F489502
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1072 | 341 | 1072 | 89 |
Family's Representative Sequence
| Representative Sequence | 3300005364|Ga0070673_101341274|Ga0070673_1013412741 |
| Length | 103 |
| Sequence | VQLARVIGDVVATVKDPRLDGHKLLILQPITPDPEPRPVGRTLIAIDSTGAGVGEYVFFVRGREASFPFLPVETPVDACVIGIIDHWDLEPGAGSLQPGAPSL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 76 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 81 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 82 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 121 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 187 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 188 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 190 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 191 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 192 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 193 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 194 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 195 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 196 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 197 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 198 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 200 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 201 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 202 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 204 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 206 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 209 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 213 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 214 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 215 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 216 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 217 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 218 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 219 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 222 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 223 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 224 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 225 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 226 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 227 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 228 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 229 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 230 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 231 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 232 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 233 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 234 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 235 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 236 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 237 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 238 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 239 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 240 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 241 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 242 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 243 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 244 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 245 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 246 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 247 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 272 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 273 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 274 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 275 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 276 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 277 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 280 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 281 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 282 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 283 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 284 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 311 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 319 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 320 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 321 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 322 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 323 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 324 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 338 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 339 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 340 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.91 |
| Metatranscriptomes | 0.09 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.96 |
| Nodule | 0 |
| Rhizoplane | 6.53 |
| Rhizosphere | 90.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10138864 | 3300001991 | Unclassified | 540 |
| 2 | JGI24744J21845_10089966 | 3300002077 | Unclassified | 563 |
| 3 | JGI24034J26672_10063540 | 3300002239 | Bacteria | 652 |
| 4 | JGI24751J29686_10047507 | 3300002459 | Bacteria | 886 |
| 5 | Ga0065714_10191579 | 3300005288 | Unclassified | 926 |
| 6 | Ga0065704_10409366 | 3300005289 | Bacteria | 743 |
| 7 | Ga0065712_10000353 | 3300005290 | Bacteria | 21043 |
| 8 | Ga0065712_10085891 | 3300005290 | Bacteria | 2667 |
| 9 | Ga0065712_10193404 | 3300005290 | Bacteria | 1138 |
| 10 | Ga0065712_10245698 | 3300005290 | Bacteria | 972 |
| 11 | Ga0065712_10442568 | 3300005290 | Unclassified | 693 |
| 12 | Ga0065715_10090861 | 3300005293 | Bacteria | 6371 |
| 13 | Ga0065715_10122953 | 3300005293 | Unclassified | 2190 |
| 14 | Ga0065715_10158840 | 3300005293 | Bacteria | 1633 |
| 15 | Ga0065715_10208819 | 3300005293 | Bacteria | 1314 |
| 16 | Ga0065715_10255844 | 3300005293 | Bacteria | 1153 |
| 17 | Ga0065715_10378796 | 3300005293 | Unclassified | 910 |
| 18 | Ga0065715_10422987 | 3300005293 | Bacteria | 856 |
| 19 | Ga0065715_10692944 | 3300005293 | Bacteria | 657 |
| 20 | Ga0065707_10004263 | 3300005295 | Bacteria | 3652 |
| 21 | Ga0065707_10102583 | 3300005295 | Bacteria | 2797 |
| 22 | Ga0070676_10050842 | 3300005328 | Bacteria | 2431 |
| 23 | Ga0070676_10125248 | 3300005328 | Bacteria | 1618 |
| 24 | Ga0070676_10139873 | 3300005328 | Bacteria | 1540 |
| 25 | Ga0070676_10962820 | 3300005328 | Bacteria | 639 |
| 26 | Ga0070683_100001936 | 3300005329 | Bacteria | 16209 |
| 27 | Ga0070683_100049491 | 3300005329 | Bacteria | 3888 |
| 28 | Ga0070690_100063175 | 3300005330 | Unclassified | 2389 |
| 29 | Ga0070690_100114351 | 3300005330 | Bacteria | 1804 |
| 30 | Ga0070690_100313695 | 3300005330 | Bacteria | 1128 |
| 31 | Ga0070690_101154256 | 3300005330 | Unclassified | 616 |
| 32 | Ga0070670_100001546 | 3300005331 | Bacteria | 18553 |
| 33 | Ga0070670_100024170 | 3300005331 | Bacteria | 5228 |
| 34 | Ga0070670_100047682 | 3300005331 | Bacteria | 3686 |
| 35 | Ga0070670_100150277 | 3300005331 | Bacteria | 2016 |
| 36 | Ga0070670_101301605 | 3300005331 | Unclassified | 665 |
| 37 | Ga0070677_10261944 | 3300005333 | Bacteria | 863 |
| 38 | Ga0070677_10341987 | 3300005333 | Bacteria | 773 |
| 39 | Ga0068869_100122062 | 3300005334 | Unclassified | 1994 |
| 40 | Ga0068869_100219783 | 3300005334 | Bacteria | 1505 |
| 41 | Ga0068869_100345015 | 3300005334 | Bacteria | 1212 |
| 42 | Ga0070666_10067969 | 3300005335 | Bacteria | 2420 |
| 43 | Ga0070666_10092137 | 3300005335 | Unclassified | 2083 |
| 44 | Ga0070666_10193636 | 3300005335 | Bacteria | 1429 |
| 45 | Ga0070666_10406124 | 3300005335 | Bacteria | 980 |
| 46 | Ga0070666_11051055 | 3300005335 | Unclassified | 605 |
| 47 | Ga0070682_100172025 | 3300005337 | Bacteria | 1506 |
| 48 | Ga0068868_100095156 | 3300005338 | Unclassified | 2404 |
| 49 | Ga0068868_100132380 | 3300005338 | Bacteria | 2041 |
| 50 | Ga0070660_100096787 | 3300005339 | Bacteria | 2335 |
| 51 | Ga0070660_100661703 | 3300005339 | Bacteria | 875 |
| 52 | Ga0070689_100141077 | 3300005340 | Bacteria | 1938 |
| 53 | Ga0070689_101508873 | 3300005340 | Unclassified | 609 |
| 54 | Ga0070689_102168393 | 3300005340 | Unclassified | 509 |
| 55 | Ga0070687_100030453 | 3300005343 | Bacteria | 2638 |
| 56 | Ga0070687_100052795 | 3300005343 | Unclassified | 2111 |
| 57 | Ga0070687_100917645 | 3300005343 | Unclassified | 629 |
| 58 | Ga0070661_100006579 | 3300005344 | Bacteria | 8013 |
| 59 | Ga0070661_100555592 | 3300005344 | Bacteria | 924 |
| 60 | Ga0070692_10141854 | 3300005345 | Bacteria | 1360 |
| 61 | Ga0070692_11061622 | 3300005345 | Bacteria | 570 |
| 62 | Ga0070692_11192751 | 3300005345 | Bacteria | 542 |
| 63 | Ga0070668_100979764 | 3300005347 | Unclassified | 759 |
| 64 | Ga0070668_101732551 | 3300005347 | Unclassified | 574 |
| 65 | Ga0070668_102006358 | 3300005347 | Unclassified | 534 |
| 66 | Ga0070669_100000166 | 3300005353 | Bacteria | 58014 |
| 67 | Ga0070669_100050963 | 3300005353 | Unclassified | 3025 |
| 68 | Ga0070669_100187620 | 3300005353 | Bacteria | 1621 |
| 69 | Ga0070669_100743340 | 3300005353 | Bacteria | 831 |
| 70 | Ga0070669_101235117 | 3300005353 | Unclassified | 646 |
| 71 | Ga0070669_101913318 | 3300005353 | Bacteria | 518 |
| 72 | Ga0070675_100002899 | 3300005354 | Bacteria | 12924 |
| 73 | Ga0070675_100078452 | 3300005354 | Bacteria | 2750 |
| 74 | Ga0070675_100120981 | 3300005354 | Bacteria | 2224 |
| 75 | Ga0070675_100470081 | 3300005354 | Unclassified | 1130 |
| 76 | Ga0070675_100512164 | 3300005354 | Bacteria | 1082 |
| 77 | Ga0070675_100672619 | 3300005354 | Bacteria | 942 |
| 78 | Ga0070675_100693337 | 3300005354 | Unclassified | 927 |
| 79 | Ga0070675_100955987 | 3300005354 | Unclassified | 786 |
| 80 | Ga0070675_101011476 | 3300005354 | Bacteria | 763 |
| 81 | Ga0070671_100183091 | 3300005355 | Unclassified | 1774 |
| 82 | Ga0070671_100185058 | 3300005355 | Bacteria | 1764 |
| 83 | Ga0070671_100312360 | 3300005355 | Bacteria | 1339 |
| 84 | Ga0070671_101434808 | 3300005355 | Unclassified | 610 |
| 85 | Ga0070674_100011525 | 3300005356 | Bacteria | 5387 |
| 86 | Ga0070674_100097298 | 3300005356 | Bacteria | 2137 |
| 87 | Ga0070674_100126422 | 3300005356 | Bacteria | 1900 |
| 88 | Ga0070674_100588196 | 3300005356 | Bacteria | 939 |
| 89 | Ga0070674_100719633 | 3300005356 | Bacteria | 855 |
| 90 | Ga0070674_100770303 | 3300005356 | Bacteria | 828 |
| 91 | Ga0070674_101555351 | 3300005356 | Bacteria | 595 |
| 92 | Ga0070673_100002561 | 3300005364 | Bacteria | 11095 |
| 93 | Ga0070673_101341274 | 3300005364 | Bacteria | 672 |
| 94 | Ga0070673_101513306 | 3300005364 | Unclassified | 633 |
| 95 | Ga0070673_101597864 | 3300005364 | Bacteria | 616 |
| 96 | Ga0070673_102322210 | 3300005364 | Bacteria | 510 |
| 97 | Ga0070688_100014815 | 3300005365 | Bacteria | 4424 |
| 98 | Ga0070688_100208852 | 3300005365 | Bacteria | 1370 |
| 99 | Ga0070688_100305285 | 3300005365 | Unclassified | 1151 |
| 100 | Ga0070688_101514940 | 3300005365 | Unclassified | 546 |
| 101 | Ga0070659_100168933 | 3300005366 | Bacteria | 1791 |
| 102 | Ga0070659_100354644 | 3300005366 | Bacteria | 1231 |
| 103 | Ga0070659_100852790 | 3300005366 | Bacteria | 794 |
| 104 | Ga0070659_101167960 | 3300005366 | Bacteria | 680 |
| 105 | Ga0070659_101856936 | 3300005366 | Unclassified | 540 |
| 106 | Ga0070667_100048804 | 3300005367 | Unclassified | 3564 |
| 107 | Ga0070667_100963734 | 3300005367 | Unclassified | 795 |
| 108 | Ga0070667_102138147 | 3300005367 | Bacteria | 527 |
| 109 | Ga0070713_100386032 | 3300005436 | Unclassified | 1305 |
| 110 | Ga0070701_10003736 | 3300005438 | Bacteria | 6077 |
| 111 | Ga0070701_10909765 | 3300005438 | Bacteria | 608 |
| 112 | Ga0070711_100902157 | 3300005439 | Unclassified | 754 |
| 113 | Ga0070711_101536326 | 3300005439 | Bacteria | 581 |
| 114 | Ga0070705_100600092 | 3300005440 | Unclassified | 851 |
| 115 | Ga0070705_101075107 | 3300005440 | Bacteria | 657 |
| 116 | Ga0070700_100630669 | 3300005441 | Unclassified | 844 |
| 117 | Ga0070700_100944530 | 3300005441 | Unclassified | 705 |
| 118 | Ga0070700_101143879 | 3300005441 | Unclassified | 647 |
| 119 | Ga0070694_100896708 | 3300005444 | Unclassified | 732 |
| 120 | Ga0070694_100991037 | 3300005444 | Bacteria | 697 |
| 121 | Ga0070663_100170260 | 3300005455 | Unclassified | 1683 |
| 122 | Ga0070663_100388748 | 3300005455 | Bacteria | 1138 |
| 123 | Ga0070663_100390052 | 3300005455 | Bacteria | 1136 |
| 124 | Ga0070663_100448748 | 3300005455 | Bacteria | 1063 |
| 125 | Ga0070678_100122387 | 3300005456 | Unclassified | 2054 |
| 126 | Ga0070678_100145886 | 3300005456 | Bacteria | 1900 |
| 127 | Ga0070678_100256343 | 3300005456 | Unclassified | 1469 |
| 128 | Ga0070678_100415177 | 3300005456 | Bacteria | 1172 |
| 129 | Ga0070678_100736357 | 3300005456 | Bacteria | 891 |
| 130 | Ga0070678_101106059 | 3300005456 | Bacteria | 732 |
| 131 | Ga0070678_101442012 | 3300005456 | Unclassified | 643 |
| 132 | Ga0070662_100040943 | 3300005457 | Bacteria | 3302 |
| 133 | Ga0070662_100158979 | 3300005457 | Unclassified | 1766 |
| 134 | Ga0070662_100680803 | 3300005457 | Bacteria | 869 |
| 135 | Ga0070681_10108734 | 3300005458 | Bacteria | 2713 |
| 136 | Ga0070681_11908863 | 3300005458 | Unclassified | 521 |
| 137 | Ga0068867_100011928 | 3300005459 | Bacteria | 6139 |
| 138 | Ga0068867_100085366 | 3300005459 | Bacteria | 2386 |
| 139 | Ga0068867_100592081 | 3300005459 | Bacteria | 966 |
| 140 | Ga0070685_10003988 | 3300005466 | Bacteria | 7458 |
| 141 | Ga0070685_11523048 | 3300005466 | Bacteria | 516 |
| 142 | Ga0070706_100634444 | 3300005467 | Bacteria | 992 |
| 143 | Ga0070706_100794605 | 3300005467 | Bacteria | 876 |
| 144 | Ga0070707_100931109 | 3300005468 | Bacteria | 834 |
| 145 | Ga0070707_101659703 | 3300005468 | Bacteria | 606 |
| 146 | Ga0070698_100340178 | 3300005471 | Bacteria | 1432 |
| 147 | Ga0070698_101119969 | 3300005471 | Bacteria | 736 |
| 148 | Ga0070698_101503986 | 3300005471 | Bacteria | 625 |
| 149 | Ga0070698_101620173 | 3300005471 | Unclassified | 599 |
| 150 | Ga0074259_10932921 | 3300005507 | Unclassified | 509 |
| 151 | Ga0070699_100951258 | 3300005518 | Bacteria | 787 |
| 152 | Ga0070699_101491838 | 3300005518 | Bacteria | 620 |
| 153 | Ga0070684_100000291 | 3300005535 | Bacteria | 34899 |
| 154 | Ga0070684_100722382 | 3300005535 | Bacteria | 929 |
| 155 | Ga0068853_100824579 | 3300005539 | Unclassified | 889 |
| 156 | Ga0068853_101443326 | 3300005539 | Unclassified | 666 |
| 157 | Ga0068853_102293707 | 3300005539 | Bacteria | 523 |
| 158 | Ga0068853_102352289 | 3300005539 | Unclassified | 516 |
| 159 | Ga0070672_100019443 | 3300005543 | Bacteria | 4929 |
| 160 | Ga0070672_100021908 | 3300005543 | Bacteria | 4683 |
| 161 | Ga0070672_100118152 | 3300005543 | Bacteria | 2168 |
| 162 | Ga0070672_100232545 | 3300005543 | Bacteria | 1549 |
| 163 | Ga0070672_101240170 | 3300005543 | Unclassified | 665 |
| 164 | Ga0070686_100033623 | 3300005544 | Bacteria | 3152 |
| 165 | Ga0070686_100306200 | 3300005544 | Unclassified | 1180 |
| 166 | Ga0070686_101057707 | 3300005544 | Bacteria | 668 |
| 167 | Ga0070696_100295643 | 3300005546 | Bacteria | 1239 |
| 168 | Ga0070696_100483150 | 3300005546 | Bacteria | 983 |
| 169 | Ga0070696_100721736 | 3300005546 | Bacteria | 814 |
| 170 | Ga0070693_101016747 | 3300005547 | Bacteria | 628 |
| 171 | Ga0070693_101049058 | 3300005547 | Bacteria | 619 |
| 172 | Ga0070665_100010087 | 3300005548 | Bacteria | 9559 |
| 173 | Ga0070665_100022622 | 3300005548 | Bacteria | 6329 |
| 174 | Ga0070665_100248210 | 3300005548 | Bacteria | 1780 |
| 175 | Ga0070665_100250519 | 3300005548 | Bacteria | 1772 |
| 176 | Ga0070665_100476735 | 3300005548 | Bacteria | 1258 |
| 177 | Ga0070665_100483781 | 3300005548 | Bacteria | 1249 |
| 178 | Ga0070665_100801899 | 3300005548 | Unclassified | 955 |
| 179 | Ga0070665_101085551 | 3300005548 | Bacteria | 812 |
| 180 | Ga0070704_100071794 | 3300005549 | Bacteria | 2516 |
| 181 | Ga0070704_100175306 | 3300005549 | Bacteria | 1710 |
| 182 | Ga0070704_100277876 | 3300005549 | Bacteria | 1386 |
| 183 | Ga0070704_100544980 | 3300005549 | Bacteria | 1013 |
| 184 | Ga0070704_100917012 | 3300005549 | Unclassified | 789 |
| 185 | Ga0070704_101040332 | 3300005549 | Bacteria | 742 |
| 186 | Ga0068855_100929771 | 3300005563 | Bacteria | 917 |
| 187 | Ga0068855_101573479 | 3300005563 | Bacteria | 673 |
| 188 | Ga0070664_100003002 | 3300005564 | Bacteria | 13648 |
| 189 | Ga0070664_100142540 | 3300005564 | Unclassified | 2111 |
| 190 | Ga0070664_100335665 | 3300005564 | Unclassified | 1372 |
| 191 | Ga0070664_100710477 | 3300005564 | Bacteria | 937 |
| 192 | Ga0070664_101806239 | 3300005564 | Bacteria | 580 |
| 193 | Ga0070664_102143281 | 3300005564 | Unclassified | 530 |
| 194 | Ga0068854_100099848 | 3300005578 | Bacteria | 2174 |
| 195 | Ga0068854_100436159 | 3300005578 | Bacteria | 1091 |
| 196 | Ga0068854_100549707 | 3300005578 | Unclassified | 979 |
| 197 | Ga0068854_101246943 | 3300005578 | Unclassified | 668 |
| 198 | Ga0068856_100062149 | 3300005614 | Bacteria | 3689 |
| 199 | Ga0068856_101189163 | 3300005614 | Unclassified | 779 |
| 200 | Ga0068856_101588804 | 3300005614 | Unclassified | 667 |
| 201 | Ga0070702_100149497 | 3300005615 | Bacteria | 1497 |
| 202 | Ga0070702_100377258 | 3300005615 | Bacteria | 1007 |
| 203 | Ga0070702_100659878 | 3300005615 | Bacteria | 792 |
| 204 | Ga0068852_100078194 | 3300005616 | Bacteria | 2926 |
| 205 | Ga0068852_100111289 | 3300005616 | Unclassified | 2490 |
| 206 | Ga0068852_100223280 | 3300005616 | Bacteria | 1793 |
| 207 | Ga0068852_100920448 | 3300005616 | Bacteria | 892 |
| 208 | Ga0068852_102667994 | 3300005616 | Bacteria | 519 |
| 209 | Ga0068859_100003822 | 3300005617 | Bacteria | 15377 |
| 210 | Ga0068859_100644005 | 3300005617 | Unclassified | 1152 |
| 211 | Ga0068864_100028940 | 3300005618 | Unclassified | 4687 |
| 212 | Ga0068864_100732842 | 3300005618 | Bacteria | 968 |
| 213 | Ga0068864_100922272 | 3300005618 | Unclassified | 863 |
| 214 | Ga0068864_101172838 | 3300005618 | Unclassified | 766 |
| 215 | Ga0068864_101462168 | 3300005618 | Bacteria | 686 |
| 216 | Ga0068866_10044883 | 3300005718 | Bacteria | 2214 |
| 217 | Ga0068866_10599907 | 3300005718 | Bacteria | 743 |
| 218 | Ga0068861_100105876 | 3300005719 | Unclassified | 2246 |
| 219 | Ga0068861_100372418 | 3300005719 | Bacteria | 1259 |
| 220 | Ga0068861_100479695 | 3300005719 | Bacteria | 1120 |
| 221 | Ga0068861_101872619 | 3300005719 | Unclassified | 596 |
| 222 | Ga0068861_102129904 | 3300005719 | Bacteria | 561 |
| 223 | Ga0068851_10247991 | 3300005834 | Bacteria | 1009 |
| 224 | Ga0068851_10890393 | 3300005834 | Bacteria | 557 |
