F489502

General Info

Members Datasets Scaffolds Average Seq Length
1072 341 1072 89

Family's Representative Sequence

Representative Sequence 3300005364|Ga0070673_101341274|Ga0070673_1013412741
Length 103
Sequence VQLARVIGDVVATVKDPRLDGHKLLILQPITPDPEPRPVGRTLIAIDSTGAGVGEYVFFVRGREASFPFLPVETPVDACVIGIIDHWDLEPGAGSLQPGAPSL

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
181 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
190 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
196 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
197 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
198 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
199 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
200 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
201 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
202 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
203 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
204 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
205 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
206 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
207 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
208 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
209 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
215 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
216 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
217 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
218 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
219 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
220 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
221 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
222 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
223 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
224 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
225 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
226 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
227 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
228 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
229 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
230 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
231 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
232 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
233 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
234 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
235 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
236 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
237 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
238 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
239 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
240 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
241 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
242 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
243 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
244 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
245 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
246 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
247 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
248 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
249 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
250 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
251 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
252 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
253 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
254 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
255 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
256 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
257 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
258 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
259 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
260 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
261 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
262 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
263 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
264 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
265 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
266 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
267 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
268 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
269 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
270 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
275 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
276 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
277 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
278 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
279 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
280 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
281 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
282 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
283 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
284 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
300 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
301 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
302 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
303 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
304 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
305 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
306 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
307 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
308 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
309 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
310 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
311 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
312 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
313 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
314 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
315 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
318 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
319 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
320 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
321 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
322 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
323 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
324 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
325 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
326 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
327 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
328 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
329 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
330 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
331 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
332 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
333 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
334 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
335 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
336 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
337 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
338 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
339 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
340 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
341 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.91
Metatranscriptomes 0.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.96
Nodule 0
Rhizoplane 6.53
Rhizosphere 90.67
Stem 0
Stem Tuber 0
Unclassified 0.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10138864 3300001991 Unclassified 540
2 JGI24744J21845_10089966 3300002077 Unclassified 563
3 JGI24034J26672_10063540 3300002239 Bacteria 652
4 JGI24751J29686_10047507 3300002459 Bacteria 886
5 Ga0065714_10191579 3300005288 Unclassified 926
6 Ga0065704_10409366 3300005289 Bacteria 743
7 Ga0065712_10000353 3300005290 Bacteria 21043
8 Ga0065712_10085891 3300005290 Bacteria 2667
9 Ga0065712_10193404 3300005290 Bacteria 1138
10 Ga0065712_10245698 3300005290 Bacteria 972
11 Ga0065712_10442568 3300005290 Unclassified 693
12 Ga0065715_10090861 3300005293 Bacteria 6371
13 Ga0065715_10122953 3300005293 Unclassified 2190
14 Ga0065715_10158840 3300005293 Bacteria 1633
15 Ga0065715_10208819 3300005293 Bacteria 1314
16 Ga0065715_10255844 3300005293 Bacteria 1153
17 Ga0065715_10378796 3300005293 Unclassified 910
18 Ga0065715_10422987 3300005293 Bacteria 856
19 Ga0065715_10692944 3300005293 Bacteria 657
20 Ga0065707_10004263 3300005295 Bacteria 3652
21 Ga0065707_10102583 3300005295 Bacteria 2797
22 Ga0070676_10050842 3300005328 Bacteria 2431
23 Ga0070676_10125248 3300005328 Bacteria 1618
24 Ga0070676_10139873 3300005328 Bacteria 1540
25 Ga0070676_10962820 3300005328 Bacteria 639
26 Ga0070683_100001936 3300005329 Bacteria 16209
27 Ga0070683_100049491 3300005329 Bacteria 3888
28 Ga0070690_100063175 3300005330 Unclassified 2389
29 Ga0070690_100114351 3300005330 Bacteria 1804
30 Ga0070690_100313695 3300005330 Bacteria 1128
31 Ga0070690_101154256 3300005330 Unclassified 616
32 Ga0070670_100001546 3300005331 Bacteria 18553
33 Ga0070670_100024170 3300005331 Bacteria 5228
34 Ga0070670_100047682 3300005331 Bacteria 3686
35 Ga0070670_100150277 3300005331 Bacteria 2016
36 Ga0070670_101301605 3300005331 Unclassified 665
37 Ga0070677_10261944 3300005333 Bacteria 863
38 Ga0070677_10341987 3300005333 Bacteria 773
39 Ga0068869_100122062 3300005334 Unclassified 1994
40 Ga0068869_100219783 3300005334 Bacteria 1505
41 Ga0068869_100345015 3300005334 Bacteria 1212
42 Ga0070666_10067969 3300005335 Bacteria 2420
43 Ga0070666_10092137 3300005335 Unclassified 2083
44 Ga0070666_10193636 3300005335 Bacteria 1429
45 Ga0070666_10406124 3300005335 Bacteria 980
46 Ga0070666_11051055 3300005335 Unclassified 605
47 Ga0070682_100172025 3300005337 Bacteria 1506
48 Ga0068868_100095156 3300005338 Unclassified 2404
49 Ga0068868_100132380 3300005338 Bacteria 2041
50 Ga0070660_100096787 3300005339 Bacteria 2335
51 Ga0070660_100661703 3300005339 Bacteria 875
52 Ga0070689_100141077 3300005340 Bacteria 1938
53 Ga0070689_101508873 3300005340 Unclassified 609
54 Ga0070689_102168393 3300005340 Unclassified 509
55 Ga0070687_100030453 3300005343 Bacteria 2638
56 Ga0070687_100052795 3300005343 Unclassified 2111
57 Ga0070687_100917645 3300005343 Unclassified 629
58 Ga0070661_100006579 3300005344 Bacteria 8013
59 Ga0070661_100555592 3300005344 Bacteria 924
60 Ga0070692_10141854 3300005345 Bacteria 1360
61 Ga0070692_11061622 3300005345 Bacteria 570
62 Ga0070692_11192751 3300005345 Bacteria 542
63 Ga0070668_100979764 3300005347 Unclassified 759
64 Ga0070668_101732551 3300005347 Unclassified 574
65 Ga0070668_102006358 3300005347 Unclassified 534
66 Ga0070669_100000166 3300005353 Bacteria 58014
67 Ga0070669_100050963 3300005353 Unclassified 3025
68 Ga0070669_100187620 3300005353 Bacteria 1621
69 Ga0070669_100743340 3300005353 Bacteria 831
70 Ga0070669_101235117 3300005353 Unclassified 646
71 Ga0070669_101913318 3300005353 Bacteria 518
72 Ga0070675_100002899 3300005354 Bacteria 12924
73 Ga0070675_100078452 3300005354 Bacteria 2750
74 Ga0070675_100120981 3300005354 Bacteria 2224
75 Ga0070675_100470081 3300005354 Unclassified 1130
76 Ga0070675_100512164 3300005354 Bacteria 1082
77 Ga0070675_100672619 3300005354 Bacteria 942
78 Ga0070675_100693337 3300005354 Unclassified 927
79 Ga0070675_100955987 3300005354 Unclassified 786
80 Ga0070675_101011476 3300005354 Bacteria 763
81 Ga0070671_100183091 3300005355 Unclassified 1774
82 Ga0070671_100185058 3300005355 Bacteria 1764
83 Ga0070671_100312360 3300005355 Bacteria 1339
84 Ga0070671_101434808 3300005355 Unclassified 610
85 Ga0070674_100011525 3300005356 Bacteria 5387
86 Ga0070674_100097298 3300005356 Bacteria 2137
87 Ga0070674_100126422 3300005356 Bacteria 1900
88 Ga0070674_100588196 3300005356 Bacteria 939
89 Ga0070674_100719633 3300005356 Bacteria 855
90 Ga0070674_100770303 3300005356 Bacteria 828
91 Ga0070674_101555351 3300005356 Bacteria 595
92 Ga0070673_100002561 3300005364 Bacteria 11095
93 Ga0070673_101341274 3300005364 Bacteria 672
94 Ga0070673_101513306 3300005364 Unclassified 633
95 Ga0070673_101597864 3300005364 Bacteria 616
96 Ga0070673_102322210 3300005364 Bacteria 510
97 Ga0070688_100014815 3300005365 Bacteria 4424
98 Ga0070688_100208852 3300005365 Bacteria 1370
99 Ga0070688_100305285 3300005365 Unclassified 1151
100 Ga0070688_101514940 3300005365 Unclassified 546
101 Ga0070659_100168933 3300005366 Bacteria 1791
102 Ga0070659_100354644 3300005366 Bacteria 1231
103 Ga0070659_100852790 3300005366 Bacteria 794
104 Ga0070659_101167960 3300005366 Bacteria 680
105 Ga0070659_101856936 3300005366 Unclassified 540
106 Ga0070667_100048804 3300005367 Unclassified 3564
107 Ga0070667_100963734 3300005367 Unclassified 795
108 Ga0070667_102138147 3300005367 Bacteria 527
109 Ga0070713_100386032 3300005436 Unclassified 1305
110 Ga0070701_10003736 3300005438 Bacteria 6077
111 Ga0070701_10909765 3300005438 Bacteria 608
112 Ga0070711_100902157 3300005439 Unclassified 754
113 Ga0070711_101536326 3300005439 Bacteria 581
114 Ga0070705_100600092 3300005440 Unclassified 851
115 Ga0070705_101075107 3300005440 Bacteria 657
116 Ga0070700_100630669 3300005441 Unclassified 844
117 Ga0070700_100944530 3300005441 Unclassified 705
118 Ga0070700_101143879 3300005441 Unclassified 647
119 Ga0070694_100896708 3300005444 Unclassified 732
120 Ga0070694_100991037 3300005444 Bacteria 697
121 Ga0070663_100170260 3300005455 Unclassified 1683
122 Ga0070663_100388748 3300005455 Bacteria 1138
123 Ga0070663_100390052 3300005455 Bacteria 1136
124 Ga0070663_100448748 3300005455 Bacteria 1063
125 Ga0070678_100122387 3300005456 Unclassified 2054
126 Ga0070678_100145886 3300005456 Bacteria 1900
127 Ga0070678_100256343 3300005456 Unclassified 1469
128 Ga0070678_100415177 3300005456 Bacteria 1172
129 Ga0070678_100736357 3300005456 Bacteria 891
130 Ga0070678_101106059 3300005456 Bacteria 732
131 Ga0070678_101442012 3300005456 Unclassified 643
132 Ga0070662_100040943 3300005457 Bacteria 3302
133 Ga0070662_100158979 3300005457 Unclassified 1766
134 Ga0070662_100680803 3300005457 Bacteria 869
135 Ga0070681_10108734 3300005458 Bacteria 2713
136 Ga0070681_11908863 3300005458 Unclassified 521
137 Ga0068867_100011928 3300005459 Bacteria 6139
138 Ga0068867_100085366 3300005459 Bacteria 2386
139 Ga0068867_100592081 3300005459 Bacteria 966
140 Ga0070685_10003988 3300005466 Bacteria 7458
141 Ga0070685_11523048 3300005466 Bacteria 516
142 Ga0070706_100634444 3300005467 Bacteria 992
143 Ga0070706_100794605 3300005467 Bacteria 876
144 Ga0070707_100931109 3300005468 Bacteria 834
145 Ga0070707_101659703 3300005468 Bacteria 606
146 Ga0070698_100340178 3300005471 Bacteria 1432
147 Ga0070698_101119969 3300005471 Bacteria 736
148 Ga0070698_101503986 3300005471 Bacteria 625
149 Ga0070698_101620173 3300005471 Unclassified 599
150 Ga0074259_10932921 3300005507 Unclassified 509
151 Ga0070699_100951258 3300005518 Bacteria 787
152 Ga0070699_101491838 3300005518 Bacteria 620
153 Ga0070684_100000291 3300005535 Bacteria 34899
154 Ga0070684_100722382 3300005535 Bacteria 929
155 Ga0068853_100824579 3300005539 Unclassified 889
156 Ga0068853_101443326 3300005539 Unclassified 666
157 Ga0068853_102293707 3300005539 Bacteria 523
158 Ga0068853_102352289 3300005539 Unclassified 516
159 Ga0070672_100019443 3300005543 Bacteria 4929
160 Ga0070672_100021908 3300005543 Bacteria 4683
161 Ga0070672_100118152 3300005543 Bacteria 2168
162 Ga0070672_100232545 3300005543 Bacteria 1549
163 Ga0070672_101240170 3300005543 Unclassified 665
164 Ga0070686_100033623 3300005544 Bacteria 3152
165 Ga0070686_100306200 3300005544 Unclassified 1180
