 3300005549 Ga0070704_100532649 Ga0070704_1005326492 100
298 3300005549 Ga0070704_100594585 Ga0070704_1005945852 100
299 3300005549 Ga0070704_101178029 Ga0070704_1011780291 100
300 3300005549 Ga0070704_101780447 Ga0070704_1017804471 100
301 3300005563 Ga0068855_100560438 Ga0068855_1005604383 100
302 3300005564 Ga0070664_100001327 Ga0070664_1000013278 100
303 3300005564 Ga0070664_100079188 Ga0070664_1000791884 100
304 3300005564 Ga0070664_100299092 Ga0070664_1002990922 100
305 3300005564 Ga0070664_100841919 Ga0070664_1008419192 100
306 3300005564 Ga0070664_100848654 Ga0070664_1008486542 100
307 3300005564 Ga0070664_101152881 Ga0070664_1011528812 100
308 3300005564 Ga0070664_101237113 Ga0070664_1012371132 100
309 3300005564 Ga0070664_101528581 Ga0070664_1015285812 100
310 3300005564 Ga0070664_102110802 Ga0070664_1021108021 100
311 3300005577 Ga0068857_100118789 Ga0068857_1001187892 100
312 3300005577 Ga0068857_101585569 Ga0068857_1015855692 100
313 3300005578 Ga0068854_100254274 Ga0068854_1002542743 100
314 3300005578 Ga0068854_100294909 Ga0068854_1002949093 100
315 3300005578 Ga0068854_100901357 Ga0068854_1009013572 100
316 3300005578 Ga0068854_101346857 Ga0068854_1013468572 100
317 3300005614 Ga0068856_100342148 Ga0068856_1003421483 100
318 3300005615 Ga0070702_100071552 Ga0070702_1000715522 100
319 3300005615 Ga0070702_100109339 Ga0070702_1001093393 100
320 3300005615 Ga0070702_100254710 Ga0070702_1002547102 100
321 3300005616 Ga0068852_100148816 Ga0068852_1001488162 100
322 3300005616 Ga0068852_101262355 Ga0068852_1012623551 100
323 3300005617 Ga0068859_100004737 Ga0068859_10000473713 100
324 3300005617 Ga0068859_100008005 Ga0068859_10000800510 100
325 3300005617 Ga0068859_100029471 Ga0068859_1000294713 100
326 3300005617 Ga0068859_100195030 Ga0068859_1001950302 100
327 3300005617 Ga0068859_100242799 Ga0068859_1002427993 100
328 3300005617 Ga0068859_101537581 Ga0068859_1015375812 100
329 3300005617 Ga0068859_101871300 Ga0068859_1018713002 100
330 3300005617 Ga0068859_102575170 Ga0068859_1025751701 100
331 3300005617 Ga0068859_102728551 Ga0068859_1027285511 100
332 3300005618 Ga0068864_100048934 Ga0068864_1000489342 100
333 3300005618 Ga0068864_100056442 Ga0068864_1000564422 100
334 3300005618 Ga0068864_100100497 Ga0068864_1001004972 100
335 3300005618 Ga0068864_100328606 Ga0068864_1003286062 100
336 3300005618 Ga0068864_100642660 Ga0068864_1006426602 100
337 3300005618 Ga0068864_100659115 Ga0068864_1006591152 100
338 3300005718 Ga0068866_10019977 Ga0068866_100199774 100
339 3300005718 Ga0068866_10154078 Ga0068866_101540783 100
340 3300005718 Ga0068866_11009163 Ga0068866_110091632 100
341 3300005719 Ga0068861_100071501 Ga0068861_1000715012 100
342 3300005719 Ga0068861_100166789 Ga0068861_1001667893 100
343 3300005719 Ga0068861_100226074 Ga0068861_1002260742 100
344 3300005719 Ga0068861_100392759 Ga0068861_1003927592 100
345 3300005719 Ga0068861_100457709 Ga0068861_1004577093 100
346 3300005719 Ga0068861_100666669 Ga0068861_1006666692 100
347 3300005719 Ga0068861_100673018 Ga0068861_1006730181 100
348 3300005719 Ga0068861_102211342 Ga0068861_1022113421 100
349 3300005834 Ga0068851_10058013 Ga0068851_100580132 100
350 3300005834 Ga0068851_10194288 Ga0068851_101942882 100
351 3300005834 Ga0068851_10779575 Ga0068851_107795752 100
352 3300005834 Ga0068851_10859690 Ga0068851_108596901 100
353 3300005840 Ga0068870_10009944 Ga0068870_100099447 100
354 3300005840 Ga0068870_10011318 Ga0068870_100113184 100
355 3300005840 Ga0068870_10020009 Ga0068870_100200092 100
356 3300005840 Ga0068870_10061184 Ga0068870_100611844 100
357 3300005840 Ga0068870_10165793 Ga0068870_101657931 100
358 3300005840 Ga0068870_10321045 Ga0068870_103210451 100
359 3300005840 Ga0068870_10456880 Ga0068870_104568802 100
360 3300005840 Ga0068870_10575754 Ga0068870_105757542 100
361 3300005840 Ga0068870_11184189 Ga0068870_111841892 100
362 3300005841 Ga0068863_100023408 Ga0068863_1000234085 100
363 3300005841 Ga0068863_100027198 Ga0068863_1000271984 100
364 3300005841 Ga0068863_100736499 Ga0068863_1007364991 100
365 3300005841 Ga0068863_100938243 Ga0068863_1009382432 100
366 3300005841 Ga0068863_101096089 Ga0068863_1010960892 100
367 3300005841 Ga0068863_101126947 Ga0068863_1011269472 100
368 3300005841 Ga0068863_102645197 Ga0068863_1026451972 100
369 3300005842 Ga0068858_100021214 Ga0068858_1000212149 100
370 3300005842 Ga0068858_100038893 Ga0068858_1000388932 100
371 3300005842 Ga0068858_100042104 Ga0068858_1000421044 100
372 3300005842 Ga0068858_100061755 Ga0068858_1000617553 100
373 3300005842 Ga0068858_100074228 Ga0068858_1000742284 100
374 3300005842 Ga0068858_100360781 Ga0068858_1003607811 100
375 3300005842 Ga0068858_100627920 Ga0068858_1006279202 100
376 3300005842 Ga0068858_101211263 Ga0068858_1012112632 100
377 3300005843 Ga0068860_100069371 Ga0068860_1000693715 100
378 3300005843 Ga0068860_100071856 Ga0068860_1000718565 100
379 3300005843 Ga0068860_100262337 Ga0068860_1002623373 100
380 3300005843 Ga0068860_100326915 Ga0068860_1003269153 100
381 3300005843 Ga0068860_100363828 Ga0068860_1003638283 100
382 3300005843 Ga0068860_100640107 Ga0068860_1006401072 100
383 3300005843 Ga0068860_100680183 Ga0068860_1006801832 100
384 3300005843 Ga0068860_102089522 Ga0068860_1020895222 100
385 3300005844 Ga0068862_100002588 Ga0068862_10000258816 100
386 3300005844 Ga0068862_100002657 Ga0068862_1000026575 100
387 3300005844 Ga0068862_100010700 Ga0068862_1000107003 100
388 3300005844 Ga0068862_100099714 Ga0068862_1000997143 100
389 3300005844 Ga0068862_100206861 Ga0068862_1002068612 100
390 3300005844 Ga0068862_100380938 Ga0068862_1003809382 100
391 3300005844 Ga0068862_100415816 Ga0068862_1004158162 100
392 3300005844 Ga0068862_101013437 Ga0068862_1010134372 100
393 3300005844 Ga0068862_101099749 Ga0068862_1010997492 100
394 3300005844 Ga0068862_101463828 Ga0068862_1014638281 100
395 3300006058 Ga0075432_10018649 Ga0075432_100186494 100