| 225 | Ga0068870_10156858 | 3300005840 | Bacteria | 1346 |
| 226 | Ga0068863_100011808 | 3300005841 | Bacteria | 8443 |
| 227 | Ga0068863_100080513 | 3300005841 | Bacteria | 3085 |
| 228 | Ga0068863_100276921 | 3300005841 | Unclassified | 1625 |
| 229 | Ga0068863_101011481 | 3300005841 | Bacteria | 834 |
| 230 | Ga0068863_102019482 | 3300005841 | Bacteria | 587 |
| 231 | Ga0068858_100425073 | 3300005842 | Bacteria | 1278 |
| 232 | Ga0068858_100567704 | 3300005842 | Bacteria | 1099 |
| 233 | Ga0068858_100959293 | 3300005842 | Bacteria | 837 |
| 234 | Ga0068858_102026130 | 3300005842 | Bacteria | 569 |
| 235 | Ga0068860_100153064 | 3300005843 | Bacteria | 2221 |
| 236 | Ga0068860_100656848 | 3300005843 | Bacteria | 1057 |
| 237 | Ga0068862_100026965 | 3300005844 | Bacteria | 4832 |
| 238 | Ga0068862_100053947 | 3300005844 | Bacteria | 3442 |
| 239 | Ga0068862_100087875 | 3300005844 | Unclassified | 2703 |
| 240 | Ga0068862_100706697 | 3300005844 | Unclassified | 977 |
| 241 | Ga0068862_100723461 | 3300005844 | Bacteria | 966 |
| 242 | Ga0068862_100812019 | 3300005844 | Unclassified | 914 |
| 243 | Ga0068862_101272499 | 3300005844 | Bacteria | 736 |
| 244 | Ga0068862_101415778 | 3300005844 | Unclassified | 699 |
| 245 | Ga0068862_101667013 | 3300005844 | Unclassified | 645 |
| 246 | Ga0070717_10284219 | 3300006028 | Unclassified | 1468 |
| 247 | Ga0075365_10000562 | 3300006038 | Bacteria | 14387 |
| 248 | Ga0075365_11091067 | 3300006038 | Unclassified | 562 |
| 249 | Ga0075368_10053538 | 3300006042 | Bacteria | 1607 |
| 250 | Ga0075364_10004066 | 3300006051 | Bacteria | 8395 |
| 251 | Ga0075364_10005645 | 3300006051 | Bacteria | 7292 |
| 252 | Ga0075364_10252862 | 3300006051 | Bacteria | 1198 |
| 253 | Ga0075432_10453801 | 3300006058 | Unclassified | 563 |
| 254 | Ga0070716_100479436 | 3300006173 | Bacteria | 913 |
| 255 | Ga0075362_10105944 | 3300006177 | Bacteria | 1319 |
| 256 | Ga0075367_10033063 | 3300006178 | Bacteria | 2979 |
| 257 | Ga0075366_10000965 | 3300006195 | Bacteria | 14034 |
| 258 | Ga0075366_10470540 | 3300006195 | Bacteria | 776 |
| 259 | Ga0075366_10531682 | 3300006195 | Bacteria | 728 |
| 260 | Ga0097621_100037514 | 3300006237 | Bacteria | 3884 |
| 261 | Ga0097621_101063255 | 3300006237 | Unclassified | 759 |
| 262 | Ga0068871_100045078 | 3300006358 | Bacteria | 3548 |
| 263 | Ga0068871_100213392 | 3300006358 | Unclassified | 1670 |
| 264 | Ga0068871_100223288 | 3300006358 | Unclassified | 1633 |
| 265 | Ga0068871_100819182 | 3300006358 | Bacteria | 859 |
| 266 | Ga0068871_101205864 | 3300006358 | Unclassified | 710 |
| 267 | Ga0068871_101426741 | 3300006358 | Unclassified | 653 |
| 268 | Ga0075428_100002190 | 3300006844 | Bacteria | 21137 |
| 269 | Ga0075428_100730850 | 3300006844 | Unclassified | 1054 |
| 270 | Ga0075428_100807477 | 3300006844 | Unclassified | 997 |
| 271 | Ga0075428_101100872 | 3300006844 | Bacteria | 839 |
| 272 | Ga0075430_100006051 | 3300006846 | Bacteria | 10198 |
| 273 | Ga0075430_100019324 | 3300006846 | Bacteria | 5792 |
| 274 | Ga0075430_101613232 | 3300006846 | Bacteria | 533 |
| 275 | Ga0075431_100014795 | 3300006847 | Bacteria | 7898 |
| 276 | Ga0075431_100118506 | 3300006847 | Bacteria | 2731 |
| 277 | Ga0075431_100435891 | 3300006847 | Bacteria | 1308 |
| 278 | Ga0075433_10031686 | 3300006852 | Bacteria | 4521 |
| 279 | Ga0075433_10032746 | 3300006852 | Bacteria | 4454 |
| 280 | Ga0075433_10058944 | 3300006852 | Bacteria | 3359 |
| 281 | Ga0075433_10088645 | 3300006852 | Bacteria | 2734 |
| 282 | Ga0075433_11730977 | 3300006852 | Unclassified | 538 |
| 283 | Ga0075434_100004927 | 3300006871 | Bacteria | 12099 |
| 284 | Ga0075434_100023434 | 3300006871 | Bacteria | 6016 |
| 285 | Ga0075434_100195972 | 3300006871 | Bacteria | 2040 |
| 286 | Ga0075434_100567873 | 3300006871 | Unclassified | 1154 |
| 287 | Ga0075429_100214588 | 3300006880 | Bacteria | 1686 |
| 288 | Ga0075429_100229844 | 3300006880 | Bacteria | 1625 |
| 289 | Ga0068865_100423063 | 3300006881 | Unclassified | 1096 |
| 290 | Ga0068865_100645482 | 3300006881 | Bacteria | 899 |
| 291 | Ga0068865_101667383 | 3300006881 | Bacteria | 574 |
| 292 | Ga0068865_101782309 | 3300006881 | Unclassified | 556 |
| 293 | Ga0068865_102000795 | 3300006881 | Unclassified | 526 |
| 294 | Ga0075436_100306906 | 3300006914 | Unclassified | 1138 |
| 295 | Ga0075436_100429528 | 3300006914 | Bacteria | 960 |
| 296 | Ga0097620_100003822 | 3300006931 | Bacteria | 15377 |
| 297 | Ga0097620_100644013 | 3300006931 | Unclassified | 1152 |
| 298 | Ga0075435_100006365 | 3300007076 | Bacteria | 8345 |
| 299 | Ga0075435_100015028 | 3300007076 | Bacteria | 5809 |
| 300 | Ga0075435_100272534 | 3300007076 | Bacteria | 1444 |
| 301 | Ga0075435_100279837 | 3300007076 | Bacteria | 1424 |
| 302 | Ga0105240_10195813 | 3300009093 | Bacteria | 2373 |
| 303 | Ga0105240_10302364 | 3300009093 | Bacteria | 1830 |
| 304 | Ga0105240_11641437 | 3300009093 | Bacteria | 672 |
| 305 | Ga0105240_12076160 | 3300009093 | Bacteria | 590 |
| 306 | Ga0111539_10001892 | 3300009094 | Bacteria | 27846 |
| 307 | Ga0111539_10024552 | 3300009094 | Bacteria | 7393 |
| 308 | Ga0111539_10140000 | 3300009094 | Bacteria | 2833 |
| 309 | Ga0111539_10173669 | 3300009094 | Unclassified | 2518 |
| 310 | Ga0111539_10460819 | 3300009094 | Bacteria | 1480 |
| 311 | Ga0111539_10730386 | 3300009094 | Bacteria | 1153 |
| 312 | Ga0111539_11547838 | 3300009094 | Unclassified | 769 |
| 313 | Ga0111539_11984297 | 3300009094 | Bacteria | 675 |
| 314 | Ga0111539_13090895 | 3300009094 | Bacteria | 537 |
| 315 | Ga0111539_13447851 | 3300009094 | Bacteria | 508 |
| 316 | Ga0105245_10374069 | 3300009098 | Unclassified | 1417 |
| 317 | Ga0105245_11597005 | 3300009098 | Unclassified | 704 |
| 318 | Ga0105247_10100266 | 3300009101 | Bacteria | 1851 |
| 319 | Ga0105247_10359334 | 3300009101 | Bacteria | 1026 |
| 320 | Ga0114129_10002861 | 3300009147 | Bacteria | 24137 |
| 321 | Ga0114129_10004267 | 3300009147 | Bacteria | 20199 |
| 322 | Ga0114129_10007233 | 3300009147 | Bacteria | 15803 |
| 323 | Ga0114129_10155007 | 3300009147 | Bacteria | 3133 |
| 324 | Ga0114129_10188247 | 3300009147 | Bacteria | 2804 |
| 325 | Ga0114129_11936848 | 3300009147 | Bacteria | 714 |
| 326 | Ga0114129_12298525 | 3300009147 | Bacteria | 647 |
| 327 | Ga0105243_10110197 | 3300009148 | Bacteria | 2301 |
| 328 | Ga0105243_11841527 | 3300009148 | Bacteria | 637 |
| 329 | Ga0105241_10221699 | 3300009174 | Bacteria | 1590 |
| 330 | Ga0105242_10031143 | 3300009176 | Bacteria | 4258 |
| 331 | Ga0105242_10071788 | 3300009176 | Unclassified | 2874 |
| 332 | Ga0105242_10097671 | 3300009176 | Bacteria | 2483 |
| 333 | Ga0105242_10873422 | 3300009176 | Bacteria | 897 |
| 334 | Ga0105242_13148114 | 3300009176 | Bacteria | 512 |
| 335 | Ga0105248_10026313 | 3300009177 | Bacteria | 6472 |
| 336 | Ga0105248_10054044 | 3300009177 | Bacteria | 4504 |
| 337 | Ga0105248_10058976 | 3300009177 | Bacteria | 4311 |
| 338 | Ga0105248_10059861 | 3300009177 | Unclassified | 4278 |
| 339 | Ga0105248_10178054 | 3300009177 | Bacteria | 2396 |
| 340 | Ga0105248_11490066 | 3300009177 | Bacteria | 766 |
| 341 | Ga0105248_11824620 | 3300009177 | Bacteria | 690 |
| 342 | Ga0105248_11901247 | 3300009177 | Unclassified | 675 |
| 343 | Ga0105248_12086345 | 3300009177 | Unclassified | 644 |
| 344 | Ga0105248_13388069 | 3300009177 | Unclassified | 506 |
| 345 | Ga0105238_10136346 | 3300009551 | Bacteria | 2432 |
| 346 | Ga0105238_10382426 | 3300009551 | Bacteria | 1399 |
| 347 | Ga0105238_11569608 | 3300009551 | Archaea | 688 |
| 348 | Ga0105249_10001254 | 3300009553 | Bacteria | 22246 |
| 349 | Ga0105249_10005766 | 3300009553 | Bacteria | 10712 |
| 350 | Ga0105249_10080278 | 3300009553 | Bacteria | 3030 |
| 351 | Ga0105249_10791467 | 3300009553 | Bacteria | 1012 |
| 352 | Ga0105239_10140364 | 3300010375 | Unclassified | 2692 |
| 353 | Ga0105239_10296047 | 3300010375 | Bacteria | 1822 |
| 354 | Ga0105246_10647265 | 3300011119 | Bacteria | 920 |
| 355 | Ga0105246_10809966 | 3300011119 | Unclassified | 832 |
| 356 | Ga0105246_11047866 | 3300011119 | Unclassified | 741 |
| 357 | Ga0157369_10085696 | 3300013105 | Bacteria | 3366 |
| 358 | Ga0157369_10753118 | 3300013105 | Bacteria | 1002 |
| 359 | Ga0157374_10076825 | 3300013296 | Bacteria | 3158 |
| 360 | Ga0157374_10313768 | 3300013296 | Bacteria | 1553 |
| 361 | Ga0157374_11056116 | 3300013296 | Bacteria | 832 |
| 362 | Ga0157378_10899471 | 3300013297 | Bacteria | 916 |
| 363 | Ga0157378_10972425 | 3300013297 | Unclassified | 882 |
| 364 | Ga0157378_11134919 | 3300013297 | Bacteria | 819 |
| 365 | Ga0157378_11189019 | 3300013297 | Bacteria | 802 |
| 366 | Ga0157378_11506415 | 3300013297 | Bacteria | 717 |
| 367 | Ga0157378_12540327 | 3300013297 | Unclassified | 564 |
| 368 | Ga0157378_13011974 | 3300013297 | Bacteria | 523 |
| 369 | Ga0163162_10048642 | 3300013306 | Bacteria | 4249 |
| 370 | Ga0163162_10144922 | 3300013306 | Bacteria | 2490 |
| 371 | Ga0163162_10421010 | 3300013306 | Bacteria | 1468 |
| 372 | Ga0163162_11700818 | 3300013306 | Unclassified | 720 |
| 373 | Ga0157372_10225441 | 3300013307 | Bacteria | 2173 |
| 374 | Ga0157372_11058298 | 3300013307 | Bacteria | 939 |
| 375 | Ga0157375_10152246 | 3300013308 | Unclassified | 2449 |
| 376 | Ga0157375_10208129 | 3300013308 | Bacteria | 2113 |
| 377 | Ga0157375_10259698 | 3300013308 | Bacteria | 1899 |
| 378 | Ga0157375_10835267 | 3300013308 | Unclassified | 1068 |
| 379 | Ga0157375_12002510 | 3300013308 | Unclassified | 688 |
| 380 | Ga0157375_13404568 | 3300013308 | Bacteria | 530 |
| 381 | Ga0163163_10059827 | 3300014325 | Bacteria | 3770 |
| 382 | Ga0163163_10137123 | 3300014325 | Unclassified | 2488 |
| 383 | Ga0163163_10137638 | 3300014325 | Bacteria | 2483 |
| 384 | Ga0163163_10187170 | 3300014325 | Unclassified | 2118 |
| 385 | Ga0163163_10868487 | 3300014325 | Bacteria | 965 |
| 386 | Ga0163163_12296948 | 3300014325 | Unclassified | 598 |
| 387 | Ga0163163_12641817 | 3300014325 | Bacteria | 559 |
| 388 | Ga0157380_10097792 | 3300014326 | Bacteria | 2437 |
| 389 | Ga0157380_10143224 | 3300014326 | Bacteria | 2056 |
| 390 | Ga0157380_10225108 | 3300014326 | Bacteria | 1681 |
| 391 | Ga0157380_10848854 | 3300014326 | Unclassified | 935 |
| 392 | Ga0157380_10874255 | 3300014326 | Bacteria | 923 |
| 393 | Ga0157380_10874444 | 3300014326 | Bacteria | 923 |
| 394 | Ga0157380_11520023 | 3300014326 | Bacteria | 723 |
| 395 | Ga0157380_11634596 | 3300014326 | Bacteria | 700 |
| 396 | Ga0157380_11740667 | 3300014326 | Bacteria | 681 |
| 397 | Ga0157380_13167981 | 3300014326 | Unclassified | 525 |
| 398 | Ga0157379_10216935 | 3300014968 | Bacteria | 1733 |
| 399 | Ga0157379_10385819 | 3300014968 | Bacteria | 1286 |
| 400 | Ga0157379_10726632 | 3300014968 | Bacteria | 933 |
| 401 | Ga0157376_10009699 | 3300014969 | Bacteria | 7007 |
| 402 | Ga0157376_10029717 | 3300014969 | Unclassified | 4356 |
| 403 | Ga0157376_10224087 | 3300014969 | Unclassified | 1743 |
| 404 | Ga0157376_10435551 | 3300014969 | Bacteria | 1275 |
| 405 | Ga0157376_11815180 | 3300014969 | Unclassified | 646 |
| 406 | Ga0157376_11931565 | 3300014969 | Bacteria | 627 |
| 407 | Ga0163161_10861593 | 3300017792 | Bacteria | 765 |
| 408 | Ga0206353_10674301 | 3300020082 | Bacteria | 535 |
| 409 | Ga0213876_10119947 | 3300021384 | Bacteria | 1396 |
| 410 | Ga0207666_1076982 | 3300025271 | Unclassified | 538 |
| 411 | Ga0207697_10000772 | 3300025315 | Bacteria | 18141 |
| 412 | Ga0207656_10269417 | 3300025321 | Bacteria | 838 |
| 413 | Ga0207656_10664497 | 3300025321 | Bacteria | 533 |
| 414 | Ga0207682_10212584 | 3300025893 | Bacteria | 892 |
| 415 | Ga0207682_10404771 | 3300025893 | Bacteria | 645 |
| 416 | Ga0207682_10492726 | 3300025893 | Bacteria | 580 |
| 417 | Ga0207642_10196629 | 3300025899 | Bacteria | 1111 |
| 418 | Ga0207642_10483927 | 3300025899 | Bacteria | 755 |
| 419 | Ga0207710_10377925 | 3300025900 | Bacteria | 725 |
| 420 | Ga0207688_10002773 | 3300025901 | Bacteria | 9498 |
| 421 | Ga0207688_10165611 | 3300025901 | Bacteria | 1312 |
| 422 | Ga0207680_10052607 | 3300025903 | Bacteria | 2441 |
| 423 | Ga0207680_10075968 | 3300025903 | Unclassified | 2097 |
| 424 | Ga0207680_10287234 | 3300025903 | Bacteria | 1144 |
| 425 | Ga0207647_10116664 | 3300025904 | Bacteria | 1576 |
| 426 | Ga0207647_10609017 | 3300025904 | Bacteria | 602 |
| 427 | Ga0207647_10610010 | 3300025904 | Bacteria | 601 |
| 428 | Ga0207645_10937110 | 3300025907 | Unclassified | 588 |
| 429 | Ga0207643_10182357 | 3300025908 | Bacteria | 1271 |
| 430 | Ga0207684_10364960 | 3300025910 | Bacteria | 1243 |
| 431 | Ga0207684_10438502 | 3300025910 | Bacteria | 1122 |
| 432 | Ga0207684_10778491 | 3300025910 | Bacteria | 810 |
| 433 | Ga0207707_10677920 | 3300025912 | Bacteria | 867 |
| 434 | Ga0207707_11113714 | 3300025912 | Bacteria | 643 |
| 435 | Ga0207695_10125684 | 3300025913 | Bacteria | 2527 |
| 436 | Ga0207663_10558001 | 3300025916 | Unclassified | 896 |
| 437 | Ga0207660_10638366 | 3300025917 | Bacteria | 868 |
| 438 | Ga0207662_10002361 | 3300025918 | Bacteria | 9462 |
| 439 | Ga0207662_10061797 | 3300025918 | Unclassified | 2250 |
| 440 | Ga0207662_10938226 | 3300025918 | Unclassified | 613 |
| 441 | Ga0207657_10201517 | 3300025919 | Bacteria | 1600 |
| 442 | Ga0207649_10003342 | 3300025920 | Bacteria | 8775 |
| 443 | Ga0207649_10304409 | 3300025920 | Unclassified | 1166 |
| 444 | Ga0207649_10367202 | 3300025920 | Bacteria | 1069 |
| 445 | Ga0207681_10022832 | 3300025923 | Bacteria | 3994 |
| 446 | Ga0207681_10088153 | 3300025923 | Unclassified | 2209 |
| 447 | Ga0207681_10220674 | 3300025923 | Bacteria | 1466 |
| 448 | Ga0207681_10328906 | 3300025923 | Bacteria | 1218 |
| 449 | Ga0207694_10370275 | 3300025924 | Bacteria | 1188 |
| 450 | Ga0207694_10882807 | 3300025924 | Unclassified | 756 |
| 451 | Ga0207694_11071375 | 3300025924 | Bacteria | 682 |
| 452 | Ga0207650_10010455 | 3300025925 | Bacteria | 6361 |
| 453 | Ga0207650_10022308 | 3300025925 | Bacteria | 4479 |
| 454 | Ga0207650_10064504 | 3300025925 | Bacteria | 2742 |
| 455 | Ga0207650_10160269 | 3300025925 | Bacteria | 1782 |
| 456 | Ga0207650_10207722 | 3300025925 | Bacteria | 1571 |
| 457 | Ga0207650_10539789 | 3300025925 | Bacteria | 977 |
| 458 | Ga0207659_10078671 | 3300025926 | Unclassified | 2430 |
| 459 | Ga0207659_10096263 | 3300025926 | Bacteria | 2222 |
| 460 | Ga0207659_10384772 | 3300025926 | Bacteria | 1170 |
| 461 | Ga0207659_10406365 | 3300025926 | Bacteria | 1140 |
| 462 | Ga0207659_10533713 | 3300025926 | Bacteria | 996 |
| 463 | Ga0207659_10940076 | 3300025926 | Unclassified | 743 |
| 464 | Ga0207687_10060991 | 3300025927 | Bacteria | 2662 |
| 465 | Ga0207687_10188748 | 3300025927 | Bacteria | 1602 |
| 466 | Ga0207687_10440398 | 3300025927 | Bacteria | 1079 |
| 467 | Ga0207700_10349793 | 3300025928 | Unclassified | 1287 |
| 468 | Ga0207644_10089495 | 3300025931 | Bacteria | 2291 |
| 469 | Ga0207644_10154648 | 3300025931 | Bacteria | 1777 |
| 470 | Ga0207644_10172039 | 3300025931 | Unclassified | 1692 |
| 471 | Ga0207690_10254468 | 3300025932 | Bacteria | 1358 |
| 472 | Ga0207690_10271928 | 3300025932 | Bacteria | 1317 |
| 473 | Ga0207690_10736624 | 3300025932 | Bacteria | 812 |
| 474 | Ga0207690_11251775 | 3300025932 | Bacteria | 620 |
| 475 | Ga0207706_10036735 | 3300025933 | Bacteria | 4351 |
| 476 | Ga0207706_10085694 | 3300025933 | Bacteria | 2770 |
| 477 | Ga0207706_10181333 | 3300025933 | Unclassified | 1849 |
| 478 | Ga0207706_10547227 | 3300025933 | Bacteria | 997 |
| 479 | Ga0207706_10822047 | 3300025933 | Bacteria | 788 |
| 480 | Ga0207706_10863325 | 3300025933 | Bacteria | 766 |
| 481 | Ga0207686_10040704 | 3300025934 | Bacteria | 2827 |
| 482 | Ga0207686_10064654 | 3300025934 | Bacteria | 2330 |
| 483 | Ga0207686_11714098 | 3300025934 | Unclassified | 520 |
| 484 | Ga0207709_10059748 | 3300025935 | Bacteria | 2374 |
| 485 | Ga0207709_10187417 | 3300025935 | Bacteria | 1466 |
| 486 | Ga0207709_10938905 | 3300025935 | Unclassified | 705 |
| 487 | Ga0207670_10063237 | 3300025936 | Bacteria | 2531 |
| 488 | Ga0207670_10872255 | 3300025936 | Unclassified | 753 |
| 489 | Ga0207670_11205493 | 3300025936 | Bacteria | 641 |
| 490 | Ga0207669_10045755 | 3300025937 | Unclassified | 2581 |
| 491 | Ga0207669_10077387 | 3300025937 | Bacteria | 2115 |
| 492 | Ga0207669_10462811 | 3300025937 | Bacteria | 1007 |
| 493 | Ga0207669_10593369 | 3300025937 | Bacteria | 899 |
| 494 | Ga0207669_10681576 | 3300025937 | Bacteria | 843 |
| 495 | Ga0207669_11662304 | 3300025937 | Bacteria | 545 |
| 496 | Ga0207704_10048697 | 3300025938 | Unclassified | 2543 |
| 497 | Ga0207704_10113482 | 3300025938 | Bacteria | 1837 |
| 498 | Ga0207704_10234030 | 3300025938 | Bacteria | 1368 |
| 499 | Ga0207704_11334434 | 3300025938 | Unclassified | 614 |
| 500 | Ga0207691_10021474 | 3300025940 | Bacteria | 6095 |
| 501 | Ga0207691_10053749 | 3300025940 | Bacteria | 3676 |
| 502 | Ga0207691_10148042 | 3300025940 | Bacteria | 2066 |
| 503 | Ga0207691_10192644 | 3300025940 | Bacteria | 1777 |
| 504 | Ga0207691_10601706 | 3300025940 | Bacteria | 931 |
| 505 | Ga0207711_10018265 | 3300025941 | Bacteria | 5829 |
| 506 | Ga0207711_10144641 | 3300025941 | Unclassified | 2141 |
| 507 | Ga0207711_10144777 | 3300025941 | Unclassified | 2140 |
| 508 | Ga0207711_10330700 | 3300025941 | Bacteria | 1409 |
| 509 | Ga0207711_10624986 | 3300025941 | Bacteria | 1005 |
| 510 | Ga0207711_11417222 | 3300025941 | Bacteria | 637 |
| 511 | Ga0207711_11774495 | 3300025941 | Bacteria | 560 |
| 512 | Ga0207711_12075604 | 3300025941 | Bacteria | 511 |
| 513 | Ga0207689_10074129 | 3300025942 | Bacteria | 2797 |
| 514 | Ga0207689_10127286 | 3300025942 | Bacteria | 2095 |
| 515 | Ga0207689_10960749 | 3300025942 | Bacteria | 721 |
| 516 | Ga0207661_10001428 | 3300025944 | Bacteria | 16108 |
| 517 | Ga0207661_10012308 | 3300025944 | Bacteria | 6215 |
| 518 | Ga0207679_10002083 | 3300025945 | Bacteria | 12410 |
| 519 | Ga0207679_10041983 | 3300025945 | Bacteria | 3284 |
| 520 | Ga0207679_10233106 | 3300025945 | Bacteria | 1556 |
| 521 | Ga0207679_10368845 | 3300025945 | Bacteria | 1256 |
| 522 | Ga0207679_11478069 | 3300025945 | Bacteria | 623 |
| 523 | Ga0207667_10756568 | 3300025949 | Bacteria | 971 |
| 524 | Ga0207651_10001330 | 3300025960 | Bacteria | 11158 |
| 525 | Ga0207651_10597674 | 3300025960 | Bacteria | 964 |
| 526 | Ga0207651_10726985 | 3300025960 | Bacteria | 876 |
| 527 | Ga0207651_11188574 | 3300025960 | Bacteria | 685 |
| 528 | Ga0207651_11933639 | 3300025960 | Bacteria | 530 |
| 529 | Ga0207712_10011937 | 3300025961 | Bacteria | 5540 |
| 530 | Ga0207712_10078458 | 3300025961 | Bacteria | 2396 |
| 531 | Ga0207712_10652875 | 3300025961 | Bacteria | 914 |