166 Ga0070686_101057707 3300005544 Bacteria 668
167 Ga0070696_100295643 3300005546 Bacteria 1239
168 Ga0070696_100483150 3300005546 Bacteria 983
169 Ga0070696_100721736 3300005546 Bacteria 814
170 Ga0070693_101016747 3300005547 Bacteria 628
171 Ga0070693_101049058 3300005547 Bacteria 619
172 Ga0070665_100010087 3300005548 Bacteria 9559
173 Ga0070665_100022622 3300005548 Bacteria 6329
174 Ga0070665_100248210 3300005548 Bacteria 1780
175 Ga0070665_100250519 3300005548 Bacteria 1772
176 Ga0070665_100476735 3300005548 Bacteria 1258
177 Ga0070665_100483781 3300005548 Bacteria 1249
178 Ga0070665_100801899 3300005548 Unclassified 955
179 Ga0070665_101085551 3300005548 Bacteria 812
180 Ga0070704_100071794 3300005549 Bacteria 2516
181 Ga0070704_100175306 3300005549 Bacteria 1710
182 Ga0070704_100277876 3300005549 Bacteria 1386
183 Ga0070704_100544980 3300005549 Bacteria 1013
184 Ga0070704_100917012 3300005549 Unclassified 789
185 Ga0070704_101040332 3300005549 Bacteria 742
186 Ga0068855_100929771 3300005563 Bacteria 917
187 Ga0068855_101573479 3300005563 Bacteria 673
188 Ga0070664_100003002 3300005564 Bacteria 13648
189 Ga0070664_100142540 3300005564 Unclassified 2111
190 Ga0070664_100335665 3300005564 Unclassified 1372
191 Ga0070664_100710477 3300005564 Bacteria 937
192 Ga0070664_101806239 3300005564 Bacteria 580
193 Ga0070664_102143281 3300005564 Unclassified 530
194 Ga0068854_100099848 3300005578 Bacteria 2174
195 Ga0068854_100436159 3300005578 Bacteria 1091
196 Ga0068854_100549707 3300005578 Unclassified 979
197 Ga0068854_101246943 3300005578 Unclassified 668
198 Ga0068856_100062149 3300005614 Bacteria 3689
199 Ga0068856_101189163 3300005614 Unclassified 779
200 Ga0068856_101588804 3300005614 Unclassified 667
201 Ga0070702_100149497 3300005615 Bacteria 1497
202 Ga0070702_100377258 3300005615 Bacteria 1007
203 Ga0070702_100659878 3300005615 Bacteria 792
204 Ga0068852_100078194 3300005616 Bacteria 2926
205 Ga0068852_100111289 3300005616 Unclassified 2490
206 Ga0068852_100223280 3300005616 Bacteria 1793
207 Ga0068852_100920448 3300005616 Bacteria 892
208 Ga0068852_102667994 3300005616 Bacteria 519
209 Ga0068859_100003822 3300005617 Bacteria 15377
210 Ga0068859_100644005 3300005617 Unclassified 1152
211 Ga0068864_100028940 3300005618 Unclassified 4687
212 Ga0068864_100732842 3300005618 Bacteria 968
213 Ga0068864_100922272 3300005618 Unclassified 863
214 Ga0068864_101172838 3300005618 Unclassified 766
215 Ga0068864_101462168 3300005618 Bacteria 686
216 Ga0068866_10044883 3300005718 Bacteria 2214
217 Ga0068866_10599907 3300005718 Bacteria 743
218 Ga0068861_100105876 3300005719 Unclassified 2246
219 Ga0068861_100372418 3300005719 Bacteria 1259
220 Ga0068861_100479695 3300005719 Bacteria 1120
221 Ga0068861_101872619 3300005719 Unclassified 596
222 Ga0068861_102129904 3300005719 Bacteria 561
223 Ga0068851_10247991 3300005834 Bacteria 1009
224 Ga0068851_10890393 3300005834 Bacteria 557
225 Ga0068870_10156858 3300005840 Bacteria 1346
226 Ga0068863_100011808 3300005841 Bacteria 8443
227 Ga0068863_100080513 3300005841 Bacteria 3085
228 Ga0068863_100276921 3300005841 Unclassified 1625
229 Ga0068863_101011481 3300005841 Bacteria 834
230 Ga0068863_102019482 3300005841 Bacteria 587
231 Ga0068858_100425073 3300005842 Bacteria 1278
232 Ga0068858_100567704 3300005842 Bacteria 1099
233 Ga0068858_100959293 3300005842 Bacteria 837
234 Ga0068858_102026130 3300005842 Bacteria 569
235 Ga0068860_100153064 3300005843 Bacteria 2221
236 Ga0068860_100656848 3300005843 Bacteria 1057
237 Ga0068862_100026965 3300005844 Bacteria 4832
238 Ga0068862_100053947 3300005844 Bacteria 3442
239 Ga0068862_100087875 3300005844 Unclassified 2703
240 Ga0068862_100706697 3300005844 Unclassified 977
241 Ga0068862_100723461 3300005844 Bacteria 966
242 Ga0068862_100812019 3300005844 Unclassified 914
243 Ga0068862_101272499 3300005844 Bacteria 736
244 Ga0068862_101415778 3300005844 Unclassified 699
245 Ga0068862_101667013 3300005844 Unclassified 645
246 Ga0070717_10284219 3300006028 Unclassified 1468
247 Ga0075365_10000562 3300006038 Bacteria 14387
248 Ga0075365_11091067 3300006038 Unclassified 562
249 Ga0075368_10053538 3300006042 Bacteria 1607
250 Ga0075364_10004066 3300006051 Bacteria 8395
251 Ga0075364_10005645 3300006051 Bacteria 7292
252 Ga0075364_10252862 3300006051 Bacteria 1198
253 Ga0075432_10453801 3300006058 Unclassified 563
254 Ga0070716_100479436 3300006173 Bacteria 913
255 Ga0075362_10105944 3300006177 Bacteria 1319
256 Ga0075367_10033063 3300006178 Bacteria 2979
257 Ga0075366_10000965 3300006195 Bacteria 14034
258 Ga0075366_10470540 3300006195 Bacteria 776
259 Ga0075366_10531682 3300006195 Bacteria 728
260 Ga0097621_100037514 3300006237 Bacteria 3884
261 Ga0097621_101063255 3300006237 Unclassified 759
262 Ga0068871_100045078 3300006358 Bacteria 3548
263 Ga0068871_100213392 3300006358 Unclassified 1670
264 Ga0068871_100223288 3300006358 Unclassified 1633
265 Ga0068871_100819182 3300006358 Bacteria 859
266 Ga0068871_101205864 3300006358 Unclassified 710
267 Ga0068871_101426741 3300006358 Unclassified 653
268 Ga0075428_100002190 3300006844 Bacteria 21137
269 Ga0075428_100730850 3300006844 Unclassified 1054
270 Ga0075428_100807477 3300006844 Unclassified 997
271 Ga0075428_101100872 3300006844 Bacteria 839
272 Ga0075430_100006051 3300006846 Bacteria 10198
273 Ga0075430_100019324 3300006846 Bacteria 5792
274 Ga0075430_101613232 3300006846 Bacteria 533
275 Ga0075431_100014795 3300006847 Bacteria 7898
276 Ga0075431_100118506 3300006847 Bacteria 2731
277 Ga0075431_100435891 3300006847 Bacteria 1308
278 Ga0075433_10031686 3300006852 Bacteria 4521
279 Ga0075433_10032746 3300006852 Bacteria 4454
280 Ga0075433_10058944 3300006852 Bacteria 3359
281 Ga0075433_10088645 3300006852 Bacteria 2734
282 Ga0075433_11730977 3300006852 Unclassified 538
283 Ga0075434_100004927 3300006871 Bacteria 12099
284 Ga0075434_100023434 3300006871 Bacteria 6016
285 Ga0075434_100195972 3300006871 Bacteria 2040
286 Ga0075434_100567873 3300006871 Unclassified 1154
287 Ga0075429_100214588 3300006880 Bacteria 1686
288 Ga0075429_100229844 3300006880 Bacteria 1625
289 Ga0068865_100423063 3300006881 Unclassified 1096
290 Ga0068865_100645482 3300006881 Bacteria 899
291 Ga0068865_101667383 3300006881 Bacteria 574
292 Ga0068865_101782309 3300006881 Unclassified 556
293 Ga0068865_102000795 3300006881 Unclassified 526
294 Ga0075436_100306906 3300006914 Unclassified 1138
295 Ga0075436_100429528 3300006914 Bacteria 960
296 Ga0097620_100003822 3300006931 Bacteria 15377
297 Ga0097620_100644013 3300006931 Unclassified 1152
298 Ga0075435_100006365 3300007076 Bacteria 8345
299 Ga0075435_100015028 3300007076 Bacteria 5809
300 Ga0075435_100272534 3300007076 Bacteria 1444
301 Ga0075435_100279837 3300007076 Bacteria 1424
302 Ga0105240_10195813 3300009093 Bacteria 2373
303 Ga0105240_10302364 3300009093 Bacteria 1830
304 Ga0105240_11641437 3300009093 Bacteria 672
305 Ga0105240_12076160 3300009093 Bacteria 590
306 Ga0111539_10001892 3300009094 Bacteria 27846
307 Ga0111539_10024552 3300009094 Bacteria 7393
308 Ga0111539_10140000 3300009094 Bacteria 2833
309 Ga0111539_10173669 3300009094 Unclassified 2518
310 Ga0111539_10460819 3300009094 Bacteria 1480
311 Ga0111539_10730386 3300009094 Bacteria 1153
312 Ga0111539_11547838 3300009094 Unclassified 769
313 Ga0111539_11984297 3300009094 Bacteria 675
314 Ga0111539_13090895 3300009094 Bacteria 537
315 Ga0111539_13447851 3300009094 Bacteria 508
316 Ga0105245_10374069 3300009098 Unclassified 1417
317 Ga0105245_11597005 3300009098 Unclassified 704
318 Ga0105247_10100266 3300009101 Bacteria 1851
319 Ga0105247_10359334 3300009101 Bacteria 1026
320 Ga0114129_10002861 3300009147 Bacteria 24137
321 Ga0114129_10004267 3300009147 Bacteria 20199
322 Ga0114129_10007233 3300009147 Bacteria 15803
323 Ga0114129_10155007 3300009147 Bacteria 3133
324 Ga0114129_10188247 3300009147 Bacteria 2804
325 Ga0114129_11936848 3300009147 Bacteria 714
326 Ga0114129_12298525 3300009147 Bacteria 647
327 Ga0105243_10110197 3300009148 Bacteria 2301
328 Ga0105243_11841527 3300009148 Bacteria 637
329 Ga0105241_10221699 3300009174 Bacteria 1590
330 Ga0105242_10031143 3300009176 Bacteria 4258
331 Ga0105242_10071788 3300009176 Unclassified 2874
332 Ga0105242_10097671 3300009176 Bacteria 2483
333 Ga0105242_10873422 3300009176 Bacteria 897
334 Ga0105242_13148114 3300009176 Bacteria 512
335 Ga0105248_10026313 3300009177 Bacteria 6472
336 Ga0105248_10054044 3300009177 Bacteria 4504
337 Ga0105248_10058976 3300009177 Bacteria 4311
338 Ga0105248_10059861 3300009177 Unclassified 4278
339 Ga0105248_10178054 3300009177 Bacteria 2396
340 Ga0105248_11490066 3300009177 Bacteria 766
341 Ga0105248_11824620 3300009177 Bacteria 690
342 Ga0105248_11901247 3300009177 Unclassified 675
343 Ga0105248_12086345 3300009177 Unclassified 644
344 Ga0105248_13388069 3300009177 Unclassified 506
345 Ga0105238_10136346 3300009551 Bacteria 2432
346 Ga0105238_10382426 3300009551 Bacteria 1399
347 Ga0105238_11569608 3300009551 Archaea 688
348 Ga0105249_10001254 3300009553 Bacteria 22246
349 Ga0105249_10005766 3300009553 Bacteria 10712
350 Ga0105249_10080278 3300009553 Bacteria 3030
351 Ga0105249_10791467 3300009553 Bacteria 1012
352 Ga0105239_10140364 3300010375 Unclassified 2692
353 Ga0105239_10296047 3300010375 Bacteria 1822
354 Ga0105246_10647265 3300011119 Bacteria 920
355 Ga0105246_10809966 3300011119 Unclassified 832
356 Ga0105246_11047866 3300011119 Unclassified 741
357 Ga0157369_10085696 3300013105 Bacteria 3366
358 Ga0157369_10753118 3300013105 Bacteria 1002
359 Ga0157374_10076825 3300013296 Bacteria 3158
360 Ga0157374_10313768 3300013296 Bacteria 1553
361 Ga0157374_11056116 3300013296 Bacteria 832
362 Ga0157378_10899471 3300013297 Bacteria 916
363 Ga0157378_10972425 3300013297 Unclassified 882
364 Ga0157378_11134919 3300013297 Bacteria 819
365 Ga0157378_11189019 3300013297 Bacteria 802
366 Ga0157378_11506415 3300013297 Bacteria 717
367 Ga0157378_12540327 3300013297 Unclassified 564
368 Ga0157378_13011974 3300013297 Bacteria 523
369 Ga0163162_10048642 3300013306 Bacteria 4249
370 Ga0163162_10144922 3300013306 Bacteria 2490
371 Ga0163162_10421010 3300013306 Bacteria 1468
372 Ga0163162_11700818 3300013306 Unclassified 720
373 Ga0157372_10225441 3300013307 Bacteria 2173
374 Ga0157372_11058298 3300013307 Bacteria 939
375 Ga0157375_10152246 3300013308 Unclassified 2449
376 Ga0157375_10208129 3300013308 Bacteria 2113
377 Ga0157375_10259698 3300013308 Bacteria 1899
378 Ga0157375_10835267 3300013308 Unclassified 1068
379 Ga0157375_12002510 3300013308 Unclassified 688
380 Ga0157375_13404568 3300013308 Bacteria 530
381 Ga0163163_10059827 3300014325 Bacteria 3770
382 Ga0163163_10137123 3300014325 Unclassified 2488
383 Ga0163163_10137638 3300014325 Bacteria 2483
384 Ga0163163_10187170 3300014325 Unclassified 2118
385 Ga0163163_10868487 3300014325 Bacteria 965
386 Ga0163163_12296948 3300014325 Unclassified 598
387 Ga0163163_12641817 3300014325 Bacteria 559
388 Ga0157380_10097792 3300014326 Bacteria 2437
389 Ga0157380_10143224 3300014326 Bacteria 2056
390 Ga0157380_10225108 3300014326 Bacteria 1681
391 Ga0157380_10848854 3300014326 Unclassified 935
392 Ga0157380_10874255 3300014326 Bacteria 923
393 Ga0157380_10874444 3300014326 Bacteria 923
394 Ga0157380_11520023 3300014326 Bacteria 723
395 Ga0157380_11634596 3300014326 Bacteria 700
396 Ga0157380_11740667 3300014326 Bacteria 681
397 Ga0157380_13167981 3300014326 Unclassified 525
398 Ga0157379_10216935 3300014968 Bacteria 1733
399 Ga0157379_10385819 3300014968 Bacteria 1286
400 Ga0157379_10726632 3300014968 Bacteria 933
401 Ga0157376_10009699 3300014969 Bacteria 7007
402 Ga0157376_10029717 3300014969 Unclassified 4356
403 Ga0157376_10224087 3300014969 Unclassified 1743
404 Ga0157376_10435551 3300014969 Bacteria 1275
405 Ga0157376_11815180 3300014969 Unclassified 646
406 Ga0157376_11931565 3300014969 Bacteria 627
407 Ga0163161_10861593 3300017792 Bacteria 765
408 Ga0206353_10674301 3300020082 Bacteria 535
409 Ga0213876_10119947 3300021384 Bacteria 1396
410 Ga0207666_1076982 3300025271 Unclassified 538
411 Ga0207697_10000772 3300025315 Bacteria 18141
412 Ga0207656_10269417 3300025321 Bacteria 838
413 Ga0207656_10664497 3300025321 Bacteria 533
414 Ga0207682_10212584 3300025893 Bacteria 892
415 Ga0207682_10404771 3300025893 Bacteria 645
416 Ga0207682_10492726 3300025893 Bacteria 580
417 Ga0207642_10196629 3300025899 Bacteria 1111
418 Ga0207642_10483927 3300025899 Bacteria 755
419 Ga0207710_10377925 3300025900 Bacteria 725
420 Ga0207688_10002773 3300025901 Bacteria 9498
421 Ga0207688_10165611 3300025901 Bacteria 1312
422 Ga0207680_10052607 3300025903 Bacteria 2441
423 Ga0207680_10075968 3300025903 Unclassified 2097
424 Ga0207680_10287234 3300025903 Bacteria 1144
425 Ga0207647_10116664 3300025904 Bacteria 1576
426 Ga0207647_10609017 3300025904 Bacteria 602
427 Ga0207647_10610010 3300025904 Bacteria 601
428 Ga0207645_10937110 3300025907 Unclassified 588
429 Ga0207643_10182357 3300025908 Bacteria 1271
430 Ga0207684_10364960 3300025910 Bacteria 1243
431 Ga0207684_10438502 3300025910 Bacteria 1122
432 Ga0207684_10778491 3300025910 Bacteria 810
433 Ga0207707_10677920 3300025912 Bacteria 867
434 Ga0207707_11113714 3300025912 Bacteria 643
435 Ga0207695_10125684 3300025913 Bacteria 2527
436 Ga0207663_10558001 3300025916 Unclassified 896
437 Ga0207660_10638366 3300025917 Bacteria 868
438 Ga0207662_10002361 3300025918 Bacteria 9462
439 Ga0207662_10061797 3300025918 Unclassified 2250
440 Ga0207662_10938226 3300025918 Unclassified 613
441 Ga0207657_10201517 3300025919 Bacteria 1600
442 Ga0207649_10003342 3300025920 Bacteria 8775
443 Ga0207649_10304409 3300025920 Unclassified 1166
444 Ga0207649_10367202 3300025920 Bacteria 1069
445 Ga0207681_10022832 3300025923 Bacteria 3994
446 Ga0207681_10088153 3300025923 Unclassified 2209
447 Ga0207681_10220674 3300025923 Bacteria 1466
448 Ga0207681_10328906 3300025923 Bacteria 1218
449 Ga0207694_10370275 3300025924 Bacteria 1188
450 Ga0207694_10882807 3300025924 Unclassified 756
451 Ga0207694_11071375 3300025924 Bacteria 682
452 Ga0207650_10010455 3300025925 Bacteria 6361
453 Ga0207650_10022308 3300025925 Bacteria 4479
454 Ga0207650_10064504 3300025925 Bacteria 2742
455 Ga0207650_10160269 3300025925 Bacteria 1782
456 Ga0207650_10207722 3300025925 Bacteria 1571
457 Ga0207650_10539789 3300025925 Bacteria 977
458 Ga0207659_10078671 3300025926 Unclassified 2430
459 Ga0207659_10096263 3300025926 Bacteria 2222
460 Ga0207659_10384772 3300025926 Bacteria 1170
461 Ga0207659_10406365 3300025926 Bacteria 1140
462 Ga0207659_10533713 3300025926 Bacteria 996
463 Ga0207659_10940076 3300025926 Unclassified 743
464 Ga0207687_10060991 3300025927 Bacteria 2662
465 Ga0207687_10188748 3300025927 Bacteria 1602
466 Ga0207687_10440398 3300025927 Bacteria 1079
467 Ga0207700_10349793 3300025928 Unclassified 1287
468 Ga0207644_10089495 3300025931 Bacteria 2291
469 Ga0207644_10154648 3300025931 Bacteria 1777
470 Ga0207644_10172039 3300025931 Unclassified 1692
471 Ga0207690_10254468 3300025932 Bacteria 1358
472 Ga0207690_10271928 3300025932 Bacteria 1317
473 Ga0207690_10736624 3300025932 Bacteria 812
474 Ga0207690_11251775 3300025932 Bacteria 620
475 Ga0207706_10036735 3300025933 Bacteria 4351
476 Ga0207706_10085694 3300025933 Bacteria 2770
477 Ga0207706_10181333 3300025933 Unclassified 1849
478 Ga0207706_10547227 3300025933 Bacteria 997
479 Ga0207706_10822047 3300025933 Bacteria 788
480 Ga0207706_10863325 3300025933 Bacteria 766
481 Ga0207686_10040704 3300025934 Bacteria 2827
482 Ga0207686_10064654 3300025934 Bacteria 2330
483 Ga0207686_11714098 3300025934 Unclassified 520
484 Ga0207709_10059748 3300025935 Bacteria 2374
485 Ga0207709_10187417 3300025935 Bacteria 1466
486 Ga0207709_10938905 3300025935 Unclassified 705
487 Ga0207670_10063237 3300025936 Bacteria 2531