396 3300006058 Ga0075432_10022440 Ga0075432_100224403 100
397 3300006058 Ga0075432_10042709 Ga0075432_100427093 100
398 3300006058 Ga0075432_10196518 Ga0075432_101965181 100
399 3300006237 Ga0097621_100196812 Ga0097621_1001968122 100
400 3300006237 Ga0097621_100249713 Ga0097621_1002497133 100
401 3300006237 Ga0097621_100660923 Ga0097621_1006609232 100
402 3300006353 Ga0075370_10492590 Ga0075370_104925902 100
403 3300006358 Ga0068871_100032412 Ga0068871_1000324126 100
404 3300006358 Ga0068871_100088291 Ga0068871_1000882912 100
405 3300006358 Ga0068871_100311933 Ga0068871_1003119333 100
406 3300006358 Ga0068871_100804422 Ga0068871_1008044222 100
407 3300006358 Ga0068871_101894518 Ga0068871_1018945182 100
408 3300006844 Ga0075428_100000377 Ga0075428_10000037735 100
409 3300006844 Ga0075428_100002001 Ga0075428_10000200112 100
410 3300006844 Ga0075428_100009521 Ga0075428_10000952112 100
411 3300006844 Ga0075428_100020830 Ga0075428_1000208304 100
412 3300006844 Ga0075428_100033834 Ga0075428_1000338347 100
413 3300006844 Ga0075428_100132740 Ga0075428_1001327402 100
414 3300006844 Ga0075428_100306215 Ga0075428_1003062152 100
415 3300006844 Ga0075428_100648611 Ga0075428_1006486111 100
416 3300006844 Ga0075428_101294535 Ga0075428_1012945352 100
417 3300006844 Ga0075428_101297249 Ga0075428_1012972492 100
418 3300006844 Ga0075428_102195098 Ga0075428_1021950982 100
419 3300006846 Ga0075430_100003207 Ga0075430_1000032074 100
420 3300006846 Ga0075430_100038491 Ga0075430_1000384912 100
421 3300006846 Ga0075430_100097632 Ga0075430_1000976321 100
422 3300006847 Ga0075431_100000943 Ga0075431_1000009438 100
423 3300006847 Ga0075431_100052605 Ga0075431_1000526057 100
424 3300006847 Ga0075431_100066018 Ga0075431_1000660182 100
425 3300006847 Ga0075431_100073720 Ga0075431_1000737205 100
426 3300006847 Ga0075431_100097501 Ga0075431_1000975013 100
427 3300006852 Ga0075433_10001576 Ga0075433_100015766 100
428 3300006852 Ga0075433_10122925 Ga0075433_101229253 100
429 3300006852 Ga0075433_10137231 Ga0075433_101372311 100
430 3300006852 Ga0075433_10335777 Ga0075433_103357772 100
431 3300006852 Ga0075433_10635860 Ga0075433_106358602 100
432 3300006852 Ga0075433_10794390 Ga0075433_107943902 100
433 3300006852 Ga0075433_11500019 Ga0075433_115000192 100
434 3300006871 Ga0075434_100008841 Ga0075434_1000088411 100
435 3300006871 Ga0075434_100049640 Ga0075434_1000496402 100
436 3300006871 Ga0075434_100114950 Ga0075434_1001149502 100
437 3300006871 Ga0075434_100449529 Ga0075434_1004495292 100
438 3300006871 Ga0075434_100848057 Ga0075434_1008480572 100
439 3300006871 Ga0075434_101048974 Ga0075434_1010489741 100
440 3300006871 Ga0075434_102086689 Ga0075434_1020866892 100
441 3300006880 Ga0075429_100004661 Ga0075429_10000466110 100
442 3300006880 Ga0075429_100014110 Ga0075429_1000141107 100
443 3300006880 Ga0075429_100082650 Ga0075429_1000826504 100
444 3300006880 Ga0075429_100127727 Ga0075429_1001277272 100
445 3300006881 Ga0068865_100000314 Ga0068865_1000003147 100
446 3300006881 Ga0068865_100012120 Ga0068865_1000121206 100
447 3300006881 Ga0068865_100180548 Ga0068865_1001805483 100
448 3300006881 Ga0068865_100399117 Ga0068865_1003991171 100
449 3300006881 Ga0068865_100730737 Ga0068865_1007307371 100
450 3300006881 Ga0068865_101652302 Ga0068865_1016523021 100
451 3300006914 Ga0075436_100133015 Ga0075436_1001330154 100
452 3300006931 Ga0097620_100004737 Ga0097620_10000473713 100
453 3300006931 Ga0097620_100008005 Ga0097620_10000800510 100
454 3300006931 Ga0097620_100029472 Ga0097620_1000294727 100
455 3300006931 Ga0097620_100195026 Ga0097620_1001950262 100
456 3300006931 Ga0097620_100242785 Ga0097620_1002427853 100
457 3300006931 Ga0097620_101537587 Ga0097620_1015375872 100
458 3300006931 Ga0097620_101871603 Ga0097620_1018716032 100
459 3300006931 Ga0097620_102574695 Ga0097620_1025746952 100
460 3300006931 Ga0097620_102727647 Ga0097620_1027276471 100
461 3300007076 Ga0075435_100003605 Ga0075435_1000036057 100
462 3300007076 Ga0075435_100041793 Ga0075435_1000417934 100
463 3300007076 Ga0075435_100057999 Ga0075435_1000579994 100
464 3300007076 Ga0075435_100230262 Ga0075435_1002302622 100
465 3300007076 Ga0075435_100261351 Ga0075435_1002613513 100
466 3300007076 Ga0075435_101071859 Ga0075435_1010718592 100
467 3300007265 Ga0099794_10192820 Ga0099794_101928202 100
468 3300009011 Ga0105251_10113876 Ga0105251_101138763 100
469 3300009092 Ga0105250_10312269 Ga0105250_103122691 100
470 3300009092 Ga0105250_10381175 Ga0105250_103811752 100
471 3300009093 Ga0105240_10301966 Ga0105240_103019661 100
472 3300009094 Ga0111539_10003861 Ga0111539_100038618 100
473 3300009094 Ga0111539_10007889 Ga0111539_1000788911 100
474 3300009094 Ga0111539_10009953 Ga0111539_100099536 100
475 3300009094 Ga0111539_10041369 Ga0111539_100413696 100
476 3300009094 Ga0111539_10070401 Ga0111539_100704015 100
477 3300009094 Ga0111539_10120027 Ga0111539_101200272 100
478 3300009094 Ga0111539_10150487 Ga0111539_101504874 100
479 3300009094 Ga0111539_10297580 Ga0111539_102975803 100
480 3300009094 Ga0111539_10606797 Ga0111539_106067972 100
481 3300009094 Ga0111539_10675451 Ga0111539_106754513 100
482 3300009094 Ga0111539_10815489 Ga0111539_108154892 100
483 3300009094 Ga0111539_11371304 Ga0111539_113713042 100
484 3300009098 Ga0105245_10053254 Ga0105245_100532543 100
485 3300009098 Ga0105245_10207295 Ga0105245_102072953 100
486 3300009098 Ga0105245_11063816 Ga0105245_110638162 100
487 3300009098 Ga0105245_11067771 Ga0105245_110677712 100
488 3300009098 Ga0105245_11383675 Ga0105245_113836752 100
489 3300009101 Ga0105247_10012480 Ga0105247_100124804 100
490 3300009101 Ga0105247_10172239 Ga0105247_101722393 100
491 3300009101 Ga0105247_10201992 Ga0105247_102019922 100
492 3300009147 Ga0114129_10000090 Ga0114129_1000009030 100
493 3300009147 Ga0114129_10000961 Ga0114129_1000096110 100
494 3300009147 Ga0114129_10003363 Ga0114129_1000336311 100
495 3300009147 Ga0114129_10003850 Ga0114129_1000385016 100