| 532 | Ga0207712_10666017 | 3300025961 | Bacteria | 906 |
| 533 | Ga0207712_11257449 | 3300025961 | Unclassified | 661 |
| 534 | Ga0207712_11336061 | 3300025961 | Bacteria | 641 |
| 535 | Ga0207712_11391467 | 3300025961 | Unclassified | 628 |
| 536 | Ga0207668_10321528 | 3300025972 | Bacteria | 1284 |
| 537 | Ga0207668_10721926 | 3300025972 | Bacteria | 877 |
| 538 | Ga0207668_11915835 | 3300025972 | Bacteria | 534 |
| 539 | Ga0207668_12081120 | 3300025972 | Unclassified | 511 |
| 540 | Ga0207640_10225562 | 3300025981 | Unclassified | 1437 |
| 541 | Ga0207640_10565627 | 3300025981 | Bacteria | 957 |
| 542 | Ga0207640_10678815 | 3300025981 | Bacteria | 881 |
| 543 | Ga0207640_10970716 | 3300025981 | Bacteria | 746 |
| 544 | Ga0207658_10111366 | 3300025986 | Bacteria | 2165 |
| 545 | Ga0207658_10520384 | 3300025986 | Bacteria | 1062 |
| 546 | Ga0207658_11896125 | 3300025986 | Unclassified | 543 |
| 547 | Ga0207677_10013411 | 3300026023 | Bacteria | 4749 |
| 548 | Ga0207677_10236423 | 3300026023 | Bacteria | 1475 |
| 549 | Ga0207677_10247294 | 3300026023 | Bacteria | 1446 |
| 550 | Ga0207677_10413697 | 3300026023 | Bacteria | 1147 |
| 551 | Ga0207703_10343359 | 3300026035 | Bacteria | 1373 |
| 552 | Ga0207703_10421748 | 3300026035 | Bacteria | 1242 |
| 553 | Ga0207703_10522849 | 3300026035 | Bacteria | 1116 |
| 554 | Ga0207639_10394324 | 3300026041 | Bacteria | 1246 |
| 555 | Ga0207639_10686133 | 3300026041 | Bacteria | 949 |
| 556 | Ga0207639_10954421 | 3300026041 | Bacteria | 802 |
| 557 | Ga0207678_10062158 | 3300026067 | Bacteria | 3211 |
| 558 | Ga0207678_10066402 | 3300026067 | Bacteria | 3098 |
| 559 | Ga0207678_10402467 | 3300026067 | Bacteria | 1185 |
| 560 | Ga0207708_10001093 | 3300026075 | Bacteria | 20328 |
| 561 | Ga0207708_10455269 | 3300026075 | Bacteria | 1066 |
| 562 | Ga0207708_10511461 | 3300026075 | Bacteria | 1008 |
| 563 | Ga0207708_11448935 | 3300026075 | Bacteria | 603 |
| 564 | Ga0207708_11637692 | 3300026075 | Unclassified | 565 |
| 565 | Ga0207702_10171726 | 3300026078 | Bacteria | 1988 |
| 566 | Ga0207702_10996829 | 3300026078 | Bacteria | 831 |
| 567 | Ga0207641_10014969 | 3300026088 | Bacteria | 6359 |
| 568 | Ga0207641_10064332 | 3300026088 | Bacteria | 3135 |
| 569 | Ga0207641_10200120 | 3300026088 | Bacteria | 1841 |
| 570 | Ga0207641_10206070 | 3300026088 | Bacteria | 1816 |
| 571 | Ga0207641_10361365 | 3300026088 | Bacteria | 1386 |
| 572 | Ga0207641_10735499 | 3300026088 | Bacteria | 973 |
| 573 | Ga0207648_10007485 | 3300026089 | Bacteria | 10729 |
| 574 | Ga0207648_10011911 | 3300026089 | Bacteria | 8168 |
| 575 | Ga0207648_10150231 | 3300026089 | Unclassified | 2055 |
| 576 | Ga0207648_11500138 | 3300026089 | Unclassified | 634 |
| 577 | Ga0207648_11645629 | 3300026089 | Unclassified | 603 |
| 578 | Ga0207648_11790717 | 3300026089 | Bacteria | 576 |
| 579 | Ga0207676_10098053 | 3300026095 | Unclassified | 2422 |
| 580 | Ga0207676_10592018 | 3300026095 | Bacteria | 1064 |
| 581 | Ga0207676_10708581 | 3300026095 | Bacteria | 976 |
| 582 | Ga0207676_10729959 | 3300026095 | Bacteria | 962 |
| 583 | Ga0207676_11104632 | 3300026095 | Unclassified | 784 |
| 584 | Ga0207676_11268119 | 3300026095 | Unclassified | 731 |
| 585 | Ga0207674_11809654 | 3300026116 | Bacteria | 578 |
| 586 | Ga0207675_100153719 | 3300026118 | Unclassified | 2192 |
| 587 | Ga0207675_100564433 | 3300026118 | Bacteria | 1138 |
| 588 | Ga0207675_100621348 | 3300026118 | Bacteria | 1085 |
| 589 | Ga0207675_100713542 | 3300026118 | Bacteria | 1012 |
| 590 | Ga0207675_101030748 | 3300026118 | Bacteria | 842 |
| 591 | Ga0207675_101576150 | 3300026118 | Bacteria | 677 |
| 592 | Ga0207683_10016603 | 3300026121 | Bacteria | 6266 |
| 593 | Ga0207683_10046066 | 3300026121 | Bacteria | 3814 |
| 594 | Ga0207683_10083873 | 3300026121 | Bacteria | 2832 |
| 595 | Ga0207683_10151646 | 3300026121 | Unclassified | 2092 |
| 596 | Ga0207683_10157805 | 3300026121 | Bacteria | 2050 |
| 597 | Ga0207683_10594449 | 3300026121 | Bacteria | 1024 |
| 598 | Ga0207683_10691580 | 3300026121 | Bacteria | 945 |
| 599 | Ga0207683_10950776 | 3300026121 | Bacteria | 798 |
| 600 | Ga0207683_11006305 | 3300026121 | Bacteria | 774 |
| 601 | Ga0207698_10104018 | 3300026142 | Unclassified | 2361 |
| 602 | Ga0207698_10327331 | 3300026142 | Unclassified | 1438 |
| 603 | Ga0207698_10531528 | 3300026142 | Bacteria | 1149 |
| 604 | Ga0207698_10789066 | 3300026142 | Bacteria | 951 |
| 605 | Ga0209983_1066781 | 3300027665 | Unclassified | 798 |
| 606 | Ga0209998_10033825 | 3300027717 | Bacteria | 1141 |
| 607 | Ga0209813_10085216 | 3300027866 | Bacteria | 1052 |
| 608 | Ga0209974_10065162 | 3300027876 | Bacteria | 1237 |
| 609 | Ga0209974_10095280 | 3300027876 | Bacteria | 1035 |
| 610 | Ga0207428_10016103 | 3300027907 | Bacteria | 6441 |
| 611 | Ga0268266_10256241 | 3300028379 | Bacteria | 1620 |
| 612 | Ga0268266_10699476 | 3300028379 | Bacteria | 977 |
| 613 | Ga0268266_10981289 | 3300028379 | Unclassified | 817 |
| 614 | Ga0268266_11030104 | 3300028379 | Bacteria | 796 |
| 615 | Ga0268266_11654958 | 3300028379 | Bacteria | 615 |
| 616 | Ga0268265_10122749 | 3300028380 | Bacteria | 2143 |
| 617 | Ga0268265_10124906 | 3300028380 | Unclassified | 2127 |
| 618 | Ga0268265_10341819 | 3300028380 | Bacteria | 1363 |
| 619 | Ga0268265_10922509 | 3300028380 | Bacteria | 859 |
| 620 | Ga0268265_10937031 | 3300028380 | Unclassified | 852 |
| 621 | Ga0268265_11272228 | 3300028380 | Unclassified | 735 |
| 622 | Ga0268265_11944779 | 3300028380 | Bacteria | 595 |
| 623 | Ga0268265_12267722 | 3300028380 | Bacteria | 550 |
| 624 | Ga0268264_10266278 | 3300028381 | Bacteria | 1599 |
| 625 | Ga0307513_10771604 | 3300031456 | Bacteria | 667 |
| 626 | Ga0307408_100040174 | 3300031548 | Bacteria | 3312 |
| 627 | Ga0307408_100176766 | 3300031548 | Bacteria | 1708 |
| 628 | Ga0307408_100593034 | 3300031548 | Bacteria | 983 |
| 629 | Ga0307405_10557249 | 3300031731 | Bacteria | 928 |
| 630 | Ga0307410_10018152 | 3300031852 | Bacteria | 4245 |
| 631 | Ga0307410_10458030 | 3300031852 | Bacteria | 1042 |
| 632 | Ga0307410_11673589 | 3300031852 | Bacteria | 563 |
| 633 | Ga0307407_10154023 | 3300031903 | Bacteria | 1497 |
| 634 | Ga0307407_10219668 | 3300031903 | Bacteria | 1284 |
| 635 | Ga0307412_10150812 | 3300031911 | Bacteria | 1715 |
| 636 | Ga0307412_10220979 | 3300031911 | Bacteria | 1452 |
| 637 | Ga0307412_11552073 | 3300031911 | Bacteria | 603 |
| 638 | Ga0307409_100030071 | 3300031995 | Bacteria | 3897 |
| 639 | Ga0307409_100089370 | 3300031995 | Bacteria | 2518 |
| 640 | Ga0307409_100173215 | 3300031995 | Bacteria | 1902 |
| 641 | Ga0307409_101483992 | 3300031995 | Bacteria | 705 |
| 642 | Ga0307416_100040357 | 3300032002 | Bacteria | 3625 |
| 643 | Ga0307416_100056201 | 3300032002 | Bacteria | 3175 |
| 644 | Ga0307416_100360816 | 3300032002 | Bacteria | 1475 |
| 645 | Ga0307416_100475328 | 3300032002 | Bacteria | 1308 |
| 646 | Ga0307416_100598913 | 3300032002 | Bacteria | 1182 |
| 647 | Ga0307416_101061513 | 3300032002 | Unclassified | 914 |
| 648 | Ga0307416_101342006 | 3300032002 | Bacteria | 821 |
| 649 | Ga0307416_101572766 | 3300032002 | Bacteria | 763 |
| 650 | Ga0307416_101764404 | 3300032002 | Bacteria | 723 |
| 651 | Ga0307416_103701786 | 3300032002 | Bacteria | 512 |
| 652 | Ga0307411_10081445 | 3300032005 | Bacteria | 2229 |
| 653 | Ga0307411_10319128 | 3300032005 | Bacteria | 1254 |
| 654 | Ga0307411_10512552 | 3300032005 | Unclassified | 1016 |
| 655 | Ga0307411_10981694 | 3300032005 | Bacteria | 755 |
| 656 | Ga0307415_100195976 | 3300032126 | Bacteria | 1598 |
| 657 | Ga0307415_100342065 | 3300032126 | Bacteria | 1256 |
| 658 | Ga0373940_0123896 | 3300035088 | Bacteria | 804 |
| 659 | Ga0373951_0027075 | 3300035091 | Bacteria | 1338 |
| 660 | Ga0373932_0030680 | 3300035112 | Bacteria | 1492 |
| 661 | Ga0373941_0314819 | 3300035115 | Unclassified | 628 |
| 662 | Ga0373945_0305763 | 3300035116 | Bacteria | 682 |
| 663 | Ga0373954_0639826 | 3300035118 | Unclassified | 527 |
| 664 | Ga0373956_0408164 | 3300035119 | Unclassified | 648 |
| 665 | Ga0373943_0121418 | 3300035170 | Bacteria | 1389 |
| 666 | Ga0373943_0229432 | 3300035170 | Unclassified | 1037 |
| 667 | Ga0373946_0144595 | 3300035171 | Bacteria | 1105 |
| 668 | Ga0373955_0191679 | 3300035172 | Bacteria | 1215 |
| 669 | Ga0373942_0073203 | 3300035207 | Bacteria | 1004 |
| 670 | Ga0373961_0111885 | 3300035241 | Bacteria | 895 |
| 671 | Ga0373961_0226756 | 3300035241 | Unclassified | 668 |
| 672 | Ga0373962_0187825 | 3300035242 | Bacteria | 694 |
| 673 | Ga0373931_0092841 | 3300035691 | Bacteria | 1685 |
| 674 | Ga0373931_0592533 | 3300035691 | Unclassified | 724 |
| 675 | Ga0373937_0000651 | 3300036401 | Bacteria | 30483 |
| 676 | Ga0373937_0280691 | 3300036401 | Bacteria | 1573 |
| 677 | Ga0373925_0006513 | 3300037068 | Bacteria | 8586 |
| 678 | Ga0373925_1139757 | 3300037068 | Bacteria | 641 |
| 679 | Ga0395900_0875039 | 3300037418 | Bacteria | 823 |
| 680 | Ga0436365_0113116 | 3300039437 | Bacteria | 1636 |
| 681 | Ga0439439_0086069 | 3300041406 | Bacteria | 854 |
| 682 | Ga0439461_0060476 | 3300041410 | Unclassified | 859 |
| 683 | Ga0451791_1519790 | 3300041451 | Bacteria | 601 |
| 684 | Ga0451793_0108495 | 3300041452 | Unclassified | 642 |
| 685 | Ga0451802_0119544 | 3300041460 | Bacteria | 586 |
| 686 | Ga0451802_0912663 | 3300041460 | Bacteria | 733 |
| 687 | Ga0451804_0779925 | 3300041463 | Bacteria | 810 |
| 688 | Ga0451807_0449784 | 3300041486 | Bacteria | 685 |
| 689 | Ga0451845_0675573 | 3300041501 | Unclassified | 661 |
| 690 | Ga0451853_0170158 | 3300041512 | Bacteria | 727 |
| 691 | Ga0451853_1132466 | 3300041512 | Unclassified | 602 |
| 692 | Ga0451853_1313310 | 3300041512 | Bacteria | 620 |
| 693 | Ga0451853_2018823 | 3300041512 | Bacteria | 1263 |
| 694 | Ga0451853_3998079 | 3300041512 | Bacteria | 1226 |
| 695 | Ga0439433_0021574 | 3300041999 | Bacteria | 1441 |
| 696 | Ga0439433_0051436 | 3300041999 | Bacteria | 972 |
| 697 | Ga0439449_0120317 | 3300042007 | Bacteria | 975 |
| 698 | Ga0439454_056707 | 3300042011 | Bacteria | 672 |
| 699 | Ga0439457_116874 | 3300042014 | Unclassified | 629 |
| 700 | Ga0439462_0091092 | 3300042015 | Bacteria | 836 |
| 701 | Ga0450920_018330 | 3300042122 | Bacteria | 1340 |
| 702 | Ga0450920_044911 | 3300042122 | Bacteria | 883 |
| 703 | Ga0450923_012281 | 3300042125 | Bacteria | 1556 |
| 704 | Ga0450891_019284 | 3300042129 | Unclassified | 663 |
| 705 | Ga0450894_002011 | 3300042131 | Bacteria | 2802 |
| 706 | Ga0450895_005338 | 3300042132 | Bacteria | 1034 |
| 707 | Ga0450896_000284 | 3300042133 | Bacteria | 4738 |
| 708 | Ga0450899_017456 | 3300042135 | Bacteria | 826 |
| 709 | Ga0450905_075900 | 3300042142 | Bacteria | 578 |
| 710 | Ga0450905_083305 | 3300042142 | Unclassified | 558 |
| 711 | Ga0450906_038357 | 3300042145 | Bacteria | 845 |
| 712 | Ga0439446_0013235 | 3300042156 | Bacteria | 2262 |
| 713 | Ga0439446_0107312 | 3300042156 | Unclassified | 888 |
| 714 | Ga0450908_020092 | 3300042184 | Bacteria | 1175 |
| 715 | Ga0439434_0070902 | 3300042435 | Bacteria | 1097 |
| 716 | Ga0439434_0272390 | 3300042435 | Unclassified | 582 |
| 717 | Ga0439435_0040353 | 3300042436 | Bacteria | 1304 |
| 718 | Ga0439460_0028314 | 3300042461 | Bacteria | 1580 |
| 719 | Ga0450916_018446 | 3300042530 | Bacteria | 940 |
| 720 | Ga0450916_065943 | 3300042530 | Unclassified | 596 |
| 721 | Ga0450893_0007133 | 3300042532 | Bacteria | 1814 |
| 722 | Ga0451577_0033978 | 3300042876 | Bacteria | 4599 |
| 723 | Ga0453684_0230994 | 3300044712 | Bacteria | 2136 |
| 724 | Ga0451576_0585839 | 3300045051 | Bacteria | 1172 |
| 725 | Ga0495592_0860683 | 3300046454 | Bacteria | 535 |
| 726 | Ga0495603_0015692 | 3300046455 | Bacteria | 4583 |
| 727 | Ga0495629_0264585 | 3300046459 | Bacteria | 1182 |
| 728 | Ga0495651_0790365 | 3300046462 | Unclassified | 586 |
| 729 | Ga0495653_0016842 | 3300046463 | Bacteria | 5948 |
| 730 | Ga0495582_0584143 | 3300046473 | Unclassified | 646 |
| 731 | Ga0495585_0612910 | 3300046492 | Unclassified | 511 |
| 732 | Ga0495594_0235853 | 3300046499 | Bacteria | 1043 |
| 733 | Ga0495618_0811460 | 3300046514 | Bacteria | 544 |
| 734 | Ga0495630_0924182 | 3300046517 | Unclassified | 664 |
| 735 | Ga0495652_0255448 | 3300046529 | Bacteria | 1297 |
| 736 | Ga0495640_0245015 | 3300046533 | Bacteria | 1124 |
| 737 | Ga0495586_0282431 | 3300046535 | Bacteria | 950 |
| 738 | Ga0495621_0190859 | 3300046539 | Bacteria | 821 |
| 739 | Ga0495667_0114538 | 3300046559 | Bacteria | 1742 |
| 740 | Ga0495634_0579531 | 3300046642 | Bacteria | 652 |
| 741 | Ga0495635_0314122 | 3300046663 | Bacteria | 1049 |
| 742 | Ga0495659_0286459 | 3300046664 | Unclassified | 693 |
| 743 | Ga0495658_0099746 | 3300046683 | Bacteria | 1732 |
| 744 | Ga0495658_0172874 | 3300046683 | Bacteria | 1338 |
| 745 | Ga0495658_0569642 | 3300046683 | Bacteria | 725 |
| 746 | Ga0495658_0801188 | 3300046683 | Unclassified | 603 |
| 747 | Ga0495613_0047197 | 3300046689 | Bacteria | 3182 |
| 748 | Ga0495613_0589545 | 3300046689 | Unclassified | 740 |
| 749 | Ga0495604_0200006 | 3300047317 | Bacteria | 1387 |
| 750 | Ga0495674_0077950 | 3300047319 | Bacteria | 2848 |
| 751 | Ga0495674_0439832 | 3300047319 | Unclassified | 1049 |
| 752 | Ga0495674_0645816 | 3300047319 | Bacteria | 835 |
| 753 | Ga0495674_0802443 | 3300047319 | Bacteria | 732 |
| 754 | Ga0496100_0152608 | 3300048903 | Bacteria | 1649 |
| 755 | Ga0496100_0531087 | 3300048903 | Unclassified | 909 |
| 756 | Ga0496100_0540795 | 3300048903 | Unclassified | 900 |
| 757 | Ga0496101_0025059 | 3300048904 | Bacteria | 4135 |
| 758 | Ga0496101_0468680 | 3300048904 | Bacteria | 994 |
| 759 | Ga0496101_0915932 | 3300048904 | Bacteria | 690 |
| 760 | Ga0496101_0963197 | 3300048904 | Unclassified | 671 |
| 761 | Ga0496102_0166996 | 3300048905 | Unclassified | 2071 |
| 762 | Ga0496102_0560969 | 3300048905 | Bacteria | 1065 |
| 763 | Ga0496102_0702480 | 3300048905 | Bacteria | 934 |
| 764 | Ga0496102_1548139 | 3300048905 | Bacteria | 581 |
| 765 | Ga0496102_1578786 | 3300048905 | Bacteria | 575 |
| 766 | Ga0496103_0213103 | 3300048906 | Bacteria | 1242 |
| 767 | Ga0496104_0000157 | 3300048907 | Bacteria | 61755 |
| 768 | Ga0496104_0042987 | 3300048907 | Bacteria | 4243 |
| 769 | Ga0496104_0086907 | 3300048907 | Unclassified | 2986 |
| 770 | Ga0496104_0404824 | 3300048907 | Bacteria | 1277 |
| 771 | Ga0496105_0593340 | 3300048908 | Bacteria | 860 |
| 772 | Ga0496105_0811839 | 3300048908 | Unclassified | 710 |
| 773 | Ga0496105_0837321 | 3300048908 | Bacteria | 697 |
| 774 | Ga0496106_0111211 | 3300048909 | Bacteria | 2133 |
| 775 | Ga0496106_0349184 | 3300048909 | Unclassified | 1188 |
| 776 | Ga0496106_0443834 | 3300048909 | Bacteria | 1042 |
| 777 | Ga0496106_0506700 | 3300048909 | Unclassified | 969 |
| 778 | Ga0496106_0849733 | 3300048909 | Unclassified | 722 |
| 779 | Ga0496106_0974294 | 3300048909 | Bacteria | 668 |
| 780 | Ga0496107_0078155 | 3300048910 | Bacteria | 2411 |
| 781 | Ga0496107_0135686 | 3300048910 | Unclassified | 1818 |
| 782 | Ga0496107_0361523 | 3300048910 | Bacteria | 1080 |
| 783 | Ga0496107_0742530 | 3300048910 | Bacteria | 720 |
| 784 | Ga0496107_0846301 | 3300048910 | Unclassified | 668 |
| 785 | Ga0496108_0008261 | 3300048911 | Bacteria | 8444 |
| 786 | Ga0496108_0132996 | 3300048911 | Unclassified | 2138 |
| 787 | Ga0496108_0200393 | 3300048911 | Bacteria | 1732 |
| 788 | Ga0496108_0204459 | 3300048911 | Bacteria | 1714 |
| 789 | Ga0496108_0395800 | 3300048911 | Bacteria | 1207 |
| 790 | Ga0496108_0509991 | 3300048911 | Bacteria | 1050 |
| 791 | Ga0496109_0010308 | 3300048912 | Bacteria | 7981 |
| 792 | Ga0496109_0011076 | 3300048912 | Bacteria | 7731 |
| 793 | Ga0496109_0098078 | 3300048912 | Bacteria | 2717 |
| 794 | Ga0496109_0148942 | 3300048912 | Bacteria | 2191 |
| 795 | Ga0496109_0228590 | 3300048912 | Bacteria | 1750 |
| 796 | Ga0496109_0948229 | 3300048912 | Bacteria | 798 |
| 797 | Ga0496109_1087468 | 3300048912 | Bacteria | 737 |
| 798 | Ga0496110_0002759 | 3300048913 | Bacteria | 13257 |
| 799 | Ga0496110_0010807 | 3300048913 | Bacteria | 7443 |
| 800 | Ga0496110_0011106 | 3300048913 | Bacteria | 7357 |
| 801 | Ga0496110_0111841 | 3300048913 | Unclassified | 2455 |
| 802 | Ga0496110_0182747 | 3300048913 | Bacteria | 1904 |
| 803 | Ga0496110_1383736 | 3300048913 | Bacteria | 613 |
| 804 | Ga0496110_1503263 | 3300048913 | Unclassified | 583 |
| 805 | Ga0496111_0013452 | 3300048914 | Bacteria | 5570 |
| 806 | Ga0496111_0065455 | 3300048914 | Bacteria | 2638 |
| 807 | Ga0496111_0118079 | 3300048914 | Bacteria | 1958 |
| 808 | Ga0496111_0510770 | 3300048914 | Bacteria | 884 |
| 809 | Ga0496111_0647055 | 3300048914 | Bacteria | 771 |
| 810 | Ga0496112_0000148 | 3300048915 | Bacteria | 44089 |
| 811 | Ga0496112_0004165 | 3300048915 | Bacteria | 12183 |
| 812 | Ga0496112_0232059 | 3300048915 | Bacteria | 1800 |
| 813 | Ga0496112_0301031 | 3300048915 | Bacteria | 1549 |
| 814 | Ga0496112_0995801 | 3300048915 | Unclassified | 758 |
| 815 | Ga0496113_0103583 | 3300048916 | Unclassified | 2207 |
| 816 | Ga0496114_0027098 | 3300048917 | Bacteria | 4693 |
| 817 | Ga0496114_0444674 | 3300048917 | Unclassified | 1148 |
| 818 | Ga0501031_0108509 | 3300049568 | Bacteria | 1812 |
| 819 | Ga0501031_0110018 | 3300049568 | Bacteria | 1799 |
| 820 | Ga0501031_0243145 | 3300049568 | Bacteria | 1170 |
| 821 | Ga0501032_0094652 | 3300049569 | Bacteria | 1980 |
| 822 | Ga0501032_0601387 | 3300049569 | Unclassified | 699 |
| 823 | Ga0501032_0638444 | 3300049569 | Bacteria | 676 |
| 824 | Ga0501033_0048274 | 3300049570 | Bacteria | 3162 |
| 825 | Ga0501033_0139266 | 3300049570 | Bacteria | 1755 |
| 826 | Ga0501033_0807887 | 3300049570 | Bacteria | 634 |
| 827 | Ga0501033_1071967 | 3300049570 | Bacteria | 537 |
| 828 | Ga0501034_0006113 | 3300049571 | Bacteria | 12991 |
| 829 | Ga0501034_0128066 | 3300049571 | Bacteria | 2523 |
| 830 | Ga0501034_0663665 | 3300049571 | Bacteria | 943 |
| 831 | Ga0501034_1246297 | 3300049571 | Unclassified | 621 |
| 832 | Ga0501036_0021023 | 3300049572 | Bacteria | 5480 |
| 833 | Ga0501036_0175496 | 3300049572 | Bacteria | 1804 |
| 834 | Ga0501036_0177638 | 3300049572 | Bacteria | 1793 |
| 835 | Ga0501036_0214351 | 3300049572 | Bacteria | 1617 |
| 836 | Ga0501036_0395912 | 3300049572 | Bacteria | 1152 |
| 837 | Ga0501036_0728600 | 3300049572 | Bacteria | 818 |
| 838 | Ga0501036_0888572 | 3300049572 | Bacteria | 732 |
| 839 | Ga0501037_0150182 | 3300049573 | Bacteria | 1665 |
| 840 | Ga0501037_0765940 | 3300049573 | Bacteria | 639 |
| 841 | Ga0501038_0026845 | 3300049574 | Bacteria | 5127 |
| 842 | Ga0501038_0065980 | 3300049574 | Bacteria | 3083 |