488 Ga0207670_10872255 3300025936 Unclassified 753
489 Ga0207670_11205493 3300025936 Bacteria 641
490 Ga0207669_10045755 3300025937 Unclassified 2581
491 Ga0207669_10077387 3300025937 Bacteria 2115
492 Ga0207669_10462811 3300025937 Bacteria 1007
493 Ga0207669_10593369 3300025937 Bacteria 899
494 Ga0207669_10681576 3300025937 Bacteria 843
495 Ga0207669_11662304 3300025937 Bacteria 545
496 Ga0207704_10048697 3300025938 Unclassified 2543
497 Ga0207704_10113482 3300025938 Bacteria 1837
498 Ga0207704_10234030 3300025938 Bacteria 1368
499 Ga0207704_11334434 3300025938 Unclassified 614
500 Ga0207691_10021474 3300025940 Bacteria 6095
501 Ga0207691_10053749 3300025940 Bacteria 3676
502 Ga0207691_10148042 3300025940 Bacteria 2066
503 Ga0207691_10192644 3300025940 Bacteria 1777
504 Ga0207691_10601706 3300025940 Bacteria 931
505 Ga0207711_10018265 3300025941 Bacteria 5829
506 Ga0207711_10144641 3300025941 Unclassified 2141
507 Ga0207711_10144777 3300025941 Unclassified 2140
508 Ga0207711_10330700 3300025941 Bacteria 1409
509 Ga0207711_10624986 3300025941 Bacteria 1005
510 Ga0207711_11417222 3300025941 Bacteria 637
511 Ga0207711_11774495 3300025941 Bacteria 560
512 Ga0207711_12075604 3300025941 Bacteria 511
513 Ga0207689_10074129 3300025942 Bacteria 2797
514 Ga0207689_10127286 3300025942 Bacteria 2095
515 Ga0207689_10960749 3300025942 Bacteria 721
516 Ga0207661_10001428 3300025944 Bacteria 16108
517 Ga0207661_10012308 3300025944 Bacteria 6215
518 Ga0207679_10002083 3300025945 Bacteria 12410
519 Ga0207679_10041983 3300025945 Bacteria 3284
520 Ga0207679_10233106 3300025945 Bacteria 1556
521 Ga0207679_10368845 3300025945 Bacteria 1256
522 Ga0207679_11478069 3300025945 Bacteria 623
523 Ga0207667_10756568 3300025949 Bacteria 971
524 Ga0207651_10001330 3300025960 Bacteria 11158
525 Ga0207651_10597674 3300025960 Bacteria 964
526 Ga0207651_10726985 3300025960 Bacteria 876
527 Ga0207651_11188574 3300025960 Bacteria 685
528 Ga0207651_11933639 3300025960 Bacteria 530
529 Ga0207712_10011937 3300025961 Bacteria 5540
530 Ga0207712_10078458 3300025961 Bacteria 2396
531 Ga0207712_10652875 3300025961 Bacteria 914
532 Ga0207712_10666017 3300025961 Bacteria 906
533 Ga0207712_11257449 3300025961 Unclassified 661
534 Ga0207712_11336061 3300025961 Bacteria 641
535 Ga0207712_11391467 3300025961 Unclassified 628
536 Ga0207668_10321528 3300025972 Bacteria 1284
537 Ga0207668_10721926 3300025972 Bacteria 877
538 Ga0207668_11915835 3300025972 Bacteria 534
539 Ga0207668_12081120 3300025972 Unclassified 511
540 Ga0207640_10225562 3300025981 Unclassified 1437
541 Ga0207640_10565627 3300025981 Bacteria 957
542 Ga0207640_10678815 3300025981 Bacteria 881
543 Ga0207640_10970716 3300025981 Bacteria 746
544 Ga0207658_10111366 3300025986 Bacteria 2165
545 Ga0207658_10520384 3300025986 Bacteria 1062
546 Ga0207658_11896125 3300025986 Unclassified 543
547 Ga0207677_10013411 3300026023 Bacteria 4749
548 Ga0207677_10236423 3300026023 Bacteria 1475
549 Ga0207677_10247294 3300026023 Bacteria 1446
550 Ga0207677_10413697 3300026023 Bacteria 1147
551 Ga0207703_10343359 3300026035 Bacteria 1373
552 Ga0207703_10421748 3300026035 Bacteria 1242
553 Ga0207703_10522849 3300026035 Bacteria 1116
554 Ga0207639_10394324 3300026041 Bacteria 1246
555 Ga0207639_10686133 3300026041 Bacteria 949
556 Ga0207639_10954421 3300026041 Bacteria 802
557 Ga0207678_10062158 3300026067 Bacteria 3211
558 Ga0207678_10066402 3300026067 Bacteria 3098
559 Ga0207678_10402467 3300026067 Bacteria 1185
560 Ga0207708_10001093 3300026075 Bacteria 20328
561 Ga0207708_10455269 3300026075 Bacteria 1066
562 Ga0207708_10511461 3300026075 Bacteria 1008
563 Ga0207708_11448935 3300026075 Bacteria 603
564 Ga0207708_11637692 3300026075 Unclassified 565
565 Ga0207702_10171726 3300026078 Bacteria 1988
566 Ga0207702_10996829 3300026078 Bacteria 831
567 Ga0207641_10014969 3300026088 Bacteria 6359
568 Ga0207641_10064332 3300026088 Bacteria 3135
569 Ga0207641_10200120 3300026088 Bacteria 1841
570 Ga0207641_10206070 3300026088 Bacteria 1816
571 Ga0207641_10361365 3300026088 Bacteria 1386
572 Ga0207641_10735499 3300026088 Bacteria 973
573 Ga0207648_10007485 3300026089 Bacteria 10729
574 Ga0207648_10011911 3300026089 Bacteria 8168
575 Ga0207648_10150231 3300026089 Unclassified 2055
576 Ga0207648_11500138 3300026089 Unclassified 634
577 Ga0207648_11645629 3300026089 Unclassified 603
578 Ga0207648_11790717 3300026089 Bacteria 576
579 Ga0207676_10098053 3300026095 Unclassified 2422
580 Ga0207676_10592018 3300026095 Bacteria 1064
581 Ga0207676_10708581 3300026095 Bacteria 976
582 Ga0207676_10729959 3300026095 Bacteria 962
583 Ga0207676_11104632 3300026095 Unclassified 784
584 Ga0207676_11268119 3300026095 Unclassified 731
585 Ga0207674_11809654 3300026116 Bacteria 578
586 Ga0207675_100153719 3300026118 Unclassified 2192
587 Ga0207675_100564433 3300026118 Bacteria 1138
588 Ga0207675_100621348 3300026118 Bacteria 1085
589 Ga0207675_100713542 3300026118 Bacteria 1012
590 Ga0207675_101030748 3300026118 Bacteria 842
591 Ga0207675_101576150 3300026118 Bacteria 677
592 Ga0207683_10016603 3300026121 Bacteria 6266
593 Ga0207683_10046066 3300026121 Bacteria 3814
594 Ga0207683_10083873 3300026121 Bacteria 2832
595 Ga0207683_10151646 3300026121 Unclassified 2092
596 Ga0207683_10157805 3300026121 Bacteria 2050
597 Ga0207683_10594449 3300026121 Bacteria 1024
598 Ga0207683_10691580 3300026121 Bacteria 945
599 Ga0207683_10950776 3300026121 Bacteria 798
600 Ga0207683_11006305 3300026121 Bacteria 774
601 Ga0207698_10104018 3300026142 Unclassified 2361
602 Ga0207698_10327331 3300026142 Unclassified 1438
603 Ga0207698_10531528 3300026142 Bacteria 1149
604 Ga0207698_10789066 3300026142 Bacteria 951
605 Ga0209983_1066781 3300027665 Unclassified 798
606 Ga0209998_10033825 3300027717 Bacteria 1141
607 Ga0209813_10085216 3300027866 Bacteria 1052
608 Ga0209974_10065162 3300027876 Bacteria 1237
609 Ga0209974_10095280 3300027876 Bacteria 1035
610 Ga0207428_10016103 3300027907 Bacteria 6441
611 Ga0268266_10256241 3300028379 Bacteria 1620
612 Ga0268266_10699476 3300028379 Bacteria 977
613 Ga0268266_10981289 3300028379 Unclassified 817
614 Ga0268266_11030104 3300028379 Bacteria 796
615 Ga0268266_11654958 3300028379 Bacteria 615
616 Ga0268265_10122749 3300028380 Bacteria 2143
617 Ga0268265_10124906 3300028380 Unclassified 2127
618 Ga0268265_10341819 3300028380 Bacteria 1363
619 Ga0268265_10922509 3300028380 Bacteria 859
620 Ga0268265_10937031 3300028380 Unclassified 852
621 Ga0268265_11272228 3300028380 Unclassified 735
622 Ga0268265_11944779 3300028380 Bacteria 595
623 Ga0268265_12267722 3300028380 Bacteria 550
624 Ga0268264_10266278 3300028381 Bacteria 1599
625 Ga0307513_10771604 3300031456 Bacteria 667
626 Ga0307408_100040174 3300031548 Bacteria 3312
627 Ga0307408_100176766 3300031548 Bacteria 1708
628 Ga0307408_100593034 3300031548 Bacteria 983
629 Ga0307405_10557249 3300031731 Bacteria 928
630 Ga0307410_10018152 3300031852 Bacteria 4245
631 Ga0307410_10458030 3300031852 Bacteria 1042
632 Ga0307410_11673589 3300031852 Bacteria 563
633 Ga0307407_10154023 3300031903 Bacteria 1497
634 Ga0307407_10219668 3300031903 Bacteria 1284
635 Ga0307412_10150812 3300031911 Bacteria 1715
636 Ga0307412_10220979 3300031911 Bacteria 1452
637 Ga0307412_11552073 3300031911 Bacteria 603
638 Ga0307409_100030071 3300031995 Bacteria 3897
639 Ga0307409_100089370 3300031995 Bacteria 2518
640 Ga0307409_100173215 3300031995 Bacteria 1902
641 Ga0307409_101483992 3300031995 Bacteria 705
642 Ga0307416_100040357 3300032002 Bacteria 3625
643 Ga0307416_100056201 3300032002 Bacteria 3175
644 Ga0307416_100360816 3300032002 Bacteria 1475
645 Ga0307416_100475328 3300032002 Bacteria 1308
646 Ga0307416_100598913 3300032002 Bacteria 1182
647 Ga0307416_101061513 3300032002 Unclassified 914
648 Ga0307416_101342006 3300032002 Bacteria 821
649 Ga0307416_101572766 3300032002 Bacteria 763
650 Ga0307416_101764404 3300032002 Bacteria 723
651 Ga0307416_103701786 3300032002 Bacteria 512
652 Ga0307411_10081445 3300032005 Bacteria 2229
653 Ga0307411_10319128 3300032005 Bacteria 1254
654 Ga0307411_10512552 3300032005 Unclassified 1016
655 Ga0307411_10981694 3300032005 Bacteria 755
656 Ga0307415_100195976 3300032126 Bacteria 1598
657 Ga0307415_100342065 3300032126 Bacteria 1256
658 Ga0373940_0123896 3300035088 Bacteria 804
659 Ga0373951_0027075 3300035091 Bacteria 1338
660 Ga0373932_0030680 3300035112 Bacteria 1492
661 Ga0373941_0314819 3300035115 Unclassified 628
662 Ga0373945_0305763 3300035116 Bacteria 682
663 Ga0373954_0639826 3300035118 Unclassified 527
664 Ga0373956_0408164 3300035119 Unclassified 648
665 Ga0373943_0121418 3300035170 Bacteria 1389
666 Ga0373943_0229432 3300035170 Unclassified 1037
667 Ga0373946_0144595 3300035171 Bacteria 1105
668 Ga0373955_0191679 3300035172 Bacteria 1215
669 Ga0373942_0073203 3300035207 Bacteria 1004
670 Ga0373961_0111885 3300035241 Bacteria 895
671 Ga0373961_0226756 3300035241 Unclassified 668
672 Ga0373962_0187825 3300035242 Bacteria 694
673 Ga0373931_0092841 3300035691 Bacteria 1685
674 Ga0373931_0592533 3300035691 Unclassified 724
675 Ga0373937_0000651 3300036401 Bacteria 30483
676 Ga0373937_0280691 3300036401 Bacteria 1573
677 Ga0373925_0006513 3300037068 Bacteria 8586
678 Ga0373925_1139757 3300037068 Bacteria 641
679 Ga0395900_0875039 3300037418 Bacteria 823
680 Ga0436365_0113116 3300039437 Bacteria 1636
681 Ga0439439_0086069 3300041406 Bacteria 854
682 Ga0439461_0060476 3300041410 Unclassified 859
683 Ga0451791_1519790 3300041451 Bacteria 601
684 Ga0451793_0108495 3300041452 Unclassified 642
685 Ga0451802_0119544 3300041460 Bacteria 586
686 Ga0451802_0912663 3300041460 Bacteria 733
687 Ga0451804_0779925 3300041463 Bacteria 810
688 Ga0451807_0449784 3300041486 Bacteria 685
689 Ga0451845_0675573 3300041501 Unclassified 661
690 Ga0451853_0170158 3300041512 Bacteria 727
691 Ga0451853_1132466 3300041512 Unclassified 602
692 Ga0451853_1313310 3300041512 Bacteria 620
693 Ga0451853_2018823 3300041512 Bacteria 1263
694 Ga0451853_3998079 3300041512 Bacteria 1226
695 Ga0439433_0021574 3300041999 Bacteria 1441
696 Ga0439433_0051436 3300041999 Bacteria 972
697 Ga0439449_0120317 3300042007 Bacteria 975
698 Ga0439454_056707 3300042011 Bacteria 672
699 Ga0439457_116874 3300042014 Unclassified 629
700 Ga0439462_0091092 3300042015 Bacteria 836
701 Ga0450920_018330 3300042122 Bacteria 1340
702 Ga0450920_044911 3300042122 Bacteria 883
703 Ga0450923_012281 3300042125 Bacteria 1556
704 Ga0450891_019284 3300042129 Unclassified 663
705 Ga0450894_002011 3300042131 Bacteria 2802
706 Ga0450895_005338 3300042132 Bacteria 1034
707 Ga0450896_000284 3300042133 Bacteria 4738
708 Ga0450899_017456 3300042135 Bacteria 826
709 Ga0450905_075900 3300042142 Bacteria 578
710 Ga0450905_083305 3300042142 Unclassified 558
711 Ga0450906_038357 3300042145 Bacteria 845
712 Ga0439446_0013235 3300042156 Bacteria 2262
713 Ga0439446_0107312 3300042156 Unclassified 888
714 Ga0450908_020092 3300042184 Bacteria 1175
715 Ga0439434_0070902 3300042435 Bacteria 1097
716 Ga0439434_0272390 3300042435 Unclassified 582
717 Ga0439435_0040353 3300042436 Bacteria 1304
718 Ga0439460_0028314 3300042461 Bacteria 1580
719 Ga0450916_018446 3300042530 Bacteria 940
720 Ga0450916_065943 3300042530 Unclassified 596
721 Ga0450893_0007133 3300042532 Bacteria 1814
722 Ga0451577_0033978 3300042876 Bacteria 4599
723 Ga0453684_0230994 3300044712 Bacteria 2136
724 Ga0451576_0585839 3300045051 Bacteria 1172
725 Ga0495592_0860683 3300046454 Bacteria 535
726 Ga0495603_0015692 3300046455 Bacteria 4583
727 Ga0495629_0264585 3300046459 Bacteria 1182
728 Ga0495651_0790365 3300046462 Unclassified 586
729 Ga0495653_0016842 3300046463 Bacteria 5948
730 Ga0495582_0584143 3300046473 Unclassified 646
731 Ga0495585_0612910 3300046492 Unclassified 511
732 Ga0495594_0235853 3300046499 Bacteria 1043
733 Ga0495618_0811460 3300046514 Bacteria 544
734 Ga0495630_0924182 3300046517 Unclassified 664
735 Ga0495652_0255448 3300046529 Bacteria 1297
736 Ga0495640_0245015 3300046533 Bacteria 1124
737 Ga0495586_0282431 3300046535 Bacteria 950
738 Ga0495621_0190859 3300046539 Bacteria 821
739 Ga0495667_0114538 3300046559 Bacteria 1742
740 Ga0495634_0579531 3300046642 Bacteria 652
741 Ga0495635_0314122 3300046663 Bacteria 1049
742 Ga0495659_0286459 3300046664 Unclassified 693
743 Ga0495658_0099746 3300046683 Bacteria 1732
744 Ga0495658_0172874 3300046683 Bacteria 1338
745 Ga0495658_0569642 3300046683 Bacteria 725
746 Ga0495658_0801188 3300046683 Unclassified 603
747 Ga0495613_0047197 3300046689 Bacteria 3182
748 Ga0495613_0589545 3300046689 Unclassified 740
749 Ga0495604_0200006 3300047317 Bacteria 1387
750 Ga0495674_0077950 3300047319 Bacteria 2848
751 Ga0495674_0439832 3300047319 Unclassified 1049
752 Ga0495674_0645816 3300047319 Bacteria 835
753 Ga0495674_0802443 3300047319 Bacteria 732
754 Ga0496100_0152608 3300048903 Bacteria 1649
755 Ga0496100_0531087 3300048903 Unclassified 909
756 Ga0496100_0540795 3300048903 Unclassified 900
757 Ga0496101_0025059 3300048904 Bacteria 4135
758 Ga0496101_0468680 3300048904 Bacteria 994
759 Ga0496101_0915932 3300048904 Bacteria 690
760 Ga0496101_0963197 3300048904 Unclassified 671
761 Ga0496102_0166996 3300048905 Unclassified 2071
762 Ga0496102_0560969 3300048905 Bacteria 1065
763 Ga0496102_0702480 3300048905 Bacteria 934
764 Ga0496102_1548139 3300048905 Bacteria 581
765 Ga0496102_1578786 3300048905 Bacteria 575
766 Ga0496103_0213103 3300048906 Bacteria 1242
767 Ga0496104_0000157 3300048907 Bacteria 61755
768 Ga0496104_0042987 3300048907 Bacteria 4243
769 Ga0496104_0086907 3300048907 Unclassified 2986
770 Ga0496104_0404824 3300048907 Bacteria 1277
771 Ga0496105_0593340 3300048908 Bacteria 860
772 Ga0496105_0811839 3300048908 Unclassified 710
773 Ga0496105_0837321 3300048908 Bacteria 697
774 Ga0496106_0111211 3300048909 Bacteria 2133
775 Ga0496106_0349184 3300048909 Unclassified 1188
776 Ga0496106_0443834 3300048909 Bacteria 1042
777 Ga0496106_0506700 3300048909 Unclassified 969
778 Ga0496106_0849733 3300048909 Unclassified 722
779 Ga0496106_0974294 3300048909 Bacteria 668
780 Ga0496107_0078155 3300048910 Bacteria 2411
781 Ga0496107_0135686 3300048910 Unclassified 1818
782 Ga0496107_0361523 3300048910 Bacteria 1080
783 Ga0496107_0742530 3300048910 Bacteria 720
784 Ga0496107_0846301 3300048910 Unclassified 668
785 Ga0496108_0008261 3300048911 Bacteria 8444
786 Ga0496108_0132996 3300048911 Unclassified 2138
787 Ga0496108_0200393 3300048911 Bacteria 1732
788 Ga0496108_0204459 3300048911 Bacteria 1714
789 Ga0496108_0395800 3300048911 Bacteria 1207
790 Ga0496108_0509991 3300048911 Bacteria 1050
791 Ga0496109_0010308 3300048912 Bacteria 7981
792 Ga0496109_0011076 3300048912 Bacteria 7731
793 Ga0496109_0098078 3300048912 Bacteria 2717
794 Ga0496109_0148942 3300048912 Bacteria 2191
795 Ga0496109_0228590 3300048912 Bacteria 1750
796 Ga0496109_0948229 3300048912 Bacteria 798
797 Ga0496109_1087468 3300048912 Bacteria 737
798 Ga0496110_0002759 3300048913 Bacteria 13257
799 Ga0496110_0010807 3300048913 Bacteria 7443
800 Ga0496110_0011106 3300048913 Bacteria 7357
801 Ga0496110_0111841 3300048913 Unclassified 2455
802 Ga0496110_0182747 3300048913 Bacteria 1904
803 Ga0496110_1383736 3300048913 Bacteria 613
804 Ga0496110_1503263 3300048913 Unclassified 583
805 Ga0496111_0013452 3300048914 Bacteria 5570
806 Ga0496111_0065455 3300048914 Bacteria 2638
807 Ga0496111_0118079 3300048914 Bacteria 1958
808 Ga0496111_0510770 3300048914 Bacteria 884
809 Ga0496111_0647055 3300048914 Bacteria 771
810 Ga0496112_0000148 3300048915 Bacteria 44089
811 Ga0496112_0004165 3300048915 Bacteria 12183
812 Ga0496112_0232059 3300048915 Bacteria 1800
813 Ga0496112_0301031 3300048915 Bacteria 1549
814 Ga0496112_0995801 3300048915 Unclassified 758
815 Ga0496113_0103583 3300048916 Unclassified 2207