496 3300009147 Ga0114129_10045668 Ga0114129_100456686 100
497 3300009147 Ga0114129_10068730 Ga0114129_100687306 100
498 3300009147 Ga0114129_10161503 Ga0114129_101615032 100
499 3300009147 Ga0114129_10186504 Ga0114129_101865042 100
500 3300009147 Ga0114129_10196129 Ga0114129_101961294 100
501 3300009147 Ga0114129_10629430 Ga0114129_106294302 100
502 3300009147 Ga0114129_10857819 Ga0114129_108578192 100
503 3300009147 Ga0114129_11344972 Ga0114129_113449722 100
504 3300009148 Ga0105243_10047234 Ga0105243_100472345 100
505 3300009148 Ga0105243_10065887 Ga0105243_100658871 100
506 3300009148 Ga0105243_10203651 Ga0105243_102036511 100
507 3300009148 Ga0105243_10224491 Ga0105243_102244914 100
508 3300009148 Ga0105243_10318624 Ga0105243_103186242 100
509 3300009148 Ga0105243_10467714 Ga0105243_104677143 100
510 3300009148 Ga0105243_10547711 Ga0105243_105477111 100
511 3300009148 Ga0105243_11149424 Ga0105243_111494241 100
512 3300009174 Ga0105241_12105352 Ga0105241_121053521 100
513 3300009176 Ga0105242_10024625 Ga0105242_100246255 100
514 3300009176 Ga0105242_10041293 Ga0105242_100412933 100
515 3300009176 Ga0105242_10097517 Ga0105242_100975174 100
516 3300009177 Ga0105248_10009073 Ga0105248_100090734 100
517 3300009177 Ga0105248_10440767 Ga0105248_104407673 100
518 3300009177 Ga0105248_10587765 Ga0105248_105877652 100
519 3300009177 Ga0105248_10896976 Ga0105248_108969762 100
520 3300009177 Ga0105248_12124062 Ga0105248_121240622 100
521 3300009177 Ga0105248_12509649 Ga0105248_125096492 100
522 3300009177 Ga0105248_12920207 Ga0105248_129202071 100
523 3300009545 Ga0105237_10199839 Ga0105237_101998393 100
524 3300009545 Ga0105237_12308417 Ga0105237_123084172 100
525 3300009551 Ga0105238_10052352 Ga0105238_100523525 100
526 3300009551 Ga0105238_11326259 Ga0105238_113262591 100
527 3300009553 Ga0105249_10002499 Ga0105249_1000249916 100
528 3300009553 Ga0105249_10061572 Ga0105249_100615725 100
529 3300009553 Ga0105249_10061612 Ga0105249_100616126 100
530 3300009553 Ga0105249_10982670 Ga0105249_109826701 100
531 3300009553 Ga0105249_11004824 Ga0105249_110048242 100
532 3300009553 Ga0105249_11142213 Ga0105249_111422132 100
533 3300009553 Ga0105249_11551495 Ga0105249_115514952 100
534 3300009553 Ga0105249_11836706 Ga0105249_118367062 100
535 3300009553 Ga0105249_12991184 Ga0105249_129911842 100
536 3300010375 Ga0105239_11203617 Ga0105239_112036172 100
537 3300011119 Ga0105246_10010255 Ga0105246_100102556 100
538 3300011119 Ga0105246_10383606 Ga0105246_103836062 100
539 3300011119 Ga0105246_10474260 Ga0105246_104742602 100
540 3300012505 Ga0157339_1019946 Ga0157339_10199462 100
541 3300012510 Ga0157316_1006121 Ga0157316_10061212 100
542 3300013102 Ga0157371_10268218 Ga0157371_102682182 100
543 3300013296 Ga0157374_10034263 Ga0157374_100342635 100
544 3300013296 Ga0157374_10154302 Ga0157374_101543024 100
545 3300013296 Ga0157374_10660104 Ga0157374_106601042 100
546 3300013296 Ga0157374_11230454 Ga0157374_112304542 100
547 3300013296 Ga0157374_12773698 Ga0157374_127736982 100
548 3300013297 Ga0157378_10382608 Ga0157378_103826082 100
549 3300013297 Ga0157378_10432808 Ga0157378_104328083 100
550 3300013297 Ga0157378_11115715 Ga0157378_111157152 100
551 3300013306 Ga0163162_10023495 Ga0163162_100234952 100
552 3300013306 Ga0163162_10305796 Ga0163162_103057962 100
553 3300013306 Ga0163162_10337290 Ga0163162_103372903 100
554 3300013306 Ga0163162_10902576 Ga0163162_109025762 100
555 3300013306 Ga0163162_12052709 Ga0163162_120527092 100
556 3300013307 Ga0157372_12971316 Ga0157372_129713161 100
557 3300013308 Ga0157375_10035668 Ga0157375_100356683 100
558 3300013308 Ga0157375_10579778 Ga0157375_105797782 100
559 3300013308 Ga0157375_10715247 Ga0157375_107152471 100
560 3300013308 Ga0157375_11025845 Ga0157375_110258452 100
561 3300013308 Ga0157375_12119837 Ga0157375_121198372 100
562 3300013308 Ga0157375_12791686 Ga0157375_127916861 100
563 3300013308 Ga0157375_13648500 Ga0157375_136485001 100
564 3300014325 Ga0163163_10002016 Ga0163163_1000201613 100
565 3300014325 Ga0163163_10077716 Ga0163163_100777162 100
566 3300014325 Ga0163163_10167906 Ga0163163_101679063 100
567 3300014325 Ga0163163_10220250 Ga0163163_102202502 100
568 3300014325 Ga0163163_10471771 Ga0163163_104717711 100
569 3300014325 Ga0163163_10495844 Ga0163163_104958442 100
570 3300014325 Ga0163163_10500081 Ga0163163_105000813 100
571 3300014325 Ga0163163_10969843 Ga0163163_109698432 100
572 3300014325 Ga0163163_11176836 Ga0163163_111768362 100
573 3300014325 Ga0163163_12447103 Ga0163163_124471032 100
574 3300014326 Ga0157380_10035309 Ga0157380_100353095 100
575 3300014326 Ga0157380_10081419 Ga0157380_100814192 100
576 3300014326 Ga0157380_10202531 Ga0157380_102025313 100
577 3300014326 Ga0157380_10281129 Ga0157380_102811292 100
578 3300014326 Ga0157380_10340602 Ga0157380_103406023 100
579 3300014326 Ga0157380_10709635 Ga0157380_107096352 100
580 3300014326 Ga0157380_10803286 Ga0157380_108032862 100
581 3300014326 Ga0157380_10843851 Ga0157380_108438513 100
582 3300014326 Ga0157380_10924763 Ga0157380_109247632 100
583 3300014326 Ga0157380_11299914 Ga0157380_112999141 100
584 3300014326 Ga0157380_11414201 Ga0157380_114142012 100
585 3300014326 Ga0157380_12711086 Ga0157380_127110862 100
586 3300014745 Ga0157377_10007500 Ga0157377_100075006 100
587 3300014745 Ga0157377_10019853 Ga0157377_100198533 100
588 3300014745 Ga0157377_10060632 Ga0157377_100606323 100
589 3300014745 Ga0157377_10080786 Ga0157377_100807863 100
590 3300014745 Ga0157377_10686191 Ga0157377_106861912 100
591 3300014745 Ga0157377_11122191 Ga0157377_111221912 100
592 3300014968 Ga0157379_10011139 Ga0157379_100111396 100
593 3300014968 Ga0157379_10361242 Ga0157379_103612422 100
594 3300014968 Ga0157379_10857228 Ga0157379_108572281 100
595 3300014968 Ga0157379_11026268 Ga0157379_110262682 100
596 3300014969 Ga0157376_10079266 Ga0157376_100792663 100
597 3300014969 Ga0157376_10090388 Ga0157376_100903883 100