| 843 | Ga0501038_0229508 | 3300049574 | Bacteria | 1478 |
| 844 | Ga0501038_0557184 | 3300049574 | Bacteria | 871 |
| 845 | Ga0501039_0059409 | 3300049575 | Bacteria | 2962 |
| 846 | Ga0501039_0086565 | 3300049575 | Bacteria | 2440 |
| 847 | Ga0501039_0121123 | 3300049575 | Bacteria | 2050 |
| 848 | Ga0501039_1588473 | 3300049575 | Unclassified | 502 |
| 849 | Ga0501040_0202994 | 3300049576 | Unclassified | 1408 |
| 850 | Ga0501040_0348611 | 3300049576 | Bacteria | 1060 |
| 851 | Ga0501040_0486101 | 3300049576 | Bacteria | 890 |
| 852 | Ga0501040_0616573 | 3300049576 | Bacteria | 784 |
| 853 | Ga0501040_0702329 | 3300049576 | Unclassified | 731 |
| 854 | Ga0501040_0782944 | 3300049576 | Bacteria | 690 |
| 855 | Ga0501041_0082306 | 3300049577 | Bacteria | 1983 |
| 856 | Ga0501041_0155832 | 3300049577 | Bacteria | 1427 |
| 857 | Ga0501041_0602352 | 3300049577 | Bacteria | 701 |
| 858 | Ga0501041_0702693 | 3300049577 | Bacteria | 647 |
| 859 | Ga0501042_0021483 | 3300049578 | Bacteria | 4499 |
| 860 | Ga0501042_0260722 | 3300049578 | Bacteria | 1251 |
| 861 | Ga0501042_0371331 | 3300049578 | Unclassified | 1035 |
| 862 | Ga0501042_0465593 | 3300049578 | Bacteria | 917 |
| 863 | Ga0501042_0500515 | 3300049578 | Bacteria | 882 |
| 864 | Ga0501042_0992274 | 3300049578 | Unclassified | 612 |
| 865 | Ga0501043_0003776 | 3300049579 | Bacteria | 12447 |
| 866 | Ga0501043_0349186 | 3300049579 | Bacteria | 1124 |
| 867 | Ga0501043_0424204 | 3300049579 | Bacteria | 1002 |
| 868 | Ga0501043_0974685 | 3300049579 | Unclassified | 605 |
| 869 | Ga0501043_1235536 | 3300049579 | Bacteria | 523 |
| 870 | Ga0501046_0005320 | 3300049580 | Bacteria | 11510 |
| 871 | Ga0501046_0011536 | 3300049580 | Bacteria | 7556 |
| 872 | Ga0501046_0069357 | 3300049580 | Bacteria | 2743 |
| 873 | Ga0501046_0296786 | 3300049580 | Unclassified | 1181 |
| 874 | Ga0501046_1012268 | 3300049580 | Unclassified | 576 |
| 875 | Ga0501046_1037604 | 3300049580 | Bacteria | 568 |
| 876 | Ga0501047_0001473 | 3300049581 | Bacteria | 22948 |
| 877 | Ga0501047_0051950 | 3300049581 | Bacteria | 3961 |
| 878 | Ga0501047_0096646 | 3300049581 | Bacteria | 2832 |
| 879 | Ga0501047_0156752 | 3300049581 | Bacteria | 2150 |
| 880 | Ga0501047_0440795 | 3300049581 | Unclassified | 1132 |
| 881 | Ga0501048_0151199 | 3300049582 | Bacteria | 1642 |
| 882 | Ga0501048_0156468 | 3300049582 | Bacteria | 1612 |
| 883 | Ga0501048_0685850 | 3300049582 | Bacteria | 735 |
| 884 | Ga0501048_0975704 | 3300049582 | Bacteria | 609 |
| 885 | Ga0501067_0228787 | 3300049583 | Bacteria | 1035 |
| 886 | Ga0501067_0247372 | 3300049583 | Bacteria | 992 |
| 887 | Ga0501067_0407869 | 3300049583 | Unclassified | 758 |
| 888 | Ga0501067_0436425 | 3300049583 | Bacteria | 731 |
| 889 | Ga0501067_0500022 | 3300049583 | Bacteria | 680 |
| 890 | Ga0501068_0006774 | 3300049584 | Bacteria | 6331 |
| 891 | Ga0501068_0620940 | 3300049584 | Bacteria | 705 |
| 892 | Ga0501069_0217962 | 3300049585 | Bacteria | 1108 |
| 893 | Ga0501069_0784561 | 3300049585 | Unclassified | 577 |
| 894 | Ga0501070_0404719 | 3300049586 | Bacteria | 1103 |
| 895 | Ga0501071_0035635 | 3300049587 | Bacteria | 3545 |
| 896 | Ga0501071_0055007 | 3300049587 | Bacteria | 2872 |
| 897 | Ga0501071_0137129 | 3300049587 | Bacteria | 1821 |
| 898 | Ga0501071_0177385 | 3300049587 | Bacteria | 1596 |
| 899 | Ga0501071_1174141 | 3300049587 | Bacteria | 593 |
| 900 | Ga0501072_0018755 | 3300049588 | Bacteria | 5335 |
| 901 | Ga0501072_0040269 | 3300049588 | Bacteria | 3669 |
| 902 | Ga0501072_0264553 | 3300049588 | Bacteria | 1369 |
| 903 | Ga0501072_0346760 | 3300049588 | Bacteria | 1179 |
| 904 | Ga0501072_0347587 | 3300049588 | Bacteria | 1177 |
| 905 | Ga0501072_0529226 | 3300049588 | Unclassified | 932 |
| 906 | Ga0501072_0584751 | 3300049588 | Bacteria | 881 |
| 907 | Ga0501072_0601348 | 3300049588 | Bacteria | 867 |
| 908 | Ga0501072_0837720 | 3300049588 | Bacteria | 719 |
| 909 | Ga0501072_1474436 | 3300049588 | Bacteria | 525 |
| 910 | Ga0501073_0040646 | 3300049589 | Bacteria | 3289 |
| 911 | Ga0501073_0110912 | 3300049589 | Bacteria | 1903 |
| 912 | Ga0501073_0118916 | 3300049589 | Bacteria | 1831 |
| 913 | Ga0501073_0147300 | 3300049589 | Bacteria | 1631 |
| 914 | Ga0501073_0192543 | 3300049589 | Bacteria | 1411 |
| 915 | Ga0501073_0224747 | 3300049589 | Bacteria | 1297 |
| 916 | Ga0501073_0378015 | 3300049589 | Bacteria | 978 |
| 917 | Ga0501073_0383720 | 3300049589 | Bacteria | 971 |
| 918 | Ga0501074_0160395 | 3300049590 | Bacteria | 1606 |
| 919 | Ga0501074_0162251 | 3300049590 | Bacteria | 1596 |
| 920 | Ga0501074_0186184 | 3300049590 | Bacteria | 1480 |
| 921 | Ga0501074_0343411 | 3300049590 | Unclassified | 1060 |
| 922 | Ga0501074_0706996 | 3300049590 | Bacteria | 711 |
| 923 | Ga0501075_0037021 | 3300049591 | Bacteria | 3643 |
| 924 | Ga0501075_0042891 | 3300049591 | Bacteria | 3393 |
| 925 | Ga0501075_0060105 | 3300049591 | Bacteria | 2864 |
| 926 | Ga0501075_0088648 | 3300049591 | Bacteria | 2346 |
| 927 | Ga0501075_0189572 | 3300049591 | Bacteria | 1568 |
| 928 | Ga0501075_0541494 | 3300049591 | Bacteria | 888 |
| 929 | Ga0501076_0005978 | 3300049592 | Bacteria | 8786 |
| 930 | Ga0501076_0056689 | 3300049592 | Bacteria | 3110 |
| 931 | Ga0501076_0086660 | 3300049592 | Bacteria | 2517 |
| 932 | Ga0501076_0089559 | 3300049592 | Bacteria | 2474 |
| 933 | Ga0501076_0241737 | 3300049592 | Bacteria | 1477 |
| 934 | Ga0501076_0252368 | 3300049592 | Unclassified | 1444 |
| 935 | Ga0501076_0323579 | 3300049592 | Bacteria | 1265 |
| 936 | Ga0501076_0452904 | 3300049592 | Bacteria | 1057 |
| 937 | Ga0501076_0775457 | 3300049592 | Unclassified | 791 |
| 938 | Ga0501076_1358166 | 3300049592 | Unclassified | 584 |
| 939 | Ga0501077_0040315 | 3300049593 | Bacteria | 2976 |
| 940 | Ga0501077_0086806 | 3300049593 | Bacteria | 1983 |
| 941 | Ga0501077_0184000 | 3300049593 | Bacteria | 1328 |
| 942 | Ga0501077_0419057 | 3300049593 | Unclassified | 856 |
| 943 | Ga0501077_0574753 | 3300049593 | Bacteria | 723 |
| 944 | Ga0501249_173077 | 3300049679 | Unclassified | 554 |
| 945 | Ga0501079_0054982 | 3300049741 | Bacteria | 3071 |
| 946 | Ga0501079_0058537 | 3300049741 | Bacteria | 2973 |
| 947 | Ga0501079_0103295 | 3300049741 | Bacteria | 2211 |
| 948 | Ga0501079_0291780 | 3300049741 | Bacteria | 1276 |
| 949 | Ga0501079_0312420 | 3300049741 | Bacteria | 1230 |
| 950 | Ga0501079_0876309 | 3300049741 | Unclassified | 707 |
| 951 | Ga0501079_0881503 | 3300049741 | Unclassified | 705 |
| 952 | Ga0501080_0027293 | 3300049742 | Bacteria | 5309 |
| 953 | Ga0501080_0287010 | 3300049742 | Bacteria | 1495 |
| 954 | Ga0501080_0291905 | 3300049742 | Unclassified | 1480 |
| 955 | Ga0501080_0607157 | 3300049742 | Bacteria | 971 |
| 956 | Ga0501080_0608565 | 3300049742 | Bacteria | 969 |
| 957 | Ga0501080_0621866 | 3300049742 | Bacteria | 957 |
| 958 | Ga0501080_0746448 | 3300049742 | Bacteria | 861 |
| 959 | Ga0501080_1534035 | 3300049742 | Bacteria | 565 |
| 960 | Ga0501080_1557705 | 3300049742 | Bacteria | 560 |
| 961 | Ga0501081_0042825 | 3300049743 | Bacteria | 3104 |
| 962 | Ga0501081_0063454 | 3300049743 | Bacteria | 2564 |
| 963 | Ga0501081_0212806 | 3300049743 | Unclassified | 1404 |
| 964 | Ga0501081_0299607 | 3300049743 | Bacteria | 1179 |
| 965 | Ga0501081_0635315 | 3300049743 | Bacteria | 800 |
| 966 | Ga0501081_0710202 | 3300049743 | Unclassified | 755 |
| 967 | Ga0501083_0012875 | 3300049744 | Bacteria | 5850 |
| 968 | Ga0501083_0115600 | 3300049744 | Bacteria | 1761 |
| 969 | Ga0501035_0094786 | 3300049822 | Bacteria | 2624 |
| 970 | Ga0501035_0104196 | 3300049822 | Bacteria | 2488 |
| 971 | Ga0501035_0193773 | 3300049822 | Bacteria | 1746 |
| 972 | Ga0501044_0025113 | 3300049823 | Bacteria | 6319 |
| 973 | Ga0501044_0037359 | 3300049823 | Bacteria | 5076 |
| 974 | Ga0501045_0037298 | 3300049824 | Bacteria | 3532 |
| 975 | Ga0501045_0046206 | 3300049824 | Bacteria | 3171 |
| 976 | Ga0501045_0128366 | 3300049824 | Bacteria | 1884 |
| 977 | Ga0501045_0850916 | 3300049824 | Bacteria | 671 |
| 978 | Ga0501045_0930076 | 3300049824 | Bacteria | 638 |
| 979 | nmdc:mga03683_11941_c1 | 3300050489 | Bacteria | 3159 |
| 980 | nmdc:mga00v17_59698_c1 | 3300050491 | Bacteria | 2341 |
| 981 | nmdc:mga0yw44_1015696_c1 | 3300050492 | Unclassified | 561 |
| 982 | nmdc:mga0yw44_303014_c1 | 3300050492 | Bacteria | 1071 |
| 983 | nmdc:mga0k408_290120_c1 | 3300050493 | Bacteria | 976 |
| 984 | nmdc:mga0k408_5399_c1 | 3300050493 | Bacteria | 6797 |
| 985 | nmdc:mga0k408_6905_c1 | 3300050493 | Bacteria | 6057 |
| 986 | nmdc:mga06z11_294816_c1 | 3300050494 | Unclassified | 963 |
| 987 | nmdc:mga04h51_72200_c1 | 3300050495 | Bacteria | 1207 |
| 988 | nmdc:mga05p37_1068279_c1 | 3300050507 | Bacteria | 849 |
| 989 | nmdc:mga05p37_167732_c1 | 3300050507 | Bacteria | 2679 |
| 990 | nmdc:mga05p37_2454_c1 | 3300050507 | Bacteria | 21555 |
| 991 | nmdc:mga05p37_34417_c1 | 3300050507 | Bacteria | 6205 |
| 992 | nmdc:mga05p37_41627_c1 | 3300050507 | Bacteria | 5641 |
| 993 | nmdc:mga05p37_613640_c2 | 3300050507 | Bacteria | 706 |
| 994 | nmdc:mga05p37_63372_c1 | 3300050507 | Bacteria | 4549 |
| 995 | nmdc:mga09592_143785_c1 | 3300050508 | Unclassified | 2056 |
| 996 | nmdc:mga09592_144718_c1 | 3300050508 | Bacteria | 2049 |
| 997 | nmdc:mga09592_1484143_c1 | 3300050508 | Bacteria | 552 |
| 998 | nmdc:mga0qj67_139841_c1 | 3300050509 | Bacteria | 1963 |
| 999 | nmdc:mga0qj67_4402_c1 | 3300050509 | Bacteria | 10199 |
| 1000 | nmdc:mga0qj67_45318_c1 | 3300050509 | Bacteria | 3470 |
| 1001 | nmdc:mga06r32_36771_c1 | 3300050510 | Bacteria | 4629 |
| 1002 | nmdc:mga06r32_454924_c1 | 3300050510 | Bacteria | 1260 |
| 1003 | nmdc:mga06r32_66537_c1 | 3300050510 | Bacteria | 3477 |
| 1004 | nmdc:mga06r32_7498_c1 | 3300050510 | Bacteria | 9812 |
| 1005 | nmdc:mga08y16_1464923_c1 | 3300050511 | Bacteria | 644 |
| 1006 | nmdc:mga08y16_153994_c1 | 3300050511 | Unclassified | 2389 |
| 1007 | nmdc:mga08y16_167701_c1 | 3300050511 | Bacteria | 2281 |
| 1008 | nmdc:mga08y16_1963090_c1 | 3300050511 | Bacteria | 535 |
| 1009 | nmdc:mga08y16_20168_c1 | 3300050511 | Bacteria | 7034 |
| 1010 | nmdc:mga08y16_2821_c1 | 3300050511 | Bacteria | 17849 |
| 1011 | nmdc:mga08y16_579412_c1 | 3300050511 | Unclassified | 1133 |
| 1012 | nmdc:mga08y16_66551_c2 | 3300050511 | Bacteria | 2833 |
| 1013 | nmdc:mga08y16_716615_c1 | 3300050511 | Bacteria | 999 |
| 1014 | nmdc:mga0n895_115148_c1 | 3300050512 | Bacteria | 2707 |
| 1015 | nmdc:mga0n895_1750711_c1 | 3300050512 | Bacteria | 583 |
| 1016 | nmdc:mga0n895_233473_c1 | 3300050512 | Bacteria | 1867 |
| 1017 | nmdc:mga0n895_24578_c1 | 3300050512 | Bacteria | 5680 |
| 1018 | nmdc:mga0n895_368008_c1 | 3300050512 | Bacteria | 1455 |
| 1019 | nmdc:mga0n895_411574_c1 | 3300050512 | Bacteria | 1367 |
| 1020 | nmdc:mga0rr50_108886_c1 | 3300050513 | Bacteria | 2190 |
| 1021 | nmdc:mga0rr50_165429_c1 | 3300050513 | Bacteria | 1798 |
| 1022 | nmdc:mga0rr50_1819885_c1 | 3300050513 | Unclassified | 512 |
| 1023 | nmdc:mga0rr50_1831293_c1 | 3300050513 | Bacteria | 511 |
| 1024 | nmdc:mga0rr50_30217_c1 | 3300050513 | Unclassified | 3833 |
| 1025 | nmdc:mga08x19_212632_c1 | 3300050514 | Bacteria | 1328 |
| 1026 | nmdc:mga08x19_301288_c1 | 3300050514 | Bacteria | 1113 |
| 1027 | nmdc:mga08x19_355707_c1 | 3300050514 | Unclassified | 1023 |
| 1028 | nmdc:mga0a205_1146693_c1 | 3300050515 | Bacteria | 625 |
| 1029 | nmdc:mga0a205_49034_c1 | 3300050515 | Bacteria | 4075 |
| 1030 | nmdc:mga0a205_61638_c1 | 3300050515 | Bacteria | 3623 |
| 1031 | nmdc:mga0a205_65091_c1 | 3300050515 | Bacteria | 3521 |
| 1032 | nmdc:mga0a205_6759_c1 | 3300050515 | Bacteria | 10372 |
| 1033 | Ga0495601_0076870 | 3300053077 | Bacteria | 2138 |
| 1034 | Ga0495601_0084465 | 3300053077 | Bacteria | 2039 |
| 1035 | Ga0495595_0042625 | 3300053084 | Bacteria | 2079 |
| 1036 | Ga0495595_0115643 | 3300053084 | Bacteria | 1304 |
| 1037 | Ga0495595_0652844 | 3300053084 | Bacteria | 539 |
| 1038 | Ga0495619_0001225 | 3300053085 | Bacteria | 16804 |
| 1039 | Ga0501084_0006584 | 3300054114 | Bacteria | 9545 |
| 1040 | Ga0501084_0017135 | 3300054114 | Bacteria | 6018 |
| 1041 | Ga0501084_0035496 | 3300054114 | Bacteria | 4168 |
| 1042 | Ga0501084_0071519 | 3300054114 | Bacteria | 2905 |
| 1043 | Ga0501084_0162260 | 3300054114 | Bacteria | 1885 |
| 1044 | Ga0501084_0550247 | 3300054114 | Bacteria | 975 |
| 1045 | Ga0501084_0555518 | 3300054114 | Bacteria | 970 |
| 1046 | Ga0501084_0587188 | 3300054114 | Bacteria | 941 |
| 1047 | Ga0501084_0718101 | 3300054114 | Unclassified | 842 |
| 1048 | Ga0501084_0855243 | 3300054114 | Bacteria | 765 |
| 1049 | Ga0501084_0869774 | 3300054114 | Bacteria | 758 |
| 1050 | Ga0501084_1590854 | 3300054114 | Bacteria | 546 |
| 1051 | Ga0590071_004751 | 3300059421 | Bacteria | 3280 |
| 1052 | Ga0590075_003372 | 3300059424 | Bacteria | 3803 |
| 1053 | Ga0590077_008658 | 3300059426 | Bacteria | 2083 |
| 1054 | Ga0501082_0026825 | 3300060353 | Bacteria | 4964 |
| 1055 | Ga0501082_0047449 | 3300060353 | Bacteria | 3701 |
| 1056 | Ga0501082_0160030 | 3300060353 | Bacteria | 1956 |
| 1057 | Ga0501082_0272132 | 3300060353 | Bacteria | 1474 |
| 1058 | Ga0501082_0758095 | 3300060353 | Bacteria | 849 |
| 1059 | Ga0501082_0776644 | 3300060353 | Bacteria | 838 |
| 1060 | Ga0501082_0826581 | 3300060353 | Bacteria | 810 |
| 1061 | Ga0501082_0920344 | 3300060353 | Bacteria | 765 |
| 1062 | Ga0501082_0935583 | 3300060353 | Unclassified | 758 |
| 1063 | Ga0501082_0962246 | 3300060353 | Bacteria | 746 |
| 1064 | Ga0501082_1627775 | 3300060353 | Unclassified | 564 |
| 1065 | Ga0530510_0243740 | 3300061734 | Bacteria | 1338 |
| 1066 | Ga0530510_0344118 | 3300061734 | Bacteria | 1120 |
| 1067 | Ga0530510_0390335 | 3300061734 | Bacteria | 1048 |
| 1068 | Ga0530510_0445218 | 3300061734 | Bacteria | 979 |
| 1069 | Ga0530510_0544508 | 3300061734 | Bacteria | 881 |
| 1070 | Ga0530510_0683748 | 3300061734 | Bacteria | 782 |
| 1071 | Ga0530510_0745755 | 3300061734 | Bacteria | 747 |
| 1072 | Ga0530510_0991487 | 3300061734 | Bacteria | 643 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035118 | Ga0373954_0639826 | Ga0373954_0639826_253_513 | 79 |
| 2 | 3300009176 | Ga0105242_13148114 | Ga0105242_131481142 | 82 |
| 3 | 3300035088 | Ga0373940_0123896 | Ga0373940_0123896_31_282 | 82 |
| 4 | 3300005340 | Ga0070689_100141077 | Ga0070689_1001410772 | 83 |
| 5 | 3300009094 | Ga0111539_11984297 | Ga0111539_119842971 | 83 |
| 6 | 3300009101 | Ga0105247_10100266 | Ga0105247_101002664 | 83 |
| 7 | 3300009177 | Ga0105248_10054044 | Ga0105248_100540446 | 83 |
| 8 | 3300009551 | Ga0105238_10136346 | Ga0105238_101363463 | 83 |
| 9 | 3300010375 | Ga0105239_10296047 | Ga0105239_102960474 | 83 |
| 10 | 3300013308 | Ga0157375_10259698 | Ga0157375_102596985 | 83 |
| 11 | 3300025940 | Ga0207691_10601706 | Ga0207691_106017061 | 83 |
| 12 | 3300035170 | Ga0373943_0229432 | Ga0373943_0229432_51_302 | 83 |
| 13 | 3300050512 | nmdc:mga0n895_411574_c1 | nmdc:mga0n895_411574_c1_691_942 | 83 |
| 14 | 3300050513 | nmdc:mga0rr50_108886_c1 | nmdc:mga0rr50_108886_c1_932_1183 | 83 |
| 15 | 3300005471 | Ga0070698_101620173 | Ga0070698_1016201731 | 84 |
| 16 | 3300005844 | Ga0068862_100723461 | Ga0068862_1007234613 | 84 |
| 17 | 3300026089 | Ga0207648_11645629 | Ga0207648_116456292 | 84 |
| 18 | 3300028380 | Ga0268265_11944779 | Ga0268265_119447792 | 84 |
| 19 | 3300049577 | Ga0501041_0702693 | Ga0501041_0702693_130_387 | 85 |
| 20 | 3300049578 | Ga0501042_0500515 | Ga0501042_0500515_221_478 | 85 |
| 21 | 3300049591 | Ga0501075_0541494 | Ga0501075_0541494_456_713 | 85 |
| 22 | 3300049592 | Ga0501076_0089559 | Ga0501076_0089559_804_1061 | 85 |
| 23 | 3300049743 | Ga0501081_0212806 | Ga0501081_0212806_454_711 | 85 |
| 24 | 3300054114 | Ga0501084_0071519 | Ga0501084_0071519_282_539 | 85 |
| 25 | 3300060353 | Ga0501082_0826581 | Ga0501082_0826581_440_697 | 85 |
| 26 | 3300061734 | Ga0530510_0991487 | Ga0530510_0991487_119_376 | 85 |
| 27 | 3300005290 | Ga0065712_10193404 | Ga0065712_101934042 | 86 |
| 28 | 3300005354 | Ga0070675_101011476 | Ga0070675_1010114761 | 86 |
| 29 | 3300005367 | Ga0070667_102138147 | Ga0070667_1021381471 | 86 |
| 30 | 3300005615 | Ga0070702_100149497 | Ga0070702_1001494971 | 86 |
| 31 | 3300005719 | Ga0068861_100372418 | Ga0068861_1003724184 | 86 |
| 32 | 3300009094 | Ga0111539_10173669 | Ga0111539_101736693 | 86 |
| 33 | 3300009553 | Ga0105249_10791467 | Ga0105249_107914672 | 86 |
| 34 | 3300014326 | Ga0157380_10143224 | Ga0157380_101432241 | 86 |
| 35 | 3300025926 | Ga0207659_10533713 | Ga0207659_105337133 | 86 |
| 36 | 3300025936 | Ga0207670_11205493 | Ga0207670_112054932 | 86 |
| 37 | 3300025937 | Ga0207669_11662304 | Ga0207669_116623041 | 86 |
| 38 | 3300025961 | Ga0207712_10652875 | Ga0207712_106528752 | 86 |
| 39 | 3300026118 | Ga0207675_100713542 | Ga0207675_1007135423 | 86 |
| 40 | 3300050508 | nmdc:mga09592_1484143_c1 | nmdc:mga09592_1484143_c1_253_519 | 86 |
| 41 | 3300050511 | nmdc:mga08y16_153994_c1 | nmdc:mga08y16_153994_c1_1794_2060 | 86 |
| 42 | 3300050511 | nmdc:mga08y16_579412_c1 | nmdc:mga08y16_579412_c1_35_301 | 86 |
| 43 | 3300050512 | nmdc:mga0n895_1750711_c1 | nmdc:mga0n895_1750711_c1_16_282 | 86 |
| 44 | 3300002459 | JGI24751J29686_10047507 | JGI24751J29686_100475073 | 87 |
| 45 | 3300005288 | Ga0065714_10191579 | Ga0065714_101915791 | 87 |
| 46 | 3300005331 | Ga0070670_100047682 | Ga0070670_1000476826 | 87 |
| 47 | 3300005339 | Ga0070660_100661703 | Ga0070660_1006617033 | 87 |
| 48 | 3300005356 | Ga0070674_100097298 | Ga0070674_1000972984 | 87 |
| 49 | 3300005366 | Ga0070659_100168933 | Ga0070659_1001689334 | 87 |
| 50 | 3300005455 | Ga0070663_100390052 | Ga0070663_1003900524 | 87 |
| 51 | 3300005457 | Ga0070662_100680803 | Ga0070662_1006808032 | 87 |
| 52 | 3300005539 | Ga0068853_102293707 | Ga0068853_1022937071 | 87 |
| 53 | 3300005547 | Ga0070693_101049058 | Ga0070693_1010490582 | 87 |
| 54 | 3300005548 | Ga0070665_100248210 | Ga0070665_1002482104 | 87 |
| 55 | 3300005548 | Ga0070665_101085551 | Ga0070665_1010855513 | 87 |
| 56 | 3300005618 | Ga0068864_100732842 | Ga0068864_1007328422 | 87 |
| 57 | 3300005844 | Ga0068862_101272499 | Ga0068862_1012724992 | 87 |
| 58 | 3300006846 | Ga0075430_100006051 | Ga0075430_1000060513 | 87 |
| 59 | 3300009177 | Ga0105248_13388069 | Ga0105248_133880692 | 87 |
| 60 | 3300014326 | Ga0157380_11740667 | Ga0157380_117406672 | 87 |
| 61 | 3300025925 | Ga0207650_10010455 | Ga0207650_100104552 | 87 |
| 62 | 3300025932 | Ga0207690_10271928 | Ga0207690_102719283 | 87 |
| 63 | 3300025933 | Ga0207706_10822047 | Ga0207706_108220473 | 87 |
| 64 | 3300025933 | Ga0207706_10863325 | Ga0207706_108633252 | 87 |
| 65 | 3300025937 | Ga0207669_10593369 | Ga0207669_105933692 | 87 |