816 Ga0496114_0027098 3300048917 Bacteria 4693
817 Ga0496114_0444674 3300048917 Unclassified 1148
818 Ga0501031_0108509 3300049568 Bacteria 1812
819 Ga0501031_0110018 3300049568 Bacteria 1799
820 Ga0501031_0243145 3300049568 Bacteria 1170
821 Ga0501032_0094652 3300049569 Bacteria 1980
822 Ga0501032_0601387 3300049569 Unclassified 699
823 Ga0501032_0638444 3300049569 Bacteria 676
824 Ga0501033_0048274 3300049570 Bacteria 3162
825 Ga0501033_0139266 3300049570 Bacteria 1755
826 Ga0501033_0807887 3300049570 Bacteria 634
827 Ga0501033_1071967 3300049570 Bacteria 537
828 Ga0501034_0006113 3300049571 Bacteria 12991
829 Ga0501034_0128066 3300049571 Bacteria 2523
830 Ga0501034_0663665 3300049571 Bacteria 943
831 Ga0501034_1246297 3300049571 Unclassified 621
832 Ga0501036_0021023 3300049572 Bacteria 5480
833 Ga0501036_0175496 3300049572 Bacteria 1804
834 Ga0501036_0177638 3300049572 Bacteria 1793
835 Ga0501036_0214351 3300049572 Bacteria 1617
836 Ga0501036_0395912 3300049572 Bacteria 1152
837 Ga0501036_0728600 3300049572 Bacteria 818
838 Ga0501036_0888572 3300049572 Bacteria 732
839 Ga0501037_0150182 3300049573 Bacteria 1665
840 Ga0501037_0765940 3300049573 Bacteria 639
841 Ga0501038_0026845 3300049574 Bacteria 5127
842 Ga0501038_0065980 3300049574 Bacteria 3083
843 Ga0501038_0229508 3300049574 Bacteria 1478
844 Ga0501038_0557184 3300049574 Bacteria 871
845 Ga0501039_0059409 3300049575 Bacteria 2962
846 Ga0501039_0086565 3300049575 Bacteria 2440
847 Ga0501039_0121123 3300049575 Bacteria 2050
848 Ga0501039_1588473 3300049575 Unclassified 502
849 Ga0501040_0202994 3300049576 Unclassified 1408
850 Ga0501040_0348611 3300049576 Bacteria 1060
851 Ga0501040_0486101 3300049576 Bacteria 890
852 Ga0501040_0616573 3300049576 Bacteria 784
853 Ga0501040_0702329 3300049576 Unclassified 731
854 Ga0501040_0782944 3300049576 Bacteria 690
855 Ga0501041_0082306 3300049577 Bacteria 1983
856 Ga0501041_0155832 3300049577 Bacteria 1427
857 Ga0501041_0602352 3300049577 Bacteria 701
858 Ga0501041_0702693 3300049577 Bacteria 647
859 Ga0501042_0021483 3300049578 Bacteria 4499
860 Ga0501042_0260722 3300049578 Bacteria 1251
861 Ga0501042_0371331 3300049578 Unclassified 1035
862 Ga0501042_0465593 3300049578 Bacteria 917
863 Ga0501042_0500515 3300049578 Bacteria 882
864 Ga0501042_0992274 3300049578 Unclassified 612
865 Ga0501043_0003776 3300049579 Bacteria 12447
866 Ga0501043_0349186 3300049579 Bacteria 1124
867 Ga0501043_0424204 3300049579 Bacteria 1002
868 Ga0501043_0974685 3300049579 Unclassified 605
869 Ga0501043_1235536 3300049579 Bacteria 523
870 Ga0501046_0005320 3300049580 Bacteria 11510
871 Ga0501046_0011536 3300049580 Bacteria 7556
872 Ga0501046_0069357 3300049580 Bacteria 2743
873 Ga0501046_0296786 3300049580 Unclassified 1181
874 Ga0501046_1012268 3300049580 Unclassified 576
875 Ga0501046_1037604 3300049580 Bacteria 568
876 Ga0501047_0001473 3300049581 Bacteria 22948
877 Ga0501047_0051950 3300049581 Bacteria 3961
878 Ga0501047_0096646 3300049581 Bacteria 2832
879 Ga0501047_0156752 3300049581 Bacteria 2150
880 Ga0501047_0440795 3300049581 Unclassified 1132
881 Ga0501048_0151199 3300049582 Bacteria 1642
882 Ga0501048_0156468 3300049582 Bacteria 1612
883 Ga0501048_0685850 3300049582 Bacteria 735
884 Ga0501048_0975704 3300049582 Bacteria 609
885 Ga0501067_0228787 3300049583 Bacteria 1035
886 Ga0501067_0247372 3300049583 Bacteria 992
887 Ga0501067_0407869 3300049583 Unclassified 758
888 Ga0501067_0436425 3300049583 Bacteria 731
889 Ga0501067_0500022 3300049583 Bacteria 680
890 Ga0501068_0006774 3300049584 Bacteria 6331
891 Ga0501068_0620940 3300049584 Bacteria 705
892 Ga0501069_0217962 3300049585 Bacteria 1108
893 Ga0501069_0784561 3300049585 Unclassified 577
894 Ga0501070_0404719 3300049586 Bacteria 1103
895 Ga0501071_0035635 3300049587 Bacteria 3545
896 Ga0501071_0055007 3300049587 Bacteria 2872
897 Ga0501071_0137129 3300049587 Bacteria 1821
898 Ga0501071_0177385 3300049587 Bacteria 1596
899 Ga0501071_1174141 3300049587 Bacteria 593
900 Ga0501072_0018755 3300049588 Bacteria 5335
901 Ga0501072_0040269 3300049588 Bacteria 3669
902 Ga0501072_0264553 3300049588 Bacteria 1369
903 Ga0501072_0346760 3300049588 Bacteria 1179
904 Ga0501072_0347587 3300049588 Bacteria 1177
905 Ga0501072_0529226 3300049588 Unclassified 932
906 Ga0501072_0584751 3300049588 Bacteria 881
907 Ga0501072_0601348 3300049588 Bacteria 867
908 Ga0501072_0837720 3300049588 Bacteria 719
909 Ga0501072_1474436 3300049588 Bacteria 525
910 Ga0501073_0040646 3300049589 Bacteria 3289
911 Ga0501073_0110912 3300049589 Bacteria 1903
912 Ga0501073_0118916 3300049589 Bacteria 1831
913 Ga0501073_0147300 3300049589 Bacteria 1631
914 Ga0501073_0192543 3300049589 Bacteria 1411
915 Ga0501073_0224747 3300049589 Bacteria 1297
916 Ga0501073_0378015 3300049589 Bacteria 978
917 Ga0501073_0383720 3300049589 Bacteria 971
918 Ga0501074_0160395 3300049590 Bacteria 1606
919 Ga0501074_0162251 3300049590 Bacteria 1596
920 Ga0501074_0186184 3300049590 Bacteria 1480
921 Ga0501074_0343411 3300049590 Unclassified 1060
922 Ga0501074_0706996 3300049590 Bacteria 711
923 Ga0501075_0037021 3300049591 Bacteria 3643
924 Ga0501075_0042891 3300049591 Bacteria 3393
925 Ga0501075_0060105 3300049591 Bacteria 2864
926 Ga0501075_0088648 3300049591 Bacteria 2346
927 Ga0501075_0189572 3300049591 Bacteria 1568
928 Ga0501075_0541494 3300049591 Bacteria 888
929 Ga0501076_0005978 3300049592 Bacteria 8786
930 Ga0501076_0056689 3300049592 Bacteria 3110
931 Ga0501076_0086660 3300049592 Bacteria 2517
932 Ga0501076_0089559 3300049592 Bacteria 2474
933 Ga0501076_0241737 3300049592 Bacteria 1477
934 Ga0501076_0252368 3300049592 Unclassified 1444
935 Ga0501076_0323579 3300049592 Bacteria 1265
936 Ga0501076_0452904 3300049592 Bacteria 1057
937 Ga0501076_0775457 3300049592 Unclassified 791
938 Ga0501076_1358166 3300049592 Unclassified 584
939 Ga0501077_0040315 3300049593 Bacteria 2976
940 Ga0501077_0086806 3300049593 Bacteria 1983
941 Ga0501077_0184000 3300049593 Bacteria 1328
942 Ga0501077_0419057 3300049593 Unclassified 856
943 Ga0501077_0574753 3300049593 Bacteria 723
944 Ga0501249_173077 3300049679 Unclassified 554
945 Ga0501079_0054982 3300049741 Bacteria 3071
946 Ga0501079_0058537 3300049741 Bacteria 2973
947 Ga0501079_0103295 3300049741 Bacteria 2211
948 Ga0501079_0291780 3300049741 Bacteria 1276
949 Ga0501079_0312420 3300049741 Bacteria 1230
950 Ga0501079_0876309 3300049741 Unclassified 707
951 Ga0501079_0881503 3300049741 Unclassified 705
952 Ga0501080_0027293 3300049742 Bacteria 5309
953 Ga0501080_0287010 3300049742 Bacteria 1495
954 Ga0501080_0291905 3300049742 Unclassified 1480
955 Ga0501080_0607157 3300049742 Bacteria 971
956 Ga0501080_0608565 3300049742 Bacteria 969
957 Ga0501080_0621866 3300049742 Bacteria 957
958 Ga0501080_0746448 3300049742 Bacteria 861
959 Ga0501080_1534035 3300049742 Bacteria 565
960 Ga0501080_1557705 3300049742 Bacteria 560
961 Ga0501081_0042825 3300049743 Bacteria 3104
962 Ga0501081_0063454 3300049743 Bacteria 2564
963 Ga0501081_0212806 3300049743 Unclassified 1404
964 Ga0501081_0299607 3300049743 Bacteria 1179
965 Ga0501081_0635315 3300049743 Bacteria 800
966 Ga0501081_0710202 3300049743 Unclassified 755
967 Ga0501083_0012875 3300049744 Bacteria 5850
968 Ga0501083_0115600 3300049744 Bacteria 1761
969 Ga0501035_0094786 3300049822 Bacteria 2624
970 Ga0501035_0104196 3300049822 Bacteria 2488
971 Ga0501035_0193773 3300049822 Bacteria 1746
972 Ga0501044_0025113 3300049823 Bacteria 6319
973 Ga0501044_0037359 3300049823 Bacteria 5076
974 Ga0501045_0037298 3300049824 Bacteria 3532
975 Ga0501045_0046206 3300049824 Bacteria 3171
976 Ga0501045_0128366 3300049824 Bacteria 1884
977 Ga0501045_0850916 3300049824 Bacteria 671
978 Ga0501045_0930076 3300049824 Bacteria 638
979 nmdc:mga03683_11941_c1 3300050489 Bacteria 3159
980 nmdc:mga00v17_59698_c1 3300050491 Bacteria 2341
981 nmdc:mga0yw44_1015696_c1 3300050492 Unclassified 561
982 nmdc:mga0yw44_303014_c1 3300050492 Bacteria 1071
983 nmdc:mga0k408_290120_c1 3300050493 Bacteria 976
984 nmdc:mga0k408_5399_c1 3300050493 Bacteria 6797
985 nmdc:mga0k408_6905_c1 3300050493 Bacteria 6057
986 nmdc:mga06z11_294816_c1 3300050494 Unclassified 963
987 nmdc:mga04h51_72200_c1 3300050495 Bacteria 1207
988 nmdc:mga05p37_1068279_c1 3300050507 Bacteria 849
989 nmdc:mga05p37_167732_c1 3300050507 Bacteria 2679
990 nmdc:mga05p37_2454_c1 3300050507 Bacteria 21555
991 nmdc:mga05p37_34417_c1 3300050507 Bacteria 6205
992 nmdc:mga05p37_41627_c1 3300050507 Bacteria 5641
993 nmdc:mga05p37_613640_c2 3300050507 Bacteria 706
994 nmdc:mga05p37_63372_c1 3300050507 Bacteria 4549
995 nmdc:mga09592_143785_c1 3300050508 Unclassified 2056
996 nmdc:mga09592_144718_c1 3300050508 Bacteria 2049
997 nmdc:mga09592_1484143_c1 3300050508 Bacteria 552
998 nmdc:mga0qj67_139841_c1 3300050509 Bacteria 1963
999 nmdc:mga0qj67_4402_c1 3300050509 Bacteria 10199
1000 nmdc:mga0qj67_45318_c1 3300050509 Bacteria 3470
1001 nmdc:mga06r32_36771_c1 3300050510 Bacteria 4629
1002 nmdc:mga06r32_454924_c1 3300050510 Bacteria 1260
1003 nmdc:mga06r32_66537_c1 3300050510 Bacteria 3477
1004 nmdc:mga06r32_7498_c1 3300050510 Bacteria 9812
1005 nmdc:mga08y16_1464923_c1 3300050511 Bacteria 644
1006 nmdc:mga08y16_153994_c1 3300050511 Unclassified 2389
1007 nmdc:mga08y16_167701_c1 3300050511 Bacteria 2281
1008 nmdc:mga08y16_1963090_c1 3300050511 Bacteria 535
1009 nmdc:mga08y16_20168_c1 3300050511 Bacteria 7034
1010 nmdc:mga08y16_2821_c1 3300050511 Bacteria 17849
1011 nmdc:mga08y16_579412_c1 3300050511 Unclassified 1133
1012 nmdc:mga08y16_66551_c2 3300050511 Bacteria 2833
1013 nmdc:mga08y16_716615_c1 3300050511 Bacteria 999
1014 nmdc:mga0n895_115148_c1 3300050512 Bacteria 2707
1015 nmdc:mga0n895_1750711_c1 3300050512 Bacteria 583
1016 nmdc:mga0n895_233473_c1 3300050512 Bacteria 1867
1017 nmdc:mga0n895_24578_c1 3300050512 Bacteria 5680
1018 nmdc:mga0n895_368008_c1 3300050512 Bacteria 1455
1019 nmdc:mga0n895_411574_c1 3300050512 Bacteria 1367
1020 nmdc:mga0rr50_108886_c1 3300050513 Bacteria 2190
1021 nmdc:mga0rr50_165429_c1 3300050513 Bacteria 1798
1022 nmdc:mga0rr50_1819885_c1 3300050513 Unclassified 512
1023 nmdc:mga0rr50_1831293_c1 3300050513 Bacteria 511
1024 nmdc:mga0rr50_30217_c1 3300050513 Unclassified 3833
1025 nmdc:mga08x19_212632_c1 3300050514 Bacteria 1328
1026 nmdc:mga08x19_301288_c1 3300050514 Bacteria 1113
1027 nmdc:mga08x19_355707_c1 3300050514 Unclassified 1023
1028 nmdc:mga0a205_1146693_c1 3300050515 Bacteria 625
1029 nmdc:mga0a205_49034_c1 3300050515 Bacteria 4075
1030 nmdc:mga0a205_61638_c1 3300050515 Bacteria 3623
1031 nmdc:mga0a205_65091_c1 3300050515 Bacteria 3521
1032 nmdc:mga0a205_6759_c1 3300050515 Bacteria 10372
1033 Ga0495601_0076870 3300053077 Bacteria 2138
1034 Ga0495601_0084465 3300053077 Bacteria 2039
1035 Ga0495595_0042625 3300053084 Bacteria 2079
1036 Ga0495595_0115643 3300053084 Bacteria 1304
1037 Ga0495595_0652844 3300053084 Bacteria 539
1038 Ga0495619_0001225 3300053085 Bacteria 16804
1039 Ga0501084_0006584 3300054114 Bacteria 9545
1040 Ga0501084_0017135 3300054114 Bacteria 6018
1041 Ga0501084_0035496 3300054114 Bacteria 4168
1042 Ga0501084_0071519 3300054114 Bacteria 2905
1043 Ga0501084_0162260 3300054114 Bacteria 1885
1044 Ga0501084_0550247 3300054114 Bacteria 975
1045 Ga0501084_0555518 3300054114 Bacteria 970
1046 Ga0501084_0587188 3300054114 Bacteria 941
1047 Ga0501084_0718101 3300054114 Unclassified 842
1048 Ga0501084_0855243 3300054114 Bacteria 765
1049 Ga0501084_0869774 3300054114 Bacteria 758
1050 Ga0501084_1590854 3300054114 Bacteria 546
1051 Ga0590071_004751 3300059421 Bacteria 3280
1052 Ga0590075_003372 3300059424 Bacteria 3803
1053 Ga0590077_008658 3300059426 Bacteria 2083
1054 Ga0501082_0026825 3300060353 Bacteria 4964
1055 Ga0501082_0047449 3300060353 Bacteria 3701
1056 Ga0501082_0160030 3300060353 Bacteria 1956
1057 Ga0501082_0272132 3300060353 Bacteria 1474
1058 Ga0501082_0758095 3300060353 Bacteria 849
1059 Ga0501082_0776644 3300060353 Bacteria 838
1060 Ga0501082_0826581 3300060353 Bacteria 810
1061 Ga0501082_0920344 3300060353 Bacteria 765
1062 Ga0501082_0935583 3300060353 Unclassified 758
1063 Ga0501082_0962246 3300060353 Bacteria 746
1064 Ga0501082_1627775 3300060353 Unclassified 564
1065 Ga0530510_0243740 3300061734 Bacteria 1338
1066 Ga0530510_0344118 3300061734 Bacteria 1120
1067 Ga0530510_0390335 3300061734 Bacteria 1048
1068 Ga0530510_0445218 3300061734 Bacteria 979
1069 Ga0530510_0544508 3300061734 Bacteria 881
1070 Ga0530510_0683748 3300061734 Bacteria 782
1071 Ga0530510_0745755 3300061734 Bacteria 747
1072 Ga0530510_0991487 3300061734 Bacteria 643

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035118 Ga0373954_0639826 Ga0373954_0639826_253_513 79
2 3300009176 Ga0105242_13148114 Ga0105242_131481142 82
3 3300035088 Ga0373940_0123896 Ga0373940_0123896_31_282 82
4 3300005340 Ga0070689_100141077 Ga0070689_1001410772 83
5 3300009094 Ga0111539_11984297 Ga0111539_119842971 83
6 3300009101 Ga0105247_10100266 Ga0105247_101002664 83
7 3300009177 Ga0105248_10054044 Ga0105248_100540446 83
8 3300009551 Ga0105238_10136346 Ga0105238_101363463 83
9 3300010375 Ga0105239_10296047 Ga0105239_102960474 83
10 3300013308 Ga0157375_10259698 Ga0157375_102596985 83
11 3300025940 Ga0207691_10601706 Ga0207691_106017061 83
12 3300035170 Ga0373943_0229432 Ga0373943_0229432_51_302 83
13 3300050512 nmdc:mga0n895_411574_c1 nmdc:mga0n895_411574_c1_691_942 83
14 3300050513 nmdc:mga0rr50_108886_c1 nmdc:mga0rr50_108886_c1_932_1183 83
15 3300005471 Ga0070698_101620173 Ga0070698_1016201731 84
16 3300005844 Ga0068862_100723461 Ga0068862_1007234613 84
17 3300026089 Ga0207648_11645629 Ga0207648_116456292 84
18 3300028380 Ga0268265_11944779 Ga0268265_119447792 84
19 3300049577 Ga0501041_0702693 Ga0501041_0702693_130_387 85
20 3300049578 Ga0501042_0500515 Ga0501042_0500515_221_478 85
21 3300049591 Ga0501075_0541494 Ga0501075_0541494_456_713 85
22 3300049592 Ga0501076_0089559 Ga0501076_0089559_804_1061 85
23 3300049743 Ga0501081_0212806 Ga0501081_0212806_454_711 85
24 3300054114 Ga0501084_0071519 Ga0501084_0071519_282_539 85
25 3300060353 Ga0501082_0826581 Ga0501082_0826581_440_697 85
26 3300061734 Ga0530510_0991487 Ga0530510_0991487_119_376 85
27 3300005290 Ga0065712_10193404 Ga0065712_101934042 86
28 3300005354 Ga0070675_101011476 Ga0070675_1010114761 86
29 3300005367 Ga0070667_102138147 Ga0070667_1021381471 86
30 3300005615 Ga0070702_100149497 Ga0070702_1001494971 86
31 3300005719 Ga0068861_100372418 Ga0068861_1003724184 86
32 3300009094 Ga0111539_10173669 Ga0111539_101736693 86
33 3300009553 Ga0105249_10791467 Ga0105249_107914672 86
34 3300014326 Ga0157380_10143224 Ga0157380_101432241 86
35 3300025926 Ga0207659_10533713 Ga0207659_105337133 86
36 3300025936 Ga0207670_11205493 Ga0207670_112054932 86
37 3300025937 Ga0207669_11662304 Ga0207669_116623041 86
38 3300025961 Ga0207712_10652875 Ga0207712_106528752 86
39 3300026118 Ga0207675_100713542 Ga0207675_1007135423 86
40 3300050508 nmdc:mga09592_1484143_c1 nmdc:mga09592_1484143_c1_253_519 86
41 3300050511 nmdc:mga08y16_153994_c1 nmdc:mga08y16_153994_c1_1794_2060 86
42 3300050511 nmdc:mga08y16_579412_c1 nmdc:mga08y16_579412_c1_35_301 86
43 3300050512 nmdc:mga0n895_1750711_c1 nmdc:mga0n895_1750711_c1_16_282 86
44 3300002459 JGI24751J29686_10047507 JGI24751J29686_100475073 87
45 3300005288 Ga0065714_10191579 Ga0065714_101915791 87
46 3300005331 Ga0070670_100047682 Ga0070670_1000476826 87
47 3300005339 Ga0070660_100661703 Ga0070660_1006617033 87
48 3300005356 Ga0070674_100097298 Ga0070674_1000972984 87
49 3300005366 Ga0070659_100168933 Ga0070659_1001689334 87
50 3300005455 Ga0070663_100390052 Ga0070663_1003900524 87
51 3300005457 Ga0070662_100680803 Ga0070662_1006808032 87
52 3300005539 Ga0068853_102293707 Ga0068853_1022937071 87
53 3300005547 Ga0070693_101049058 Ga0070693_1010490582 87
54 3300005548 Ga0070665_100248210 Ga0070665_1002482104 87
55 3300005548 Ga0070665_101085551 Ga0070665_1010855513 87
56 3300005618 Ga0068864_100732842 Ga0068864_1007328422 87
57 3300005844 Ga0068862_101272499 Ga0068862_1012724992 87
58 3300006846 Ga0075430_100006051 Ga0075430_1000060513 87
59 3300009177 Ga0105248_13388069 Ga0105248_133880692 87
60 3300014326 Ga0157380_11740667 Ga0157380_117406672 87
61 3300025925 Ga0207650_10010455 Ga0207650_100104552 87
62 3300025932 Ga0207690_10271928 Ga0207690_102719283 87
63 3300025933 Ga0207706_10822047 Ga0207706_108220473 87
64 3300025933 Ga0207706_10863325 Ga0207706_108633252 87
65 3300025937 Ga0207669_10593369 Ga0207669_105933692 87
66 3300025941 Ga0207711_10330700 Ga0207711_103307003 87
67 3300025961 Ga0207712_11391467 Ga0207712_113914671 87
68 3300026041 Ga0207639_10394324 Ga0207639_103943244 87
69 3300026067 Ga0207678_10402467 Ga0207678_104024674 87
70 3300026088 Ga0207641_10735499 Ga0207641_107354992 87
71 3300026095 Ga0207676_10708581 Ga0207676_107085812 87
72 3300027717 Ga0209998_10033825 Ga0209998_100338254 87
73 3300028380 Ga0268265_10341819 Ga0268265_103418192 87
74 3300031456 Ga0307513_10771604 Ga0307513_107716042 87
75 3300031995 Ga0307409_100173215 Ga0307409_1001732154 87
76 3300031995 Ga0307409_101483992 Ga0307409_1014839923 87
77 3300032002 Ga0307416_101342006 Ga0307416_1013420063 87
78 3300037068 Ga0373925_0006513 Ga0373925_0006513_7002_7265 87
79 3300041460 Ga0451802_0912663 Ga0451802_0912663_452_715 87
80 3300041463 Ga0451804_0779925 Ga0451804_0779925_356_619 87
81 3300041512 Ga0451853_3998079 Ga0451853_3998079_211_474 87
82 3300042129 Ga0450891_019284 Ga0450891_019284_197_460 87
83 3300042142 Ga0450905_083305 Ga0450905_083305_11_274 87
84 3300042530 Ga0450916_018446 Ga0450916_018446_149_412 87
85 3300046514 Ga0495618_0811460 Ga0495618_0811460_25_288 87
86 3300046689 Ga0495613_0047197 Ga0495613_0047197_822_1085 87
87 3300048905 Ga0496102_0702480 Ga0496102_0702480_366_629 87
88 3300048913 Ga0496110_1383736 Ga0496110_1383736_303_566 87
89 3300049568 Ga0501031_0108509 Ga0501031_0108509_85_348 87
90 3300049570 Ga0501033_1071967 Ga0501033_1071967_254_517 87
91 3300049572 Ga0501036_0395912 Ga0501036_0395912_125_388 87
92 3300049574 Ga0501038_0229508 Ga0501038_0229508_1180_1443 87
93 3300049575 Ga0501039_0059409 Ga0501039_0059409_739_1002 87
94 3300049576 Ga0501040_0348611 Ga0501040_0348611_746_1009 87
95 3300049577 Ga0501041_0602352 Ga0501041_0602352_106_369 87
96 3300049582 Ga0501048_0685850 Ga0501048_0685850_25_288 87
97 3300049583 Ga0501067_0407869 Ga0501067_0407869_136_411 87
98 3300049587 Ga0501071_0035635 Ga0501071_0035635_475_738 87
99 3300049588 Ga0501072_0347587 Ga0501072_0347587_127_390 87
100 3300049590 Ga0501074_0343411 Ga0501074_0343411_254_517 87
101 3300049591 Ga0501075_0037021 Ga0501075_0037021_2497_2760 87
102 3300049592 Ga0501076_0056689 Ga0501076_0056689_2234_2497 87
103 3300049593 Ga0501077_0086806 Ga0501077_0086806_1682_1945 87
104 3300049593 Ga0501077_0184000 Ga0501077_0184000_845_1108 87
105 3300049741 Ga0501079_0054982 Ga0501079_0054982_503_766 87
106 3300049743 Ga0501081_0063454 Ga0501081_0063454_771_1034 87
107 3300049822 Ga0501035_0104196 Ga0501035_0104196_382_645 87
108 3300049824 Ga0501045_0037298 Ga0501045_0037298_853_1116 87
109 3300050509 nmdc:mga0qj67_4402_c1 nmdc:mga0qj67_4402_c1_9393_9656 87
110 3300054114 Ga0501084_0555518 Ga0501084_0555518_451_714 87
111 3300054114 Ga0501084_0855243 Ga0501084_0855243_111_374 87
112 3300060353 Ga0501082_0047449 Ga0501082_0047449_464_727 87
113 3300061734 Ga0530510_0243740 Ga0530510_0243740_777_1040 87
114 3300001991 JGI24743J22301_10138864 JGI24743J22301_101388642 88
115 3300002077 JGI24744J21845_10089966 JGI24744J21845_100899662 88
116 3300002239 JGI24034J26672_10063540 JGI24034J26672_100635402 88
117 3300005289 Ga0065704_10409366 Ga0065704_104093662 88
118 3300005290 Ga0065712_10000353 Ga0065712_1000035316 88
119 3300005290 Ga0065712_10085891 Ga0065712_100858916 88
120 3300005290 Ga0065712_10245698 Ga0065712_102456981 88
121 3300005290 Ga0065712_10442568 Ga0065712_104425681 88
122 3300005293 Ga0065715_10090861 Ga0065715_100908613 88
123 3300005293 Ga0065715_10122953 Ga0065715_101229532 88
124 3300005293 Ga0065715_10158840 Ga0065715_101588403 88
125 3300005293 Ga0065715_10208819 Ga0065715_102088193 88
126 3300005293 Ga0065715_10255844 Ga0065715_102558443 88
127 3300005293 Ga0065715_10378796 Ga0065715_103787961 88
128 3300005293 Ga0065715_10422987 Ga0065715_104229872 88
129 3300005293 Ga0065715_10692944 Ga0065715_106929441 88
130 3300005295 Ga0065707_10004263 Ga0065707_100042635 88
131 3300005295 Ga0065707_10102583 Ga0065707_101025836 88
132 3300005328 Ga0070676_10050842 Ga0070676_100508425 88
133 3300005328 Ga0070676_10125248 Ga0070676_101252484 88
134 3300005328 Ga0070676_10139873 Ga0070676_101398733 88
135 3300005328 Ga0070676_10962820 Ga0070676_109628202 88
136 3300005329 Ga0070683_100001936 Ga0070683_10000193610 88
137 3300005329 Ga0070683_100049491 Ga0070683_1000494914 88
138 3300005330 Ga0070690_100063175 Ga0070690_1000631753 88
139 3300005330 Ga0070690_100114351 Ga0070690_1001143514 88
140 3300005330 Ga0070690_100313695 Ga0070690_1003136951 88
141 3300005330 Ga0070690_101154256 Ga0070690_1011542562 88
142 3300005331 Ga0070670_100001546 Ga0070670_10000154620 88
143 3300005331 Ga0070670_100024170 Ga0070670_1000241707 88
144 3300005331 Ga0070670_100150277 Ga0070670_1001502774 88
145 3300005331 Ga0070670_101301605 Ga0070670_1013016052 88
146 3300005333 Ga0070677_10261944 Ga0070677_102619442 88
147 3300005333 Ga0070677_10341987 Ga0070677_103419871 88
148 3300005334 Ga0068869_100122062 Ga0068869_1001220623 88
149 3300005334 Ga0068869_100219783 Ga0068869_1002197832 88
150 3300005334 Ga0068869_100345015 Ga0068869_1003450153 88
151 3300005335 Ga0070666_10067969 Ga0070666_100679691 88
152 3300005335 Ga0070666_10092137 Ga0070666_100921374 88
153 3300005335 Ga0070666_10193636 Ga0070666_101936363 88
154 3300005335 Ga0070666_10406124 Ga0070666_104061242 88
155 3300005335 Ga0070666_11051055 Ga0070666_110510552 88
156 3300005337 Ga0070682_100172025 Ga0070682_1001720254 88
157 3300005338 Ga0068868_100095156 Ga0068868_1000951562 88
158 3300005338 Ga0068868_100132380 Ga0068868_1001323804 88
159 3300005339 Ga0070660_100096787 Ga0070660_1000967874 88
160 3300005340 Ga0070689_101508873 Ga0070689_1015088731 88
161 3300005340 Ga0070689_102168393 Ga0070689_1021683932 88
162 3300005343 Ga0070687_100030453 Ga0070687_1000304535 88
163 3300005343 Ga0070687_100052795 Ga0070687_1000527953 88
164 3300005343 Ga0070687_100917645 Ga0070687_1009176451 88
165 3300005344 Ga0070661_100006579 Ga0070661_1000065799 88
166 3300005344 Ga0070661_100555592 Ga0070661_1005555924 88
167 3300005345 Ga0070692_10141854 Ga0070692_101418544 88
168 3300005345 Ga0070692_11061622 Ga0070692_110616221 88
169 3300005345 Ga0070692_11192751 Ga0070692_111927512 88
170 3300005347 Ga0070668_100979764 Ga0070668_1009797641 88
171 3300005347 Ga0070668_101732551 Ga0070668_1017325511 88
172 3300005347 Ga0070668_102006358 Ga0070668_1020063582 88
173 3300005353 Ga0070669_100000166 Ga0070669_1000001667 88
174 3300005353 Ga0070669_100050963 Ga0070669_1000509634 88
175 3300005353 Ga0070669_100187620 Ga0070669_1001876204 88
176 3300005353 Ga0070669_100743340 Ga0070669_1007433403 88
177 3300005353 Ga0070669_101235117 Ga0070669_1012351172 88
178 3300005353 Ga0070669_101913318 Ga0070669_1019133182 88
179 3300005354 Ga0070675_100002899 Ga0070675_1000028998 88
180 3300005354 Ga0070675_100078452 Ga0070675_1000784526 88
181 3300005354 Ga0070675_100120981 Ga0070675_1001209814 88
182 3300005354 Ga0070675_100470081 Ga0070675_1004700814 88
183 3300005354 Ga0070675_100512164 Ga0070675_1005121643 88
184 3300005354 Ga0070675_100672619 Ga0070675_1006726192 88
185 3300005354 Ga0070675_100693337 Ga0070675_1006933373 88
186 3300005354 Ga0070675_100955987 Ga0070675_1009559872 88
187 3300005355 Ga0070671_100183091 Ga0070671_1001830914 88
188 3300005355 Ga0070671_100185058 Ga0070671_1001850584 88
189 3300005355 Ga0070671_100312360 Ga0070671_1003123601 88
190 3300005355 Ga0070671_101434808 Ga0070671_1014348081 88
191 3300005356 Ga0070674_100011525 Ga0070674_1000115257 88
192 3300005356 Ga0070674_100126422 Ga0070674_1001264222 88
193 3300005356 Ga0070674_100588196 Ga0070674_1005881963 88
194 3300005356 Ga0070674_100719633 Ga0070674_1007196333 88
195 3300005356 Ga0070674_100770303 Ga0070674_1007703032 88
196 3300005356 Ga0070674_101555351 Ga0070674_1015553512 88
197 3300005364 Ga0070673_100002561 Ga0070673_1000025619 88
198 3300005364 Ga0070673_101341274 Ga0070673_1013412741 88
199 3300005364 Ga0070673_101513306 Ga0070673_1015133062 88
200 3300005364 Ga0070673_101597864 Ga0070673_1015978642 88
201 3300005364 Ga0070673_102322210 Ga0070673_1023222101 88
202 3300005365 Ga0070688_100014815 Ga0070688_1000148158 88
203 3300005365 Ga0070688_100208852 Ga0070688_1002088523 88
204 3300005365 Ga0070688_100305285 Ga0070688_1003052852 88
205 3300005365 Ga0070688_101514940 Ga0070688_1015149401 88
206 3300005366 Ga0070659_100354644 Ga0070659_1003546443 88
207 3300005366 Ga0070659_100852790 Ga0070659_1008527901 88
208 3300005366 Ga0070659_101167960 Ga0070659_1011679602 88
209 3300005366 Ga0070659_101856936 Ga0070659_1018569361 88
210 3300005367 Ga0070667_100048804 Ga0070667_1000488046 88
211 3300005367 Ga0070667_100963734 Ga0070667_1009637342 88
212 3300005436 Ga0070713_100386032 Ga0070713_1003860322 88
213 3300005438 Ga0070701_10003736 Ga0070701_100037364 88
214 3300005438 Ga0070701_10909765 Ga0070701_109097652 88
215 3300005439 Ga0070711_100902157 Ga0070711_1009021571 88
216 3300005439 Ga0070711_101536326 Ga0070711_1015363262 88
217 3300005440 Ga0070705_100600092 Ga0070705_1006000922 88
218 3300005440 Ga0070705_101075107 Ga0070705_1010751071 88
219 3300005441 Ga0070700_100630669 Ga0070700_1006306693 88
220 3300005441 Ga0070700_100944530 Ga0070700_1009445301 88
221 3300005441 Ga0070700_101143879 Ga0070700_1011438792 88
222 3300005444 Ga0070694_100896708 Ga0070694_1008967081 88
223 3300005444 Ga0070694_100991037 Ga0070694_1009910372 88
224 3300005455 Ga0070663_100170260 Ga0070663_1001702603 88
225 3300005455 Ga0070663_100388748 Ga0070663_1003887483 88
226 3300005455 Ga0070663_100448748 Ga0070663_1004487482 88
227 3300005456 Ga0070678_100122387 Ga0070678_1001223874 88
228 3300005456 Ga0070678_100145886 Ga0070678_1001458864 88
229 3300005456 Ga0070678_100256343 Ga0070678_1002563431 88
230 3300005456 Ga0070678_100415177 Ga0070678_1004151774 88
231 3300005456 Ga0070678_100736357 Ga0070678_1007363572 88
232 3300005456 Ga0070678_101106059 Ga0070678_1011060592 88
233 3300005456 Ga0070678_101442012 Ga0070678_1014420121 88
234 3300005457 Ga0070662_100040943 Ga0070662_1000409432 88
235 3300005457 Ga0070662_100158979 Ga0070662_1001589793 88
236 3300005458 Ga0070681_10108734 Ga0070681_101087345 88
237 3300005458 Ga0070681_11908863 Ga0070681_119088632 88
238 3300005459 Ga0068867_100011928 Ga0068867_1000119284 88
239 3300005459 Ga0068867_100085366 Ga0068867_1000853664 88
240 3300005459 Ga0068867_100592081 Ga0068867_1005920811 88
241 3300005466 Ga0070685_10003988 Ga0070685_100039885 88
242 3300005466 Ga0070685_11523048 Ga0070685_115230482 88
243 3300005467 Ga0070706_100634444 Ga0070706_1006344443 88
244 3300005467 Ga0070706_100794605 Ga0070706_1007946052 88
245 3300005468 Ga0070707_100931109 Ga0070707_1009311092 88
246 3300005468 Ga0070707_101659703 Ga0070707_1016597031 88
247 3300005471 Ga0070698_100340178 Ga0070698_1003401783 88
248 3300005471 Ga0070698_101119969 Ga0070698_1011199692 88
249 3300005471 Ga0070698_101503986 Ga0070698_1015039861 88
250 3300005507 Ga0074259_10932921 Ga0074259_109329212 88
251 3300005518 Ga0070699_100951258 Ga0070699_1009512582 88
252 3300005518 Ga0070699_101491838 Ga0070699_1014918382 88
253 3300005535 Ga0070684_100000291 Ga0070684_10000029124 88
254 3300005535 Ga0070684_100722382 Ga0070684_1007223821 88
255 3300005539 Ga0068853_100824579 Ga0068853_1008245791 88
256 3300005539 Ga0068853_101443326 Ga0068853_1014433262 88
257 3300005539 Ga0068853_102352289 Ga0068853_1023522892 88
258 3300005543 Ga0070672_100019443 Ga0070672_1000194434 88
259 3300005543 Ga0070672_100021908 Ga0070672_1000219087 88
260 3300005543 Ga0070672_100118152 Ga0070672_1001181524 88
261 3300005543 Ga0070672_100232545 Ga0070672_1002325454 88
262 3300005543 Ga0070672_101240170 Ga0070672_1012401702 88
263 3300005544 Ga0070686_100033623 Ga0070686_1000336233 88
264 3300005544 Ga0070686_100306200 Ga0070686_1003062002 88
265 3300005544 Ga0070686_101057707 Ga0070686_1010577071 88
266 3300005546 Ga0070696_100295643 Ga0070696_1002956433 88
267 3300005546 Ga0070696_100483150 Ga0070696_1004831502 88
268 3300005546 Ga0070696_100721736 Ga0070696_1007217362 88
269 3300005547 Ga0070693_101016747 Ga0070693_1010167472 88
270 3300005548 Ga0070665_100010087 Ga0070665_1000100874 88
271 3300005548 Ga0070665_100022622 Ga0070665_1000226226 88
272 3300005548 Ga0070665_100250519 Ga0070665_1002505194 88
273 3300005548 Ga0070665_100476735 Ga0070665_1004767354 88
274 3300005548 Ga0070665_100483781 Ga0070665_1004837812 88
275 3300005548 Ga0070665_100801899 Ga0070665_1008018993 88
276 3300005549 Ga0070704_100071794 Ga0070704_1000717944 88
277 3300005549 Ga0070704_100175306 Ga0070704_1001753063 88
278 3300005549 Ga0070704_100277876 Ga0070704_1002778762 88
279 3300005549 Ga0070704_100544980 Ga0070704_1005449801 88
280 3300005549 Ga0070704_100917012 Ga0070704_1009170122 88
281 3300005549 Ga0070704_101040332 Ga0070704_1010403322 88
282 3300005563 Ga0068855_100929771 Ga0068855_1009297712 88
283 3300005563 Ga0068855_101573479 Ga0068855_1015734792 88
284 3300005564 Ga0070664_100003002 Ga0070664_1000030026 88
285 3300005564 Ga0070664_100142540 Ga0070664_1001425404 88
286 3300005564 Ga0070664_100335665 Ga0070664_1003356651 88
287 3300005564 Ga0070664_100710477 Ga0070664_1007104771 88
288 3300005564 Ga0070664_101806239 Ga0070664_1018062392 88
289 3300005564 Ga0070664_102143281 Ga0070664_1021432812 88
290 3300005578 Ga0068854_100099848 Ga0068854_1000998484 88
291 3300005578 Ga0068854_100436159 Ga0068854_1004361592 88
292 3300005578 Ga0068854_100549707 Ga0068854_1005497072 88
293 3300005578 Ga0068854_101246943 Ga0068854_1012469432 88
294 3300005614 Ga0068856_100062149 Ga0068856_1000621492 88
295 3300005614 Ga0068856_101189163 Ga0068856_1011891632 88
296 3300005614 Ga0068856_101588804 Ga0068856_1015888042 88
297 3300005615 Ga0070702_100377258 Ga0070702_1003772582 88
298 3300005615 Ga0070702_100659878 Ga0070702_1006598782 88
299 3300005616 Ga0068852_100078194 Ga0068852_1000781944 88
300 3300005616 Ga0068852_100111289 Ga0068852_1001112894 88
301 3300005616 Ga0068852_100223280 Ga0068852_1002232804 88
302 3300005616 Ga0068852_100920448 Ga0068852_1009204482 88
303 3300005616 Ga0068852_102667994 Ga0068852_1026679942 88
304 3300005617 Ga0068859_100003822 Ga0068859_1000038228 88
305 3300005617 Ga0068859_100644005 Ga0068859_1006440053 88
306 3300005618 Ga0068864_100028940 Ga0068864_1000289405 88
307 3300005618 Ga0068864_100922272 Ga0068864_1009222722 88
308 3300005618 Ga0068864_101172838 Ga0068864_1011728383 88
309 3300005618 Ga0068864_101462168 Ga0068864_1014621681 88
310 3300005718 Ga0068866_10044883 Ga0068866_100448835 88
311 3300005718 Ga0068866_10599907 Ga0068866_105999072 88
312 3300005719 Ga0068861_100105876 Ga0068861_1001058764 88
313 3300005719 Ga0068861_100479695 Ga0068861_1004796953 88
314 3300005719 Ga0068861_101872619 Ga0068861_1018726192 88
315 3300005719 Ga0068861_102129904 Ga0068861_1021299041 88
316 3300005834 Ga0068851_10247991 Ga0068851_102479913 88
317 3300005834 Ga0068851_10890393 Ga0068851_108903931 88
318 3300005840 Ga0068870_10156858 Ga0068870_101568581 88
319 3300005841 Ga0068863_100011808 Ga0068863_1000118084 88
320 3300005841 Ga0068863_100080513 Ga0068863_1000805134 88
321 3300005841 Ga0068863_100276921 Ga0068863_1002769213 88
322 3300005841 Ga0068863_101011481 Ga0068863_1010114811 88
323 3300005841 Ga0068863_102019482 Ga0068863_1020194821 88
324 3300005842 Ga0068858_100425073 Ga0068858_1004250734 88
325 3300005842 Ga0068858_100567704 Ga0068858_1005677042 88
326 3300005842 Ga0068858_100959293 Ga0068858_1009592932 88
327 3300005842 Ga0068858_102026130 Ga0068858_1020261301 88
328 3300005843 Ga0068860_100153064 Ga0068860_1001530644 88
329 3300005843 Ga0068860_100656848 Ga0068860_1006568484 88
330 3300005844 Ga0068862_100026965 Ga0068862_1000269655 88
331 3300005844 Ga0068862_100053947 Ga0068862_1000539475 88
332 3300005844 Ga0068862_100087875 Ga0068862_1000878753 88
333 3300005844 Ga0068862_100706697 Ga0068862_1007066972 88
334 3300005844 Ga0068862_100812019 Ga0068862_1008120192 88
335 3300005844 Ga0068862_101415778 Ga0068862_1014157782 88
336 3300005844 Ga0068862_101667013 Ga0068862_1016670132 88
337 3300006028 Ga0070717_10284219 Ga0070717_102842192 88
338 3300006038 Ga0075365_10000562 Ga0075365_1000056213 88
339 3300006038 Ga0075365_11091067 Ga0075365_110910671 88
340 3300006042 Ga0075368_10053538 Ga0075368_100535384 88
341 3300006051 Ga0075364_10004066 Ga0075364_100040663 88
342 3300006051 Ga0075364_10005645 Ga0075364_100056454 88
343 3300006051 Ga0075364_10252862 Ga0075364_102528623 88
344 3300006058 Ga0075432_10453801 Ga0075432_104538012 88
345 3300006173 Ga0070716_100479436 Ga0070716_1004794363 88
346 3300006177 Ga0075362_10105944 Ga0075362_101059443 88
347 3300006178 Ga0075367_10033063 Ga0075367_100330636 88
348 3300006195 Ga0075366_10000965 Ga0075366_100009659 88
349 3300006195 Ga0075366_10470540 Ga0075366_104705401 88
350 3300006195 Ga0075366_10531682 Ga0075366_105316823 88
351 3300006237 Ga0097621_100037514 Ga0097621_1000375147 88
352 3300006237 Ga0097621_101063255 Ga0097621_1010632551 88
353 3300006358 Ga0068871_100045078 Ga0068871_1000450783 88
354 3300006358 Ga0068871_100213392 Ga0068871_1002133923 88
355 3300006358 Ga0068871_100223288 Ga0068871_1002232884 88
356 3300006358 Ga0068871_100819182 Ga0068871_1008191822 88
357 3300006358 Ga0068871_101205864 Ga0068871_1012058642 88
358 3300006358 Ga0068871_101426741 Ga0068871_1014267412 88
359 3300006844 Ga0075428_100002190 Ga0075428_10000219015 88
360 3300006844 Ga0075428_100730850 Ga0075428_1007308503 88
361 3300006844 Ga0075428_100807477 Ga0075428_1008074773 88
362 3300006844 Ga0075428_101100872 Ga0075428_1011008722 88
363 3300006846 Ga0075430_100019324 Ga0075430_1000193248 88
364 3300006846 Ga0075430_101613232 Ga0075430_1016132322 88
365 3300006847 Ga0075431_100014795 Ga0075431_1000147954 88
366 3300006847 Ga0075431_100118506 Ga0075431_1001185063 88
367 3300006847 Ga0075431_100435891 Ga0075431_1004358914 88
368 3300006852 Ga0075433_10031686 Ga0075433_100316861 88
369 3300006852 Ga0075433_10032746 Ga0075433_100327468 88
370 3300006852 Ga0075433_10058944 Ga0075433_100589447 88
371 3300006852 Ga0075433_10088645 Ga0075433_100886454 88
372 3300006852 Ga0075433_11730977 Ga0075433_117309771 88
373 3300006871 Ga0075434_100004927 Ga0075434_10000492714 88
374 3300006871 Ga0075434_100023434 Ga0075434_1000234342 88
375 3300006871 Ga0075434_100195972 Ga0075434_1001959723 88
376 3300006871 Ga0075434_100567873 Ga0075434_1005678733 88
377 3300006880 Ga0075429_100214588 Ga0075429_1002145884 88
378 3300006880 Ga0075429_100229844 Ga0075429_1002298444 88
379 3300006881 Ga0068865_100423063 Ga0068865_1004230632 88
380 3300006881 Ga0068865_100645482 Ga0068865_1006454823 88
381 3300006881 Ga0068865_101667383 Ga0068865_1016673832 88
382 3300006881 Ga0068865_101782309 Ga0068865_1017823092 88
383 3300006881 Ga0068865_102000795 Ga0068865_1020007952 88
384 3300006914 Ga0075436_100306906 Ga0075436_1003069064 88
385 3300006914 Ga0075436_100429528 Ga0075436_1004295283 88
386 3300006931 Ga0097620_100003822 Ga0097620_1000038228 88
387 3300006931 Ga0097620_100644013 Ga0097620_1006440133 88
388 3300007076 Ga0075435_100006365 Ga0075435_1000063654 88
389 3300007076 Ga0075435_100015028 Ga0075435_1000150288 88
390 3300007076 Ga0075435_100272534 Ga0075435_1002725344 88
391 3300007076 Ga0075435_100279837 Ga0075435_1002798371 88
392 3300009093 Ga0105240_10195813 Ga0105240_101958134 88
393 3300009093 Ga0105240_10302364 Ga0105240_103023644 88
394 3300009093 Ga0105240_11641437 Ga0105240_116414372 88
395 3300009093 Ga0105240_12076160 Ga0105240_120761601 88
396 3300009094 Ga0111539_10001892 Ga0111539_1000189220 88
397 3300009094 Ga0111539_10024552 Ga0111539_1002455212 88
398 3300009094 Ga0111539_10140000 Ga0111539_101400003 88
399 3300009094 Ga0111539_10460819 Ga0111539_104608194 88
400 3300009094 Ga0111539_10730386 Ga0111539_107303862 88
401 3300009094 Ga0111539_11547838 Ga0111539_115478381 88
402 3300009094 Ga0111539_13090895 Ga0111539_130908951 88
403 3300009094 Ga0111539_13447851 Ga0111539_134478511 88
404 3300009098 Ga0105245_10374069 Ga0105245_103740694 88
405 3300009098 Ga0105245_11597005 Ga0105245_115970052 88
406 3300009101 Ga0105247_10359334 Ga0105247_103593343 88
407 3300009147 Ga0114129_10002861 Ga0114129_1000286119 88
408 3300009147 Ga0114129_10004267 Ga0114129_1000426715 88
409 3300009147 Ga0114129_10007233 Ga0114129_1000723316 88
410 3300009147 Ga0114129_10155007 Ga0114129_101550073 88
411 3300009147 Ga0114129_10188247 Ga0114129_101882474 88
412 3300009147 Ga0114129_11936848 Ga0114129_119368483 88
413 3300009147 Ga0114129_12298525 Ga0114129_122985252 88
414 3300009148 Ga0105243_10110197 Ga0105243_101101974 88
415 3300009148 Ga0105243_11841527 Ga0105243_118415272 88
416 3300009174 Ga0105241_10221699 Ga0105241_102216993 88
417 3300009176 Ga0105242_10031143 Ga0105242_100311438 88
418 3300009176 Ga0105242_10071788 Ga0105242_100717886 88
419 3300009176 Ga0105242_10097671 Ga0105242_100976714 88
420 3300009176 Ga0105242_10873422 Ga0105242_108734221 88
421 3300009177 Ga0105248_10026313 Ga0105248_100263133 88
422 3300009177 Ga0105248_10058976 Ga0105248_100589768 88
423 3300009177 Ga0105248_10059861 Ga0105248_100598617 88
424 3300009177 Ga0105248_10178054 Ga0105248_101780542 88
425 3300009177 Ga0105248_11490066 Ga0105248_114900662 88
426 3300009177 Ga0105248_11824620 Ga0105248_118246202 88
427 3300009177 Ga0105248_11901247 Ga0105248_119012472 88
428 3300009177 Ga0105248_12086345 Ga0105248_120863452 88
429 3300009551 Ga0105238_10382426 Ga0105238_103824261 88
430 3300009551 Ga0105238_11569608 Ga0105238_115696082 88
431 3300009553 Ga0105249_10001254 Ga0105249_1000125413 88
432 3300009553 Ga0105249_10005766 Ga0105249_1000576613 88
433 3300009553 Ga0105249_10080278 Ga0105249_100802786 88
434 3300010375 Ga0105239_10140364 Ga0105239_101403644 88
435 3300011119 Ga0105246_10647265 Ga0105246_106472652 88
436 3300011119 Ga0105246_10809966 Ga0105246_108099662 88
437 3300011119 Ga0105246_11047866 Ga0105246_110478662 88
438 3300013105 Ga0157369_10085696 Ga0157369_100856966 88
439 3300013105 Ga0157369_10753118 Ga0157369_107531182 88
440 3300013296 Ga0157374_10076825 Ga0157374_100768257 88
441 3300013296 Ga0157374_10313768 Ga0157374_103137684 88
442 3300013296 Ga0157374_11056116 Ga0157374_110561161 88
443 3300013297 Ga0157378_10899471 Ga0157378_108994712 88
444 3300013297 Ga0157378_10972425 Ga0157378_109724252 88
445 3300013297 Ga0157378_11134919 Ga0157378_111349192 88
446 3300013297 Ga0157378_11189019 Ga0157378_111890192 88
447 3300013297 Ga0157378_11506415 Ga0157378_115064151 88
448 3300013297 Ga0157378_12540327 Ga0157378_125403271 88
449 3300013297 Ga0157378_13011974 Ga0157378_130119742 88
450 3300013306 Ga0163162_10048642 Ga0163162_100486421 88
451 3300013306 Ga0163162_10144922 Ga0163162_101449224 88
452 3300013306 Ga0163162_10421010 Ga0163162_104210103 88
453 3300013306 Ga0163162_11700818 Ga0163162_117008182 88
454 3300013307 Ga0157372_10225441 Ga0157372_102254414 88
455 3300013307 Ga0157372_11058298 Ga0157372_110582982 88
456 3300013308 Ga0157375_10152246 Ga0157375_101522465 88
457 3300013308 Ga0157375_10208129 Ga0157375_102081295 88
458 3300013308 Ga0157375_10835267 Ga0157375_108352673 88
459 3300013308 Ga0157375_12002510 Ga0157375_120025102 88
460 3300013308 Ga0157375_13404568 Ga0157375_134045682 88
461 3300014325 Ga0163163_10059827 Ga0163163_100598274 88
462 3300014325 Ga0163163_10137123 Ga0163163_101371233 88
463 3300014325 Ga0163163_10137638 Ga0163163_101376384 88
464 3300014325 Ga0163163_10187170 Ga0163163_101871703 88
465 3300014325 Ga0163163_10868487 Ga0163163_108684872 88
466 3300014325 Ga0163163_12296948 Ga0163163_122969482 88
467 3300014325 Ga0163163_12641817 Ga0163163_126418172 88
468 3300014326 Ga0157380_10097792 Ga0157380_100977925 88
469 3300014326 Ga0157380_10225108 Ga0157380_102251083 88
470 3300014326 Ga0157380_10848854 Ga0157380_108488541 88
471 3300014326 Ga0157380_10874255 Ga0157380_108742553 88
472 3300014326 Ga0157380_10874444 Ga0157380_108744442 88
473 3300014326 Ga0157380_11520023 Ga0157380_115200233 88
474 3300014326 Ga0157380_11634596 Ga0157380_116345962 88
475 3300014326 Ga0157380_13167981 Ga0157380_131679811 88
476 3300014968 Ga0157379_10216935 Ga0157379_102169352 88
477 3300014968 Ga0157379_10385819 Ga0157379_103858194 88
478 3300014968 Ga0157379_10726632 Ga0157379_107266323 88
479 3300014969 Ga0157376_10009699 Ga0157376_100096997 88
480 3300014969 Ga0157376_10029717 Ga0157376_100297177 88
481 3300014969 Ga0157376_10224087 Ga0157376_102240872 88
482 3300014969 Ga0157376_10435551 Ga0157376_104355514 88
483 3300014969 Ga0157376_11815180 Ga0157376_118151802 88
484 3300014969 Ga0157376_11931565 Ga0157376_119315651 88
485 3300017792 Ga0163161_10861593 Ga0163161_108615931 88
486 3300020082 Ga0206353_10674301 Ga0206353_106743012 88
487 3300021384 Ga0213876_10119947 Ga0213876_101199473 88
488 3300025271 Ga0207666_1076982 Ga0207666_10769822 88
489 3300025315 Ga0207697_10000772 Ga0207697_1000077214 88
490 3300025321 Ga0207656_10269417 Ga0207656_102694173 88
491 3300025321 Ga0207656_10664497 Ga0207656_106644972 88
492 3300025893 Ga0207682_10212584 Ga0207682_102125842 88
493 3300025893 Ga0207682_10404771 Ga0207682_104047712 88
494 3300025893 Ga0207682_10492726 Ga0207682_104927261 88
495 3300025899 Ga0207642_10196629 Ga0207642_101966291 88
496 3300025899 Ga0207642_10483927 Ga0207642_104839272 88
497 3300025900 Ga0207710_10377925 Ga0207710_103779252 88
498 3300025901 Ga0207688_10002773 Ga0207688_100027736 88
499 3300025901 Ga0207688_10165611 Ga0207688_101656113 88
500 3300025903 Ga0207680_10052607 Ga0207680_100526075 88
501 3300025903 Ga0207680_10075968 Ga0207680_100759682 88
502 3300025903 Ga0207680_10287234 Ga0207680_102872344 88
503 3300025904 Ga0207647_10116664 Ga0207647_101166643 88
504 3300025904 Ga0207647_10609017 Ga0207647_106090172 88
505 3300025904 Ga0207647_10610010 Ga0207647_106100102 88
506 3300025907 Ga0207645_10937110 Ga0207645_109371101 88
507 3300025908 Ga0207643_10182357 Ga0207643_101823574 88
508 3300025910 Ga0207684_10364960 Ga0207684_103649604 88
509 3300025910 Ga0207684_10438502 Ga0207684_104385023 88
510 3300025910 Ga0207684_10778491 Ga0207684_107784912 88
511 3300025912 Ga0207707_10677920 Ga0207707_106779203 88
512 3300025912 Ga0207707_11113714 Ga0207707_111137142 88
513 3300025913 Ga0207695_10125684 Ga0207695_101256845 88
514 3300025916 Ga0207663_10558001 Ga0207663_105580012 88
515 3300025917 Ga0207660_10638366 Ga0207660_106383662 88
516 3300025918 Ga0207662_10002361 Ga0207662_1000236113 88
517 3300025918 Ga0207662_10061797 Ga0207662_100617973 88
518 3300025918 Ga0207662_10938226 Ga0207662_109382262 88
519 3300025919 Ga0207657_10201517 Ga0207657_102015173 88
520 3300025920 Ga0207649_10003342 Ga0207649_100033429 88
521 3300025920 Ga0207649_10304409 Ga0207649_103044091 88
522 3300025920 Ga0207649_10367202 Ga0207649_103672021 88
523 3300025923 Ga0207681_10022832 Ga0207681_100228326 88
524 3300025923 Ga0207681_10088153 Ga0207681_100881534 88
525 3300025923 Ga0207681_10220674 Ga0207681_102206744 88
526 3300025923 Ga0207681_10328906 Ga0207681_103289062 88
527 3300025924 Ga0207694_10370275 Ga0207694_103702753 88
528 3300025924 Ga0207694_10882807 Ga0207694_108828072 88
529 3300025924 Ga0207694_11071375 Ga0207694_110713751 88
530 3300025925 Ga0207650_10022308 Ga0207650_100223083 88
531 3300025925 Ga0207650_10064504 Ga0207650_100645045 88
532 3300025925 Ga0207650_10160269 Ga0207650_101602691 88
533 3300025925 Ga0207650_10207722 Ga0207650_102077223 88
534 3300025925 Ga0207650_10539789 Ga0207650_105397891 88
535 3300025926 Ga0207659_10078671 Ga0207659_100786715 88
536 3300025926 Ga0207659_10096263 Ga0207659_100962631 88
537 3300025926 Ga0207659_10384772 Ga0207659_103847723 88
538 3300025926 Ga0207659_10406365 Ga0207659_104063652 88
539 3300025926 Ga0207659_10940076 Ga0207659_109400762 88
540 3300025927 Ga0207687_10060991 Ga0207687_100609911 88
541 3300025927 Ga0207687_10188748 Ga0207687_101887482 88
542 3300025927 Ga0207687_10440398 Ga0207687_104403982 88
543 3300025928 Ga0207700_10349793 Ga0207700_103497932 88
544 3300025931 Ga0207644_10089495 Ga0207644_100894954 88
545 3300025931 Ga0207644_10154648 Ga0207644_101546484 88
546 3300025931 Ga0207644_10172039 Ga0207644_101720394 88
547 3300025932 Ga0207690_10254468 Ga0207690_102544683 88
548 3300025932 Ga0207690_10736624 Ga0207690_107366242 88
549 3300025932 Ga0207690_11251775 Ga0207690_112517752 88
550 3300025933 Ga0207706_10036735 Ga0207706_100367357 88
551 3300025933 Ga0207706_10085694 Ga0207706_100856943 88
552 3300025933 Ga0207706_10181333 Ga0207706_101813334 88
553 3300025933 Ga0207706_10547227 Ga0207706_105472271 88
554 3300025934 Ga0207686_10040704 Ga0207686_100407046 88
555 3300025934 Ga0207686_10064654 Ga0207686_100646544 88
556 3300025934 Ga0207686_11714098 Ga0207686_117140981 88
557 3300025935 Ga0207709_10059748 Ga0207709_100597484 88
558 3300025935 Ga0207709_10187417 Ga0207709_101874174 88
559 3300025935 Ga0207709_10938905 Ga0207709_109389052 88
560 3300025936 Ga0207670_10063237 Ga0207670_100632373 88
561 3300025936 Ga0207670_10872255 Ga0207670_108722552 88
562 3300025937 Ga0207669_10045755 Ga0207669_100457554 88
563 3300025937 Ga0207669_10077387 Ga0207669_100773874 88
564 3300025937 Ga0207669_10462811 Ga0207669_104628112 88
565 3300025937 Ga0207669_10681576 Ga0207669_106815763 88
566 3300025938 Ga0207704_10048697 Ga0207704_100486975 88
567 3300025938 Ga0207704_10113482 Ga0207704_101134822 88
568 3300025938 Ga0207704_10234030 Ga0207704_102340304 88
569 3300025938 Ga0207704_11334434 Ga0207704_113344342 88
570 3300025940 Ga0207691_10021474 Ga0207691_100214748 88
571 3300025940 Ga0207691_10053749 Ga0207691_100537492 88
572 3300025940 Ga0207691_10148042 Ga0207691_101480423 88
573 3300025940 Ga0207691_10192644 Ga0207691_101926444 88
574 3300025941 Ga0207711_10018265 Ga0207711_100182652 88
575 3300025941 Ga0207711_10144641 Ga0207711_101446415 88
576 3300025941 Ga0207711_10144777 Ga0207711_101447775 88
577 3300025941 Ga0207711_10624986 Ga0207711_106249863 88
578 3300025941 Ga0207711_11417222 Ga0207711_114172222 88
579 3300025941 Ga0207711_11774495 Ga0207711_117744952 88
580 3300025941 Ga0207711_12075604 Ga0207711_120756041 88
581 3300025942 Ga0207689_10074129 Ga0207689_100741294 88
582 3300025942 Ga0207689_10127286 Ga0207689_101272864 88
583 3300025942 Ga0207689_10960749 Ga0207689_109607492 88
584 3300025944 Ga0207661_10001428 Ga0207661_1000142813 88
585 3300025944 Ga0207661_10012308 Ga0207661_100123086 88
586 3300025945 Ga0207679_10002083 Ga0207679_1000208310 88
587 3300025945 Ga0207679_10041983 Ga0207679_100419833 88
588 3300025945 Ga0207679_10233106 Ga0207679_102331063 88
589 3300025945 Ga0207679_10368845 Ga0207679_103688454 88
590 3300025945 Ga0207679_11478069 Ga0207679_114780692 88
591 3300025949 Ga0207667_10756568 Ga0207667_107565683 88
592 3300025960 Ga0207651_10001330 Ga0207651_100013306 88
593 3300025960 Ga0207651_10597674 Ga0207651_105976742 88
594 3300025960 Ga0207651_10726985 Ga0207651_107269853 88
595 3300025960 Ga0207651_11188574 Ga0207651_111885742 88
596 3300025960 Ga0207651_11933639 Ga0207651_119336392 88
597 3300025961 Ga0207712_10011937 Ga0207712_100119376 88
598 3300025961 Ga0207712_10078458 Ga0207712_100784586 88
599 3300025961 Ga0207712_10666017 Ga0207712_106660173 88
600 3300025961 Ga0207712_11257449 Ga0207712_112574491 88
601 3300025961 Ga0207712_11336061 Ga0207712_113360612 88
602 3300025972 Ga0207668_10321528 Ga0207668_103215283 88
603 3300025972 Ga0207668_10721926 Ga0207668_107219261 88
604 3300025972 Ga0207668_11915835 Ga0207668_119158352 88
605 3300025972 Ga0207668_12081120 Ga0207668_120811201 88
606 3300025981 Ga0207640_10225562 Ga0207640_102255622 88
607 3300025981 Ga0207640_10565627 Ga0207640_105656271 88
608 3300025981 Ga0207640_10678815 Ga0207640_106788153 88
609 3300025981 Ga0207640_10970716 Ga0207640_109707161 88
610 3300025986 Ga0207658_10111366 Ga0207658_101113664 88
611 3300025986 Ga0207658_10520384 Ga0207658_105203841 88
612 3300025986 Ga0207658_11896125 Ga0207658_118961251 88
613 3300026023 Ga0207677_10013411 Ga0207677_100134115 88
614 3300026023 Ga0207677_10236423 Ga0207677_102364231 88
615 3300026023 Ga0207677_10247294 Ga0207677_102472944 88
616 3300026023 Ga0207677_10413697 Ga0207677_104136973 88
617 3300026035 Ga0207703_10343359 Ga0207703_103433594 88
618 3300026035 Ga0207703_10421748 Ga0207703_104217483 88
619 3300026035 Ga0207703_10522849 Ga0207703_105228492 88
620 3300026041 Ga0207639_10686133 Ga0207639_106861333 88
621 3300026041 Ga0207639_10954421 Ga0207639_109544212 88
622 3300026067 Ga0207678_10062158 Ga0207678_100621585 88
623 3300026067 Ga0207678_10066402 Ga0207678_100664024 88
624 3300026075 Ga0207708_10001093 Ga0207708_100010934 88
625 3300026075 Ga0207708_10455269 Ga0207708_104552693 88
626 3300026075 Ga0207708_10511461 Ga0207708_105114613 88
627 3300026075 Ga0207708_11448935 Ga0207708_114489352 88
628 3300026075 Ga0207708_11637692 Ga0207708_116376922 88
629 3300026078 Ga0207702_10171726 Ga0207702_101717262 88
630 3300026078 Ga0207702_10996829 Ga0207702_109968293 88
631 3300026088 Ga0207641_10014969 Ga0207641_100149696 88
632 3300026088 Ga0207641_10064332 Ga0207641_100643327 88
633 3300026088 Ga0207641_10200120 Ga0207641_102001204 88
634 3300026088 Ga0207641_10206070 Ga0207641_102060703 88
635 3300026088 Ga0207641_10361365 Ga0207641_103613653 88
636 3300026089 Ga0207648_10007485 Ga0207648_100074858 88
637 3300026089 Ga0207648_10011911 Ga0207648_1001191112 88
638 3300026089 Ga0207648_10150231 Ga0207648_101502315 88
639 3300026089 Ga0207648_11500138 Ga0207648_115001382 88
640 3300026089 Ga0207648_11790717 Ga0207648_117907171 88
641 3300026095 Ga0207676_10098053 Ga0207676_100980536 88
642 3300026095 Ga0207676_10592018 Ga0207676_105920183 88
643 3300026095 Ga0207676_10729959 Ga0207676_107299592 88
644 3300026095 Ga0207676_11104632 Ga0207676_111046323 88
645 3300026095 Ga0207676_11268119 Ga0207676_112681192 88
646 3300026116 Ga0207674_11809654 Ga0207674_118096542 88
647 3300026118 Ga0207675_100153719 Ga0207675_1001537195 88
648 3300026118 Ga0207675_100564433 Ga0207675_1005644332 88
649 3300026118 Ga0207675_100621348 Ga0207675_1006213482 88
650 3300026118 Ga0207675_101030748 Ga0207675_1010307482 88
651 3300026118 Ga0207675_101576150 Ga0207675_1015761502 88
652 3300026121 Ga0207683_10016603 Ga0207683_100166038 88
653 3300026121 Ga0207683_10046066 Ga0207683_100460666 88
654 3300026121 Ga0207683_10083873 Ga0207683_100838733 88
655 3300026121 Ga0207683_10151646 Ga0207683_101516463 88
656 3300026121 Ga0207683_10157805 Ga0207683_101578055 88
657 3300026121 Ga0207683_10594449 Ga0207683_105944492 88
658 3300026121 Ga0207683_10691580 Ga0207683_106915801 88
659 3300026121 Ga0207683_10950776 Ga0207683_109507763 88
660 3300026121 Ga0207683_11006305 Ga0207683_110063052 88
661 3300026142 Ga0207698_10104018 Ga0207698_101040185 88
662 3300026142 Ga0207698_10327331 Ga0207698_103273314 88
663 3300026142 Ga0207698_10531528 Ga0207698_105315284 88
664 3300026142 Ga0207698_10789066 Ga0207698_107890662 88
665 3300027665 Ga0209983_1066781 Ga0209983_10667812 88
666 3300027866 Ga0209813_10085216 Ga0209813_100852162 88
667 3300027876 Ga0209974_10065162 Ga0209974_100651623 88
668 3300027876 Ga0209974_10095280 Ga0209974_100952802 88
669 3300027907 Ga0207428_10016103 Ga0207428_100161039 88
670 3300028379 Ga0268266_10256241 Ga0268266_102562414 88
671 3300028379 Ga0268266_10699476 Ga0268266_106994762 88
672 3300028379 Ga0268266_10981289 Ga0268266_109812893 88
673 3300028379 Ga0268266_11030104 Ga0268266_110301042 88
674 3300028379 Ga0268266_11654958 Ga0268266_116549582 88
675 3300028380 Ga0268265_10122749 Ga0268265_101227495 88
676 3300028380 Ga0268265_10124906 Ga0268265_101249063 88
677 3300028380 Ga0268265_10922509 Ga0268265_109225092 88
678 3300028380 Ga0268265_10937031 Ga0268265_109370312 88
679 3300028380 Ga0268265_11272228 Ga0268265_112722282 88
680 3300028380 Ga0268265_12267722 Ga0268265_122677222 88
681 3300028381 Ga0268264_10266278 Ga0268264_102662782 88
682 3300031548 Ga0307408_100040174 Ga0307408_1000401746 88
683 3300031548 Ga0307408_100176766 Ga0307408_1001767662 88
684 3300031548 Ga0307408_100593034 Ga0307408_1005930343 88
685 3300031731 Ga0307405_10557249 Ga0307405_105572492 88
686 3300031852 Ga0307410_10018152 Ga0307410_100181527 88
687 3300031852 Ga0307410_10458030 Ga0307410_104580302 88
688 3300031852 Ga0307410_11673589 Ga0307410_116735891 88
689 3300031903 Ga0307407_10154023 Ga0307407_101540234 88
690 3300031903 Ga0307407_10219668 Ga0307407_102196683 88
691 3300031911 Ga0307412_10150812 Ga0307412_101508124 88
692 3300031911 Ga0307412_10220979 Ga0307412_102209794 88
693 3300031911 Ga0307412_11552073 Ga0307412_115520732 88
694 3300031995 Ga0307409_100030071 Ga0307409_1000300715 88
695 3300031995 Ga0307409_100089370 Ga0307409_1000893701 88
696 3300032002 Ga0307416_100040357 Ga0307416_1000403576 88
697 3300032002 Ga0307416_100056201 Ga0307416_1000562016 88
698 3300032002 Ga0307416_100360816 Ga0307416_1003608162 88
699 3300032002 Ga0307416_100475328 Ga0307416_1004753283 88
700 3300032002 Ga0307416_100598913 Ga0307416_1005989131 88
701 3300032002 Ga0307416_101061513 Ga0307416_1010615132 88
702 3300032002 Ga0307416_101572766 Ga0307416_1015727662 88
703 3300032002 Ga0307416_101764404 Ga0307416_1017644042 88
704 3300032002 Ga0307416_103701786 Ga0307416_1037017862 88
705 3300032005 Ga0307411_10081445 Ga0307411_100814455 88
706 3300032005 Ga0307411_10319128 Ga0307411_103191283 88
707 3300032005 Ga0307411_10512552 Ga0307411_105125522 88
708 3300032005 Ga0307411_10981694 Ga0307411_109816942 88
709 3300032126 Ga0307415_100195976 Ga0307415_1001959764 88
710 3300032126 Ga0307415_100342065 Ga0307415_1003420652 88
711 3300035091 Ga0373951_0027075 Ga0373951_0027075_901_1167 88
712 3300035112 Ga0373932_0030680 Ga0373932_0030680_1081_1347 88
713 3300035115 Ga0373941_0314819 Ga0373941_0314819_85_351 88
714 3300035116 Ga0373945_0305763 Ga0373945_0305763_26_292 88
715 3300035119 Ga0373956_0408164 Ga0373956_0408164_302_586 88
716 3300035170 Ga0373943_0121418 Ga0373943_0121418_746_1030 88
717 3300035171 Ga0373946_0144595 Ga0373946_0144595_675_959 88
718 3300035172 Ga0373955_0191679 Ga0373955_0191679_526_810 88
719 3300035207 Ga0373942_0073203 Ga0373942_0073203_569_835 88
720 3300035241 Ga0373961_0111885 Ga0373961_0111885_304_570 88
721 3300035241 Ga0373961_0226756 Ga0373961_0226756_60_326 88
722 3300035242 Ga0373962_0187825 Ga0373962_0187825_17_283 88
723 3300035691 Ga0373931_0092841 Ga0373931_0092841_1051_1317 88
724 3300035691 Ga0373931_0592533 Ga0373931_0592533_340_606 88
725 3300036401 Ga0373937_0000651 Ga0373937_0000651_11797_12066 88
726 3300036401 Ga0373937_0280691 Ga0373937_0280691_527_793 88
727 3300037068 Ga0373925_1139757 Ga0373925_1139757_276_542 88
728 3300037418 Ga0395900_0875039 Ga0395900_0875039_212_478 88
729 3300039437 Ga0436365_0113116 Ga0436365_0113116_782_1048 88
730 3300041406 Ga0439439_0086069 Ga0439439_0086069_518_790 88
731 3300041410 Ga0439461_0060476 Ga0439461_0060476_306_575 88
732 3300041451 Ga0451791_1519790 Ga0451791_1519790_13_279 88
733 3300041452 Ga0451793_0108495 Ga0451793_0108495_151_417 88
734 3300041460 Ga0451802_0119544 Ga0451802_0119544_140_406 88
735 3300041486 Ga0451807_0449784 Ga0451807_0449784_314_598 88
736 3300041501 Ga0451845_0675573 Ga0451845_0675573_190_456 88
737 3300041512 Ga0451853_0170158 Ga0451853_0170158_325_606 88
738 3300041512 Ga0451853_1132466 Ga0451853_1132466_210_476 88
739 3300041512 Ga0451853_1313310 Ga0451853_1313310_97_363 88
740 3300041512 Ga0451853_2018823 Ga0451853_2018823_570_836 88
741 3300041999 Ga0439433_0021574 Ga0439433_0021574_393_662 88
742 3300041999 Ga0439433_0051436 Ga0439433_0051436_541_813 88
743 3300042007 Ga0439449_0120317 Ga0439449_0120317_43_309 88
744 3300042011 Ga0439454_056707 Ga0439454_056707_240_506 88
745 3300042014 Ga0439457_116874 Ga0439457_116874_39_311 88
746 3300042015 Ga0439462_0091092 Ga0439462_0091092_152_421 88
747 3300042122 Ga0450920_018330 Ga0450920_018330_460_753 88
748 3300042122 Ga0450920_044911 Ga0450920_044911_462_728 88
749 3300042125 Ga0450923_012281 Ga0450923_012281_1196_1489 88
750 3300042131 Ga0450894_002011 Ga0450894_002011_644_937 88
751 3300042132 Ga0450895_005338 Ga0450895_005338_503_796 88
752 3300042133 Ga0450896_000284 Ga0450896_000284_3502_3795 88
753 3300042135 Ga0450899_017456 Ga0450899_017456_446_739 88
754 3300042142 Ga0450905_075900 Ga0450905_075900_139_414 88
755 3300042145 Ga0450906_038357 Ga0450906_038357_233_526 88
756 3300042156 Ga0439446_0013235 Ga0439446_0013235_1859_2128 88
757 3300042156 Ga0439446_0107312 Ga0439446_0107312_502_768 88
758 3300042184 Ga0450908_020092 Ga0450908_020092_445_738 88
759 3300042435 Ga0439434_0070902 Ga0439434_0070902_143_409 88
760 3300042435 Ga0439434_0272390 Ga0439434_0272390_224_493 88
761 3300042436 Ga0439435_0040353 Ga0439435_0040353_356_622 88
762 3300042461 Ga0439460_0028314 Ga0439460_0028314_989_1267 88
763 3300042530 Ga0450916_065943 Ga0450916_065943_285_551 88
764 3300042532 Ga0450893_0007133 Ga0450893_0007133_278_571 88
765 3300042876 Ga0451577_0033978 Ga0451577_0033978_1937_2203 88
766 3300044712 Ga0453684_0230994 Ga0453684_0230994_33_299 88
767 3300045051 Ga0451576_0585839 Ga0451576_0585839_319_594 88
768 3300046454 Ga0495592_0860683 Ga0495592_0860683_142_411 88
769 3300046455 Ga0495603_0015692 Ga0495603_0015692_3667_3948 88
770 3300046459 Ga0495629_0264585 Ga0495629_0264585_840_1121 88
771 3300046462 Ga0495651_0790365 Ga0495651_0790365_53_319 88
772 3300046463 Ga0495653_0016842 Ga0495653_0016842_325_591 88
773 3300046473 Ga0495582_0584143 Ga0495582_0584143_123_407 88
774 3300046492 Ga0495585_0612910 Ga0495585_0612910_176_457 88
775 3300046499 Ga0495594_0235853 Ga0495594_0235853_64_333 88
776 3300046517 Ga0495630_0924182 Ga0495630_0924182_248_532 88
777 3300046529 Ga0495652_0255448 Ga0495652_0255448_184_465 88
778 3300046533 Ga0495640_0245015 Ga0495640_0245015_143_409 88
779 3300046535 Ga0495586_0282431 Ga0495586_0282431_194_460 88
780 3300046539 Ga0495621_0190859 Ga0495621_0190859_208_474 88
781 3300046559 Ga0495667_0114538 Ga0495667_0114538_716_982 88
782 3300046642 Ga0495634_0579531 Ga0495634_0579531_314_580 88
783 3300046663 Ga0495635_0314122 Ga0495635_0314122_315_599 88
784 3300046664 Ga0495659_0286459 Ga0495659_0286459_387_680 88
785 3300046683 Ga0495658_0099746 Ga0495658_0099746_735_1001 88
786 3300046683 Ga0495658_0172874 Ga0495658_0172874_532_813 88
787 3300046683 Ga0495658_0569642 Ga0495658_0569642_151_417 88
788 3300046683 Ga0495658_0801188 Ga0495658_0801188_100_366 88
789 3300046689 Ga0495613_0589545 Ga0495613_0589545_177_461 88
790 3300047317 Ga0495604_0200006 Ga0495604_0200006_20_304 88
791 3300047319 Ga0495674_0077950 Ga0495674_0077950_2244_2528 88
792 3300047319 Ga0495674_0439832 Ga0495674_0439832_606_872 88
793 3300047319 Ga0495674_0645816 Ga0495674_0645816_486_767 88
794 3300047319 Ga0495674_0802443 Ga0495674_0802443_24_293 88
795 3300048903 Ga0496100_0152608 Ga0496100_0152608_722_1003 88
796 3300048903 Ga0496100_0531087 Ga0496100_0531087_329_595 88
797 3300048903 Ga0496100_0540795 Ga0496100_0540795_459_725 88
798 3300048904 Ga0496101_0025059 Ga0496101_0025059_1225_1506 88
799 3300048904 Ga0496101_0468680 Ga0496101_0468680_113_379 88
800 3300048904 Ga0496101_0915932 Ga0496101_0915932_315_596 88
801 3300048904 Ga0496101_0963197 Ga0496101_0963197_57_323 88
802 3300048905 Ga0496102_0166996 Ga0496102_0166996_1312_1593 88
803 3300048905 Ga0496102_0560969 Ga0496102_0560969_358_639 88
804 3300048905 Ga0496102_1548139 Ga0496102_1548139_41_307 88
805 3300048905 Ga0496102_1578786 Ga0496102_1578786_286_552 88
806 3300048906 Ga0496103_0213103 Ga0496103_0213103_402_668 88
807 3300048907 Ga0496104_0000157 Ga0496104_0000157_25018_25284 88
808 3300048907 Ga0496104_0042987 Ga0496104_0042987_292_573 88
809 3300048907 Ga0496104_0086907 Ga0496104_0086907_2106_2387 88
810 3300048907 Ga0496104_0404824 Ga0496104_0404824_507_773 88
811 3300048908 Ga0496105_0593340 Ga0496105_0593340_459_740 88
812 3300048908 Ga0496105_0811839 Ga0496105_0811839_65_331 88
813 3300048908 Ga0496105_0837321 Ga0496105_0837321_273_554 88
814 3300048909 Ga0496106_0111211 Ga0496106_0111211_368_634 88
815 3300048909 Ga0496106_0349184 Ga0496106_0349184_533_799 88
816 3300048909 Ga0496106_0443834 Ga0496106_0443834_220_501 88
817 3300048909 Ga0496106_0506700 Ga0496106_0506700_644_931 88
818 3300048909 Ga0496106_0849733 Ga0496106_0849733_10_291 88
819 3300048909 Ga0496106_0974294 Ga0496106_0974294_341_607 88
820 3300048910 Ga0496107_0078155 Ga0496107_0078155_1138_1419 88
821 3300048910 Ga0496107_0135686 Ga0496107_0135686_201_482 88
822 3300048910 Ga0496107_0361523 Ga0496107_0361523_324_590 88
823 3300048910 Ga0496107_0742530 Ga0496107_0742530_283_549 88
824 3300048910 Ga0496107_0846301 Ga0496107_0846301_299_589 88
825 3300048911 Ga0496108_0008261 Ga0496108_0008261_1361_1627 88
826 3300048911 Ga0496108_0132996 Ga0496108_0132996_188_469 88
827 3300048911 Ga0496108_0200393 Ga0496108_0200393_723_1004 88
828 3300048911 Ga0496108_0204459 Ga0496108_0204459_277_543 88
829 3300048911 Ga0496108_0395800 Ga0496108_0395800_846_1112 88
830 3300048911 Ga0496108_0509991 Ga0496108_0509991_392_658 88
831 3300048912 Ga0496109_0010308 Ga0496109_0010308_4957_5238 88
832 3300048912 Ga0496109_0011076 Ga0496109_0011076_5860_6126 88
833 3300048912 Ga0496109_0098078 Ga0496109_0098078_2129_2395 88
834 3300048912 Ga0496109_0148942 Ga0496109_0148942_633_899 88
835 3300048912 Ga0496109_0228590 Ga0496109_0228590_1294_1560 88
836 3300048912 Ga0496109_0948229 Ga0496109_0948229_221_487 88
837 3300048912 Ga0496109_1087468 Ga0496109_1087468_286_567 88
838 3300048913 Ga0496110_0002759 Ga0496110_0002759_1688_1954 88
839 3300048913 Ga0496110_0010807 Ga0496110_0010807_1393_1659 88
840 3300048913 Ga0496110_0011106 Ga0496110_0011106_920_1201 88
841 3300048913 Ga0496110_0111841 Ga0496110_0111841_375_656 88
842 3300048913 Ga0496110_0182747 Ga0496110_0182747_1232_1498 88
843 3300048913 Ga0496110_1503263 Ga0496110_1503263_186_455 88
844 3300048914 Ga0496111_0013452 Ga0496111_0013452_1156_1437 88
845 3300048914 Ga0496111_0065455 Ga0496111_0065455_918_1184 88
846 3300048914 Ga0496111_0118079 Ga0496111_0118079_1063_1329 88
847 3300048914 Ga0496111_0510770 Ga0496111_0510770_521_787 88
848 3300048914 Ga0496111_0647055 Ga0496111_0647055_68_334 88
849 3300048915 Ga0496112_0000148 Ga0496112_0000148_23057_23323 88
850 3300048915 Ga0496112_0004165 Ga0496112_0004165_8137_8418 88
851 3300048915 Ga0496112_0232059 Ga0496112_0232059_890_1156 88
852 3300048915 Ga0496112_0301031 Ga0496112_0301031_638_904 88
853 3300048915 Ga0496112_0995801 Ga0496112_0995801_38_304 88
854 3300048916 Ga0496113_0103583 Ga0496113_0103583_177_458 88
855 3300048917 Ga0496114_0027098 Ga0496114_0027098_329_610 88
856 3300048917 Ga0496114_0444674 Ga0496114_0444674_103_369 88
857 3300049568 Ga0501031_0110018 Ga0501031_0110018_909_1175 88
858 3300049568 Ga0501031_0243145 Ga0501031_0243145_87_353 88
859 3300049569 Ga0501032_0094652 Ga0501032_0094652_1513_1779 88
860 3300049569 Ga0501032_0601387 Ga0501032_0601387_184_450 88
861 3300049569 Ga0501032_0638444 Ga0501032_0638444_324_590 88
862 3300049570 Ga0501033_0048274 Ga0501033_0048274_894_1160 88
863 3300049570 Ga0501033_0139266 Ga0501033_0139266_1457_1723 88
864 3300049570 Ga0501033_0807887 Ga0501033_0807887_68_334 88
865 3300049571 Ga0501034_0006113 Ga0501034_0006113_2231_2497 88
866 3300049571 Ga0501034_0128066 Ga0501034_0128066_407_673 88
867 3300049571 Ga0501034_0663665 Ga0501034_0663665_539_805 88
868 3300049571 Ga0501034_1246297 Ga0501034_1246297_186_452 88
869 3300049572 Ga0501036_0021023 Ga0501036_0021023_886_1152 88
870 3300049572 Ga0501036_0175496 Ga0501036_0175496_918_1184 88
871 3300049572 Ga0501036_0177638 Ga0501036_0177638_1022_1294 88
872 3300049572 Ga0501036_0214351 Ga0501036_0214351_1023_1289 88
873 3300049572 Ga0501036_0728600 Ga0501036_0728600_487_753 88
874 3300049572 Ga0501036_0888572 Ga0501036_0888572_357_632 88
875 3300049573 Ga0501037_0150182 Ga0501037_0150182_1142_1408 88
876 3300049573 Ga0501037_0765940 Ga0501037_0765940_10_276 88
877 3300049574 Ga0501038_0026845 Ga0501038_0026845_313_579 88
878 3300049574 Ga0501038_0065980 Ga0501038_0065980_1041_1307 88
879 3300049574 Ga0501038_0557184 Ga0501038_0557184_411_677 88
880 3300049575 Ga0501039_0086565 Ga0501039_0086565_15_281 88
881 3300049575 Ga0501039_0121123 Ga0501039_0121123_435_701 88
882 3300049575 Ga0501039_1588473 Ga0501039_1588473_42_335 88
883 3300049576 Ga0501040_0202994 Ga0501040_0202994_395_661 88
884 3300049576 Ga0501040_0486101 Ga0501040_0486101_53_328 88
885 3300049576 Ga0501040_0616573 Ga0501040_0616573_357_623 88
886 3300049576 Ga0501040_0702329 Ga0501040_0702329_355_621 88
887 3300049576 Ga0501040_0782944 Ga0501040_0782944_277_543 88
888 3300049577 Ga0501041_0082306 Ga0501041_0082306_1204_1470 88
889 3300049577 Ga0501041_0155832 Ga0501041_0155832_876_1142 88
890 3300049578 Ga0501042_0021483 Ga0501042_0021483_1908_2174 88
891 3300049578 Ga0501042_0260722 Ga0501042_0260722_775_1041 88
892 3300049578 Ga0501042_0371331 Ga0501042_0371331_32_298 88
893 3300049578 Ga0501042_0465593 Ga0501042_0465593_111_377 88
894 3300049578 Ga0501042_0992274 Ga0501042_0992274_287_553 88
895 3300049579 Ga0501043_0003776 Ga0501043_0003776_1465_1731 88
896 3300049579 Ga0501043_0349186 Ga0501043_0349186_612_881 88
897 3300049579 Ga0501043_0424204 Ga0501043_0424204_616_882 88
898 3300049579 Ga0501043_0974685 Ga0501043_0974685_290_562 88
899 3300049579 Ga0501043_1235536 Ga0501043_1235536_213_479 88
900 3300049580 Ga0501046_0005320 Ga0501046_0005320_11199_11465 88
901 3300049580 Ga0501046_0011536 Ga0501046_0011536_175_441 88
902 3300049580 Ga0501046_0069357 Ga0501046_0069357_1280_1546 88
903 3300049580 Ga0501046_0296786 Ga0501046_0296786_237_503 88
904 3300049580 Ga0501046_1012268 Ga0501046_1012268_13_285 88
905 3300049580 Ga0501046_1037604 Ga0501046_1037604_17_283 88
906 3300049581 Ga0501047_0001473 Ga0501047_0001473_12051_12317 88
907 3300049581 Ga0501047_0051950 Ga0501047_0051950_3166_3432 88
908 3300049581 Ga0501047_0096646 Ga0501047_0096646_1760_2026 88
909 3300049581 Ga0501047_0156752 Ga0501047_0156752_12_278 88
910 3300049581 Ga0501047_0440795 Ga0501047_0440795_640_906 88
911 3300049582 Ga0501048_0151199 Ga0501048_0151199_580_846 88
912 3300049582 Ga0501048_0156468 Ga0501048_0156468_1252_1518 88
913 3300049582 Ga0501048_0975704 Ga0501048_0975704_155_421 88
914 3300049583 Ga0501067_0228787 Ga0501067_0228787_757_1023 88
915 3300049583 Ga0501067_0247372 Ga0501067_0247372_630_896 88
916 3300049583 Ga0501067_0436425 Ga0501067_0436425_214_480 88
917 3300049583 Ga0501067_0500022 Ga0501067_0500022_147_416 88
918 3300049584 Ga0501068_0006774 Ga0501068_0006774_4286_4552 88
919 3300049584 Ga0501068_0620940 Ga0501068_0620940_297_566 88
920 3300049585 Ga0501069_0217962 Ga0501069_0217962_383_649 88
921 3300049585 Ga0501069_0784561 Ga0501069_0784561_295_561 88
922 3300049586 Ga0501070_0404719 Ga0501070_0404719_745_1011 88
923 3300049587 Ga0501071_0055007 Ga0501071_0055007_701_967 88
924 3300049587 Ga0501071_0137129 Ga0501071_0137129_741_1007 88
925 3300049587 Ga0501071_0177385 Ga0501071_0177385_663_935 88
926 3300049587 Ga0501071_1174141 Ga0501071_1174141_229_495 88
927 3300049588 Ga0501072_0018755 Ga0501072_0018755_2202_2474 88
928 3300049588 Ga0501072_0040269 Ga0501072_0040269_2816_3082 88
929 3300049588 Ga0501072_0264553 Ga0501072_0264553_688_954 88
930 3300049588 Ga0501072_0346760 Ga0501072_0346760_677_943 88
931 3300049588 Ga0501072_0529226 Ga0501072_0529226_271_540 88
932 3300049588 Ga0501072_0584751 Ga0501072_0584751_361_645 88
933 3300049588 Ga0501072_0601348 Ga0501072_0601348_229_495 88
934 3300049588 Ga0501072_0837720 Ga0501072_0837720_165_431 88
935 3300049588 Ga0501072_1474436 Ga0501072_1474436_232_498 88
936 3300049589 Ga0501073_0040646 Ga0501073_0040646_1495_1761 88
937 3300049589 Ga0501073_0110912 Ga0501073_0110912_699_974 88
938 3300049589 Ga0501073_0118916 Ga0501073_0118916_501_767 88
939 3300049589 Ga0501073_0147300 Ga0501073_0147300_1104_1370 88
940 3300049589 Ga0501073_0192543 Ga0501073_0192543_54_320 88
941 3300049589 Ga0501073_0224747 Ga0501073_0224747_215_481 88
942 3300049589 Ga0501073_0378015 Ga0501073_0378015_568_834 88
943 3300049589 Ga0501073_0383720 Ga0501073_0383720_16_282 88
944 3300049590 Ga0501074_0160395 Ga0501074_0160395_1230_1496 88
945 3300049590 Ga0501074_0162251 Ga0501074_0162251_599_865 88
946 3300049590 Ga0501074_0186184 Ga0501074_0186184_442_714 88
947 3300049590 Ga0501074_0706996 Ga0501074_0706996_62_328 88
948 3300049591 Ga0501075_0042891 Ga0501075_0042891_792_1058 88
949 3300049591 Ga0501075_0060105 Ga0501075_0060105_889_1161 88
950 3300049591 Ga0501075_0088648 Ga0501075_0088648_1233_1499 88
951 3300049591 Ga0501075_0189572 Ga0501075_0189572_354_620 88
952 3300049592 Ga0501076_0005978 Ga0501076_0005978_1711_1977 88
953 3300049592 Ga0501076_0086660 Ga0501076_0086660_1566_1841 88
954 3300049592 Ga0501076_0241737 Ga0501076_0241737_541_807 88
955 3300049592 Ga0501076_0252368 Ga0501076_0252368_143_415 88
956 3300049592 Ga0501076_0323579 Ga0501076_0323579_722_988 88
957 3300049592 Ga0501076_0452904 Ga0501076_0452904_360_638 88
958 3300049592 Ga0501076_0775457 Ga0501076_0775457_329_595 88
959 3300049592 Ga0501076_1358166 Ga0501076_1358166_135_419 88
960 3300049593 Ga0501077_0040315 Ga0501077_0040315_1322_1588 88
961 3300049593 Ga0501077_0419057 Ga0501077_0419057_445_711 88
962 3300049593 Ga0501077_0574753 Ga0501077_0574753_188_457 88
963 3300049679 Ga0501249_173077 Ga0501249_173077_208_474 88
964 3300049741 Ga0501079_0058537 Ga0501079_0058537_1716_1982 88
965 3300049741 Ga0501079_0103295 Ga0501079_0103295_529_795 88
966 3300049741 Ga0501079_0291780 Ga0501079_0291780_979_1245 88
967 3300049741 Ga0501079_0312420 Ga0501079_0312420_939_1205 88
968 3300049741 Ga0501079_0876309 Ga0501079_0876309_111_386 88
969 3300049741 Ga0501079_0881503 Ga0501079_0881503_322_588 88
970 3300049742 Ga0501080_0027293 Ga0501080_0027293_208_474 88
971 3300049742 Ga0501080_0287010 Ga0501080_0287010_423_689 88
972 3300049742 Ga0501080_0291905 Ga0501080_0291905_311_577 88
973 3300049742 Ga0501080_0607157 Ga0501080_0607157_396_662 88
974 3300049742 Ga0501080_0608565 Ga0501080_0608565_646_912 88
975 3300049742 Ga0501080_0621866 Ga0501080_0621866_183_449 88
976 3300049742 Ga0501080_0746448 Ga0501080_0746448_12_281 88
977 3300049742 Ga0501080_1534035 Ga0501080_1534035_193_459 88
978 3300049742 Ga0501080_1557705 Ga0501080_1557705_275_541 88
979 3300049743 Ga0501081_0042825 Ga0501081_0042825_514_780 88
980 3300049743 Ga0501081_0299607 Ga0501081_0299607_714_980 88
981 3300049743 Ga0501081_0635315 Ga0501081_0635315_270_536 88
982 3300049743 Ga0501081_0710202 Ga0501081_0710202_54_323 88
983 3300049744 Ga0501083_0012875 Ga0501083_0012875_227_493 88
984 3300049744 Ga0501083_0115600 Ga0501083_0115600_227_493 88
985 3300049822 Ga0501035_0094786 Ga0501035_0094786_563_829 88
986 3300049822 Ga0501035_0193773 Ga0501035_0193773_1170_1436 88
987 3300049823 Ga0501044_0025113 Ga0501044_0025113_5880_6146 88
988 3300049823 Ga0501044_0037359 Ga0501044_0037359_357_623 88
989 3300049824 Ga0501045_0046206 Ga0501045_0046206_1978_2244 88
990 3300049824 Ga0501045_0128366 Ga0501045_0128366_371_637 88
991 3300049824 Ga0501045_0850916 Ga0501045_0850916_64_330 88
992 3300049824 Ga0501045_0930076 Ga0501045_0930076_320_586 88
993 3300050489 nmdc:mga03683_11941_c1 nmdc:mga03683_11941_c1_713_979 88
994 3300050491 nmdc:mga00v17_59698_c1 nmdc:mga00v17_59698_c1_898_1164 88
995 3300050492 nmdc:mga0yw44_1015696_c1 nmdc:mga0yw44_1015696_c1_251_517 88
996 3300050492 nmdc:mga0yw44_303014_c1 nmdc:mga0yw44_303014_c1_399_665 88
997 3300050493 nmdc:mga0k408_290120_c1 nmdc:mga0k408_290120_c1_309_578 88
998 3300050493 nmdc:mga0k408_5399_c1 nmdc:mga0k408_5399_c1_76_342 88
999 3300050493 nmdc:mga0k408_6905_c1 nmdc:mga0k408_6905_c1_4276_4542 88
1000 3300050494 nmdc:mga06z11_294816_c1 nmdc:mga06z11_294816_c1_284_550 88
1001 3300050495 nmdc:mga04h51_72200_c1 nmdc:mga04h51_72200_c1_367_633 88
1002 3300050507 nmdc:mga05p37_1068279_c1 nmdc:mga05p37_1068279_c1_183_449 88
1003 3300050507 nmdc:mga05p37_167732_c1 nmdc:mga05p37_167732_c1_1050_1328 88
1004 3300050507 nmdc:mga05p37_2454_c1 nmdc:mga05p37_2454_c1_12070_12336 88
1005 3300050507 nmdc:mga05p37_34417_c1 nmdc:mga05p37_34417_c1_2801_3067 88
1006 3300050507 nmdc:mga05p37_41627_c1 nmdc:mga05p37_41627_c1_3882_4148 88
1007 3300050507 nmdc:mga05p37_613640_c2 nmdc:mga05p37_613640_c2_371_643 88
1008 3300050507 nmdc:mga05p37_63372_c1 nmdc:mga05p37_63372_c1_845_1111 88
1009 3300050508 nmdc:mga09592_143785_c1 nmdc:mga09592_143785_c1_769_1047 88
1010 3300050508 nmdc:mga09592_144718_c1 nmdc:mga09592_144718_c1_456_731 88
1011 3300050509 nmdc:mga0qj67_139841_c1 nmdc:mga0qj67_139841_c1_1275_1553 88
1012 3300050509 nmdc:mga0qj67_45318_c1 nmdc:mga0qj67_45318_c1_179_445 88
1013 3300050510 nmdc:mga06r32_36771_c1 nmdc:mga06r32_36771_c1_4064_4336 88
1014 3300050510 nmdc:mga06r32_454924_c1 nmdc:mga06r32_454924_c1_542_820 88
1015 3300050510 nmdc:mga06r32_66537_c1 nmdc:mga06r32_66537_c1_237_509 88
1016 3300050510 nmdc:mga06r32_7498_c1 nmdc:mga06r32_7498_c1_47_313 88
1017 3300050511 nmdc:mga08y16_1464923_c1 nmdc:mga08y16_1464923_c1_128_394 88
1018 3300050511 nmdc:mga08y16_167701_c1 nmdc:mga08y16_167701_c1_1147_1413 88
1019 3300050511 nmdc:mga08y16_1963090_c1 nmdc:mga08y16_1963090_c1_135_410 88
1020 3300050511 nmdc:mga08y16_20168_c1 nmdc:mga08y16_20168_c1_6300_6566 88
1021 3300050511 nmdc:mga08y16_2821_c1 nmdc:mga08y16_2821_c1_2063_2338 88
1022 3300050511 nmdc:mga08y16_66551_c2 nmdc:mga08y16_66551_c2_1730_2002 88
1023 3300050511 nmdc:mga08y16_716615_c1 nmdc:mga08y16_716615_c1_673_957 88
1024 3300050512 nmdc:mga0n895_115148_c1 nmdc:mga0n895_115148_c1_810_1076 88
1025 3300050512 nmdc:mga0n895_233473_c1 nmdc:mga0n895_233473_c1_654_920 88
1026 3300050512 nmdc:mga0n895_24578_c1 nmdc:mga0n895_24578_c1_2040_2306 88
1027 3300050512 nmdc:mga0n895_368008_c1 nmdc:mga0n895_368008_c1_774_1043 88
1028 3300050513 nmdc:mga0rr50_165429_c1 nmdc:mga0rr50_165429_c1_1122_1388 88
1029 3300050513 nmdc:mga0rr50_1819885_c1 nmdc:mga0rr50_1819885_c1_164_442 88
1030 3300050513 nmdc:mga0rr50_1831293_c1 nmdc:mga0rr50_1831293_c1_135_401 88
1031 3300050513 nmdc:mga0rr50_30217_c1 nmdc:mga0rr50_30217_c1_1973_2239 88
1032 3300050514 nmdc:mga08x19_212632_c1 nmdc:mga08x19_212632_c1_928_1194 88
1033 3300050514 nmdc:mga08x19_301288_c1 nmdc:mga08x19_301288_c1_160_426 88
1034 3300050514 nmdc:mga08x19_355707_c1 nmdc:mga08x19_355707_c1_106_372 88
1035 3300050515 nmdc:mga0a205_1146693_c1 nmdc:mga0a205_1146693_c1_234_512 88
1036 3300050515 nmdc:mga0a205_49034_c1 nmdc:mga0a205_49034_c1_363_629 88
1037 3300050515 nmdc:mga0a205_61638_c1 nmdc:mga0a205_61638_c1_1981_2247 88
1038 3300050515 nmdc:mga0a205_65091_c1 nmdc:mga0a205_65091_c1_169_435 88
1039 3300050515 nmdc:mga0a205_6759_c1 nmdc:mga0a205_6759_c1_4336_4602 88
1040 3300053077 Ga0495601_0076870 Ga0495601_0076870_1549_1818 88
1041 3300053077 Ga0495601_0084465 Ga0495601_0084465_706_990 88
1042 3300053084 Ga0495595_0042625 Ga0495595_0042625_249_533 88
1043 3300053084 Ga0495595_0115643 Ga0495595_0115643_135_404 88
1044 3300053084 Ga0495595_0652844 Ga0495595_0652844_162_428 88
1045 3300053085 Ga0495619_0001225 Ga0495619_0001225_12546_12830 88
1046 3300054114 Ga0501084_0006584 Ga0501084_0006584_193_459 88
1047 3300054114 Ga0501084_0017135 Ga0501084_0017135_5236_5502 88
1048 3300054114 Ga0501084_0035496 Ga0501084_0035496_1242_1508 88
1049 3300054114 Ga0501084_0162260 Ga0501084_0162260_826_1098 88
1050 3300054114 Ga0501084_0550247 Ga0501084_0550247_144_410 88
1051 3300054114 Ga0501084_0587188 Ga0501084_0587188_324_590 88
1052 3300054114 Ga0501084_0718101 Ga0501084_0718101_384_650 88
1053 3300054114 Ga0501084_0869774 Ga0501084_0869774_355_633 88
1054 3300054114 Ga0501084_1590854 Ga0501084_1590854_180_446 88
1055 3300059421 Ga0590071_004751 Ga0590071_004751_621_920 88
1056 3300059424 Ga0590075_003372 Ga0590075_003372_1057_1356 88
1057 3300059426 Ga0590077_008658 Ga0590077_008658_1066_1365 88
1058 3300060353 Ga0501082_0026825 Ga0501082_0026825_2567_2833 88
1059 3300060353 Ga0501082_0160030 Ga0501082_0160030_275_541 88
1060 3300060353 Ga0501082_0272132 Ga0501082_0272132_526_792 88
1061 3300060353 Ga0501082_0758095 Ga0501082_0758095_61_327 88
1062 3300060353 Ga0501082_0776644 Ga0501082_0776644_380_646 88
1063 3300060353 Ga0501082_0920344 Ga0501082_0920344_244_513 88
1064 3300060353 Ga0501082_0935583 Ga0501082_0935583_111_380 88
1065 3300060353 Ga0501082_0962246 Ga0501082_0962246_343_609 88
1066 3300060353 Ga0501082_1627775 Ga0501082_1627775_111_383 88
1067 3300061734 Ga0530510_0344118 Ga0530510_0344118_661_927 88
1068 3300061734 Ga0530510_0390335 Ga0530510_0390335_566_832 88
1069 3300061734 Ga0530510_0445218 Ga0530510_0445218_375_641 88
1070 3300061734 Ga0530510_0544508 Ga0530510_0544508_201_467 88
1071 3300061734 Ga0530510_0683748 Ga0530510_0683748_145_411 88
1072 3300061734 Ga0530510_0745755 Ga0530510_0745755_94_369 88

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03319

EutN_CcmL

Ethanolamine utilisation protein EutN/carboxysome

1

85

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i7a-assembly1.cif.gz_B grpn pentameric microcompartment shell protein from rhodospirillum rubrum 0.9187 1 87
4i7a-assembly1.cif.gz_A grpn pentameric microcompartment shell protein from rhodospirillum rubrum 0.9175 1 88
4i7a-assembly1.cif.gz_C grpn pentameric microcompartment shell protein from rhodospirillum rubrum 0.9155 1 88
4i7a-assembly1.cif.gz_B grpn pentameric microcompartment shell protein from rhodospirillum rubrum 0.9082 1 87
4i7a-assembly1.cif.gz_A grpn pentameric microcompartment shell protein from rhodospirillum rubrum 0.9073 1 88
ID Description Score Start End Superfamily
4i7aB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml 0.9187 1 87 2.40.50.220
4i7aB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml 0.9082 1 87 2.40.50.220
4n8x100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml 0.8747 1 83 2.40.50.220
2z9hB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml 0.8653 1 83 2.40.50.220
2hd3F00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml 0.8632 2 83 2.40.50.220
ID Description Score Start End GO Terms
AF-A0A523NDQ4-F1-model_v4 Ethanolamine utilization protein EutN 0.982 1 60 GO:0031469
AF-X1G3E1-F1-model_v4 Ethanolamine utilization protein EutN 0.977 1 64 GO:0031469
AF-X1HQN0-F1-model_v4 Ethanolamine utilization protein EutN 0.975 1 60 GO:0031469
AF-A0A831KBR1-F1-model_v4 Ethanolamine utilization protein EutN 0.9721 1 56 GO:0031469
AF-A0A3N5X188-F1-model_v4 Ethanolamine utilization protein EutN 0.9672 2 55 GO:0031469

Feature Viewer

pLDDT pTM Quality
87.69 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map