598 3300014969 Ga0157376_10560107 Ga0157376_105601071 100
599 3300014969 Ga0157376_11704053 Ga0157376_117040532 100
600 3300017792 Ga0163161_10054290 Ga0163161_100542903 100
601 3300017792 Ga0163161_10423845 Ga0163161_104238453 100
602 3300017792 Ga0163161_10808943 Ga0163161_108089432 100
603 3300017792 Ga0163161_10886326 Ga0163161_108863262 100
604 3300025271 Ga0207666_1073018 Ga0207666_10730181 100
605 3300025290 Ga0207673_1002600 Ga0207673_10026002 100
606 3300025315 Ga0207697_10005501 Ga0207697_100055013 100
607 3300025315 Ga0207697_10097542 Ga0207697_100975422 100
608 3300025315 Ga0207697_10104081 Ga0207697_101040813 100
609 3300025321 Ga0207656_10007252 Ga0207656_100072523 100
610 3300025321 Ga0207656_10258355 Ga0207656_102583552 100
611 3300025321 Ga0207656_10494942 Ga0207656_104949421 100
612 3300025885 Ga0207653_10046610 Ga0207653_100466102 100
613 3300025885 Ga0207653_10076824 Ga0207653_100768242 100
614 3300025885 Ga0207653_10136900 Ga0207653_101369002 100
615 3300025885 Ga0207653_10281698 Ga0207653_102816981 100
616 3300025893 Ga0207682_10001224 Ga0207682_100012248 100
617 3300025893 Ga0207682_10035154 Ga0207682_100351543 100
618 3300025893 Ga0207682_10063942 Ga0207682_100639423 100
619 3300025893 Ga0207682_10109851 Ga0207682_101098511 100
620 3300025893 Ga0207682_10165642 Ga0207682_101656421 100
621 3300025893 Ga0207682_10270733 Ga0207682_102707332 100
622 3300025899 Ga0207642_10407204 Ga0207642_104072041 100
623 3300025899 Ga0207642_11068670 Ga0207642_110686701 100
624 3300025900 Ga0207710_10021883 Ga0207710_100218835 100
625 3300025900 Ga0207710_10768844 Ga0207710_107688442 100
626 3300025901 Ga0207688_10009371 Ga0207688_100093718 100
627 3300025901 Ga0207688_10254198 Ga0207688_102541982 100
628 3300025901 Ga0207688_10261755 Ga0207688_102617552 100
629 3300025901 Ga0207688_10315656 Ga0207688_103156563 100
630 3300025901 Ga0207688_10713712 Ga0207688_107137121 100
631 3300025903 Ga0207680_10036782 Ga0207680_100367822 100
632 3300025903 Ga0207680_10226464 Ga0207680_102264641 100
633 3300025903 Ga0207680_10240601 Ga0207680_102406013 100
634 3300025904 Ga0207647_10469422 Ga0207647_104694222 100
635 3300025907 Ga0207645_10002078 Ga0207645_100020784 100
636 3300025907 Ga0207645_10009110 Ga0207645_100091107 100
637 3300025907 Ga0207645_10143363 Ga0207645_101433632 100
638 3300025907 Ga0207645_10215518 Ga0207645_102155181 100
639 3300025907 Ga0207645_10277005 Ga0207645_102770052 100
640 3300025907 Ga0207645_10313563 Ga0207645_103135632 100
641 3300025907 Ga0207645_10597391 Ga0207645_105973911 100
642 3300025908 Ga0207643_10000832 Ga0207643_1000083212 100
643 3300025908 Ga0207643_10015722 Ga0207643_100157224 100
644 3300025908 Ga0207643_10026631 Ga0207643_100266312 100
645 3300025908 Ga0207643_10100971 Ga0207643_101009712 100
646 3300025908 Ga0207643_10452927 Ga0207643_104529271 100
647 3300025908 Ga0207643_10529557 Ga0207643_105295572 100
648 3300025908 Ga0207643_10571905 Ga0207643_105719052 100
649 3300025908 Ga0207643_10577646 Ga0207643_105776462 100
650 3300025910 Ga0207684_10439570 Ga0207684_104395702 100
651 3300025912 Ga0207707_10122110 Ga0207707_101221104 100
652 3300025917 Ga0207660_10707203 Ga0207660_107072032 100
653 3300025918 Ga0207662_10003136 Ga0207662_100031363 100
654 3300025918 Ga0207662_10026040 Ga0207662_100260406 100
655 3300025918 Ga0207662_10040344 Ga0207662_100403443 100
656 3300025918 Ga0207662_10482942 Ga0207662_104829422 100
657 3300025918 Ga0207662_10867409 Ga0207662_108674091 100
658 3300025919 Ga0207657_10659863 Ga0207657_106598632 100
659 3300025920 Ga0207649_10029447 Ga0207649_100294474 100
660 3300025920 Ga0207649_10210507 Ga0207649_102105072 100
661 3300025920 Ga0207649_10509554 Ga0207649_105095542 100
662 3300025922 Ga0207646_10064574 Ga0207646_100645742 100
663 3300025922 Ga0207646_10595071 Ga0207646_105950712 100
664 3300025922 Ga0207646_10799295 Ga0207646_107992951 100
665 3300025923 Ga0207681_10012433 Ga0207681_100124339 100
666 3300025923 Ga0207681_10012857 Ga0207681_100128572 100
667 3300025923 Ga0207681_10060309 Ga0207681_100603094 100
668 3300025923 Ga0207681_10139883 Ga0207681_101398832 100
669 3300025923 Ga0207681_10149521 Ga0207681_101495214 100
670 3300025923 Ga0207681_10177750 Ga0207681_101777502 100
671 3300025923 Ga0207681_10946909 Ga0207681_109469092 100
672 3300025923 Ga0207681_11072158 Ga0207681_110721582 100
673 3300025923 Ga0207681_11141776 Ga0207681_111417762 100
674 3300025924 Ga0207694_10003836 Ga0207694_1000383611 100
675 3300025925 Ga0207650_10006164 Ga0207650_100061648 100
676 3300025925 Ga0207650_10061509 Ga0207650_100615095 100
677 3300025925 Ga0207650_10077835 Ga0207650_100778353 100
678 3300025925 Ga0207650_10676109 Ga0207650_106761092 100
679 3300025925 Ga0207650_10908238 Ga0207650_109082382 100
680 3300025926 Ga0207659_10002642 Ga0207659_100026427 100
681 3300025926 Ga0207659_10009199 Ga0207659_100091994 100
682 3300025926 Ga0207659_10021667 Ga0207659_100216673 100
683 3300025926 Ga0207659_10025297 Ga0207659_100252974 100
684 3300025926 Ga0207659_10032932 Ga0207659_100329322 100
685 3300025926 Ga0207659_10106017 Ga0207659_101060172 100
686 3300025926 Ga0207659_10197810 Ga0207659_101978101 100
687 3300025926 Ga0207659_10219883 Ga0207659_102198832 100
688 3300025926 Ga0207659_10220441 Ga0207659_102204412 100
689 3300025926 Ga0207659_10260618 Ga0207659_102606183 100
690 3300025926 Ga0207659_10514744 Ga0207659_105147442 100
691 3300025926 Ga0207659_10587441 Ga0207659_105874412 100
692 3300025926 Ga0207659_10623932 Ga0207659_106239322 100
693 3300025927 Ga0207687_10039014 Ga0207687_100390145 100
694 3300025927 Ga0207687_10517243 Ga0207687_105172432 100
695 3300025927 Ga0207687_10623804 Ga0207687_106238042 100
696 3300025931 Ga0207644_10013059 Ga0207644_100130597 100
697 3300025931 Ga0207644_10018847 Ga0207644_100188475 100
698 3300025931 Ga0207644_10055749 Ga0207644_100557492 100
699 3300025932 Ga0207690_11071639 Ga0207690_110716391 100
700 3300025932 Ga0207690_11119248 Ga0207690_111192481 100
701 3300025932 Ga0207690_11700703 Ga0207690_117007031 100
702 3300025933 Ga0207706_10029018 Ga0207706_100290182 100
703 3300025933 Ga0207706_10127780 Ga0207706_101277802 100
704 3300025933 Ga0207706_10149111 Ga0207706_101491113 100
705 3300025933 Ga0207706_10235777 Ga0207706_102357772 100
706 3300025933 Ga0207706_10321647 Ga0207706_103216472 100
707 3300025934 Ga0207686_10011465 Ga0207686_100114655 100
708 3300025934 Ga0207686_10046529 Ga0207686_100465294 100
709 3300025934 Ga0207686_10152844 Ga0207686_101528443 100
710 3300025935 Ga0207709_10039347 Ga0207709_100393473 100
711 3300025935 Ga0207709_10116053 Ga0207709_101160532 100
712 3300025935 Ga0207709_10164768 Ga0207709_101647683 100
713 3300025935 Ga0207709_10346675 Ga0207709_103466752 100
714 3300025935 Ga0207709_10348594 Ga0207709_103485943 100
715 3300025935 Ga0207709_10778738 Ga0207709_107787381 100
716 3300025935 Ga0207709_11457513 Ga0207709_114575132 100
717 3300025936 Ga0207670_10023111 Ga0207670_100231113 100
718 3300025936 Ga0207670_10039201 Ga0207670_100392014 100
719 3300025936 Ga0207670_10326378 Ga0207670_103263781 100
720 3300025936 Ga0207670_10673746 Ga0207670_106737463 100
721 3300025936 Ga0207670_11935473 Ga0207670_119354732 100
722 3300025937 Ga0207669_10000046 Ga0207669_1000004610 100
723 3300025937 Ga0207669_10041347 Ga0207669_100413473 100
724 3300025937 Ga0207669_10046745 Ga0207669_100467453 100
725 3300025937 Ga0207669_11235858 Ga0207669_112358581 100
726 3300025937 Ga0207669_11575813 Ga0207669_115758131 100
727 3300025938 Ga0207704_10001922 Ga0207704_100019225 100
728 3300025938 Ga0207704_10223773 Ga0207704_102237732 100
729 3300025938 Ga0207704_10244874 Ga0207704_102448742 100
730 3300025938 Ga0207704_10480800 Ga0207704_104808001 100
731 3300025940 Ga0207691_10021362 Ga0207691_100213627 100
732 3300025940 Ga0207691_10026097 Ga0207691_100260977 100
733 3300025940 Ga0207691_10038423 Ga0207691_100384233 100
734 3300025940 Ga0207691_10065552 Ga0207691_100655523 100
735 3300025940 Ga0207691_10108300 Ga0207691_101083002 100
736 3300025940 Ga0207691_10142131 Ga0207691_101421312 100
737 3300025940 Ga0207691_10151703 Ga0207691_101517032 100
738 3300025940 Ga0207691_10201413 Ga0207691_102014132 100
739 3300025940 Ga0207691_10237015 Ga0207691_102370152 100
740 3300025940 Ga0207691_10383129 Ga0207691_103831292 100
741 3300025941 Ga0207711_10007787 Ga0207711_100077879 100
742 3300025941 Ga0207711_10192278 Ga0207711_101922783 100
743 3300025941 Ga0207711_10200902 Ga0207711_102009022 100
744 3300025941 Ga0207711_10302693 Ga0207711_103026931 100
745 3300025941 Ga0207711_10375609 Ga0207711_103756092 100
746 3300025942 Ga0207689_10002481 Ga0207689_1000248116 100
747 3300025942 Ga0207689_10009132 Ga0207689_100091322 100
748 3300025942 Ga0207689_10040878 Ga0207689_100408784 100
749 3300025942 Ga0207689_10397250 Ga0207689_103972502 100
750 3300025942 Ga0207689_10614555 Ga0207689_106145552 100
751 3300025942 Ga0207689_10830430 Ga0207689_108304302 100
752 3300025944 Ga0207661_10091394 Ga0207661_100913941 100
753 3300025944 Ga0207661_10325954 Ga0207661_103259542 100
754 3300025945 Ga0207679_10001898 Ga0207679_100018986 100
755 3300025945 Ga0207679_10106687 Ga0207679_101066873 100
756 3300025945 Ga0207679_10127605 Ga0207679_101276052 100
757 3300025945 Ga0207679_10132030 Ga0207679_101320304 100
758 3300025945 Ga0207679_10174152 Ga0207679_101741523 100
759 3300025945 Ga0207679_10225488 Ga0207679_102254881 100
760 3300025945 Ga0207679_10440137 Ga0207679_104401372 100
761 3300025945 Ga0207679_10554977 Ga0207679_105549771 100
762 3300025945 Ga0207679_10586570 Ga0207679_105865701 100
763 3300025960 Ga0207651_10002368 Ga0207651_100023685 100
764 3300025960 Ga0207651_10087453 Ga0207651_100874532 100
765 3300025960 Ga0207651_10087876 Ga0207651_100878762 100
766 3300025960 Ga0207651_10283029 Ga0207651_102830292 100
767 3300025960 Ga0207651_10305470 Ga0207651_103054701 100
768 3300025960 Ga0207651_10489724 Ga0207651_104897242 100
769 3300025960 Ga0207651_10561304 Ga0207651_105613042 100
770 3300025960 Ga0207651_10606181 Ga0207651_106061812 100
771 3300025960 Ga0207651_10788057 Ga0207651_107880572 100
772 3300025960 Ga0207651_11547566 Ga0207651_115475661 100
773 3300025961 Ga0207712_10084558 Ga0207712_100845583 100
774 3300025961 Ga0207712_10113506 Ga0207712_101135063 100
775 3300025961 Ga0207712_10389670 Ga0207712_103896702 100
776 3300025961 Ga0207712_10622644 Ga0207712_106226442 100
777 3300025961 Ga0207712_11305750 Ga0207712_113057501 100
778 3300025961 Ga0207712_11330329 Ga0207712_113303292 100
779 3300025961 Ga0207712_11985506 Ga0207712_119855062 100
780 3300025961 Ga0207712_12048898 Ga0207712_120488982 100
781 3300025972 Ga0207668_10041120 Ga0207668_100411202 100
782 3300025972 Ga0207668_10140863 Ga0207668_101408632 100
783 3300025972 Ga0207668_11015618 Ga0207668_110156181 100
784 3300025981 Ga0207640_10089575 Ga0207640_100895753 100
785 3300025981 Ga0207640_10504343 Ga0207640_105043431 100
786 3300025981 Ga0207640_10972266 Ga0207640_109722661 100
787 3300025981 Ga0207640_11328704 Ga0207640_113287042 100
788 3300025986 Ga0207658_10150843 Ga0207658_101508431 100
789 3300025986 Ga0207658_10356135 Ga0207658_103561352 100
790 3300025986 Ga0207658_10382021 Ga0207658_103820212 100
791 3300025986 Ga0207658_11097971 Ga0207658_110979711 100
792 3300026023 Ga0207677_10131622 Ga0207677_101316223 100
793 3300026023 Ga0207677_10223879 Ga0207677_102238792 100
794 3300026023 Ga0207677_10636755 Ga0207677_106367552 100
795 3300026023 Ga0207677_10739419 Ga0207677_107394192 100
796 3300026023 Ga0207677_11190820 Ga0207677_111908202 100
797 3300026023 Ga0207677_11315868 Ga0207677_113158681 100
798 3300026035 Ga0207703_10004570 Ga0207703_100045705 100
799 3300026035 Ga0207703_10024306 Ga0207703_100243064 100
800 3300026035 Ga0207703_10072739 Ga0207703_100727393 100
801 3300026035 Ga0207703_10076145 Ga0207703_100761452 100
802 3300026035 Ga0207703_10113204 Ga0207703_101132044 100
803 3300026035 Ga0207703_10203157 Ga0207703_102031571 100
804 3300026035 Ga0207703_10428772 Ga0207703_104287721 100
805 3300026035 Ga0207703_10931227 Ga0207703_109312271 100
806 3300026035 Ga0207703_11203226 Ga0207703_112032261 100
807 3300026041 Ga0207639_12157191 Ga0207639_121571912 100
808 3300026067 Ga0207678_10529561 Ga0207678_105295612 100
809 3300026067 Ga0207678_11173879 Ga0207678_111738791 100
810 3300026075 Ga0207708_10018541 Ga0207708_100185412 100
811 3300026075 Ga0207708_10056988 Ga0207708_100569885 100
812 3300026075 Ga0207708_10060815 Ga0207708_100608154 100
813 3300026075 Ga0207708_10083623 Ga0207708_100836233 100
814 3300026075 Ga0207708_10100083 Ga0207708_101000831 100
815 3300026075 Ga0207708_10277555 Ga0207708_102775551 100
816 3300026075 Ga0207708_10639315 Ga0207708_106393153 100
817 3300026075 Ga0207708_10958416 Ga0207708_109584163 100
818 3300026078 Ga0207702_10552079 Ga0207702_105520792 100
819 3300026088 Ga0207641_10021850 Ga0207641_100218506 100
820 3300026088 Ga0207641_10200323 Ga0207641_102003233 100
821 3300026088 Ga0207641_10790200 Ga0207641_107902002 100
822 3300026088 Ga0207641_10850142 Ga0207641_108501422 100
823 3300026088 Ga0207641_11019141 Ga0207641_110191412 100
824 3300026088 Ga0207641_11523910 Ga0207641_115239102 100
825 3300026088 Ga0207641_12038310 Ga0207641_120383101 100
826 3300026089 Ga0207648_10000198 Ga0207648_1000019821 100
827 3300026089 Ga0207648_10004539 Ga0207648_100045392 100
828 3300026089 Ga0207648_10093868 Ga0207648_100938684 100
829 3300026089 Ga0207648_10151552 Ga0207648_101515522 100
830 3300026089 Ga0207648_11242031 Ga0207648_112420311 100
831 3300026089 Ga0207648_11307545 Ga0207648_113075451 100
832 3300026089 Ga0207648_11777136 Ga0207648_117771362 100
833 3300026095 Ga0207676_10002483 Ga0207676_100024836 100
834 3300026095 Ga0207676_10033829 Ga0207676_100338293 100
835 3300026095 Ga0207676_10086796 Ga0207676_100867964 100
836 3300026095 Ga0207676_10092542 Ga0207676_100925422 100
837 3300026095 Ga0207676_10157578 Ga0207676_101575784 100
838 3300026095 Ga0207676_10438501 Ga0207676_104385012 100
839 3300026095 Ga0207676_10460303 Ga0207676_104603032 100
840 3300026095 Ga0207676_10593730 Ga0207676_105937302 100
841 3300026095 Ga0207676_10737620 Ga0207676_107376202 100
842 3300026095 Ga0207676_11096224 Ga0207676_110962242 100
843 3300026095 Ga0207676_11761503 Ga0207676_117615031 100
844 3300026116 Ga0207674_10031401 Ga0207674_100314017 100
845 3300026116 Ga0207674_10698884 Ga0207674_106988841 100
846 3300026116 Ga0207674_10992711 Ga0207674_109927111 100
847 3300026116 Ga0207674_11144495 Ga0207674_111444952 100
848 3300026118 Ga0207675_100001270 Ga0207675_1000012709 100
849 3300026118 Ga0207675_100003798 Ga0207675_10000379814 100
850 3300026118 Ga0207675_100009919 Ga0207675_1000099192 100
851 3300026118 Ga0207675_100375130 Ga0207675_1003751303 100
852 3300026118 Ga0207675_100476539 Ga0207675_1004765392 100
853 3300026118 Ga0207675_100580742 Ga0207675_1005807422 100
854 3300026118 Ga0207675_101692882 Ga0207675_1016928821 100
855 3300026118 Ga0207675_101702041 Ga0207675_1017020412 100
856 3300026118 Ga0207675_102522021 Ga0207675_1025220211 100
857 3300026121 Ga0207683_10059342 Ga0207683_100593425 100
858 3300026121 Ga0207683_10075217 Ga0207683_100752173 100
859 3300026121 Ga0207683_10188902 Ga0207683_101889021 100
860 3300026121 Ga0207683_10412119 Ga0207683_104121192 100
861 3300026121 Ga0207683_10912229 Ga0207683_109122292 100
862 3300026142 Ga0207698_10118651 Ga0207698_101186512 100
863 3300027462 Ga0210000_1002849 Ga0210000_10028493 100
864 3300027614 Ga0209970_1013396 Ga0209970_10133962 100
865 3300027876 Ga0209974_10443810 Ga0209974_104438102 100
866 3300027907 Ga0207428_10000510 Ga0207428_1000051025 100
867 3300027907 Ga0207428_10003032 Ga0207428_1000303211 100
868 3300027907 Ga0207428_10004234 Ga0207428_100042344 100
869 3300027907 Ga0207428_10263731 Ga0207428_102637312 100
870 3300028379 Ga0268266_10013971 Ga0268266_100139717 100
871 3300028379 Ga0268266_10417416 Ga0268266_104174162 100
872 3300028379 Ga0268266_12221360 Ga0268266_122213601 100
873 3300028380 Ga0268265_10000767 Ga0268265_1000076729 100
874 3300028380 Ga0268265_10075231 Ga0268265_100752313 100
875 3300028380 Ga0268265_10251782 Ga0268265_102517821 100
876 3300028380 Ga0268265_10262384 Ga0268265_102623844 100
877 3300028380 Ga0268265_10294777 Ga0268265_102947772 100
878 3300028380 Ga0268265_10312020 Ga0268265_103120203 100
879 3300028380 Ga0268265_10352055 Ga0268265_103520553 100
880 3300028380 Ga0268265_10352470 Ga0268265_103524703 100
881 3300028380 Ga0268265_10780979 Ga0268265_107809792 100
882 3300028380 Ga0268265_10948111 Ga0268265_109481113 100
883 3300028380 Ga0268265_10984993 Ga0268265_109849932 100
884 3300028380 Ga0268265_11428253 Ga0268265_114282532 100
885 3300028380 Ga0268265_12702755 Ga0268265_127027551 100
886 3300028381 Ga0268264_10030150 Ga0268264_100301504 100
887 3300028381 Ga0268264_10057330 Ga0268264_100573305 100
888 3300028381 Ga0268264_10098065 Ga0268264_100980653 100
889 3300028381 Ga0268264_10159438 Ga0268264_101594381 100
890 3300028381 Ga0268264_10245646 Ga0268264_102456463 100
891 3300028381 Ga0268264_10755889 Ga0268264_107558892 100
892 3300028381 Ga0268264_10947585 Ga0268264_109475852 100
893 3300028381 Ga0268264_12219417 Ga0268264_122194171 100
894 3300031548 Ga0307408_100497660 Ga0307408_1004976602 100
895 3300031548 Ga0307408_100780086 Ga0307408_1007800863 100
896 3300031901 Ga0307406_11100810 Ga0307406_111008102 100
897 3300032002 Ga0307416_100543392 Ga0307416_1005433922 100
898 3300032002 Ga0307416_101044015 Ga0307416_1010440152 100
899 3300032002 Ga0307416_103272197 Ga0307416_1032721971 100
900 3300032002 Ga0307416_103509611 Ga0307416_1035096111 100
901 3300032005 Ga0307411_10444698 Ga0307411_104446982 100
902 3300034817 Ga0373948_0013431 Ga0373948_0013431_1117_1419 100
903 3300034817 Ga0373948_0063876 Ga0373948_0063876_73_375 100
904 3300035084 Ga0373928_0031217 Ga0373928_0031217_787_1089 100
905 3300035088 Ga0373940_0009982 Ga0373940_0009982_405_707 100
906 3300035091 Ga0373951_0085893 Ga0373951_0085893_418_720 100
907 3300035092 Ga0373952_0034602 Ga0373952_0034602_520_822 100
908 3300035114 Ga0373939_0182272 Ga0373939_0182272_358_660 100
909 3300035120 Ga0373957_0458749 Ga0373957_0458749_146_448 100
910 3300035121 Ga0373960_0023324 Ga0373960_0023324_875_1177 100
911 3300035170 Ga0373943_0450629 Ga0373943_0450629_74_376 100
912 3300035241 Ga0373961_0105539 Ga0373961_0105539_243_545 100
913 3300035242 Ga0373962_0029537 Ga0373962_0029537_123_425 100
914 3300035691 Ga0373931_0057702 Ga0373931_0057702_1499_1801 100
915 3300041408 Ga0439453_0023334 Ga0439453_0023334_107_409 100
916 3300041511 Ga0451855_0304849 Ga0451855_0304849_107_418 100
917 3300041512 Ga0451853_1394807 Ga0451853_1394807_337_648 100
918 3300042008 Ga0439450_005251 Ga0439450_005251_743_1045 100
919 3300042011 Ga0439454_008248 Ga0439454_008248_889_1191 100
920 3300042184 Ga0450908_065796 Ga0450908_065796_169_471 100
921 3300042436 Ga0439435_0005021 Ga0439435_0005021_182_484 100
922 3300042439 Ga0439464_0262658 Ga0439464_0262658_12_314 100
923 3300042461 Ga0439460_0136469 Ga0439460_0136469_348_659 100
924 3300042530 Ga0450916_000508 Ga0450916_000508_74_376 100
925 3300042876 Ga0451577_0395950 Ga0451577_0395950_70_372 100
926 3300042993 Ga0439440_0040261 Ga0439440_0040261_381_683 100
927 3300044673 Ga0453683_0559799 Ga0453683_0559799_298_600 100
928 3300045051 Ga0451576_0015279 Ga0451576_0015279_2254_2556 100
929 3300045051 Ga0451576_0025358 Ga0451576_0025358_4178_4480 100
930 3300045051 Ga0451576_0136760 Ga0451576_0136760_1094_1396 100
931 3300045051 Ga0451576_0296849 Ga0451576_0296849_1065_1367 100
932 3300045051 Ga0451576_0461962 Ga0451576_0461962_808_1110 100
933 3300045051 Ga0451576_0798617 Ga0451576_0798617_271_573 100
934 3300045051 Ga0451576_2671451 Ga0451576_2671451_21_323 100
935 3300045051 Ga0451576_2713153 Ga0451576_2713153_10_312 100
936 3300046455 Ga0495603_0187959 Ga0495603_0187959_779_1081 100
937 3300046472 Ga0495580_0127709 Ga0495580_0127709_446_748 100
938 3300046473 Ga0495582_0105123 Ga0495582_0105123_631_933 100
939 3300046491 Ga0495584_0269337 Ga0495584_0269337_511_813 100
940 3300046499 Ga0495594_0119481 Ga0495594_0119481_304_606 100
941 3300046522 Ga0495643_0407409 Ga0495643_0407409_131_433 100
942 3300046523 Ga0495644_0350931 Ga0495644_0350931_116_418 100
943 3300046528 Ga0495642_0019218 Ga0495642_0019218_1507_1809 100
944 3300046537 Ga0495598_0015644 Ga0495598_0015644_585_887 100
945 3300046537 Ga0495598_0052951 Ga0495598_0052951_598_900 100
946 3300046539 Ga0495621_0003986 Ga0495621_0003986_1879_2181 100
947 3300046539 Ga0495621_0027536 Ga0495621_0027536_452_754 100
948 3300046539 Ga0495621_0149592 Ga0495621_0149592_53_355 100
949 3300046539 Ga0495621_0164603 Ga0495621_0164603_401_703 100
950 3300046616 Ga0495668_0842339 Ga0495668_0842339_173_475 100
951 3300046648 Ga0495611_0575908 Ga0495611_0575908_16_318 100
952 3300046664 Ga0495659_0043359 Ga0495659_0043359_1194_1496 100
953 3300046664 Ga0495659_0128935 Ga0495659_0128935_31_333 100
954 3300046674 Ga0495588_0017456 Ga0495588_0017456_2812_3114 100
955 3300046674 Ga0495588_0310439 Ga0495588_0310439_192_494 100
956 3300046684 Ga0495669_0023891 Ga0495669_0023891_1614_1916 100
957 3300046691 Ga0495670_0365774 Ga0495670_0365774_246_548 100
958 3300047447 Ga0495685_007328 Ga0495685_007328_3328_3630 100
959 3300048903 Ga0496100_1123756 Ga0496100_1123756_59_361 100
960 3300048906 Ga0496103_0249263 Ga0496103_0249263_627_929 100
961 3300048907 Ga0496104_1139524 Ga0496104_1139524_256_558 100
962 3300048909 Ga0496106_0424775 Ga0496106_0424775_675_977 100
963 3300048909 Ga0496106_0498865 Ga0496106_0498865_513_815 100
964 3300048909 Ga0496106_0673437 Ga0496106_0673437_285_587 100
965 3300048909 Ga0496106_0923624 Ga0496106_0923624_237_539 100
966 3300048911 Ga0496108_0012075 Ga0496108_0012075_2634_2936 100
967 3300048911 Ga0496108_0613048 Ga0496108_0613048_131_433 100
968 3300048912 Ga0496109_0048968 Ga0496109_0048968_2335_2637 100
969 3300048912 Ga0496109_0288894 Ga0496109_0288894_668_970 100
970 3300048913 Ga0496110_0411574 Ga0496110_0411574_835_1137 100
971 3300048913 Ga0496110_0417667 Ga0496110_0417667_55_357 100
972 3300048913 Ga0496110_0941518 Ga0496110_0941518_417_719 100
973 3300048914 Ga0496111_0971003 Ga0496111_0971003_12_314 100
974 3300048915 Ga0496112_0032678 Ga0496112_0032678_4282_4584 100
975 3300048915 Ga0496112_0282770 Ga0496112_0282770_802_1104 100
976 3300048915 Ga0496112_1529119 Ga0496112_1529119_28_330 100
977 3300048916 Ga0496113_0062438 Ga0496113_0062438_1318_1620 100
978 3300048916 Ga0496113_0238777 Ga0496113_0238777_251_553 100
979 3300048916 Ga0496113_0558702 Ga0496113_0558702_108_410 100
980 3300048916 Ga0496113_1426056 Ga0496113_1426056_168_470 100
981 3300048917 Ga0496114_0157966 Ga0496114_0157966_1645_1947 100
982 3300048917 Ga0496114_0162749 Ga0496114_0162749_632_934 100
983 3300049569 Ga0501032_0484185 Ga0501032_0484185_278_586 100
984 3300049572 Ga0501036_0136152 Ga0501036_0136152_1139_1447 100
985 3300049575 Ga0501039_0241187 Ga0501039_0241187_316_624 100
986 3300049576 Ga0501040_0015108 Ga0501040_0015108_3786_4094 100
987 3300049576 Ga0501040_0470679 Ga0501040_0470679_543_845 100
988 3300049577 Ga0501041_0025616 Ga0501041_0025616_1162_1470 100
989 3300049577 Ga0501041_0468819 Ga0501041_0468819_434_736 100
990 3300049577 Ga0501041_0615566 Ga0501041_0615566_110_412 100
991 3300049578 Ga0501042_0040657 Ga0501042_0040657_1719_2027 100
992 3300049578 Ga0501042_0448264 Ga0501042_0448264_524_826 100
993 3300049580 Ga0501046_0123338 Ga0501046_0123338_151_459 100
994 3300049582 Ga0501048_0092382 Ga0501048_0092382_431_739 100
995 3300049583 Ga0501067_0047049 Ga0501067_0047049_887_1189 100
996 3300049584 Ga0501068_0195566 Ga0501068_0195566_924_1226 100
997 3300049584 Ga0501068_0973622 Ga0501068_0973622_210_518 100
998 3300049585 Ga0501069_0661712 Ga0501069_0661712_265_567 100
999 3300049587 Ga0501071_0014605 Ga0501071_0014605_1550_1858 100
1000 3300049588 Ga0501072_0111349 Ga0501072_0111349_865_1173 100
1001 3300049589 Ga0501073_0196467 Ga0501073_0196467_827_1135 100
1002 3300049591 Ga0501075_0415886 Ga0501075_0415886_384_692 100
1003 3300049591 Ga0501075_0761614 Ga0501075_0761614_380_682 100
1004 3300049592 Ga0501076_0015576 Ga0501076_0015576_324_632 100
1005 3300049593 Ga0501077_0065109 Ga0501077_0065109_15_323 100
1006 3300049660 Ga0501216_189627 Ga0501216_189627_73_375 100
1007 3300049741 Ga0501079_0541301 Ga0501079_0541301_38_340 100
1008 3300049742 Ga0501080_0157308 Ga0501080_0157308_773_1081 100
1009 3300049743 Ga0501081_0087638 Ga0501081_0087638_1202_1510 100
1010 3300049743 Ga0501081_1365077 Ga0501081_1365077_191_493 100
1011 3300049822 Ga0501035_0489901 Ga0501035_0489901_637_945 100
1012 3300049824 Ga0501045_0084317 Ga0501045_0084317_990_1298 100
1013 3300049824 Ga0501045_0754509 Ga0501045_0754509_404_706 100
1014 3300050494 nmdc:mga06z11_984731_c1 nmdc:mga06z11_984731_c1_188_490 100
1015 3300050507 nmdc:mga05p37_154896_c1 nmdc:mga05p37_154896_c1_2292_2594 100
1016 3300050507 nmdc:mga05p37_316351_c1 nmdc:mga05p37_316351_c1_1241_1543 100
1017 3300050507 nmdc:mga05p37_31798_c1 nmdc:mga05p37_31798_c1_3312_3614 100
1018 3300050507 nmdc:mga05p37_424054_c1 nmdc:mga05p37_424054_c1_731_1033 100
1019 3300050507 nmdc:mga05p37_45770_c1 nmdc:mga05p37_45770_c1_4037_4339 100
1020 3300050507 nmdc:mga05p37_46638_c1 nmdc:mga05p37_46638_c1_1623_1925 100
1021 3300050507 nmdc:mga05p37_6944_c1 nmdc:mga05p37_6944_c1_5983_6285 100
1022 3300050507 nmdc:mga05p37_80881_c1 nmdc:mga05p37_80881_c1_1833_2135 100
1023 3300050507 nmdc:mga05p37_82470_c1 nmdc:mga05p37_82470_c1_865_1167 100
1024 3300050507 nmdc:mga05p37_9343_c1 nmdc:mga05p37_9343_c1_1145_1447 100
1025 3300050507 nmdc:mga05p37_963354_c1 nmdc:mga05p37_963354_c1_106_408 100
1026 3300050508 nmdc:mga09592_141643_c1 nmdc:mga09592_141643_c1_990_1292 100
1027 3300050508 nmdc:mga09592_1434034_c1 nmdc:mga09592_1434034_c1_146_448 100
1028 3300050508 nmdc:mga09592_27707_c1 nmdc:mga09592_27707_c1_2681_2983 100
1029 3300050508 nmdc:mga09592_41975_c1 nmdc:mga09592_41975_c1_895_1197 100
1030 3300050508 nmdc:mga09592_7964_c1 nmdc:mga09592_7964_c1_1104_1406 100
1031 3300050509 nmdc:mga0qj67_2661_c1 nmdc:mga0qj67_2661_c1_1963_2265 100
1032 3300050509 nmdc:mga0qj67_4487_c1 nmdc:mga0qj67_4487_c1_7944_8246 100
1033 3300050509 nmdc:mga0qj67_48108_c1 nmdc:mga0qj67_48108_c1_821_1123 100
1034 3300050509 nmdc:mga0qj67_81590_c1 nmdc:mga0qj67_81590_c1_1192_1494 100
1035 3300050509 nmdc:mga0qj67_944362_c1 nmdc:mga0qj67_944362_c1_18_320 100
1036 3300050510 nmdc:mga06r32_30562_c1 nmdc:mga06r32_30562_c1_2082_2384 100
1037 3300050510 nmdc:mga06r32_321167_c1 nmdc:mga06r32_321167_c1_713_1015 100
1038 3300050510 nmdc:mga06r32_341466_c1 nmdc:mga06r32_341466_c1_1141_1443 100
1039 3300050510 nmdc:mga06r32_3807_c1 nmdc:mga06r32_3807_c1_6570_6872 100
1040 3300050510 nmdc:mga06r32_769888_c1 nmdc:mga06r32_769888_c1_232_534 100
1041 3300050510 nmdc:mga06r32_961683_c1 nmdc:mga06r32_961683_c1_120_422 100
1042 3300050511 nmdc:mga08y16_186481_c1 nmdc:mga08y16_186481_c1_501_803 100
1043 3300050511 nmdc:mga08y16_211392_c1 nmdc:mga08y16_211392_c1_498_800 100
1044 3300050511 nmdc:mga08y16_2170387_c1 nmdc:mga08y16_2170387_c1_162_464 100
1045 3300050511 nmdc:mga08y16_2418_c1 nmdc:mga08y16_2418_c1_5118_5420 100
1046 3300050511 nmdc:mga08y16_317680_c1 nmdc:mga08y16_317680_c1_558_860 100
1047 3300050511 nmdc:mga08y16_438934_c1 nmdc:mga08y16_438934_c1_55_357 100
1048 3300050511 nmdc:mga08y16_470786_c1 nmdc:mga08y16_470786_c1_647_949 100
1049 3300050511 nmdc:mga08y16_65165_c1 nmdc:mga08y16_65165_c1_2971_3273 100
1050 3300050511 nmdc:mga08y16_66472_c1 nmdc:mga08y16_66472_c1_2160_2462 100
1051 3300050512 nmdc:mga0n895_1010297_c1 nmdc:mga0n895_1010297_c1_399_701 100
1052 3300050512 nmdc:mga0n895_113337_c1 nmdc:mga0n895_113337_c1_1043_1345 100
1053 3300050512 nmdc:mga0n895_13174_c1 nmdc:mga0n895_13174_c1_2605_2907 100
1054 3300050512 nmdc:mga0n895_1607549_c1 nmdc:mga0n895_1607549_c1_109_411 100
1055 3300050512 nmdc:mga0n895_176532_c1 nmdc:mga0n895_176532_c1_1420_1722 100
1056 3300050512 nmdc:mga0n895_23506_c1 nmdc:mga0n895_23506_c1_5011_5313 100
1057 3300050512 nmdc:mga0n895_334878_c1 nmdc:mga0n895_334878_c1_1036_1338 100
1058 3300050512 nmdc:mga0n895_37953_c1 nmdc:mga0n895_37953_c1_3430_3732 100
1059 3300050512 nmdc:mga0n895_55203_c1 nmdc:mga0n895_55203_c1_1003_1305 100
1060 3300050512 nmdc:mga0n895_763631_c1 nmdc:mga0n895_763631_c1_122_424 100
1061 3300050513 nmdc:mga0rr50_1011122_c1 nmdc:mga0rr50_1011122_c1_184_486 100
1062 3300050513 nmdc:mga0rr50_111659_c1 nmdc:mga0rr50_111659_c1_253_555 100
1063 3300050513 nmdc:mga0rr50_1466745_c1 nmdc:mga0rr50_1466745_c1_60_362 100
1064 3300050513 nmdc:mga0rr50_345131_c1 nmdc:mga0rr50_345131_c1_170_472 100
1065 3300050513 nmdc:mga0rr50_615268_c1 nmdc:mga0rr50_615268_c1_599_901 100
1066 3300050513 nmdc:mga0rr50_74018_c1 nmdc:mga0rr50_74018_c1_1055_1357 100
1067 3300050515 nmdc:mga0a205_1393380_c1 nmdc:mga0a205_1393380_c1_184_486 100
1068 3300050515 nmdc:mga0a205_1514780_c1 nmdc:mga0a205_1514780_c1_113_415 100
1069 3300050515 nmdc:mga0a205_170121_c1 nmdc:mga0a205_170121_c1_101_403 100
1070 3300050515 nmdc:mga0a205_1825_c2 nmdc:mga0a205_1825_c2_11913_12215 100
1071 3300050515 nmdc:mga0a205_186754_c1 nmdc:mga0a205_186754_c1_1384_1686 100
1072 3300050515 nmdc:mga0a205_3581_c1 nmdc:mga0a205_3581_c1_12601_12903 100
1073 3300050515 nmdc:mga0a205_968536_c1 nmdc:mga0a205_968536_c1_221_523 100
1074 3300053103 Ga0500555_121089 Ga0500555_121089_159_461 100
1075 3300060353 Ga0501082_0167734 Ga0501082_0167734_561_869 100

Feature Viewer

pLDDT pTM Quality
78.54 0.36 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map