| 66 | 3300025941 | Ga0207711_10330700 | Ga0207711_103307003 | 87 |
| 67 | 3300025961 | Ga0207712_11391467 | Ga0207712_113914671 | 87 |
| 68 | 3300026041 | Ga0207639_10394324 | Ga0207639_103943244 | 87 |
| 69 | 3300026067 | Ga0207678_10402467 | Ga0207678_104024674 | 87 |
| 70 | 3300026088 | Ga0207641_10735499 | Ga0207641_107354992 | 87 |
| 71 | 3300026095 | Ga0207676_10708581 | Ga0207676_107085812 | 87 |
| 72 | 3300027717 | Ga0209998_10033825 | Ga0209998_100338254 | 87 |
| 73 | 3300028380 | Ga0268265_10341819 | Ga0268265_103418192 | 87 |
| 74 | 3300031456 | Ga0307513_10771604 | Ga0307513_107716042 | 87 |
| 75 | 3300031995 | Ga0307409_100173215 | Ga0307409_1001732154 | 87 |
| 76 | 3300031995 | Ga0307409_101483992 | Ga0307409_1014839923 | 87 |
| 77 | 3300032002 | Ga0307416_101342006 | Ga0307416_1013420063 | 87 |
| 78 | 3300037068 | Ga0373925_0006513 | Ga0373925_0006513_7002_7265 | 87 |
| 79 | 3300041460 | Ga0451802_0912663 | Ga0451802_0912663_452_715 | 87 |
| 80 | 3300041463 | Ga0451804_0779925 | Ga0451804_0779925_356_619 | 87 |
| 81 | 3300041512 | Ga0451853_3998079 | Ga0451853_3998079_211_474 | 87 |
| 82 | 3300042129 | Ga0450891_019284 | Ga0450891_019284_197_460 | 87 |
| 83 | 3300042142 | Ga0450905_083305 | Ga0450905_083305_11_274 | 87 |
| 84 | 3300042530 | Ga0450916_018446 | Ga0450916_018446_149_412 | 87 |
| 85 | 3300046514 | Ga0495618_0811460 | Ga0495618_0811460_25_288 | 87 |
| 86 | 3300046689 | Ga0495613_0047197 | Ga0495613_0047197_822_1085 | 87 |
| 87 | 3300048905 | Ga0496102_0702480 | Ga0496102_0702480_366_629 | 87 |
| 88 | 3300048913 | Ga0496110_1383736 | Ga0496110_1383736_303_566 | 87 |
| 89 | 3300049568 | Ga0501031_0108509 | Ga0501031_0108509_85_348 | 87 |
| 90 | 3300049570 | Ga0501033_1071967 | Ga0501033_1071967_254_517 | 87 |
| 91 | 3300049572 | Ga0501036_0395912 | Ga0501036_0395912_125_388 | 87 |
| 92 | 3300049574 | Ga0501038_0229508 | Ga0501038_0229508_1180_1443 | 87 |
| 93 | 3300049575 | Ga0501039_0059409 | Ga0501039_0059409_739_1002 | 87 |
| 94 | 3300049576 | Ga0501040_0348611 | Ga0501040_0348611_746_1009 | 87 |
| 95 | 3300049577 | Ga0501041_0602352 | Ga0501041_0602352_106_369 | 87 |
| 96 | 3300049582 | Ga0501048_0685850 | Ga0501048_0685850_25_288 | 87 |
| 97 | 3300049583 | Ga0501067_0407869 | Ga0501067_0407869_136_411 | 87 |
| 98 | 3300049587 | Ga0501071_0035635 | Ga0501071_0035635_475_738 | 87 |
| 99 | 3300049588 | Ga0501072_0347587 | Ga0501072_0347587_127_390 | 87 |
| 100 | 3300049590 | Ga0501074_0343411 | Ga0501074_0343411_254_517 | 87 |
| 101 | 3300049591 | Ga0501075_0037021 | Ga0501075_0037021_2497_2760 | 87 |
| 102 | 3300049592 | Ga0501076_0056689 | Ga0501076_0056689_2234_2497 | 87 |
| 103 | 3300049593 | Ga0501077_0086806 | Ga0501077_0086806_1682_1945 | 87 |
| 104 | 3300049593 | Ga0501077_0184000 | Ga0501077_0184000_845_1108 | 87 |
| 105 | 3300049741 | Ga0501079_0054982 | Ga0501079_0054982_503_766 | 87 |
| 106 | 3300049743 | Ga0501081_0063454 | Ga0501081_0063454_771_1034 | 87 |
| 107 | 3300049822 | Ga0501035_0104196 | Ga0501035_0104196_382_645 | 87 |
| 108 | 3300049824 | Ga0501045_0037298 | Ga0501045_0037298_853_1116 | 87 |
| 109 | 3300050509 | nmdc:mga0qj67_4402_c1 | nmdc:mga0qj67_4402_c1_9393_9656 | 87 |
| 110 | 3300054114 | Ga0501084_0555518 | Ga0501084_0555518_451_714 | 87 |
| 111 | 3300054114 | Ga0501084_0855243 | Ga0501084_0855243_111_374 | 87 |
| 112 | 3300060353 | Ga0501082_0047449 | Ga0501082_0047449_464_727 | 87 |
| 113 | 3300061734 | Ga0530510_0243740 | Ga0530510_0243740_777_1040 | 87 |
| 114 | 3300001991 | JGI24743J22301_10138864 | JGI24743J22301_101388642 | 88 |
| 115 | 3300002077 | JGI24744J21845_10089966 | JGI24744J21845_100899662 | 88 |
| 116 | 3300002239 | JGI24034J26672_10063540 | JGI24034J26672_100635402 | 88 |
| 117 | 3300005289 | Ga0065704_10409366 | Ga0065704_104093662 | 88 |
| 118 | 3300005290 | Ga0065712_10000353 | Ga0065712_1000035316 | 88 |
| 119 | 3300005290 | Ga0065712_10085891 | Ga0065712_100858916 | 88 |
| 120 | 3300005290 | Ga0065712_10245698 | Ga0065712_102456981 | 88 |
| 121 | 3300005290 | Ga0065712_10442568 | Ga0065712_104425681 | 88 |
| 122 | 3300005293 | Ga0065715_10090861 | Ga0065715_100908613 | 88 |
| 123 | 3300005293 | Ga0065715_10122953 | Ga0065715_101229532 | 88 |
| 124 | 3300005293 | Ga0065715_10158840 | Ga0065715_101588403 | 88 |
| 125 | 3300005293 | Ga0065715_10208819 | Ga0065715_102088193 | 88 |
| 126 | 3300005293 | Ga0065715_10255844 | Ga0065715_102558443 | 88 |
| 127 | 3300005293 | Ga0065715_10378796 | Ga0065715_103787961 | 88 |
| 128 | 3300005293 | Ga0065715_10422987 | Ga0065715_104229872 | 88 |
| 129 | 3300005293 | Ga0065715_10692944 | Ga0065715_106929441 | 88 |
| 130 | 3300005295 | Ga0065707_10004263 | Ga0065707_100042635 | 88 |
| 131 | 3300005295 | Ga0065707_10102583 | Ga0065707_101025836 | 88 |
| 132 | 3300005328 | Ga0070676_10050842 | Ga0070676_100508425 | 88 |
| 133 | 3300005328 | Ga0070676_10125248 | Ga0070676_101252484 | 88 |
| 134 | 3300005328 | Ga0070676_10139873 | Ga0070676_101398733 | 88 |
| 135 | 3300005328 | Ga0070676_10962820 | Ga0070676_109628202 | 88 |
| 136 | 3300005329 | Ga0070683_100001936 | Ga0070683_10000193610 | 88 |
| 137 | 3300005329 | Ga0070683_100049491 | Ga0070683_1000494914 | 88 |
| 138 | 3300005330 | Ga0070690_100063175 | Ga0070690_1000631753 | 88 |
| 139 | 3300005330 | Ga0070690_100114351 | Ga0070690_1001143514 | 88 |
| 140 | 3300005330 | Ga0070690_100313695 | Ga0070690_1003136951 | 88 |
| 141 | 3300005330 | Ga0070690_101154256 | Ga0070690_1011542562 | 88 |
| 142 | 3300005331 | Ga0070670_100001546 | Ga0070670_10000154620 | 88 |
| 143 | 3300005331 | Ga0070670_100024170 | Ga0070670_1000241707 | 88 |
| 144 | 3300005331 | Ga0070670_100150277 | Ga0070670_1001502774 | 88 |
| 145 | 3300005331 | Ga0070670_101301605 | Ga0070670_1013016052 | 88 |
| 146 | 3300005333 | Ga0070677_10261944 | Ga0070677_102619442 | 88 |
| 147 | 3300005333 | Ga0070677_10341987 | Ga0070677_103419871 | 88 |
| 148 | 3300005334 | Ga0068869_100122062 | Ga0068869_1001220623 | 88 |
| 149 | 3300005334 | Ga0068869_100219783 | Ga0068869_1002197832 | 88 |
| 150 | 3300005334 | Ga0068869_100345015 | Ga0068869_1003450153 | 88 |
| 151 | 3300005335 | Ga0070666_10067969 | Ga0070666_100679691 | 88 |
| 152 | 3300005335 | Ga0070666_10092137 | Ga0070666_100921374 | 88 |
| 153 | 3300005335 | Ga0070666_10193636 | Ga0070666_101936363 | 88 |
| 154 | 3300005335 | Ga0070666_10406124 | Ga0070666_104061242 | 88 |
| 155 | 3300005335 | Ga0070666_11051055 | Ga0070666_110510552 | 88 |
| 156 | 3300005337 | Ga0070682_100172025 | Ga0070682_1001720254 | 88 |
| 157 | 3300005338 | Ga0068868_100095156 | Ga0068868_1000951562 | 88 |
| 158 | 3300005338 | Ga0068868_100132380 | Ga0068868_1001323804 | 88 |
| 159 | 3300005339 | Ga0070660_100096787 | Ga0070660_1000967874 | 88 |
| 160 | 3300005340 | Ga0070689_101508873 | Ga0070689_1015088731 | 88 |
| 161 | 3300005340 | Ga0070689_102168393 | Ga0070689_1021683932 | 88 |
| 162 | 3300005343 | Ga0070687_100030453 | Ga0070687_1000304535 | 88 |
| 163 | 3300005343 | Ga0070687_100052795 | Ga0070687_1000527953 | 88 |
| 164 | 3300005343 | Ga0070687_100917645 | Ga0070687_1009176451 | 88 |
| 165 | 3300005344 | Ga0070661_100006579 | Ga0070661_1000065799 | 88 |
| 166 | 3300005344 | Ga0070661_100555592 | Ga0070661_1005555924 | 88 |
| 167 | 3300005345 | Ga0070692_10141854 | Ga0070692_101418544 | 88 |
| 168 | 3300005345 | Ga0070692_11061622 | Ga0070692_110616221 | 88 |
| 169 | 3300005345 | Ga0070692_11192751 | Ga0070692_111927512 | 88 |
| 170 | 3300005347 | Ga0070668_100979764 | Ga0070668_1009797641 | 88 |
| 171 | 3300005347 | Ga0070668_101732551 | Ga0070668_1017325511 | 88 |
| 172 | 3300005347 | Ga0070668_102006358 | Ga0070668_1020063582 | 88 |
| 173 | 3300005353 | Ga0070669_100000166 | Ga0070669_1000001667 | 88 |
| 174 | 3300005353 | Ga0070669_100050963 | Ga0070669_1000509634 | 88 |
| 175 | 3300005353 | Ga0070669_100187620 | Ga0070669_1001876204 | 88 |
| 176 | 3300005353 | Ga0070669_100743340 | Ga0070669_1007433403 | 88 |
| 177 | 3300005353 | Ga0070669_101235117 | Ga0070669_1012351172 | 88 |
| 178 | 3300005353 | Ga0070669_101913318 | Ga0070669_1019133182 | 88 |
| 179 | 3300005354 | Ga0070675_100002899 | Ga0070675_1000028998 | 88 |
| 180 | 3300005354 | Ga0070675_100078452 | Ga0070675_1000784526 | 88 |
| 181 | 3300005354 | Ga0070675_100120981 | Ga0070675_1001209814 | 88 |
| 182 | 3300005354 | Ga0070675_100470081 | Ga0070675_1004700814 | 88 |
| 183 | 3300005354 | Ga0070675_100512164 | Ga0070675_1005121643 | 88 |
| 184 | 3300005354 | Ga0070675_100672619 | Ga0070675_1006726192 | 88 |
| 185 | 3300005354 | Ga0070675_100693337 | Ga0070675_1006933373 | 88 |
| 186 | 3300005354 | Ga0070675_100955987 | Ga0070675_1009559872 | 88 |
| 187 | 3300005355 | Ga0070671_100183091 | Ga0070671_1001830914 | 88 |
| 188 | 3300005355 | Ga0070671_100185058 | Ga0070671_1001850584 | 88 |
| 189 | 3300005355 | Ga0070671_100312360 | Ga0070671_1003123601 | 88 |
| 190 | 3300005355 | Ga0070671_101434808 | Ga0070671_1014348081 | 88 |
| 191 | 3300005356 | Ga0070674_100011525 | Ga0070674_1000115257 | 88 |
| 192 | 3300005356 | Ga0070674_100126422 | Ga0070674_1001264222 | 88 |
| 193 | 3300005356 | Ga0070674_100588196 | Ga0070674_1005881963 | 88 |
| 194 | 3300005356 | Ga0070674_100719633 | Ga0070674_1007196333 | 88 |
| 195 | 3300005356 | Ga0070674_100770303 | Ga0070674_1007703032 | 88 |
| 196 | 3300005356 | Ga0070674_101555351 | Ga0070674_1015553512 | 88 |
| 197 | 3300005364 | Ga0070673_100002561 | Ga0070673_1000025619 | 88 |
| 198 | 3300005364 | Ga0070673_101341274 | Ga0070673_1013412741 | 88 |
| 199 | 3300005364 | Ga0070673_101513306 | Ga0070673_1015133062 | 88 |
| 200 | 3300005364 | Ga0070673_101597864 | Ga0070673_1015978642 | 88 |
| 201 | 3300005364 | Ga0070673_102322210 | Ga0070673_1023222101 | 88 |
| 202 | 3300005365 | Ga0070688_100014815 | Ga0070688_1000148158 | 88 |
| 203 | 3300005365 | Ga0070688_100208852 | Ga0070688_1002088523 | 88 |
| 204 | 3300005365 | Ga0070688_100305285 | Ga0070688_1003052852 | 88 |
| 205 | 3300005365 | Ga0070688_101514940 | Ga0070688_1015149401 | 88 |
| 206 | 3300005366 | Ga0070659_100354644 | Ga0070659_1003546443 | 88 |
| 207 | 3300005366 | Ga0070659_100852790 | Ga0070659_1008527901 | 88 |
| 208 | 3300005366 | Ga0070659_101167960 | Ga0070659_1011679602 | 88 |
| 209 | 3300005366 | Ga0070659_101856936 | Ga0070659_1018569361 | 88 |
| 210 | 3300005367 | Ga0070667_100048804 | Ga0070667_1000488046 | 88 |
| 211 | 3300005367 | Ga0070667_100963734 | Ga0070667_1009637342 | 88 |
| 212 | 3300005436 | Ga0070713_100386032 | Ga0070713_1003860322 | 88 |
| 213 | 3300005438 | Ga0070701_10003736 | Ga0070701_100037364 | 88 |
| 214 | 3300005438 | Ga0070701_10909765 | Ga0070701_109097652 | 88 |
| 215 | 3300005439 | Ga0070711_100902157 | Ga0070711_1009021571 | 88 |
| 216 | 3300005439 | Ga0070711_101536326 | Ga0070711_1015363262 | 88 |
| 217 | 3300005440 | Ga0070705_100600092 | Ga0070705_1006000922 | 88 |
| 218 | 3300005440 | Ga0070705_101075107 | Ga0070705_1010751071 | 88 |
| 219 | 3300005441 | Ga0070700_100630669 | Ga0070700_1006306693 | 88 |
| 220 | 3300005441 | Ga0070700_100944530 | Ga0070700_1009445301 | 88 |
| 221 | 3300005441 | Ga0070700_101143879 | Ga0070700_1011438792 | 88 |
| 222 | 3300005444 | Ga0070694_100896708 | Ga0070694_1008967081 | 88 |
| 223 | 3300005444 | Ga0070694_100991037 | Ga0070694_1009910372 | 88 |
| 224 | 3300005455 | Ga0070663_100170260 | Ga0070663_1001702603 | 88 |
| 225 | 3300005455 | Ga0070663_100388748 | Ga0070663_1003887483 | 88 |
| 226 | 3300005455 | Ga0070663_100448748 | Ga0070663_1004487482 | 88 |
| 227 | 3300005456 | Ga0070678_100122387 | Ga0070678_1001223874 | 88 |
| 228 | 3300005456 | Ga0070678_100145886 | Ga0070678_1001458864 | 88 |
| 229 | 3300005456 | Ga0070678_100256343 | Ga0070678_1002563431 | 88 |
| 230 | 3300005456 | Ga0070678_100415177 | Ga0070678_1004151774 | 88 |
| 231 | 3300005456 | Ga0070678_100736357 | Ga0070678_1007363572 | 88 |
| 232 | 3300005456 | Ga0070678_101106059 | Ga0070678_1011060592 | 88 |
| 233 | 3300005456 | Ga0070678_101442012 | Ga0070678_1014420121 | 88 |
| 234 | 3300005457 | Ga0070662_100040943 | Ga0070662_1000409432 | 88 |
| 235 | 3300005457 | Ga0070662_100158979 | Ga0070662_1001589793 | 88 |
| 236 | 3300005458 | Ga0070681_10108734 | Ga0070681_101087345 | 88 |
| 237 | 3300005458 | Ga0070681_11908863 | Ga0070681_119088632 | 88 |
| 238 | 3300005459 | Ga0068867_100011928 | Ga0068867_1000119284 | 88 |
| 239 | 3300005459 | Ga0068867_100085366 | Ga0068867_1000853664 | 88 |
| 240 | 3300005459 | Ga0068867_100592081 | Ga0068867_1005920811 | 88 |
| 241 | 3300005466 | Ga0070685_10003988 | Ga0070685_100039885 | 88 |
| 242 | 3300005466 | Ga0070685_11523048 | Ga0070685_115230482 | 88 |
| 243 | 3300005467 | Ga0070706_100634444 | Ga0070706_1006344443 | 88 |
| 244 | 3300005467 | Ga0070706_100794605 | Ga0070706_1007946052 | 88 |
| 245 | 3300005468 | Ga0070707_100931109 | Ga0070707_1009311092 | 88 |
| 246 | 3300005468 | Ga0070707_101659703 | Ga0070707_1016597031 | 88 |
| 247 | 3300005471 | Ga0070698_100340178 | Ga0070698_1003401783 | 88 |
| 248 | 3300005471 | Ga0070698_101119969 | Ga0070698_1011199692 | 88 |
| 249 | 3300005471 | Ga0070698_101503986 | Ga0070698_1015039861 | 88 |
| 250 | 3300005507 | Ga0074259_10932921 | Ga0074259_109329212 | 88 |
| 251 | 3300005518 | Ga0070699_100951258 | Ga0070699_1009512582 | 88 |
| 252 | 3300005518 | Ga0070699_101491838 | Ga0070699_1014918382 | 88 |
| 253 | 3300005535 | Ga0070684_100000291 | Ga0070684_10000029124 | 88 |
| 254 | 3300005535 | Ga0070684_100722382 | Ga0070684_1007223821 | 88 |
| 255 | 3300005539 | Ga0068853_100824579 | Ga0068853_1008245791 | 88 |
| 256 | 3300005539 | Ga0068853_101443326 | Ga0068853_1014433262 | 88 |
| 257 | 3300005539 | Ga0068853_102352289 | Ga0068853_1023522892 | 88 |
| 258 | 3300005543 | Ga0070672_100019443 | Ga0070672_1000194434 | 88 |
| 259 | 3300005543 | Ga0070672_100021908 | Ga0070672_1000219087 | 88 |
| 260 | 3300005543 | Ga0070672_100118152 | Ga0070672_1001181524 | 88 |
| 261 | 3300005543 | Ga0070672_100232545 | Ga0070672_1002325454 | 88 |
| 262 | 3300005543 | Ga0070672_101240170 | Ga0070672_1012401702 | 88 |
| 263 | 3300005544 | Ga0070686_100033623 | Ga0070686_1000336233 | 88 |
| 264 | 3300005544 | Ga0070686_100306200 | Ga0070686_1003062002 | 88 |
| 265 | 3300005544 | Ga0070686_101057707 | Ga0070686_1010577071 | 88 |
| 266 | 3300005546 | Ga0070696_100295643 | Ga0070696_1002956433 | 88 |
| 267 | 3300005546 | Ga0070696_100483150 | Ga0070696_1004831502 | 88 |
| 268 | 3300005546 | Ga0070696_100721736 | Ga0070696_1007217362 | 88 |
| 269 | 3300005547 | Ga0070693_101016747 | Ga0070693_1010167472 | 88 |
| 270 | 3300005548 | Ga0070665_100010087 | Ga0070665_1000100874 | 88 |
| 271 | 3300005548 | Ga0070665_100022622 | Ga0070665_1000226226 | 88 |
| 272 | 3300005548 | Ga0070665_100250519 | Ga0070665_1002505194 | 88 |
| 273 | 3300005548 | Ga0070665_100476735 | Ga0070665_1004767354 | 88 |
| 274 | 3300005548 | Ga0070665_100483781 | Ga0070665_1004837812 | 88 |
| 275 | 3300005548 | Ga0070665_100801899 | Ga0070665_1008018993 | 88 |
| 276 | 3300005549 | Ga0070704_100071794 | Ga0070704_1000717944 | 88 |
| 277 | 3300005549 | Ga0070704_100175306 | Ga0070704_1001753063 | 88 |
| 278 | 3300005549 | Ga0070704_100277876 | Ga0070704_1002778762 | 88 |
| 279 | 3300005549 | Ga0070704_100544980 | Ga0070704_1005449801 | 88 |
| 280 | 3300005549 | Ga0070704_100917012 | Ga0070704_1009170122 | 88 |
| 281 | 3300005549 | Ga0070704_101040332 | Ga0070704_1010403322 | 88 |
| 282 | 3300005563 | Ga0068855_100929771 | Ga0068855_1009297712 | 88 |
| 283 | 3300005563 | Ga0068855_101573479 | Ga0068855_1015734792 | 88 |
| 284 | 3300005564 | Ga0070664_100003002 | Ga0070664_1000030026 | 88 |
| 285 | 3300005564 | Ga0070664_100142540 | Ga0070664_1001425404 | 88 |
| 286 | 3300005564 | Ga0070664_100335665 | Ga0070664_1003356651 | 88 |
| 287 | 3300005564 | Ga0070664_100710477 | Ga0070664_1007104771 | 88 |
| 288 | 3300005564 | Ga0070664_101806239 | Ga0070664_1018062392 | 88 |
| 289 | 3300005564 | Ga0070664_102143281 | Ga0070664_1021432812 | 88 |
| 290 | 3300005578 | Ga0068854_100099848 | Ga0068854_1000998484 | 88 |
| 291 | 3300005578 | Ga0068854_100436159 | Ga0068854_1004361592 | 88 |
| 292 | 3300005578 | Ga0068854_100549707 | Ga0068854_1005497072 | 88 |
| 293 | 3300005578 | Ga0068854_101246943 | Ga0068854_1012469432 | 88 |
| 294 | 3300005614 | Ga0068856_100062149 | Ga0068856_1000621492 | 88 |
| 295 | 3300005614 | Ga0068856_101189163 | Ga0068856_1011891632 | 88 |
| 296 | 3300005614 | Ga0068856_101588804 | Ga0068856_1015888042 | 88 |
| 297 | 3300005615 | Ga0070702_100377258 | Ga0070702_1003772582 | 88 |
| 298 | 3300005615 | Ga0070702_100659878 | Ga0070702_1006598782 | 88 |
| 299 | 3300005616 | Ga0068852_100078194 | Ga0068852_1000781944 | 88 |
| 300 | 3300005616 | Ga0068852_100111289 | Ga0068852_1001112894 | 88 |
| 301 | 3300005616 | Ga0068852_100223280 | Ga0068852_1002232804 | 88 |
| 302 | 3300005616 | Ga0068852_100920448 | Ga0068852_1009204482 | 88 |
| 303 | 3300005616 | Ga0068852_102667994 | Ga0068852_1026679942 | 88 |
| 304 | 3300005617 | Ga0068859_100003822 | Ga0068859_1000038228 | 88 |
| 305 | 3300005617 | Ga0068859_100644005 | Ga0068859_1006440053 | 88 |
| 306 | 3300005618 | Ga0068864_100028940 | Ga0068864_1000289405 | 88 |
| 307 | 3300005618 | Ga0068864_100922272 | Ga0068864_1009222722 | 88 |
| 308 | 3300005618 | Ga0068864_101172838 | Ga0068864_1011728383 | 88 |
| 309 | 3300005618 | Ga0068864_101462168 | Ga0068864_1014621681 | 88 |
| 310 | 3300005718 | Ga0068866_10044883 | Ga0068866_100448835 | 88 |
| 311 | 3300005718 | Ga0068866_10599907 | Ga0068866_105999072 | 88 |
| 312 | 3300005719 | Ga0068861_100105876 | Ga0068861_1001058764 | 88 |
| 313 | 3300005719 | Ga0068861_100479695 | Ga0068861_1004796953 | 88 |
| 314 | 3300005719 | Ga0068861_101872619 | Ga0068861_1018726192 | 88 |
| 315 | 3300005719 | Ga0068861_102129904 | Ga0068861_1021299041 | 88 |
| 316 | 3300005834 | Ga0068851_10247991 | Ga0068851_102479913 | 88 |
| 317 | 3300005834 | Ga0068851_10890393 | Ga0068851_108903931 | 88 |
| 318 | 3300005840 | Ga0068870_10156858 | Ga0068870_101568581 | 88 |
| 319 | 3300005841 | Ga0068863_100011808 | Ga0068863_1000118084 | 88 |
| 320 | 3300005841 | Ga0068863_100080513 | Ga0068863_1000805134 | 88 |
| 321 | 3300005841 | Ga0068863_100276921 | Ga0068863_1002769213 | 88 |
| 322 | 3300005841 | Ga0068863_101011481 | Ga0068863_1010114811 | 88 |
| 323 | 3300005841 | Ga0068863_102019482 | Ga0068863_1020194821 | 88 |
| 324 | 3300005842 | Ga0068858_100425073 | Ga0068858_1004250734 | 88 |
| 325 | 3300005842 | Ga0068858_100567704 | Ga0068858_1005677042 | 88 |
| 326 | 3300005842 | Ga0068858_100959293 | Ga0068858_1009592932 | 88 |
| 327 | 3300005842 | Ga0068858_102026130 | Ga0068858_1020261301 | 88 |
| 328 | 3300005843 | Ga0068860_100153064 | Ga0068860_1001530644 | 88 |
| 329 | 3300005843 | Ga0068860_100656848 | Ga0068860_1006568484 | 88 |
| 330 | 3300005844 | Ga0068862_100026965 | Ga0068862_1000269655 | 88 |
| 331 | 3300005844 | Ga0068862_100053947 | Ga0068862_1000539475 | 88 |
| 332 | 3300005844 | Ga0068862_100087875 | Ga0068862_1000878753 | 88 |
| 333 | 3300005844 | Ga0068862_100706697 | Ga0068862_1007066972 | 88 |
| 334 | 3300005844 | Ga0068862_100812019 | Ga0068862_1008120192 | 88 |
| 335 | 3300005844 | Ga0068862_101415778 | Ga0068862_1014157782 | 88 |
| 336 | 3300005844 | Ga0068862_101667013 | Ga0068862_1016670132 | 88 |
| 337 | 3300006028 | Ga0070717_10284219 | Ga0070717_102842192 | 88 |
| 338 | 3300006038 | Ga0075365_10000562 | Ga0075365_1000056213 | 88 |
| 339 | 3300006038 | Ga0075365_11091067 | Ga0075365_110910671 | 88 |
| 340 | 3300006042 | Ga0075368_10053538 | Ga0075368_100535384 | 88 |
| 341 | 3300006051 | Ga0075364_10004066 | Ga0075364_100040663 | 88 |
| 342 | 3300006051 | Ga0075364_10005645 | Ga0075364_100056454 | 88 |
| 343 | 3300006051 | Ga0075364_10252862 | Ga0075364_102528623 | 88 |
| 344 | 3300006058 | Ga0075432_10453801 | Ga0075432_104538012 | 88 |
| 345 | 3300006173 | Ga0070716_100479436 | Ga0070716_1004794363 | 88 |
| 346 | 3300006177 | Ga0075362_10105944 | Ga0075362_101059443 | 88 |
| 347 | 3300006178 | Ga0075367_10033063 | Ga0075367_100330636 | 88 |
| 348 | 3300006195 | Ga0075366_10000965 | Ga0075366_100009659 | 88 |
| 349 | 3300006195 | Ga0075366_10470540 | Ga0075366_104705401 | 88 |
| 350 | 3300006195 | Ga0075366_10531682 | Ga0075366_105316823 | 88 |
| 351 | 3300006237 | Ga0097621_100037514 | Ga0097621_1000375147 | 88 |
| 352 | 3300006237 | Ga0097621_101063255 | Ga0097621_1010632551 | 88 |
| 353 | 3300006358 | Ga0068871_100045078 | Ga0068871_1000450783 | 88 |
| 354 | 3300006358 | Ga0068871_100213392 | Ga0068871_1002133923 | 88 |
| 355 | 3300006358 | Ga0068871_100223288 | Ga0068871_1002232884 | 88 |
| 356 | 3300006358 | Ga0068871_100819182 | Ga0068871_1008191822 | 88 |
| 357 | 3300006358 | Ga0068871_101205864 | Ga0068871_1012058642 | 88 |
| 358 | 3300006358 | Ga0068871_101426741 | Ga0068871_1014267412 | 88 |
| 359 | 3300006844 | Ga0075428_100002190 | Ga0075428_10000219015 | 88 |
| 360 | 3300006844 | Ga0075428_100730850 | Ga0075428_1007308503 | 88 |
| 361 | 3300006844 | Ga0075428_100807477 | Ga0075428_1008074773 | 88 |
| 362 | 3300006844 | Ga0075428_101100872 | Ga0075428_1011008722 | 88 |
| 363 | 3300006846 | Ga0075430_100019324 | Ga0075430_1000193248 | 88 |
| 364 | 3300006846 | Ga0075430_101613232 | Ga0075430_1016132322 | 88 |
| 365 | 3300006847 | Ga0075431_100014795 | Ga0075431_1000147954 | 88 |
| 366 | 3300006847 | Ga0075431_100118506 | Ga0075431_1001185063 | 88 |
| 367 | 3300006847 | Ga0075431_100435891 | Ga0075431_1004358914 | 88 |
| 368 | 3300006852 | Ga0075433_10031686 | Ga0075433_100316861 | 88 |
| 369 | 3300006852 | Ga0075433_10032746 | Ga0075433_100327468 | 88 |
| 370 | 3300006852 | Ga0075433_10058944 | Ga0075433_100589447 | 88 |
| 371 | 3300006852 | Ga0075433_10088645 | Ga0075433_100886454 | 88 |
| 372 | 3300006852 | Ga0075433_11730977 | Ga0075433_117309771 | 88 |
| 373 | 3300006871 | Ga0075434_100004927 | Ga0075434_10000492714 | 88 |
| 374 | 3300006871 | Ga0075434_100023434 | Ga0075434_1000234342 | 88 |
| 375 | 3300006871 | Ga0075434_100195972 | Ga0075434_1001959723 | 88 |
| 376 | 3300006871 | Ga0075434_100567873 | Ga0075434_1005678733 | 88 |
| 377 | 3300006880 | Ga0075429_100214588 | Ga0075429_1002145884 | 88 |
| 378 | 3300006880 | Ga0075429_100229844 | Ga0075429_1002298444 | 88 |
| 379 | 3300006881 | Ga0068865_100423063 | Ga0068865_1004230632 | 88 |
| 380 | 3300006881 | Ga0068865_100645482 | Ga0068865_1006454823 | 88 |
| 381 | 3300006881 | Ga0068865_101667383 | Ga0068865_1016673832 | 88 |
| 382 | 3300006881 | Ga0068865_101782309 | Ga0068865_1017823092 | 88 |
| 383 | 3300006881 | Ga0068865_102000795 | Ga0068865_1020007952 | 88 |
| 384 | 3300006914 | Ga0075436_100306906 | Ga0075436_1003069064 | 88 |
| 385 | 3300006914 | Ga0075436_100429528 | Ga0075436_1004295283 | 88 |
| 386 | 3300006931 | Ga0097620_100003822 | Ga0097620_1000038228 | 88 |
| 387 | 3300006931 | Ga0097620_100644013 | Ga0097620_1006440133 | 88 |
| 388 | 3300007076 | Ga0075435_100006365 | Ga0075435_1000063654 | 88 |
| 389 | 3300007076 | Ga0075435_100015028 | Ga0075435_1000150288 | 88 |
| 390 | 3300007076 | Ga0075435_100272534 | Ga0075435_1002725344 | 88 |
| 391 | 3300007076 | Ga0075435_100279837 | Ga0075435_1002798371 | 88 |
| 392 | 3300009093 | Ga0105240_10195813 | Ga0105240_101958134 | 88 |
| 393 | 3300009093 | Ga0105240_10302364 | Ga0105240_103023644 | 88 |
| 394 | 3300009093 | Ga0105240_11641437 | Ga0105240_116414372 | 88 |
| 395 | 3300009093 | Ga0105240_12076160 | Ga0105240_120761601 | 88 |
| 396 | 3300009094 | Ga0111539_10001892 | Ga0111539_1000189220 | 88 |
| 397 | 3300009094 | Ga0111539_10024552 | Ga0111539_1002455212 | 88 |
| 398 | 3300009094 | Ga0111539_10140000 | Ga0111539_101400003 | 88 |
| 399 | 3300009094 | Ga0111539_10460819 | Ga0111539_104608194 | 88 |
| 400 | 3300009094 | Ga0111539_10730386 | Ga0111539_107303862 | 88 |
| 401 | 3300009094 | Ga0111539_11547838 | Ga0111539_115478381 | 88 |
| 402 | 3300009094 | Ga0111539_13090895 | Ga0111539_130908951 | 88 |
| 403 | 3300009094 | Ga0111539_13447851 | Ga0111539_134478511 | 88 |
| 404 | 3300009098 | Ga0105245_10374069 | Ga0105245_103740694 | 88 |
| 405 | 3300009098 | Ga0105245_11597005 | Ga0105245_115970052 | 88 |
| 406 | 3300009101 | Ga0105247_10359334 | Ga0105247_103593343 | 88 |
| 407 | 3300009147 | Ga0114129_10002861 | Ga0114129_1000286119 | 88 |
| 408 | 3300009147 | Ga0114129_10004267 | Ga0114129_1000426715 | 88 |
| 409 | 3300009147 | Ga0114129_10007233 | Ga0114129_1000723316 | 88 |
| 410 | 3300009147 | Ga0114129_10155007 | Ga0114129_101550073 | 88 |
| 411 | 3300009147 | Ga0114129_10188247 | Ga0114129_101882474 | 88 |
| 412 | 3300009147 | Ga0114129_11936848 | Ga0114129_119368483 | 88 |
| 413 | 3300009147 | Ga0114129_12298525 | Ga0114129_122985252 | 88 |
| 414 | 3300009148 | Ga0105243_10110197 | Ga0105243_101101974 | 88 |
| 415 | 3300009148 | Ga0105243_11841527 | Ga0105243_118415272 | 88 |
| 416 | 3300009174 | Ga0105241_10221699 | Ga0105241_102216993 | 88 |
| 417 | 3300009176 | Ga0105242_10031143 | Ga0105242_100311438 | 88 |
| 418 | 3300009176 | Ga0105242_10071788 | Ga0105242_100717886 | 88 |
| 419 | 3300009176 | Ga0105242_10097671 | Ga0105242_100976714 | 88 |
| 420 | 3300009176 | Ga0105242_10873422 | Ga0105242_108734221 | 88 |
| 421 | 3300009177 | Ga0105248_10026313 | Ga0105248_100263133 | 88 |
| 422 | 3300009177 | Ga0105248_10058976 | Ga0105248_100589768 | 88 |
| 423 | 3300009177 | Ga0105248_10059861 | Ga0105248_100598617 | 88 |
| 424 | 3300009177 | Ga0105248_10178054 | Ga0105248_101780542 | 88 |
| 425 | 3300009177 | Ga0105248_11490066 | Ga0105248_114900662 | 88 |
| 426 | 3300009177 | Ga0105248_11824620 | Ga0105248_118246202 | 88 |
| 427 | 3300009177 | Ga0105248_11901247 | Ga0105248_119012472 | 88 |
| 428 | 3300009177 | Ga0105248_12086345 | Ga0105248_120863452 | 88 |
| 429 | 3300009551 | Ga0105238_10382426 | Ga0105238_103824261 | 88 |
| 430 | 3300009551 | Ga0105238_11569608 | Ga0105238_115696082 | 88 |
| 431 | 3300009553 | Ga0105249_10001254 | Ga0105249_1000125413 | 88 |
| 432 | 3300009553 | Ga0105249_10005766 | Ga0105249_1000576613 | 88 |
| 433 | 3300009553 | Ga0105249_10080278 | Ga0105249_100802786 | 88 |
| 434 | 3300010375 | Ga0105239_10140364 | Ga0105239_101403644 | 88 |
| 435 | 3300011119 | Ga0105246_10647265 | Ga0105246_106472652 | 88 |
| 436 | 3300011119 | Ga0105246_10809966 | Ga0105246_108099662 | 88 |
| 437 | 3300011119 | Ga0105246_11047866 | Ga0105246_110478662 | 88 |
| 438 | 3300013105 | Ga0157369_10085696 | Ga0157369_100856966 | 88 |
| 439 | 3300013105 | Ga0157369_10753118 | Ga0157369_107531182 | 88 |
| 440 | 3300013296 | Ga0157374_10076825 | Ga0157374_100768257 | 88 |
| 441 | 3300013296 | Ga0157374_10313768 | Ga0157374_103137684 | 88 |
| 442 | 3300013296 | Ga0157374_11056116 | Ga0157374_110561161 | 88 |
| 443 | 3300013297 | Ga0157378_10899471 | Ga0157378_108994712 | 88 |
| 444 | 3300013297 | Ga0157378_10972425 | Ga0157378_109724252 | 88 |
| 445 | 3300013297 | Ga0157378_11134919 | Ga0157378_111349192 | 88 |
| 446 | 3300013297 | Ga0157378_11189019 | Ga0157378_111890192 | 88 |
| 447 | 3300013297 | Ga0157378_11506415 | Ga0157378_115064151 | 88 |
| 448 | 3300013297 | Ga0157378_12540327 | Ga0157378_125403271 | 88 |
| 449 | 3300013297 | Ga0157378_13011974 | Ga0157378_130119742 | 88 |
| 450 | 3300013306 | Ga0163162_10048642 | Ga0163162_100486421 | 88 |
| 451 | 3300013306 | Ga0163162_10144922 | Ga0163162_101449224 | 88 |
| 452 | 3300013306 | Ga0163162_10421010 | Ga0163162_104210103 | 88 |
| 453 | 3300013306 | Ga0163162_11700818 | Ga0163162_117008182 | 88 |
| 454 | 3300013307 | Ga0157372_10225441 | Ga0157372_102254414 | 88 |
| 455 | 3300013307 | Ga0157372_11058298 | Ga0157372_110582982 | 88 |
| 456 | 3300013308 | Ga0157375_10152246 | Ga0157375_101522465 | 88 |
| 457 | 3300013308 | Ga0157375_10208129 | Ga0157375_102081295 | 88 |
| 458 | 3300013308 | Ga0157375_10835267 | Ga0157375_108352673 | 88 |
| 459 | 3300013308 | Ga0157375_12002510 | Ga0157375_120025102 | 88 |
| 460 | 3300013308 | Ga0157375_13404568 | Ga0157375_134045682 | 88 |
| 461 | 3300014325 | Ga0163163_10059827 | Ga0163163_100598274 | 88 |
| 462 | 3300014325 | Ga0163163_10137123 | Ga0163163_101371233 | 88 |
| 463 | 3300014325 | Ga0163163_10137638 | Ga0163163_101376384 | 88 |
| 464 | 3300014325 | Ga0163163_10187170 | Ga0163163_101871703 | 88 |
| 465 | 3300014325 | Ga0163163_10868487 | Ga0163163_108684872 | 88 |
| 466 | 3300014325 | Ga0163163_12296948 | Ga0163163_122969482 | 88 |
| 467 | 3300014325 | Ga0163163_12641817 | Ga0163163_126418172 | 88 |
| 468 | 3300014326 | Ga0157380_10097792 | Ga0157380_100977925 | 88 |
| 469 | 3300014326 | Ga0157380_10225108 | Ga0157380_102251083 | 88 |
| 470 | 3300014326 | Ga0157380_10848854 | Ga0157380_108488541 | 88 |
| 471 | 3300014326 | Ga0157380_10874255 | Ga0157380_108742553 | 88 |
| 472 | 3300014326 | Ga0157380_10874444 | Ga0157380_108744442 | 88 |
| 473 | 3300014326 | Ga0157380_11520023 | Ga0157380_115200233 | 88 |
| 474 | 3300014326 | Ga0157380_11634596 | Ga0157380_116345962 | 88 |
| 475 | 3300014326 | Ga0157380_13167981 | Ga0157380_131679811 | 88 |
| 476 | 3300014968 | Ga0157379_10216935 | Ga0157379_102169352 | 88 |
| 477 | 3300014968 | Ga0157379_10385819 | Ga0157379_103858194 | 88 |
| 478 | 3300014968 | Ga0157379_10726632 | Ga0157379_107266323 | 88 |
| 479 | 3300014969 | Ga0157376_10009699 | Ga0157376_100096997 | 88 |
| 480 | 3300014969 | Ga0157376_10029717 | Ga0157376_100297177 | 88 |
| 481 | 3300014969 | Ga0157376_10224087 | Ga0157376_102240872 | 88 |
| 482 | 3300014969 | Ga0157376_10435551 | Ga0157376_104355514 | 88 |
| 483 | 3300014969 | Ga0157376_11815180 | Ga0157376_118151802 | 88 |
| 484 | 3300014969 | Ga0157376_11931565 | Ga0157376_119315651 | 88 |
| 485 | 3300017792 | Ga0163161_10861593 | Ga0163161_108615931 | 88 |
| 486 | 3300020082 | Ga0206353_10674301 | Ga0206353_106743012 | 88 |
| 487 | 3300021384 | Ga0213876_10119947 | Ga0213876_101199473 | 88 |
| 488 | 3300025271 | Ga0207666_1076982 | Ga0207666_10769822 | 88 |
| 489 | 3300025315 | Ga0207697_10000772 | Ga0207697_1000077214 | 88 |
| 490 | 3300025321 | Ga0207656_10269417 | Ga0207656_102694173 | 88 |
| 491 | 3300025321 | Ga0207656_10664497 | Ga0207656_106644972 | 88 |
| 492 | 3300025893 | Ga0207682_10212584 | Ga0207682_102125842 | 88 |
| 493 | 3300025893 | Ga0207682_10404771 | Ga0207682_104047712 | 88 |
| 494 | 3300025893 | Ga0207682_10492726 | Ga0207682_104927261 | 88 |
| 495 | 3300025899 | Ga0207642_10196629 | Ga0207642_101966291 | 88 |
| 496 | 3300025899 | Ga0207642_10483927 | Ga0207642_104839272 | 88 |
| 497 | 3300025900 | Ga0207710_10377925 | Ga0207710_103779252 | 88 |
| 498 | 3300025901 | Ga0207688_10002773 | Ga0207688_100027736 | 88 |
| 499 | 3300025901 | Ga0207688_10165611 | Ga0207688_101656113 | 88 |
| 500 | 3300025903 | Ga0207680_10052607 | Ga0207680_100526075 | 88 |
| 501 | 3300025903 | Ga0207680_10075968 | Ga0207680_100759682 | 88 |
| 502 | 3300025903 | Ga0207680_10287234 | Ga0207680_102872344 | 88 |
| 503 | 3300025904 | Ga0207647_10116664 | Ga0207647_101166643 | 88 |
| 504 | 3300025904 | Ga0207647_10609017 | Ga0207647_106090172 | 88 |
| 505 | 3300025904 | Ga0207647_10610010 | Ga0207647_106100102 | 88 |
| 506 | 3300025907 | Ga0207645_10937110 | Ga0207645_109371101 | 88 |
| 507 | 3300025908 | Ga0207643_10182357 | Ga0207643_101823574 | 88 |
| 508 | 3300025910 | Ga0207684_10364960 | Ga0207684_103649604 | 88 |
| 509 | 3300025910 | Ga0207684_10438502 | Ga0207684_104385023 | 88 |
| 510 | 3300025910 | Ga0207684_10778491 | Ga0207684_107784912 | 88 |
| 511 | 3300025912 | Ga0207707_10677920 | Ga0207707_106779203 | 88 |
| 512 | 3300025912 | Ga0207707_11113714 | Ga0207707_111137142 | 88 |
| 513 | 3300025913 | Ga0207695_10125684 | Ga0207695_101256845 | 88 |
| 514 | 3300025916 | Ga0207663_10558001 | Ga0207663_105580012 | 88 |
| 515 | 3300025917 | Ga0207660_10638366 | Ga0207660_106383662 | 88 |
| 516 | 3300025918 | Ga0207662_10002361 | Ga0207662_1000236113 | 88 |
| 517 | 3300025918 | Ga0207662_10061797 | Ga0207662_100617973 | 88 |
| 518 | 3300025918 | Ga0207662_10938226 | Ga0207662_109382262 | 88 |
| 519 | 3300025919 | Ga0207657_10201517 | Ga0207657_102015173 | 88 |
| 520 | 3300025920 | Ga0207649_10003342 | Ga0207649_100033429 | 88 |
| 521 | 3300025920 | Ga0207649_10304409 | Ga0207649_103044091 | 88 |
| 522 | 3300025920 | Ga0207649_10367202 | Ga0207649_103672021 | 88 |
| 523 | 3300025923 | Ga0207681_10022832 | Ga0207681_100228326 | 88 |
| 524 | 3300025923 | Ga0207681_10088153 | Ga0207681_100881534 | 88 |
| 525 | 3300025923 | Ga0207681_10220674 | Ga0207681_102206744 | 88 |
| 526 | 3300025923 | Ga0207681_10328906 | Ga0207681_103289062 | 88 |
| 527 | 3300025924 | Ga0207694_10370275 | Ga0207694_103702753 | 88 |
| 528 | 3300025924 | Ga0207694_10882807 | Ga0207694_108828072 | 88 |
| 529 | 3300025924 | Ga0207694_11071375 | Ga0207694_110713751 | 88 |
| 530 | 3300025925 | Ga0207650_10022308 | Ga0207650_100223083 | 88 |
| 531 | 3300025925 | Ga0207650_10064504 | Ga0207650_100645045 | 88 |
| 532 | 3300025925 | Ga0207650_10160269 | Ga0207650_101602691 | 88 |
| 533 | 3300025925 | Ga0207650_10207722 | Ga0207650_102077223 | 88 |
| 534 | 3300025925 | Ga0207650_10539789 | Ga0207650_105397891 | 88 |
| 535 | 3300025926 | Ga0207659_10078671 | Ga0207659_100786715 | 88 |
| 536 | 3300025926 | Ga0207659_10096263 | Ga0207659_100962631 | 88 |
| 537 | 3300025926 | Ga0207659_10384772 | Ga0207659_103847723 | 88 |
| 538 | 3300025926 | Ga0207659_10406365 | Ga0207659_104063652 | 88 |
| 539 | 3300025926 | Ga0207659_10940076 | Ga0207659_109400762 | 88 |
| 540 | 3300025927 | Ga0207687_10060991 | Ga0207687_100609911 | 88 |
| 541 | 3300025927 | Ga0207687_10188748 | Ga0207687_101887482 | 88 |
| 542 | 3300025927 | Ga0207687_10440398 | Ga0207687_104403982 | 88 |
| 543 | 3300025928 | Ga0207700_10349793 | Ga0207700_103497932 | 88 |
| 544 | 3300025931 | Ga0207644_10089495 | Ga0207644_100894954 | 88 |
| 545 | 3300025931 | Ga0207644_10154648 | Ga0207644_101546484 | 88 |
| 546 | 3300025931 | Ga0207644_10172039 | Ga0207644_101720394 | 88 |
| 547 | 3300025932 | Ga0207690_10254468 | Ga0207690_102544683 | 88 |
| 548 | 3300025932 | Ga0207690_10736624 | Ga0207690_107366242 | 88 |
| 549 | 3300025932 | Ga0207690_11251775 | Ga0207690_112517752 | 88 |
| 550 | 3300025933 | Ga0207706_10036735 | Ga0207706_100367357 | 88 |
| 551 | 3300025933 | Ga0207706_10085694 | Ga0207706_100856943 | 88 |
| 552 | 3300025933 | Ga0207706_10181333 | Ga0207706_101813334 | 88 |
| 553 | 3300025933 | Ga0207706_10547227 | Ga0207706_105472271 | 88 |
| 554 | 3300025934 | Ga0207686_10040704 | Ga0207686_100407046 | 88 |
| 555 | 3300025934 | Ga0207686_10064654 | Ga0207686_100646544 | 88 |
| 556 | 3300025934 | Ga0207686_11714098 | Ga0207686_117140981 | 88 |
| 557 | 3300025935 | Ga0207709_10059748 | Ga0207709_100597484 | 88 |
| 558 | 3300025935 | Ga0207709_10187417 | Ga0207709_101874174 | 88 |
| 559 | 3300025935 | Ga0207709_10938905 | Ga0207709_109389052 | 88 |
| 560 | 3300025936 | Ga0207670_10063237 | Ga0207670_100632373 | 88 |
| 561 | 3300025936 | Ga0207670_10872255 | Ga0207670_108722552 | 88 |
| 562 | 3300025937 | Ga0207669_10045755 | Ga0207669_100457554 | 88 |
| 563 | 3300025937 | Ga0207669_10077387 | Ga0207669_100773874 | 88 |
| 564 | 3300025937 | Ga0207669_10462811 | Ga0207669_104628112 | 88 |
| 565 | 3300025937 | Ga0207669_10681576 | Ga0207669_106815763 | 88 |
| 566 | 3300025938 | Ga0207704_10048697 | Ga0207704_100486975 | 88 |
| 567 | 3300025938 | Ga0207704_10113482 | Ga0207704_101134822 | 88 |
| 568 | 3300025938 | Ga0207704_10234030 | Ga0207704_102340304 | 88 |
| 569 | 3300025938 | Ga0207704_11334434 | Ga0207704_113344342 | 88 |
| 570 | 3300025940 | Ga0207691_10021474 | Ga0207691_100214748 | 88 |
| 571 | 3300025940 | Ga0207691_10053749 | Ga0207691_100537492 | 88 |
| 572 | 3300025940 | Ga0207691_10148042 | Ga0207691_101480423 | 88 |
| 573 | 3300025940 | Ga0207691_10192644 | Ga0207691_101926444 | 88 |
| 574 | 3300025941 | Ga0207711_10018265 | Ga0207711_100182652 | 88 |
| 575 | 3300025941 | Ga0207711_10144641 | Ga0207711_101446415 | 88 |
| 576 | 3300025941 | Ga0207711_10144777 | Ga0207711_101447775 | 88 |
| 577 | 3300025941 | Ga0207711_10624986 | Ga0207711_106249863 | 88 |
| 578 | 3300025941 | Ga0207711_11417222 | Ga0207711_114172222 | 88 |
| 579 | 3300025941 | Ga0207711_11774495 | Ga0207711_117744952 | 88 |
| 580 | 3300025941 | Ga0207711_12075604 | Ga0207711_120756041 | 88 |
| 581 | 3300025942 | Ga0207689_10074129 | Ga0207689_100741294 | 88 |
| 582 | 3300025942 | Ga0207689_10127286 | Ga0207689_101272864 | 88 |
| 583 | 3300025942 | Ga0207689_10960749 | Ga0207689_109607492 | 88 |
| 584 | 3300025944 | Ga0207661_10001428 | Ga0207661_1000142813 | 88 |
| 585 | 3300025944 | Ga0207661_10012308 | Ga0207661_100123086 | 88 |
| 586 | 3300025945 | Ga0207679_10002083 | Ga0207679_1000208310 | 88 |
| 587 | 3300025945 | Ga0207679_10041983 | Ga0207679_100419833 | 88 |
| 588 | 3300025945 | Ga0207679_10233106 | Ga0207679_102331063 | 88 |
| 589 | 3300025945 | Ga0207679_10368845 | Ga0207679_103688454 | 88 |
| 590 | 3300025945 | Ga0207679_11478069 | Ga0207679_114780692 | 88 |
| 591 | 3300025949 | Ga0207667_10756568 | Ga0207667_107565683 | 88 |
| 592 | 3300025960 | Ga0207651_10001330 | Ga0207651_100013306 | 88 |
| 593 | 3300025960 | Ga0207651_10597674 | Ga0207651_105976742 | 88 |
| 594 | 3300025960 | Ga0207651_10726985 | Ga0207651_107269853 | 88 |
| 595 | 3300025960 | Ga0207651_11188574 | Ga0207651_111885742 | 88 |
| 596 | 3300025960 | Ga0207651_11933639 | Ga0207651_119336392 | 88 |
| 597 | 3300025961 | Ga0207712_10011937 | Ga0207712_100119376 | 88 |
| 598 | 3300025961 | Ga0207712_10078458 | Ga0207712_100784586 | 88 |
| 599 | 3300025961 | Ga0207712_10666017 | Ga0207712_106660173 | 88 |
| 600 | 3300025961 | Ga0207712_11257449 | Ga0207712_112574491 | 88 |
| 601 | 3300025961 | Ga0207712_11336061 | Ga0207712_113360612 | 88 |
| 602 | 3300025972 | Ga0207668_10321528 | Ga0207668_103215283 | 88 |
| 603 | 3300025972 | Ga0207668_10721926 | Ga0207668_107219261 | 88 |
| 604 | 3300025972 | Ga0207668_11915835 | Ga0207668_119158352 | 88 |
| 605 | 3300025972 | Ga0207668_12081120 | Ga0207668_120811201 | 88 |
| 606 | 3300025981 | Ga0207640_10225562 | Ga0207640_102255622 | 88 |
| 607 | 3300025981 | Ga0207640_10565627 | Ga0207640_105656271 | 88 |
| 608 | 3300025981 | Ga0207640_10678815 | Ga0207640_106788153 | 88 |
| 609 | 3300025981 | Ga0207640_10970716 | Ga0207640_109707161 | 88 |
| 610 | 3300025986 | Ga0207658_10111366 | Ga0207658_101113664 | 88 |
| 611 | 3300025986 | Ga0207658_10520384 | Ga0207658_105203841 | 88 |
| 612 | 3300025986 | Ga0207658_11896125 | Ga0207658_118961251 | 88 |
| 613 | 3300026023 | Ga0207677_10013411 | Ga0207677_100134115 | 88 |
| 614 | 3300026023 | Ga0207677_10236423 | Ga0207677_102364231 | 88 |
| 615 | 3300026023 | Ga0207677_10247294 | Ga0207677_102472944 | 88 |
| 616 | 3300026023 | Ga0207677_10413697 | Ga0207677_104136973 | 88 |
| 617 | 3300026035 | Ga0207703_10343359 | Ga0207703_103433594 | 88 |
| 618 | 3300026035 | Ga0207703_10421748 | Ga0207703_104217483 | 88 |
| 619 | 3300026035 | Ga0207703_10522849 | Ga0207703_105228492 | 88 |
| 620 | 3300026041 | Ga0207639_10686133 | Ga0207639_106861333 | 88 |
| 621 | 3300026041 | Ga0207639_10954421 | Ga0207639_109544212 | 88 |
| 622 | 3300026067 | Ga0207678_10062158 | Ga0207678_100621585 | 88 |
| 623 | 3300026067 | Ga0207678_10066402 | Ga0207678_100664024 | 88 |
| 624 | 3300026075 | Ga0207708_10001093 | Ga0207708_100010934 | 88 |
| 625 | 3300026075 | Ga0207708_10455269 | Ga0207708_104552693 | 88 |
| 626 | 3300026075 | Ga0207708_10511461 | Ga0207708_105114613 | 88 |
| 627 | 3300026075 | Ga0207708_11448935 | Ga0207708_114489352 | 88 |
| 628 | 3300026075 | Ga0207708_11637692 | Ga0207708_116376922 | 88 |
| 629 | 3300026078 | Ga0207702_10171726 | Ga0207702_101717262 | 88 |
| 630 | 3300026078 | Ga0207702_10996829 | Ga0207702_109968293 | 88 |
| 631 | 3300026088 | Ga0207641_10014969 | Ga0207641_100149696 | 88 |
| 632 | 3300026088 | Ga0207641_10064332 | Ga0207641_100643327 | 88 |
| 633 | 3300026088 | Ga0207641_10200120 | Ga0207641_102001204 | 88 |
| 634 | 3300026088 | Ga0207641_10206070 | Ga0207641_102060703 | 88 |
| 635 | 3300026088 | Ga0207641_10361365 | Ga0207641_103613653 | 88 |
| 636 | 3300026089 | Ga0207648_10007485 | Ga0207648_100074858 | 88 |
| 637 | 3300026089 | Ga0207648_10011911 | Ga0207648_1001191112 | 88 |
| 638 | 3300026089 | Ga0207648_10150231 | Ga0207648_101502315 | 88 |
| 639 | 3300026089 | Ga0207648_11500138 | Ga0207648_115001382 | 88 |
| 640 | 3300026089 | Ga0207648_11790717 | Ga0207648_117907171 | 88 |
| 641 | 3300026095 | Ga0207676_10098053 | Ga0207676_100980536 | 88 |
| 642 | 3300026095 | Ga0207676_10592018 | Ga0207676_105920183 | 88 |
| 643 | 3300026095 | Ga0207676_10729959 | Ga0207676_107299592 | 88 |
| 644 | 3300026095 | Ga0207676_11104632 | Ga0207676_111046323 | 88 |
| 645 | 3300026095 | Ga0207676_11268119 | Ga0207676_112681192 | 88 |
| 646 | 3300026116 | Ga0207674_11809654 | Ga0207674_118096542 | 88 |
| 647 | 3300026118 | Ga0207675_100153719 | Ga0207675_1001537195 | 88 |
| 648 | 3300026118 | Ga0207675_100564433 | Ga0207675_1005644332 | 88 |
| 649 | 3300026118 | Ga0207675_100621348 | Ga0207675_1006213482 | 88 |
| 650 | 3300026118 | Ga0207675_101030748 | Ga0207675_1010307482 | 88 |
| 651 | 3300026118 | Ga0207675_101576150 | Ga0207675_1015761502 | 88 |
| 652 | 3300026121 | Ga0207683_10016603 | Ga0207683_100166038 | 88 |
| 653 | 3300026121 | Ga0207683_10046066 | Ga0207683_100460666 | 88 |
| 654 | 3300026121 | Ga0207683_10083873 | Ga0207683_100838733 | 88 |
| 655 | 3300026121 | Ga0207683_10151646 | Ga0207683_101516463 | 88 |
| 656 | 3300026121 | Ga0207683_10157805 | Ga0207683_101578055 | 88 |
| 657 | 3300026121 | Ga0207683_10594449 | Ga0207683_105944492 | 88 |
| 658 | 3300026121 | Ga0207683_10691580 | Ga0207683_106915801 | 88 |
| 659 | 3300026121 | Ga0207683_10950776 | Ga0207683_109507763 | 88 |
| 660 | 3300026121 | Ga0207683_11006305 | Ga0207683_110063052 | 88 |
| 661 | 3300026142 | Ga0207698_10104018 | Ga0207698_101040185 | 88 |
| 662 | 3300026142 | Ga0207698_10327331 | Ga0207698_103273314 | 88 |
| 663 | 3300026142 | Ga0207698_10531528 | Ga0207698_105315284 | 88 |
| 664 | 3300026142 | Ga0207698_10789066 | Ga0207698_107890662 | 88 |
| 665 | 3300027665 | Ga0209983_1066781 | Ga0209983_10667812 | 88 |
| 666 | 3300027866 | Ga0209813_10085216 | Ga0209813_100852162 | 88 |
| 667 | 3300027876 | Ga0209974_10065162 | Ga0209974_100651623 | 88 |
| 668 | 3300027876 | Ga0209974_10095280 | Ga0209974_100952802 | 88 |
| 669 | 3300027907 | Ga0207428_10016103 | Ga0207428_100161039 | 88 |
| 670 | 3300028379 | Ga0268266_10256241 | Ga0268266_102562414 | 88 |
| 671 | 3300028379 | Ga0268266_10699476 | Ga0268266_106994762 | 88 |
| 672 | 3300028379 | Ga0268266_10981289 | Ga0268266_109812893 | 88 |
| 673 | 3300028379 | Ga0268266_11030104 | Ga0268266_110301042 | 88 |
| 674 | 3300028379 | Ga0268266_11654958 | Ga0268266_116549582 | 88 |
| 675 | 3300028380 | Ga0268265_10122749 | Ga0268265_101227495 | 88 |
| 676 | 3300028380 | Ga0268265_10124906 | Ga0268265_101249063 | 88 |
| 677 | 3300028380 | Ga0268265_10922509 | Ga0268265_109225092 | 88 |
| 678 | 3300028380 | Ga0268265_10937031 | Ga0268265_109370312 | 88 |
| 679 | 3300028380 | Ga0268265_11272228 | Ga0268265_112722282 | 88 |
| 680 | 3300028380 | Ga0268265_12267722 | Ga0268265_122677222 | 88 |
| 681 | 3300028381 | Ga0268264_10266278 | Ga0268264_102662782 | 88 |
| 682 | 3300031548 | Ga0307408_100040174 | Ga0307408_1000401746 | 88 |
| 683 | 3300031548 | Ga0307408_100176766 | Ga0307408_1001767662 | 88 |
| 684 | 3300031548 | Ga0307408_100593034 | Ga0307408_1005930343 | 88 |
| 685 | 3300031731 | Ga0307405_10557249 | Ga0307405_105572492 | 88 |
| 686 | 3300031852 | Ga0307410_10018152 | Ga0307410_100181527 | 88 |
| 687 | 3300031852 | Ga0307410_10458030 | Ga0307410_104580302 | 88 |
| 688 | 3300031852 | Ga0307410_11673589 | Ga0307410_116735891 | 88 |
| 689 | 3300031903 | Ga0307407_10154023 | Ga0307407_101540234 | 88 |
| 690 | 3300031903 | Ga0307407_10219668 | Ga0307407_102196683 | 88 |
| 691 | 3300031911 | Ga0307412_10150812 | Ga0307412_101508124 | 88 |
| 692 | 3300031911 | Ga0307412_10220979 | Ga0307412_102209794 | 88 |
| 693 | 3300031911 | Ga0307412_11552073 | Ga0307412_115520732 | 88 |
| 694 | 3300031995 | Ga0307409_100030071 | Ga0307409_1000300715 | 88 |
| 695 | 3300031995 | Ga0307409_100089370 | Ga0307409_1000893701 | 88 |
| 696 | 3300032002 | Ga0307416_100040357 | Ga0307416_1000403576 | 88 |
| 697 | 3300032002 | Ga0307416_100056201 | Ga0307416_1000562016 | 88 |
| 698 | 3300032002 | Ga0307416_100360816 | Ga0307416_1003608162 | 88 |
| 699 | 3300032002 | Ga0307416_100475328 | Ga0307416_1004753283 | 88 |
| 700 | 3300032002 | Ga0307416_100598913 | Ga0307416_1005989131 | 88 |
| 701 | 3300032002 | Ga0307416_101061513 | Ga0307416_1010615132 | 88 |
| 702 | 3300032002 | Ga0307416_101572766 | Ga0307416_1015727662 | 88 |
| 703 | 3300032002 | Ga0307416_101764404 | Ga0307416_1017644042 | 88 |
| 704 | 3300032002 | Ga0307416_103701786 | Ga0307416_1037017862 | 88 |
| 705 | 3300032005 | Ga0307411_10081445 | Ga0307411_100814455 | 88 |
| 706 | 3300032005 | Ga0307411_10319128 | Ga0307411_103191283 | 88 |
| 707 | 3300032005 | Ga0307411_10512552 | Ga0307411_105125522 | 88 |
| 708 | 3300032005 | Ga0307411_10981694 | Ga0307411_109816942 | 88 |
| 709 | 3300032126 | Ga0307415_100195976 | Ga0307415_1001959764 | 88 |
| 710 | 3300032126 | Ga0307415_100342065 | Ga0307415_1003420652 | 88 |
| 711 | 3300035091 | Ga0373951_0027075 | Ga0373951_0027075_901_1167 | 88 |
| 712 | 3300035112 | Ga0373932_0030680 | Ga0373932_0030680_1081_1347 | 88 |
| 713 | 3300035115 | Ga0373941_0314819 | Ga0373941_0314819_85_351 | 88 |
| 714 | 3300035116 | Ga0373945_0305763 | Ga0373945_0305763_26_292 | 88 |
| 715 | 3300035119 | Ga0373956_0408164 | Ga0373956_0408164_302_586 | 88 |
| 716 | 3300035170 | Ga0373943_0121418 | Ga0373943_0121418_746_1030 | 88 |
| 717 | 3300035171 | Ga0373946_0144595 | Ga0373946_0144595_675_959 | 88 |
| 718 | 3300035172 | Ga0373955_0191679 | Ga0373955_0191679_526_810 | 88 |
| 719 | 3300035207 | Ga0373942_0073203 | Ga0373942_0073203_569_835 | 88 |
| 720 | 3300035241 | Ga0373961_0111885 | Ga0373961_0111885_304_570 | 88 |
| 721 | 3300035241 | Ga0373961_0226756 | Ga0373961_0226756_60_326 | 88 |
| 722 | 3300035242 | Ga0373962_0187825 | Ga0373962_0187825_17_283 | 88 |
| 723 | 3300035691 | Ga0373931_0092841 | Ga0373931_0092841_1051_1317 | 88 |
| 724 | 3300035691 | Ga0373931_0592533 | Ga0373931_0592533_340_606 | 88 |
| 725 | 3300036401 | Ga0373937_0000651 | Ga0373937_0000651_11797_12066 | 88 |
| 726 | 3300036401 | Ga0373937_0280691 | Ga0373937_0280691_527_793 | 88 |
| 727 | 3300037068 | Ga0373925_1139757 | Ga0373925_1139757_276_542 | 88 |
| 728 | 3300037418 | Ga0395900_0875039 | Ga0395900_0875039_212_478 | 88 |
| 729 | 3300039437 | Ga0436365_0113116 | Ga0436365_0113116_782_1048 | 88 |
| 730 | 3300041406 | Ga0439439_0086069 | Ga0439439_0086069_518_790 | 88 |
| 731 | 3300041410 | Ga0439461_0060476 | Ga0439461_0060476_306_575 | 88 |
| 732 | 3300041451 | Ga0451791_1519790 | Ga0451791_1519790_13_279 | 88 |
| 733 | 3300041452 | Ga0451793_0108495 | Ga0451793_0108495_151_417 | 88 |
| 734 | 3300041460 | Ga0451802_0119544 | Ga0451802_0119544_140_406 | 88 |
| 735 | 3300041486 | Ga0451807_0449784 | Ga0451807_0449784_314_598 | 88 |
| 736 | 3300041501 | Ga0451845_0675573 | Ga0451845_0675573_190_456 | 88 |
| 737 | 3300041512 | Ga0451853_0170158 | Ga0451853_0170158_325_606 | 88 |
| 738 | 3300041512 | Ga0451853_1132466 | Ga0451853_1132466_210_476 | 88 |
| 739 | 3300041512 | Ga0451853_1313310 | Ga0451853_1313310_97_363 | 88 |
| 740 | 3300041512 | Ga0451853_2018823 | Ga0451853_2018823_570_836 | 88 |
| 741 | 3300041999 | Ga0439433_0021574 | Ga0439433_0021574_393_662 | 88 |
| 742 | 3300041999 | Ga0439433_0051436 | Ga0439433_0051436_541_813 | 88 |
| 743 | 3300042007 | Ga0439449_0120317 | Ga0439449_0120317_43_309 | 88 |
| 744 | 3300042011 | Ga0439454_056707 | Ga0439454_056707_240_506 | 88 |
| 745 | 3300042014 | Ga0439457_116874 | Ga0439457_116874_39_311 | 88 |
| 746 | 3300042015 | Ga0439462_0091092 | Ga0439462_0091092_152_421 | 88 |
| 747 | 3300042122 | Ga0450920_018330 | Ga0450920_018330_460_753 | 88 |
| 748 | 3300042122 | Ga0450920_044911 | Ga0450920_044911_462_728 | 88 |
| 749 | 3300042125 | Ga0450923_012281 | Ga0450923_012281_1196_1489 | 88 |
| 750 | 3300042131 | Ga0450894_002011 | Ga0450894_002011_644_937 | 88 |
| 751 | 3300042132 | Ga0450895_005338 | Ga0450895_005338_503_796 | 88 |
| 752 | 3300042133 | Ga0450896_000284 | Ga0450896_000284_3502_3795 | 88 |
| 753 | 3300042135 | Ga0450899_017456 | Ga0450899_017456_446_739 | 88 |
| 754 | 3300042142 | Ga0450905_075900 | Ga0450905_075900_139_414 | 88 |
| 755 | 3300042145 | Ga0450906_038357 | Ga0450906_038357_233_526 | 88 |
| 756 | 3300042156 | Ga0439446_0013235 | Ga0439446_0013235_1859_2128 | 88 |
| 757 | 3300042156 | Ga0439446_0107312 | Ga0439446_0107312_502_768 | 88 |
| 758 | 3300042184 | Ga0450908_020092 | Ga0450908_020092_445_738 | 88 |
| 759 | 3300042435 | Ga0439434_0070902 | Ga0439434_0070902_143_409 | 88 |
| 760 | 3300042435 | Ga0439434_0272390 | Ga0439434_0272390_224_493 | 88 |
| 761 | 3300042436 | Ga0439435_0040353 | Ga0439435_0040353_356_622 | 88 |
| 762 | 3300042461 | Ga0439460_0028314 | Ga0439460_0028314_989_1267 | 88 |
| 763 | 3300042530 | Ga0450916_065943 | Ga0450916_065943_285_551 | 88 |
| 764 | 3300042532 | Ga0450893_0007133 | Ga0450893_0007133_278_571 | 88 |
| 765 | 3300042876 | Ga0451577_0033978 | Ga0451577_0033978_1937_2203 | 88 |
| 766 | 3300044712 | Ga0453684_0230994 | Ga0453684_0230994_33_299 | 88 |
| 767 | 3300045051 | Ga0451576_0585839 | Ga0451576_0585839_319_594 | 88 |
| 768 | 3300046454 | Ga0495592_0860683 | Ga0495592_0860683_142_411 | 88 |
| 769 | 3300046455 | Ga0495603_0015692 | Ga0495603_0015692_3667_3948 | 88 |
| 770 | 3300046459 | Ga0495629_0264585 | Ga0495629_0264585_840_1121 | 88 |
| 771 | 3300046462 | Ga0495651_0790365 | Ga0495651_0790365_53_319 | 88 |
| 772 | 3300046463 | Ga0495653_0016842 | Ga0495653_0016842_325_591 | 88 |
| 773 | 3300046473 | Ga0495582_0584143 | Ga0495582_0584143_123_407 | 88 |
| 774 | 3300046492 | Ga0495585_0612910 | Ga0495585_0612910_176_457 | 88 |
| 775 | 3300046499 | Ga0495594_0235853 | Ga0495594_0235853_64_333 | 88 |
| 776 | 3300046517 | Ga0495630_0924182 | Ga0495630_0924182_248_532 | 88 |
| 777 | 3300046529 | Ga0495652_0255448 | Ga0495652_0255448_184_465 | 88 |
| 778 | 3300046533 | Ga0495640_0245015 | Ga0495640_0245015_143_409 | 88 |
| 779 | 3300046535 | Ga0495586_0282431 | Ga0495586_0282431_194_460 | 88 |
| 780 | 3300046539 | Ga0495621_0190859 | Ga0495621_0190859_208_474 | 88 |
| 781 | 3300046559 | Ga0495667_0114538 | Ga0495667_0114538_716_982 | 88 |
| 782 | 3300046642 | Ga0495634_0579531 | Ga0495634_0579531_314_580 | 88 |
| 783 | 3300046663 | Ga0495635_0314122 | Ga0495635_0314122_315_599 | 88 |
| 784 | 3300046664 | Ga0495659_0286459 | Ga0495659_0286459_387_680 | 88 |
| 785 | 3300046683 | Ga0495658_0099746 | Ga0495658_0099746_735_1001 | 88 |
| 786 | 3300046683 | Ga0495658_0172874 | Ga0495658_0172874_532_813 | 88 |
| 787 | 3300046683 | Ga0495658_0569642 | Ga0495658_0569642_151_417 | 88 |
| 788 | 3300046683 | Ga0495658_0801188 | Ga0495658_0801188_100_366 | 88 |
| 789 | 3300046689 | Ga0495613_0589545 | Ga0495613_0589545_177_461 | 88 |
| 790 | 3300047317 | Ga0495604_0200006 | Ga0495604_0200006_20_304 | 88 |
| 791 | 3300047319 | Ga0495674_0077950 | Ga0495674_0077950_2244_2528 | 88 |
| 792 | 3300047319 | Ga0495674_0439832 | Ga0495674_0439832_606_872 | 88 |
| 793 | 3300047319 | Ga0495674_0645816 | Ga0495674_0645816_486_767 | 88 |
| 794 | 3300047319 | Ga0495674_0802443 | Ga0495674_0802443_24_293 | 88 |
| 795 | 3300048903 | Ga0496100_0152608 | Ga0496100_0152608_722_1003 | 88 |
| 796 | 3300048903 | Ga0496100_0531087 | Ga0496100_0531087_329_595 | 88 |
| 797 | 3300048903 | Ga0496100_0540795 | Ga0496100_0540795_459_725 | 88 |
| 798 | 3300048904 | Ga0496101_0025059 | Ga0496101_0025059_1225_1506 | 88 |
| 799 | 3300048904 | Ga0496101_0468680 | Ga0496101_0468680_113_379 | 88 |
| 800 | 3300048904 | Ga0496101_0915932 | Ga0496101_0915932_315_596 | 88 |
| 801 | 3300048904 | Ga0496101_0963197 | Ga0496101_0963197_57_323 | 88 |
| 802 | 3300048905 | Ga0496102_0166996 | Ga0496102_0166996_1312_1593 | 88 |
| 803 | 3300048905 | Ga0496102_0560969 | Ga0496102_0560969_358_639 | 88 |
| 804 | 3300048905 | Ga0496102_1548139 | Ga0496102_1548139_41_307 | 88 |
| 805 | 3300048905 | Ga0496102_1578786 | Ga0496102_1578786_286_552 | 88 |
| 806 | 3300048906 | Ga0496103_0213103 | Ga0496103_0213103_402_668 | 88 |
| 807 | 3300048907 | Ga0496104_0000157 | Ga0496104_0000157_25018_25284 | 88 |
| 808 | 3300048907 | Ga0496104_0042987 | Ga0496104_0042987_292_573 | 88 |
| 809 | 3300048907 | Ga0496104_0086907 | Ga0496104_0086907_2106_2387 | 88 |
| 810 | 3300048907 | Ga0496104_0404824 | Ga0496104_0404824_507_773 | 88 |
| 811 | 3300048908 | Ga0496105_0593340 | Ga0496105_0593340_459_740 | 88 |
| 812 | 3300048908 | Ga0496105_0811839 | Ga0496105_0811839_65_331 | 88 |
| 813 | 3300048908 | Ga0496105_0837321 | Ga0496105_0837321_273_554 | 88 |
| 814 | 3300048909 | Ga0496106_0111211 | Ga0496106_0111211_368_634 | 88 |
| 815 | 3300048909 | Ga0496106_0349184 | Ga0496106_0349184_533_799 | 88 |
| 816 | 3300048909 | Ga0496106_0443834 | Ga0496106_0443834_220_501 | 88 |
| 817 | 3300048909 | Ga0496106_0506700 | Ga0496106_0506700_644_931 | 88 |
| 818 | 3300048909 | Ga0496106_0849733 | Ga0496106_0849733_10_291 | 88 |
| 819 | 3300048909 | Ga0496106_0974294 | Ga0496106_0974294_341_607 | 88 |
| 820 | 3300048910 | Ga0496107_0078155 | Ga0496107_0078155_1138_1419 | 88 |
| 821 | 3300048910 | Ga0496107_0135686 | Ga0496107_0135686_201_482 | 88 |
| 822 | 3300048910 | Ga0496107_0361523 | Ga0496107_0361523_324_590 | 88 |
| 823 | 3300048910 | Ga0496107_0742530 | Ga0496107_0742530_283_549 | 88 |
| 824 | 3300048910 | Ga0496107_0846301 | Ga0496107_0846301_299_589 | 88 |
| 825 | 3300048911 | Ga0496108_0008261 | Ga0496108_0008261_1361_1627 | 88 |
| 826 | 3300048911 | Ga0496108_0132996 | Ga0496108_0132996_188_469 | 88 |
| 827 | 3300048911 | Ga0496108_0200393 | Ga0496108_0200393_723_1004 | 88 |
| 828 | 3300048911 | Ga0496108_0204459 | Ga0496108_0204459_277_543 | 88 |
| 829 | 3300048911 | Ga0496108_0395800 | Ga0496108_0395800_846_1112 | 88 |
| 830 | 3300048911 | Ga0496108_0509991 | Ga0496108_0509991_392_658 | 88 |
| 831 | 3300048912 | Ga0496109_0010308 | Ga0496109_0010308_4957_5238 | 88 |
| 832 | 3300048912 | Ga0496109_0011076 | Ga0496109_0011076_5860_6126 | 88 |
| 833 | 3300048912 | Ga0496109_0098078 | Ga0496109_0098078_2129_2395 | 88 |
| 834 | 3300048912 | Ga0496109_0148942 | Ga0496109_0148942_633_899 | 88 |
| 835 | 3300048912 | Ga0496109_0228590 | Ga0496109_0228590_1294_1560 | 88 |
| 836 | 3300048912 | Ga0496109_0948229 | Ga0496109_0948229_221_487 | 88 |
| 837 | 3300048912 | Ga0496109_1087468 | Ga0496109_1087468_286_567 | 88 |
| 838 | 3300048913 | Ga0496110_0002759 | Ga0496110_0002759_1688_1954 | 88 |
| 839 | 3300048913 | Ga0496110_0010807 | Ga0496110_0010807_1393_1659 | 88 |
| 840 | 3300048913 | Ga0496110_0011106 | Ga0496110_0011106_920_1201 | 88 |
| 841 | 3300048913 | Ga0496110_0111841 | Ga0496110_0111841_375_656 | 88 |
| 842 | 3300048913 | Ga0496110_0182747 | Ga0496110_0182747_1232_1498 | 88 |
| 843 | 3300048913 | Ga0496110_1503263 | Ga0496110_1503263_186_455 | 88 |
| 844 | 3300048914 | Ga0496111_0013452 | Ga0496111_0013452_1156_1437 | 88 |
| 845 | 3300048914 | Ga0496111_0065455 | Ga0496111_0065455_918_1184 | 88 |
| 846 | 3300048914 | Ga0496111_0118079 | Ga0496111_0118079_1063_1329 | 88 |
| 847 | 3300048914 | Ga0496111_0510770 | Ga0496111_0510770_521_787 | 88 |
| 848 | 3300048914 | Ga0496111_0647055 | Ga0496111_0647055_68_334 | 88 |
| 849 | 3300048915 | Ga0496112_0000148 | Ga0496112_0000148_23057_23323 | 88 |
| 850 | 3300048915 | Ga0496112_0004165 | Ga0496112_0004165_8137_8418 | 88 |
| 851 | 3300048915 | Ga0496112_0232059 | Ga0496112_0232059_890_1156 | 88 |
| 852 | 3300048915 | Ga0496112_0301031 | Ga0496112_0301031_638_904 | 88 |
| 853 | 3300048915 | Ga0496112_0995801 | Ga0496112_0995801_38_304 | 88 |
| 854 | 3300048916 | Ga0496113_0103583 | Ga0496113_0103583_177_458 | 88 |
| 855 | 3300048917 | Ga0496114_0027098 | Ga0496114_0027098_329_610 | 88 |
| 856 | 3300048917 | Ga0496114_0444674 | Ga0496114_0444674_103_369 | 88 |
| 857 | 3300049568 | Ga0501031_0110018 | Ga0501031_0110018_909_1175 | 88 |
| 858 | 3300049568 | Ga0501031_0243145 | Ga0501031_0243145_87_353 | 88 |
| 859 | 3300049569 | Ga0501032_0094652 | Ga0501032_0094652_1513_1779 | 88 |
| 860 | 3300049569 | Ga0501032_0601387 | Ga0501032_0601387_184_450 | 88 |
| 861 | 3300049569 | Ga0501032_0638444 | Ga0501032_0638444_324_590 | 88 |
| 862 | 3300049570 | Ga0501033_0048274 | Ga0501033_0048274_894_1160 | 88 |
| 863 | 3300049570 | Ga0501033_0139266 | Ga0501033_0139266_1457_1723 | 88 |
| 864 | 3300049570 | Ga0501033_0807887 | Ga0501033_0807887_68_334 | 88 |
| 865 | 3300049571 | Ga0501034_0006113 | Ga0501034_0006113_2231_2497 | 88 |
| 866 | 3300049571 | Ga0501034_0128066 | Ga0501034_0128066_407_673 | 88 |
| 867 | 3300049571 | Ga0501034_0663665 | Ga0501034_0663665_539_805 | 88 |
| 868 | 3300049571 | Ga0501034_1246297 | Ga0501034_1246297_186_452 | 88 |
| 869 | 3300049572 | Ga0501036_0021023 | Ga0501036_0021023_886_1152 | 88 |
| 870 | 3300049572 | Ga0501036_0175496 | Ga0501036_0175496_918_1184 | 88 |
| 871 | 3300049572 | Ga0501036_0177638 | Ga0501036_0177638_1022_1294 | 88 |
| 872 | 3300049572 | Ga0501036_0214351 | Ga0501036_0214351_1023_1289 | 88 |
| 873 | 3300049572 | Ga0501036_0728600 | Ga0501036_0728600_487_753 | 88 |
| 874 | 3300049572 | Ga0501036_0888572 | Ga0501036_0888572_357_632 | 88 |
| 875 | 3300049573 | Ga0501037_0150182 | Ga0501037_0150182_1142_1408 | 88 |
| 876 | 3300049573 | Ga0501037_0765940 | Ga0501037_0765940_10_276 | 88 |
| 877 | 3300049574 | Ga0501038_0026845 | Ga0501038_0026845_313_579 | 88 |
| 878 | 3300049574 | Ga0501038_0065980 | Ga0501038_0065980_1041_1307 | 88 |
| 879 | 3300049574 | Ga0501038_0557184 | Ga0501038_0557184_411_677 | 88 |
| 880 | 3300049575 | Ga0501039_0086565 | Ga0501039_0086565_15_281 | 88 |
| 881 | 3300049575 | Ga0501039_0121123 | Ga0501039_0121123_435_701 | 88 |
| 882 | 3300049575 | Ga0501039_1588473 | Ga0501039_1588473_42_335 | 88 |
| 883 | 3300049576 | Ga0501040_0202994 | Ga0501040_0202994_395_661 | 88 |
| 884 | 3300049576 | Ga0501040_0486101 | Ga0501040_0486101_53_328 | 88 |
| 885 | 3300049576 | Ga0501040_0616573 | Ga0501040_0616573_357_623 | 88 |
| 886 | 3300049576 | Ga0501040_0702329 | Ga0501040_0702329_355_621 | 88 |
| 887 | 3300049576 | Ga0501040_0782944 | Ga0501040_0782944_277_543 | 88 |
| 888 | 3300049577 | Ga0501041_0082306 | Ga0501041_0082306_1204_1470 | 88 |
| 889 | 3300049577 | Ga0501041_0155832 | Ga0501041_0155832_876_1142 | 88 |
| 890 | 3300049578 | Ga0501042_0021483 | Ga0501042_0021483_1908_2174 | 88 |
| 891 | 3300049578 | Ga0501042_0260722 | Ga0501042_0260722_775_1041 | 88 |
| 892 | 3300049578 | Ga0501042_0371331 | Ga0501042_0371331_32_298 | 88 |
| 893 | 3300049578 | Ga0501042_0465593 | Ga0501042_0465593_111_377 | 88 |
| 894 | 3300049578 | Ga0501042_0992274 | Ga0501042_0992274_287_553 | 88 |
| 895 | 3300049579 | Ga0501043_0003776 | Ga0501043_0003776_1465_1731 | 88 |
| 896 | 3300049579 | Ga0501043_0349186 | Ga0501043_0349186_612_881 | 88 |
| 897 | 3300049579 | Ga0501043_0424204 | Ga0501043_0424204_616_882 | 88 |
| 898 | 3300049579 | Ga0501043_0974685 | Ga0501043_0974685_290_562 | 88 |
| 899 | 3300049579 | Ga0501043_1235536 | Ga0501043_1235536_213_479 | 88 |
| 900 | 3300049580 | Ga0501046_0005320 | Ga0501046_0005320_11199_11465 | 88 |
| 901 | 3300049580 | Ga0501046_0011536 | Ga0501046_0011536_175_441 | 88 |
| 902 | 3300049580 | Ga0501046_0069357 | Ga0501046_0069357_1280_1546 | 88 |
| 903 | 3300049580 | Ga0501046_0296786 | Ga0501046_0296786_237_503 | 88 |
| 904 | 3300049580 | Ga0501046_1012268 | Ga0501046_1012268_13_285 | 88 |
| 905 | 3300049580 | Ga0501046_1037604 | Ga0501046_1037604_17_283 | 88 |
| 906 | 3300049581 | Ga0501047_0001473 | Ga0501047_0001473_12051_12317 | 88 |
| 907 | 3300049581 | Ga0501047_0051950 | Ga0501047_0051950_3166_3432 | 88 |
| 908 | 3300049581 | Ga0501047_0096646 | Ga0501047_0096646_1760_2026 | 88 |
| 909 | 3300049581 | Ga0501047_0156752 | Ga0501047_0156752_12_278 | 88 |
| 910 | 3300049581 | Ga0501047_0440795 | Ga0501047_0440795_640_906 | 88 |
| 911 | 3300049582 | Ga0501048_0151199 | Ga0501048_0151199_580_846 | 88 |
| 912 | 3300049582 | Ga0501048_0156468 | Ga0501048_0156468_1252_1518 | 88 |
| 913 | 3300049582 | Ga0501048_0975704 | Ga0501048_0975704_155_421 | 88 |
| 914 | 3300049583 | Ga0501067_0228787 | Ga0501067_0228787_757_1023 | 88 |
| 915 | 3300049583 | Ga0501067_0247372 | Ga0501067_0247372_630_896 | 88 |
| 916 | 3300049583 | Ga0501067_0436425 | Ga0501067_0436425_214_480 | 88 |
| 917 | 3300049583 | Ga0501067_0500022 | Ga0501067_0500022_147_416 | 88 |
| 918 | 3300049584 | Ga0501068_0006774 | Ga0501068_0006774_4286_4552 | 88 |
| 919 | 3300049584 | Ga0501068_0620940 | Ga0501068_0620940_297_566 | 88 |
| 920 | 3300049585 | Ga0501069_0217962 | Ga0501069_0217962_383_649 | 88 |
| 921 | 3300049585 | Ga0501069_0784561 | Ga0501069_0784561_295_561 | 88 |
| 922 | 3300049586 | Ga0501070_0404719 | Ga0501070_0404719_745_1011 | 88 |
| 923 | 3300049587 | Ga0501071_0055007 | Ga0501071_0055007_701_967 | 88 |
| 924 | 3300049587 | Ga0501071_0137129 | Ga0501071_0137129_741_1007 | 88 |
| 925 | 3300049587 | Ga0501071_0177385 | Ga0501071_0177385_663_935 | 88 |
| 926 | 3300049587 | Ga0501071_1174141 | Ga0501071_1174141_229_495 | 88 |
| 927 | 3300049588 | Ga0501072_0018755 | Ga0501072_0018755_2202_2474 | 88 |
| 928 | 3300049588 | Ga0501072_0040269 | Ga0501072_0040269_2816_3082 | 88 |
| 929 | 3300049588 | Ga0501072_0264553 | Ga0501072_0264553_688_954 | 88 |
| 930 | 3300049588 | Ga0501072_0346760 | Ga0501072_0346760_677_943 | 88 |
| 931 | 3300049588 | Ga0501072_0529226 | Ga0501072_0529226_271_540 | 88 |
| 932 | 3300049588 | Ga0501072_0584751 | Ga0501072_0584751_361_645 | 88 |
| 933 | 3300049588 | Ga0501072_0601348 | Ga0501072_0601348_229_495 | 88 |
| 934 | 3300049588 | Ga0501072_0837720 | Ga0501072_0837720_165_431 | 88 |
| 935 | 3300049588 | Ga0501072_1474436 | Ga0501072_1474436_232_498 | 88 |
| 936 | 3300049589 | Ga0501073_0040646 | Ga0501073_0040646_1495_1761 | 88 |
| 937 | 3300049589 | Ga0501073_0110912 | Ga0501073_0110912_699_974 | 88 |
| 938 | 3300049589 | Ga0501073_0118916 | Ga0501073_0118916_501_767 | 88 |
| 939 | 3300049589 | Ga0501073_0147300 | Ga0501073_0147300_1104_1370 | 88 |
| 940 | 3300049589 | Ga0501073_0192543 | Ga0501073_0192543_54_320 | 88 |
| 941 | 3300049589 | Ga0501073_0224747 | Ga0501073_0224747_215_481 | 88 |
| 942 | 3300049589 | Ga0501073_0378015 | Ga0501073_0378015_568_834 | 88 |
| 943 | 3300049589 | Ga0501073_0383720 | Ga0501073_0383720_16_282 | 88 |
| 944 | 3300049590 | Ga0501074_0160395 | Ga0501074_0160395_1230_1496 | 88 |
| 945 | 3300049590 | Ga0501074_0162251 | Ga0501074_0162251_599_865 | 88 |
| 946 | 3300049590 | Ga0501074_0186184 | Ga0501074_0186184_442_714 | 88 |
| 947 | 3300049590 | Ga0501074_0706996 | Ga0501074_0706996_62_328 | 88 |
| 948 | 3300049591 | Ga0501075_0042891 | Ga0501075_0042891_792_1058 | 88 |
| 949 | 3300049591 | Ga0501075_0060105 | Ga0501075_0060105_889_1161 | 88 |
| 950 | 3300049591 | Ga0501075_0088648 | Ga0501075_0088648_1233_1499 | 88 |
| 951 | 3300049591 | Ga0501075_0189572 | Ga0501075_0189572_354_620 | 88 |
| 952 | 3300049592 | Ga0501076_0005978 | Ga0501076_0005978_1711_1977 | 88 |
| 953 | 3300049592 | Ga0501076_0086660 | Ga0501076_0086660_1566_1841 | 88 |
| 954 | 3300049592 | Ga0501076_0241737 | Ga0501076_0241737_541_807 | 88 |
| 955 | 3300049592 | Ga0501076_0252368 | Ga0501076_0252368_143_415 | 88 |
| 956 | 3300049592 | Ga0501076_0323579 | Ga0501076_0323579_722_988 | 88 |
| 957 | 3300049592 | Ga0501076_0452904 | Ga0501076_0452904_360_638 | 88 |
| 958 | 3300049592 | Ga0501076_0775457 | Ga0501076_0775457_329_595 | 88 |
| 959 | 3300049592 | Ga0501076_1358166 | Ga0501076_1358166_135_419 | 88 |
| 960 | 3300049593 | Ga0501077_0040315 | Ga0501077_0040315_1322_1588 | 88 |
| 961 | 3300049593 | Ga0501077_0419057 | Ga0501077_0419057_445_711 | 88 |
| 962 | 3300049593 | Ga0501077_0574753 | Ga0501077_0574753_188_457 | 88 |
| 963 | 3300049679 | Ga0501249_173077 | Ga0501249_173077_208_474 | 88 |
| 964 | 3300049741 | Ga0501079_0058537 | Ga0501079_0058537_1716_1982 | 88 |
| 965 | 3300049741 | Ga0501079_0103295 | Ga0501079_0103295_529_795 | 88 |
| 966 | 3300049741 | Ga0501079_0291780 | Ga0501079_0291780_979_1245 | 88 |
| 967 | 3300049741 | Ga0501079_0312420 | Ga0501079_0312420_939_1205 | 88 |
| 968 | 3300049741 | Ga0501079_0876309 | Ga0501079_0876309_111_386 | 88 |
| 969 | 3300049741 | Ga0501079_0881503 | Ga0501079_0881503_322_588 | 88 |
| 970 | 3300049742 | Ga0501080_0027293 | Ga0501080_0027293_208_474 | 88 |
| 971 | 3300049742 | Ga0501080_0287010 | Ga0501080_0287010_423_689 | 88 |
| 972 | 3300049742 | Ga0501080_0291905 | Ga0501080_0291905_311_577 | 88 |
| 973 | 3300049742 | Ga0501080_0607157 | Ga0501080_0607157_396_662 | 88 |
| 974 | 3300049742 | Ga0501080_0608565 | Ga0501080_0608565_646_912 | 88 |
| 975 | 3300049742 | Ga0501080_0621866 | Ga0501080_0621866_183_449 | 88 |
| 976 | 3300049742 | Ga0501080_0746448 | Ga0501080_0746448_12_281 | 88 |
| 977 | 3300049742 | Ga0501080_1534035 | Ga0501080_1534035_193_459 | 88 |
| 978 | 3300049742 | Ga0501080_1557705 | Ga0501080_1557705_275_541 | 88 |
| 979 | 3300049743 | Ga0501081_0042825 | Ga0501081_0042825_514_780 | 88 |
| 980 | 3300049743 | Ga0501081_0299607 | Ga0501081_0299607_714_980 | 88 |
| 981 | 3300049743 | Ga0501081_0635315 | Ga0501081_0635315_270_536 | 88 |
| 982 | 3300049743 | Ga0501081_0710202 | Ga0501081_0710202_54_323 | 88 |
| 983 | 3300049744 | Ga0501083_0012875 | Ga0501083_0012875_227_493 | 88 |
| 984 | 3300049744 | Ga0501083_0115600 | Ga0501083_0115600_227_493 | 88 |
| 985 | 3300049822 | Ga0501035_0094786 | Ga0501035_0094786_563_829 | 88 |
| 986 | 3300049822 | Ga0501035_0193773 | Ga0501035_0193773_1170_1436 | 88 |
| 987 | 3300049823 | Ga0501044_0025113 | Ga0501044_0025113_5880_6146 | 88 |
| 988 | 3300049823 | Ga0501044_0037359 | Ga0501044_0037359_357_623 | 88 |
| 989 | 3300049824 | Ga0501045_0046206 | Ga0501045_0046206_1978_2244 | 88 |
| 990 | 3300049824 | Ga0501045_0128366 | Ga0501045_0128366_371_637 | 88 |
| 991 | 3300049824 | Ga0501045_0850916 | Ga0501045_0850916_64_330 | 88 |
| 992 | 3300049824 | Ga0501045_0930076 | Ga0501045_0930076_320_586 | 88 |
| 993 | 3300050489 | nmdc:mga03683_11941_c1 | nmdc:mga03683_11941_c1_713_979 | 88 |
| 994 | 3300050491 | nmdc:mga00v17_59698_c1 | nmdc:mga00v17_59698_c1_898_1164 | 88 |
| 995 | 3300050492 | nmdc:mga0yw44_1015696_c1 | nmdc:mga0yw44_1015696_c1_251_517 | 88 |
| 996 | 3300050492 | nmdc:mga0yw44_303014_c1 | nmdc:mga0yw44_303014_c1_399_665 | 88 |
| 997 | 3300050493 | nmdc:mga0k408_290120_c1 | nmdc:mga0k408_290120_c1_309_578 | 88 |
| 998 | 3300050493 | nmdc:mga0k408_5399_c1 | nmdc:mga0k408_5399_c1_76_342 | 88 |
| 999 | 3300050493 | nmdc:mga0k408_6905_c1 | nmdc:mga0k408_6905_c1_4276_4542 | 88 |
| 1000 | 3300050494 | nmdc:mga06z11_294816_c1 | nmdc:mga06z11_294816_c1_284_550 | 88 |
| 1001 | 3300050495 | nmdc:mga04h51_72200_c1 | nmdc:mga04h51_72200_c1_367_633 | 88 |
| 1002 | 3300050507 | nmdc:mga05p37_1068279_c1 | nmdc:mga05p37_1068279_c1_183_449 | 88 |
| 1003 | 3300050507 | nmdc:mga05p37_167732_c1 | nmdc:mga05p37_167732_c1_1050_1328 | 88 |
| 1004 | 3300050507 | nmdc:mga05p37_2454_c1 | nmdc:mga05p37_2454_c1_12070_12336 | 88 |
| 1005 | 3300050507 | nmdc:mga05p37_34417_c1 | nmdc:mga05p37_34417_c1_2801_3067 | 88 |
| 1006 | 3300050507 | nmdc:mga05p37_41627_c1 | nmdc:mga05p37_41627_c1_3882_4148 | 88 |
| 1007 | 3300050507 | nmdc:mga05p37_613640_c2 | nmdc:mga05p37_613640_c2_371_643 | 88 |
| 1008 | 3300050507 | nmdc:mga05p37_63372_c1 | nmdc:mga05p37_63372_c1_845_1111 | 88 |
| 1009 | 3300050508 | nmdc:mga09592_143785_c1 | nmdc:mga09592_143785_c1_769_1047 | 88 |
| 1010 | 3300050508 | nmdc:mga09592_144718_c1 | nmdc:mga09592_144718_c1_456_731 | 88 |
| 1011 | 3300050509 | nmdc:mga0qj67_139841_c1 | nmdc:mga0qj67_139841_c1_1275_1553 | 88 |
| 1012 | 3300050509 | nmdc:mga0qj67_45318_c1 | nmdc:mga0qj67_45318_c1_179_445 | 88 |
| 1013 | 3300050510 | nmdc:mga06r32_36771_c1 | nmdc:mga06r32_36771_c1_4064_4336 | 88 |
| 1014 | 3300050510 | nmdc:mga06r32_454924_c1 | nmdc:mga06r32_454924_c1_542_820 | 88 |
| 1015 | 3300050510 | nmdc:mga06r32_66537_c1 | nmdc:mga06r32_66537_c1_237_509 | 88 |
| 1016 | 3300050510 | nmdc:mga06r32_7498_c1 | nmdc:mga06r32_7498_c1_47_313 | 88 |
| 1017 | 3300050511 | nmdc:mga08y16_1464923_c1 | nmdc:mga08y16_1464923_c1_128_394 | 88 |
| 1018 | 3300050511 | nmdc:mga08y16_167701_c1 | nmdc:mga08y16_167701_c1_1147_1413 | 88 |
| 1019 | 3300050511 | nmdc:mga08y16_1963090_c1 | nmdc:mga08y16_1963090_c1_135_410 | 88 |
| 1020 | 3300050511 | nmdc:mga08y16_20168_c1 | nmdc:mga08y16_20168_c1_6300_6566 | 88 |
| 1021 | 3300050511 | nmdc:mga08y16_2821_c1 | nmdc:mga08y16_2821_c1_2063_2338 | 88 |
| 1022 | 3300050511 | nmdc:mga08y16_66551_c2 | nmdc:mga08y16_66551_c2_1730_2002 | 88 |
| 1023 | 3300050511 | nmdc:mga08y16_716615_c1 | nmdc:mga08y16_716615_c1_673_957 | 88 |
| 1024 | 3300050512 | nmdc:mga0n895_115148_c1 | nmdc:mga0n895_115148_c1_810_1076 | 88 |
| 1025 | 3300050512 | nmdc:mga0n895_233473_c1 | nmdc:mga0n895_233473_c1_654_920 | 88 |
| 1026 | 3300050512 | nmdc:mga0n895_24578_c1 | nmdc:mga0n895_24578_c1_2040_2306 | 88 |
| 1027 | 3300050512 | nmdc:mga0n895_368008_c1 | nmdc:mga0n895_368008_c1_774_1043 | 88 |
| 1028 | 3300050513 | nmdc:mga0rr50_165429_c1 | nmdc:mga0rr50_165429_c1_1122_1388 | 88 |
| 1029 | 3300050513 | nmdc:mga0rr50_1819885_c1 | nmdc:mga0rr50_1819885_c1_164_442 | 88 |
| 1030 | 3300050513 | nmdc:mga0rr50_1831293_c1 | nmdc:mga0rr50_1831293_c1_135_401 | 88 |
| 1031 | 3300050513 | nmdc:mga0rr50_30217_c1 | nmdc:mga0rr50_30217_c1_1973_2239 | 88 |
| 1032 | 3300050514 | nmdc:mga08x19_212632_c1 | nmdc:mga08x19_212632_c1_928_1194 | 88 |
| 1033 | 3300050514 | nmdc:mga08x19_301288_c1 | nmdc:mga08x19_301288_c1_160_426 | 88 |
| 1034 | 3300050514 | nmdc:mga08x19_355707_c1 | nmdc:mga08x19_355707_c1_106_372 | 88 |
| 1035 | 3300050515 | nmdc:mga0a205_1146693_c1 | nmdc:mga0a205_1146693_c1_234_512 | 88 |
| 1036 | 3300050515 | nmdc:mga0a205_49034_c1 | nmdc:mga0a205_49034_c1_363_629 | 88 |
| 1037 | 3300050515 | nmdc:mga0a205_61638_c1 | nmdc:mga0a205_61638_c1_1981_2247 | 88 |
| 1038 | 3300050515 | nmdc:mga0a205_65091_c1 | nmdc:mga0a205_65091_c1_169_435 | 88 |
| 1039 | 3300050515 | nmdc:mga0a205_6759_c1 | nmdc:mga0a205_6759_c1_4336_4602 | 88 |
| 1040 | 3300053077 | Ga0495601_0076870 | Ga0495601_0076870_1549_1818 | 88 |
| 1041 | 3300053077 | Ga0495601_0084465 | Ga0495601_0084465_706_990 | 88 |
| 1042 | 3300053084 | Ga0495595_0042625 | Ga0495595_0042625_249_533 | 88 |
| 1043 | 3300053084 | Ga0495595_0115643 | Ga0495595_0115643_135_404 | 88 |
| 1044 | 3300053084 | Ga0495595_0652844 | Ga0495595_0652844_162_428 | 88 |
| 1045 | 3300053085 | Ga0495619_0001225 | Ga0495619_0001225_12546_12830 | 88 |
| 1046 | 3300054114 | Ga0501084_0006584 | Ga0501084_0006584_193_459 | 88 |
| 1047 | 3300054114 | Ga0501084_0017135 | Ga0501084_0017135_5236_5502 | 88 |
| 1048 | 3300054114 | Ga0501084_0035496 | Ga0501084_0035496_1242_1508 | 88 |
| 1049 | 3300054114 | Ga0501084_0162260 | Ga0501084_0162260_826_1098 | 88 |
| 1050 | 3300054114 | Ga0501084_0550247 | Ga0501084_0550247_144_410 | 88 |
| 1051 | 3300054114 | Ga0501084_0587188 | Ga0501084_0587188_324_590 | 88 |
| 1052 | 3300054114 | Ga0501084_0718101 | Ga0501084_0718101_384_650 | 88 |
| 1053 | 3300054114 | Ga0501084_0869774 | Ga0501084_0869774_355_633 | 88 |
| 1054 | 3300054114 | Ga0501084_1590854 | Ga0501084_1590854_180_446 | 88 |
| 1055 | 3300059421 | Ga0590071_004751 | Ga0590071_004751_621_920 | 88 |
| 1056 | 3300059424 | Ga0590075_003372 | Ga0590075_003372_1057_1356 | 88 |
| 1057 | 3300059426 | Ga0590077_008658 | Ga0590077_008658_1066_1365 | 88 |
| 1058 | 3300060353 | Ga0501082_0026825 | Ga0501082_0026825_2567_2833 | 88 |
| 1059 | 3300060353 | Ga0501082_0160030 | Ga0501082_0160030_275_541 | 88 |
| 1060 | 3300060353 | Ga0501082_0272132 | Ga0501082_0272132_526_792 | 88 |
| 1061 | 3300060353 | Ga0501082_0758095 | Ga0501082_0758095_61_327 | 88 |
| 1062 | 3300060353 | Ga0501082_0776644 | Ga0501082_0776644_380_646 | 88 |
| 1063 | 3300060353 | Ga0501082_0920344 | Ga0501082_0920344_244_513 | 88 |
| 1064 | 3300060353 | Ga0501082_0935583 | Ga0501082_0935583_111_380 | 88 |
| 1065 | 3300060353 | Ga0501082_0962246 | Ga0501082_0962246_343_609 | 88 |
| 1066 | 3300060353 | Ga0501082_1627775 | Ga0501082_1627775_111_383 | 88 |
| 1067 | 3300061734 | Ga0530510_0344118 | Ga0530510_0344118_661_927 | 88 |
| 1068 | 3300061734 | Ga0530510_0390335 | Ga0530510_0390335_566_832 | 88 |
| 1069 | 3300061734 | Ga0530510_0445218 | Ga0530510_0445218_375_641 | 88 |
| 1070 | 3300061734 | Ga0530510_0544508 | Ga0530510_0544508_201_467 | 88 |
| 1071 | 3300061734 | Ga0530510_0683748 | Ga0530510_0683748_145_411 | 88 |
| 1072 | 3300061734 | Ga0530510_0745755 | Ga0530510_0745755_94_369 | 88 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4i7a-assembly1.cif.gz_B | grpn pentameric microcompartment shell protein from rhodospirillum rubrum | 0.9187 | 1 | 87 |
| 4i7a-assembly1.cif.gz_A | grpn pentameric microcompartment shell protein from rhodospirillum rubrum | 0.9175 | 1 | 88 |
| 4i7a-assembly1.cif.gz_C | grpn pentameric microcompartment shell protein from rhodospirillum rubrum | 0.9155 | 1 | 88 |
| 4i7a-assembly1.cif.gz_B | grpn pentameric microcompartment shell protein from rhodospirillum rubrum | 0.9082 | 1 | 87 |
| 4i7a-assembly1.cif.gz_A | grpn pentameric microcompartment shell protein from rhodospirillum rubrum | 0.9073 | 1 | 88 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4i7aB00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml | 0.9187 | 1 | 87 | 2.40.50.220 |
| 4i7aB00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml | 0.9082 | 1 | 87 | 2.40.50.220 |
| 4n8x100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml | 0.8747 | 1 | 83 | 2.40.50.220 |
| 2z9hB00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml | 0.8653 | 1 | 83 | 2.40.50.220 |
| 2hd3F00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml | 0.8632 | 2 | 83 | 2.40.50.220 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A523NDQ4-F1-model_v4 | Ethanolamine utilization protein EutN | 0.982 | 1 | 60 |
GO:0031469
|
| AF-X1G3E1-F1-model_v4 | Ethanolamine utilization protein EutN | 0.977 | 1 | 64 |
GO:0031469
|
| AF-X1HQN0-F1-model_v4 | Ethanolamine utilization protein EutN | 0.975 | 1 | 60 |
GO:0031469
|
| AF-A0A831KBR1-F1-model_v4 | Ethanolamine utilization protein EutN | 0.9721 | 1 | 56 |
GO:0031469
|
| AF-A0A3N5X188-F1-model_v4 | Ethanolamine utilization protein EutN | 0.9672 | 2 | 55 |
GO:0031469
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar