F489487

General Info

Members Datasets Scaffolds Average Seq Length
1071 406 1071 133

Family's Representative Sequence

Representative Sequence 3300035171|Ga0373946_0162633|Ga0373946_0162633_34_516
Length 160
Sequence LDLTSSGQDSGRSIHYAARRKHQDRGTAMTKELLWLTLTIILTGLMWVPYILDRIMVRGLMGAMANPSRKDKPQSEWAQRLYFAHTNAVENLIIFAPLVLILDAQGYSTPNTILACAVYFWARLAHAVVYTMGVPILRTLAFTVGFLAQIALVFAVFGKL

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
5 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
8 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
9 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
10 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
85 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
86 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
119 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
120 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
121 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
139 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
207 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
212 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
213 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
214 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
215 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
216 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
217 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
218 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
219 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
220 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
221 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
222 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
223 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
224 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
225 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
226 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
227 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
228 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
229 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
230 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
231 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
232 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
233 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
234 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
235 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
236 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
237 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
238 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
240 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
241 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
242 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
243 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
244 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
245 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
246 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
247 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
248 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
249 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
250 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
251 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
252 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
253 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
254 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
255 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
256 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
257 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
258 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
259 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
260 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
261 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
262 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
263 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
264 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
265 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
266 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
267 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
268 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
269 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
270 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
271 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
272 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
273 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
274 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
275 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
276 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
277 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
278 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
279 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
280 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
281 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
282 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
283 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
284 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
285 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
286 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
287 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
288 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
289 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
290 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
291 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
292 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
293 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
294 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
295 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
296 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
297 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
298 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
299 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
300 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
301 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
302 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
303 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
304 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
305 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
306 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
307 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
308 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
309 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
310 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
311 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
312 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
313 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
314 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
315 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
316 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
317 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
318 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
319 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
320 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
321 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
322 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
323 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
324 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
325 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
326 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
327 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
328 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
329 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
330 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
331 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
332 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
333 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
334 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
335 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
336 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
337 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
338 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
339 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
340 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
341 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
342 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
343 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
344 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
345 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
346 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
347 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
348 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
349 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
350 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
351 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
352 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
353 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
354 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
369 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
370 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
371 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
372 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
373 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
374 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
375 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
376 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
377 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
378 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
379 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
380 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
381 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
382 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
383 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
386 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
387 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
388 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
389 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
390 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
391 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
392 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
393 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
394 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
395 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
396 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
397 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
398 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
399 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
400 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
401 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
402 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
403 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
404 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
405 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
406 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.91
Metatranscriptomes 0.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.75
Nodule 0
Rhizoplane 6.91
Rhizosphere 91.69
Stem 0
Stem Tuber 0
Unclassified 0.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214544907 2209111006 Bacteria 44850
2 ARSoilYngRDRAFT_c00070 3300000042 Bacteria 16997
3 ARcpr5yngRDRAFT_c000043 3300000043 Bacteria 19987
4 ARSoilOldRDRAFT_c000047 3300000044 Bacteria 25691
5 ARCol0yngRDRAFT_1000027 3300000652 Bacteria 25707
6 JGI24737J22298_10001922 3300001990 Bacteria 7425
7 JGI24035J26624_1033123 3300002126 Unclassified 567
8 JGI26129J50193_1005822 3300003349 Unclassified 881
9 JGI26145J50221_1033792 3300003371 Bacteria 529
10 JGI25405J52794_10003919 3300003911 Bacteria 2636
11 Ga0065714_10267576 3300005288 Unclassified 745
12 Ga0065704_10072440 3300005289 Bacteria 8525
13 Ga0065712_10002336 3300005290 Bacteria 7780
14 Ga0065712_10072434 3300005290 Bacteria 4755
15 Ga0065715_10001032 3300005293 Bacteria 13924
16 Ga0065715_10002398 3300005293 Bacteria 6083
17 Ga0070658_10019414 3300005327 Bacteria 5444
18 Ga0070658_10284183 3300005327 Bacteria 1409
19 Ga0070676_10032919 3300005328 Bacteria 2972
20 Ga0070676_10662816 3300005328 Bacteria 758
21 Ga0070683_100053087 3300005329 Bacteria 3756
22 Ga0070683_100420172 3300005329 Bacteria 1275
23 Ga0070690_100024375 3300005330 Bacteria 3720
24 Ga0070690_100028881 3300005330 Bacteria 3437
25 Ga0070690_100167386 3300005330 Bacteria 1510
26 Ga0070670_100239964 3300005331 Bacteria 1578
27 Ga0070670_100285636 3300005331 Bacteria 1441
28 Ga0070670_101607530 3300005331 Unclassified 597
29 Ga0070677_10000677 3300005333 Bacteria 11415
30 Ga0068869_100283008 3300005334 Bacteria 1334
31 Ga0068869_100718018 3300005334 Bacteria 853
32 Ga0070666_10098868 3300005335 Bacteria 2009
33 Ga0070680_100009897 3300005336 Bacteria 7339
34 Ga0070680_100013833 3300005336 Bacteria 6295
35 Ga0070680_100020270 3300005336 Bacteria 5276
36 Ga0070680_100023290 3300005336 Bacteria 4938
37 Ga0070680_100026950 3300005336 Bacteria 4599
38 Ga0070680_100100236 3300005336 Bacteria 2404
39 Ga0070680_100485627 3300005336 Bacteria 1056
40 Ga0070680_100597644 3300005336 Bacteria 947
41 Ga0070682_100022819 3300005337 Bacteria 3711
42 Ga0070682_100128902 3300005337 Bacteria 1709
43 Ga0070682_100514128 3300005337 Bacteria 930
44 Ga0068868_100516961 3300005338 Bacteria 1048
45 Ga0070660_100002005 3300005339 Bacteria 14046
46 Ga0070660_100004632 3300005339 Bacteria 9521
47 Ga0070660_100041291 3300005339 Bacteria 3515
48 Ga0070660_100059038 3300005339 Bacteria 2975
49 Ga0070660_100059853 3300005339 Bacteria 2955
50 Ga0070660_100065885 3300005339 Bacteria 2819
51 Ga0070660_100486464 3300005339 Bacteria 1026
52 Ga0070689_100377583 3300005340 Bacteria 1194
53 Ga0070689_100468232 3300005340 Bacteria 1075
54 Ga0070687_100041535 3300005343 Bacteria 2325
55 Ga0070687_100111046 3300005343 Bacteria 1552
56 Ga0070687_100133143 3300005343 Bacteria 1438
57 Ga0070687_100248022 3300005343 Bacteria 1105
58 Ga0070687_100449661 3300005343 Bacteria 857
59 Ga0070661_100072176 3300005344 Bacteria 2540
60 Ga0070661_100364980 3300005344 Bacteria 1135
61 Ga0070661_100570855 3300005344 Bacteria 912
62 Ga0070692_10004569 3300005345 Bacteria 5795
63 Ga0070668_100119182 3300005347 Bacteria 2108
64 Ga0070668_100180093 3300005347 Bacteria 1726
65 Ga0070669_100016220 3300005353 Bacteria 5312
66 Ga0070675_100018511 3300005354 Bacteria 5546
67 Ga0070675_100140249 3300005354 Bacteria 2066
68 Ga0070671_100015777 3300005355 Bacteria 6104
69 Ga0070671_100459852 3300005355 Bacteria 1092
70 Ga0070671_100541485 3300005355 Bacteria 1003
71 Ga0070674_100028093 3300005356 Bacteria 3692
72 Ga0070674_100103022 3300005356 Bacteria 2083
73 Ga0070674_100293954 3300005356 Bacteria 1292
74 Ga0070673_100000255 3300005364 Bacteria 27161
75 Ga0070673_100298930 3300005364 Bacteria 1417
76 Ga0070688_100028065 3300005365 Bacteria 3356
77 Ga0070659_100960564 3300005366 Bacteria 749
78 Ga0070667_100017357 3300005367 Bacteria 5964
79 Ga0070667_100094283 3300005367 Bacteria 2579
80 Ga0070667_100276034 3300005367 Bacteria 1508
81 Ga0070667_100392722 3300005367 Bacteria 1262
82 Ga0070703_10008671 3300005406 Bacteria 2861
83 Ga0070709_10044618 3300005434 Bacteria 2746
84 Ga0070709_10167627 3300005434 Bacteria 1532
85 Ga0070714_100041120 3300005435 Bacteria 3899
86 Ga0070714_100045002 3300005435 Bacteria 3739
87 Ga0070714_100228879 3300005435 Bacteria 1712
88 Ga0070714_100267112 3300005435 Bacteria 1586
89 Ga0070714_101265039 3300005435 Bacteria 720
90 Ga0070713_100104840 3300005436 Bacteria 2455
91 Ga0070713_100144031 3300005436 Bacteria 2113
92 Ga0070713_100262538 3300005436 Bacteria 1578
93 Ga0070713_101498795 3300005436 Bacteria 654
94 Ga0070710_10131622 3300005437 Bacteria 1526
95 Ga0070701_10092619 3300005438 Bacteria 1659
96 Ga0070711_100032264 3300005439 Bacteria 3481
97 Ga0070711_100048815 3300005439 Bacteria 2896
98 Ga0070711_100080886 3300005439 Bacteria 2314
99 Ga0070711_100127304 3300005439 Bacteria 1892
100 Ga0070711_100186716 3300005439 Bacteria 1590
101 Ga0070711_100200657 3300005439 Bacteria 1539
102 Ga0070711_100958262 3300005439 Bacteria 732
103 Ga0070711_101481379 3300005439 Bacteria 592
104 Ga0070705_100035185 3300005440 Bacteria 2806
105 Ga0070705_100057750 3300005440 Bacteria 2290
106 Ga0070705_100116182 3300005440 Bacteria 1719
107 Ga0070705_100748054 3300005440 Bacteria 773
108 Ga0070700_100812943 3300005441 Bacteria 754
109 Ga0070694_100002689 3300005444 Bacteria 10536
110 Ga0070694_100769137 3300005444 Bacteria 788
111 Ga0070708_100486404 3300005445 Bacteria 1164
112 Ga0070663_100053406 3300005455 Bacteria 2884
113 Ga0070678_100479328 3300005456 Bacteria 1094
114 Ga0070678_100717645 3300005456 Bacteria 902
115 Ga0070678_101337458 3300005456 Bacteria 667
116 Ga0070662_100006353 3300005457 Bacteria 7612
117 Ga0070662_100190499 3300005457 Bacteria 1622
118 Ga0070662_100262622 3300005457 Bacteria 1391
119 Ga0070662_100533893 3300005457 Bacteria 981
120 Ga0070681_10030461 3300005458 Bacteria 5413
121 Ga0070681_10143539 3300005458 Bacteria 2317
122 Ga0070681_10176707 3300005458 Bacteria 2057
123 Ga0070681_10272939 3300005458 Bacteria 1602
124 Ga0070681_11407656 3300005458 Bacteria 621
125 Ga0070681_11408980 3300005458 Bacteria 621
126 Ga0068867_100298668 3300005459 Bacteria 1327
127 Ga0068867_102018976 3300005459 Bacteria 545
128 Ga0070685_10009552 3300005466 Bacteria 5016
129 Ga0070685_10033256 3300005466 Bacteria 2895
130 Ga0070699_101275724 3300005518 Unclassified 674
131 Ga0070699_101333816 3300005518 Bacteria 658
132 Ga0070679_100006208 3300005530 Bacteria 11131
133 Ga0070679_100038245 3300005530 Bacteria 4770
134 Ga0070679_100135759 3300005530 Bacteria 2441
135 Ga0070679_100141809 3300005530 Bacteria 2382
136 Ga0070679_100309344 3300005530 Bacteria 1530
137 Ga0070679_100463540 3300005530 Bacteria 1212
138 Ga0070679_100967421 3300005530 Bacteria 795
139 Ga0070684_100013666 3300005535 Bacteria 6552
140 Ga0070684_100036747 3300005535 Bacteria 4197
141 Ga0070684_100061157 3300005535 Bacteria 3296
142 Ga0070684_100420727 3300005535 Bacteria 1233
143 Ga0070697_100342282 3300005536 Bacteria 1291
144 Ga0068853_100088369 3300005539 Bacteria 2721
145 Ga0068853_101203413 3300005539 Bacteria 731
146 Ga0070686_100007712 3300005544 Bacteria 6016
147 Ga0070686_100010718 3300005544 Bacteria 5181
148 Ga0070686_100362408 3300005544 Bacteria 1092
149 Ga0070686_101245662 3300005544 Bacteria 619
150 Ga0070695_100022979 3300005545 Bacteria 3827
151 Ga0070695_100092809 3300005545 Bacteria 2019
152 Ga0070696_100019739 3300005546 Bacteria 4567
153 Ga0070696_100047338 3300005546 Bacteria 2983
154 Ga0070696_100047966 3300005546 Bacteria 2964
155 Ga0070696_100117942 3300005546 Bacteria 1918
156 Ga0070693_100009300 3300005547 Bacteria 4884
157 Ga0070693_100121597 3300005547 Bacteria 1620
158 Ga0070693_100125414 3300005547 Bacteria 1598
159 Ga0070704_100002044 3300005549 Bacteria 11185
160 Ga0070704_100010230 3300005549 Bacteria 5705
161 Ga0070704_102126807 3300005549 Bacteria 521
162 Ga0068855_100038030 3300005563 Bacteria 5720
163 Ga0068855_100219705 3300005563 Bacteria 2131
164 Ga0068855_100269713 3300005563 Bacteria 1893
165 Ga0070664_100411669 3300005564 Bacteria 1237
166 Ga0070664_100808148 3300005564 Unclassified 877
167 Ga0068857_100120265 3300005577 Bacteria 2364
168 Ga0068857_100250051 3300005577 Bacteria 1625
169 Ga0068854_100096026 3300005578 Bacteria 2214
170 Ga0068854_101634436 3300005578 Bacteria 588
171 Ga0068856_100213107 3300005614 Bacteria 1947
172 Ga0068856_100223126 3300005614 Bacteria 1900
173 Ga0068856_100512498 3300005614 Bacteria 1220
174 Ga0068856_100578881 3300005614 Bacteria 1144
175 Ga0068856_100655776 3300005614 Bacteria 1070
176 Ga0070702_100031250 3300005615 Bacteria 2911
177 Ga0070702_100401407 3300005615 Bacteria 981
178 Ga0068852_100014845 3300005616 Bacteria 6018
179 Ga0068852_100143760 3300005616 Bacteria 2210
180 Ga0068852_101290022 3300005616 Bacteria 752
181 Ga0068852_101471827 3300005616 Bacteria 703
182 Ga0068859_100011201 3300005617 Bacteria 9016
183 Ga0068859_100060897 3300005617 Bacteria 3803
184 Ga0068866_10004084 3300005718 Bacteria 5990
185 Ga0068866_10149670 3300005718 Bacteria 1350
186 Ga0068861_100012446 3300005719 Bacteria 5936
187 Ga0068861_101181174 3300005719 Bacteria 739
188 Ga0068851_10419441 3300005834 Bacteria 790
189 Ga0068870_10682419 3300005840 Unclassified 707
190 Ga0068858_100089734 3300005842 Bacteria 2860
191 Ga0068858_100742742 3300005842 Bacteria 956
192 Ga0068860_100079707 3300005843 Bacteria 3114
193 Ga0068860_100096697 3300005843 Bacteria 2815
194 Ga0068860_100099546 3300005843 Bacteria 2773
195 Ga0068860_102070090 3300005843 Bacteria 590
196 Ga0068862_100002658 3300005844 Bacteria 15723
197 Ga0068862_100245568 3300005844 Bacteria 1629
198 Ga0068862_101232422 3300005844 Bacteria 747
199 Ga0081455_10000009 3300005937 Bacteria 249885
200 Ga0081455_10007711 3300005937 Bacteria 11291
201 Ga0081455_10680515 3300005937 Unclassified 658
202 Ga0081540_1027731 3300005983 Bacteria 3200
203 Ga0070717_10048664 3300006028 Bacteria 3478
204 Ga0070717_10106660 3300006028 Bacteria 2385
205 Ga0075432_10008112 3300006058 Bacteria 3582
206 Ga0075432_10042732 3300006058 Bacteria 1587
207 Ga0075432_10054797 3300006058 Bacteria 1412
208 Ga0070715_10291194 3300006163 Bacteria 870
209 Ga0070715_10407091 3300006163 Bacteria 758
210 Ga0070716_100186803 3300006173 Bacteria 1366
211 Ga0070712_100159477 3300006175 Bacteria 1741
212 Ga0070712_100169264 3300006175 Bacteria 1694
213 Ga0070712_100467989 3300006175 Bacteria 1052
214 Ga0070712_100620393 3300006175 Bacteria 917
215 Ga0070712_100794227 3300006175 Bacteria 812
216 Ga0075427_10001451 3300006194 Bacteria 3042
217 Ga0097621_100057274 3300006237 Bacteria 3186
218 Ga0097621_100135984 3300006237 Bacteria 2096
219 Ga0097621_101789411 3300006237 Bacteria 585
220 Ga0075370_10913201 3300006353 Bacteria 537
221 Ga0068871_100024571 3300006358 Bacteria 4674
222 Ga0075428_100015961 3300006844 Bacteria 8311
223 Ga0075430_100002634 3300006846 Bacteria 14981
224 Ga0075431_100003630 3300006847 Bacteria 14954
225 Ga0075433_10000215 3300006852 Bacteria 32818
226 Ga0075433_10235105 3300006852 Bacteria 1627
227 Ga0075434_100001991 3300006871 Bacteria 17721
228 Ga0075434_100059088 3300006871 Bacteria 3812
229 Ga0075429_100002688 3300006880 Bacteria 14973
230 Ga0075429_100924060 3300006880 Bacteria 763
231 Ga0068865_100810042 3300006881 Bacteria 808
232 Ga0075436_100184815 3300006914 Bacteria 1474
233 Ga0075436_100264850 3300006914 Bacteria 1226
234 Ga0097620_100011201 3300006931 Bacteria 9016
235 Ga0097620_100060901 3300006931 Bacteria 3803
236 Ga0075435_100007981 3300007076 Bacteria 7576
237 Ga0075435_100066715 3300007076 Bacteria 2929
238 Ga0075435_100218531 3300007076 Bacteria 1618
239 Ga0075435_101134762 3300007076 Bacteria 683
240 Ga0105251_10056491 3300009011 Bacteria 1858
241 Ga0105251_10099896 3300009011 Bacteria 1326
242 Ga0105240_10066233 3300009093 Bacteria 4482
243 Ga0105240_10650210 3300009093 Bacteria 1156
244 Ga0105240_10926383 3300009093 Bacteria 936
245 Ga0105240_11091847 3300009093 Unclassified 849
246 Ga0111539_10001588 3300009094 Bacteria 30267
247 Ga0111539_10008998 3300009094 Bacteria 12639
248 Ga0111539_10104213 3300009094 Bacteria 3328
249 Ga0111539_11555143 3300009094 Bacteria 767
250 Ga0105245_10095625 3300009098 Bacteria 2741
251 Ga0105245_10261154 3300009098 Bacteria 1685
252 Ga0105247_10013175 3300009101 Bacteria 4961
253 Ga0105247_10078238 3300009101 Bacteria 2080
254 Ga0105247_10106779 3300009101 Bacteria 1797
255 Ga0105247_10185323 3300009101 Bacteria 1391
256 Ga0105247_10264520 3300009101 Bacteria 1180
257 Ga0114129_10008124 3300009147 Bacteria 14957
258 Ga0114129_10008445 3300009147 Bacteria 14672
259 Ga0105243_10137800 3300009148 Bacteria 2078
260 Ga0105243_10412734 3300009148 Bacteria 1257
261 Ga0105243_11222977 3300009148 Bacteria 765
262 Ga0105241_10012702 3300009174 Bacteria 6180
263 Ga0105241_10059957 3300009174 Bacteria 2927
264 Ga0105241_10128270 3300009174 Bacteria 2050
265 Ga0105242_10004424 3300009176 Bacteria 10926
266 Ga0105242_10213652 3300009176 Bacteria 1720
267 Ga0105242_11161773 3300009176 Bacteria 789
268 Ga0105248_10010513 3300009177 Bacteria 10193
269 Ga0105248_10098855 3300009177 Bacteria 3288
270 Ga0105248_10965915 3300009177 Bacteria 962
271 Ga0105237_10014708 3300009545 Bacteria 8171
272 Ga0105237_10032544 3300009545 Bacteria 5279
273 Ga0105237_10075611 3300009545 Bacteria 3359
274 Ga0105238_10042664 3300009551 Bacteria 4592
275 Ga0105238_10128853 3300009551 Bacteria 2509
276 Ga0105238_10134227 3300009551 Bacteria 2453
277 Ga0105238_12620923 3300009551 Bacteria 540
278 Ga0105249_10007257 3300009553 Bacteria 9668
279 Ga0105249_10063203 3300009553 Bacteria 3400
280 Ga0105239_10352838 3300010375 Bacteria 1661
281 Ga0105239_11088212 3300010375 Bacteria 920
282 Ga0105246_10086388 3300011119 Bacteria 2249
283 Ga0105246_10144787 3300011119 Bacteria 1792
284 Ga0157342_1006506 3300012507 Bacteria 1108
285 Ga0157316_1086012 3300012510 Unclassified 500
286 Ga0157326_1005229 3300012513 Bacteria 1368
287 Ga0157338_1002982 3300012515 Bacteria 1371
288 Ga0157373_10041889 3300013100 Bacteria 3275
289 Ga0157371_10030517 3300013102 Bacteria 3889
290 Ga0157371_10050502 3300013102 Bacteria 2956
291 Ga0157371_10067753 3300013102 Bacteria 2526
292 Ga0157371_10699682 3300013102 Bacteria 759
293 Ga0157370_10103404 3300013104 Bacteria 2666
294 Ga0157370_10630457 3300013104 Bacteria 980
295 Ga0157369_10299762 3300013105 Bacteria 1672
296 Ga0157369_10435835 3300013105 Bacteria 1358
297 Ga0157369_10792375 3300013105 Bacteria 974
298 Ga0157374_10010431 3300013296 Bacteria 7988
299 Ga0157374_10377691 3300013296 Bacteria 1411
300 Ga0157374_10392179 3300013296 Bacteria 1384
301 Ga0157374_12774910 3300013296 Unclassified 517
302 Ga0157378_10013910 3300013297 Bacteria 7039
303 Ga0157378_10208723 3300013297 Bacteria 1851
304 Ga0157378_10211096 3300013297 Bacteria 1841
305 Ga0157378_10298705 3300013297 Bacteria 1558
306 Ga0163162_10135662 3300013306 Bacteria 2571
307 Ga0163162_10179571 3300013306 Bacteria 2243
308 Ga0157372_10079573 3300013307 Bacteria 3707
309 Ga0157372_10273554 3300013307 Bacteria 1963
310 Ga0157372_10499287 3300013307 Bacteria 1419
311 Ga0157375_10032055 3300013308 Bacteria 4979
312 Ga0157375_10249621 3300013308 Bacteria 1935
313 Ga0157375_10849761 3300013308 Bacteria 1059
314 Ga0163163_10012423 3300014325 Bacteria 7758
315 Ga0163163_10013602 3300014325 Bacteria 7452
316 Ga0157380_10042945 3300014326 Bacteria 3537
317 Ga0157377_10000240 3300014745 Bacteria 27908
318 Ga0157377_10051480 3300014745 Bacteria 2323
319 Ga0157379_10005177 3300014968 Bacteria 11201
320 Ga0157379_10080639 3300014968 Bacteria 2915
321 Ga0157379_10090623 3300014968 Bacteria 2743
322 Ga0157379_11062064 3300014968 Bacteria 774
323 Ga0157379_11755730 3300014968 Bacteria 609
324 Ga0157376_10003312 3300014969 Bacteria 11094
325 Ga0157376_10083195 3300014969 Bacteria 2752
326 Ga0157376_10801883 3300014969 Bacteria 954
327 Ga0157376_11050228 3300014969 Bacteria 839
328 Ga0163161_10194928 3300017792 Bacteria 1559
329 Ga0163161_10318552 3300017792 Bacteria 1229
330 Ga0206353_10912259 3300020082 Bacteria 756
331 Ga0213876_10099297 3300021384 Bacteria 1543
332 Ga0213876_10135708 3300021384 Bacteria 1309
333 Ga0207666_1002040 3300025271 Bacteria 2415
334 Ga0207697_10004957 3300025315 Bacteria 6274
335 Ga0207653_10003884 3300025885 Bacteria 4698
336 Ga0207692_10011972 3300025898 Bacteria 3713
337 Ga0207692_10016281 3300025898 Bacteria 3288
338 Ga0207692_10066772 3300025898 Bacteria 1881
339 Ga0207692_10248956 3300025898 Bacteria 1064
340 Ga0207642_10014306 3300025899 Bacteria 2924
341 Ga0207710_10026649 3300025900 Bacteria 2499
342 Ga0207710_10069084 3300025900 Bacteria 1617
343 Ga0207688_10019028 3300025901 Bacteria 3737
344 Ga0207680_10727632 3300025903 Bacteria 711
345 Ga0207647_10037802 3300025904 Bacteria 3057
346 Ga0207685_10023862 3300025905 Bacteria 2088
347 Ga0207699_10004579 3300025906 Bacteria 6605
348 Ga0207699_10005624 3300025906 Bacteria 6015
349 Ga0207699_10105731 3300025906 Bacteria 1795
350 Ga0207699_10147340 3300025906 Bacteria 1553
351 Ga0207645_10048112 3300025907 Bacteria 2722
352 Ga0207645_10443135 3300025907 Bacteria 876
353 Ga0207645_10744116 3300025907 Unclassified 667
354 Ga0207654_10221302 3300025911 Bacteria 1256
355 Ga0207707_10007972 3300025912 Bacteria 9204
356 Ga0207707_10015798 3300025912 Bacteria 6581
357 Ga0207707_10074155 3300025912 Bacteria 2968
358 Ga0207707_10200543 3300025912 Bacteria 1740
359 Ga0207707_10229861 3300025912 Unclassified 1614
360 Ga0207695_10142546 3300025913 Bacteria 2343
361 Ga0207695_10604817 3300025913 Bacteria 977
362 Ga0207671_10042353 3300025914 Bacteria 3370
363 Ga0207671_10347525 3300025914 Bacteria 1176
364 Ga0207693_10027515 3300025915 Bacteria 4495
365 Ga0207693_10180346 3300025915 Bacteria 1662
366 Ga0207693_10210845 3300025915 Bacteria 1527
367 Ga0207693_10284603 3300025915 Bacteria 1295
368 Ga0207693_10653159 3300025915 Bacteria 817
369 Ga0207663_10016764 3300025916 Bacteria 4070
370 Ga0207663_10060759 3300025916 Bacteria 2396
371 Ga0207663_10066265 3300025916 Bacteria 2311
372 Ga0207663_10204796 3300025916 Bacteria 1426
373 Ga0207663_10433102 3300025916 Bacteria 1011
374 Ga0207663_10587971 3300025916 Bacteria 874
375 Ga0207663_10887062 3300025916 Bacteria 713
376 Ga0207663_11355244 3300025916 Unclassified 573
377 Ga0207660_10025258 3300025917 Bacteria 4031
378 Ga0207660_10031041 3300025917 Bacteria 3676
379 Ga0207660_10038443 3300025917 Bacteria 3341
380 Ga0207660_10243304 3300025917 Bacteria 1418
381 Ga0207660_10254838 3300025917 Bacteria 1386
382 Ga0207660_10584368 3300025917 Bacteria 909
383 Ga0207662_10008126 3300025918 Bacteria 5735
384 Ga0207662_10010377 3300025918 Bacteria 5142
385 Ga0207662_10104243 3300025918 Bacteria 1761
386 Ga0207662_10136862 3300025918 Bacteria 1548
387 Ga0207657_10013699 3300025919 Bacteria 7942
388 Ga0207657_10024313 3300025919 Bacteria 5615
389 Ga0207657_10037506 3300025919 Bacteria 4326
390 Ga0207657_10038255 3300025919 Bacteria 4274
391 Ga0207657_10233000 3300025919 Bacteria 1472
392 Ga0207657_10350272 3300025919 Bacteria 1165
393 Ga0207649_10260613 3300025920 Bacteria 1253
394 Ga0207649_10755619 3300025920 Unclassified 757
395 Ga0207652_10021283 3300025921 Bacteria 5352
396 Ga0207652_10021687 3300025921 Bacteria 5303
397 Ga0207652_10088833 3300025921 Bacteria 2712
398 Ga0207652_10335404 3300025921 Bacteria 1365
399 Ga0207652_10869977 3300025921 Bacteria 797
400 Ga0207646_10416498 3300025922 Bacteria 1213
401 Ga0207681_10067102 3300025923 Bacteria 2486
402 Ga0207694_10598258 3300025924 Bacteria 927
403 Ga0207650_10032643 3300025925 Bacteria 3766
404 Ga0207650_10089960 3300025925 Bacteria 2344
405 Ga0207650_10228704 3300025925 Bacteria 1499
406 Ga0207659_10055540 3300025926 Bacteria 2833
407 Ga0207687_10159028 3300025927 Bacteria 1732
408 Ga0207700_10002272 3300025928 Bacteria 11029
409 Ga0207700_10246304 3300025928 Bacteria 1525
410 Ga0207700_10298168 3300025928 Bacteria 1391
411 Ga0207664_10083642 3300025929 Bacteria 2602
412 Ga0207664_10085037 3300025929 Bacteria 2581
413 Ga0207664_10092615 3300025929 Bacteria 2481
414 Ga0207664_10345365 3300025929 Bacteria 1316
415 Ga0207644_10014800 3300025931 Bacteria 5229
416 Ga0207644_10561439 3300025931 Bacteria 945
417 Ga0207690_10198092 3300025932 Bacteria 1523
418 Ga0207690_11186755 3300025932 Bacteria 637
419 Ga0207706_10012224 3300025933 Bacteria 7823
420 Ga0207706_10040156 3300025933 Bacteria 4147
421 Ga0207706_10355946 3300025933 Bacteria 1272
422 Ga0207706_10914411 3300025933 Bacteria 740
423 Ga0207686_10032361 3300025934 Bacteria 3112
424 Ga0207686_10242797 3300025934 Bacteria 1312
425 Ga0207709_10160658 3300025935 Bacteria 1567
426 Ga0207709_10262764 3300025935 Bacteria 1266
427 Ga0207709_10922031 3300025935 Bacteria 711
428 Ga0207670_10219884 3300025936 Bacteria 1453
429 Ga0207670_11001045 3300025936 Bacteria 703
430 Ga0207669_10188652 3300025937 Bacteria 1485
431 Ga0207669_10255890 3300025937 Bacteria 1306
432 Ga0207669_10426675 3300025937 Bacteria 1045
433 Ga0207704_10055382 3300025938 Bacteria 2423
434 Ga0207704_10363737 3300025938 Bacteria 1130
435 Ga0207665_10001471 3300025939 Bacteria 15845
436 Ga0207665_10084415 3300025939 Bacteria 2191
437 Ga0207691_10168625 3300025940 Bacteria 1918
438 Ga0207691_10204014 3300025940 Bacteria 1720
439 Ga0207691_10279728 3300025940 Bacteria 1436
440 Ga0207711_10053237 3300025941 Bacteria 3471
441 Ga0207711_10076219 3300025941 Bacteria 2920
442 Ga0207711_10941853 3300025941 Bacteria 802
443 Ga0207689_10199835 3300025942 Bacteria 1650
444 Ga0207689_10290770 3300025942 Bacteria 1353
445 Ga0207661_10152218 3300025944 Bacteria 2000
446 Ga0207661_10244868 3300025944 Bacteria 1592
447 Ga0207679_10345753 3300025945 Bacteria 1295
448 Ga0207679_10659465 3300025945 Unclassified 947
449 Ga0207679_10762004 3300025945 Bacteria 881
450 Ga0207667_10130869 3300025949 Bacteria 2584
451 Ga0207667_10539762 3300025949 Bacteria 1180
452 Ga0207667_10551166 3300025949 Bacteria 1166
453 Ga0207667_11088897 3300025949 Bacteria 783
454 Ga0207667_11896952 3300025949 Bacteria 558
455 Ga0207651_10019390 3300025960 Bacteria 4075
456 Ga0207651_10914355 3300025960 Bacteria 782
457 Ga0207712_10809637 3300025961 Bacteria 824
458 Ga0207668_10407432 3300025972 Bacteria 1151
459 Ga0207640_10549423 3300025981 Bacteria 970
460 Ga0207640_11746005 3300025981 Bacteria 562
461 Ga0207658_10151064 3300025986 Bacteria 1892
462 Ga0207658_10182302 3300025986 Bacteria 1739
463 Ga0207658_10322345 3300025986 Bacteria 1338
464 Ga0207658_10846736 3300025986 Unclassified 831
465 Ga0207703_10177361 3300026035 Bacteria 1878
466 Ga0207703_10697962 3300026035 Bacteria 965
467 Ga0207639_10426935 3300026041 Bacteria 1199
468 Ga0207639_10702978 3300026041 Bacteria 938
469 Ga0207639_11333068 3300026041 Bacteria 673
470 Ga0207678_10013090 3300026067 Bacteria 7278
471 Ga0207678_10037906 3300026067 Bacteria 4191
472 Ga0207708_10005734 3300026075 Bacteria 9178
473 Ga0207708_10655696 3300026075 Bacteria 894
474 Ga0207702_10161179 3300026078 Bacteria 2048
475 Ga0207702_10446922 3300026078 Bacteria 1254
476 Ga0207702_11127662 3300026078 Unclassified 778
477 Ga0207702_11131617 3300026078 Bacteria 777
478 Ga0207648_10013903 3300026089 Bacteria 7465
479 Ga0207648_10078303 3300026089 Bacteria 2883
480 Ga0207676_10221629 3300026095 Bacteria 1685
481 Ga0207676_10292169 3300026095 Bacteria 1484
482 Ga0207676_10330084 3300026095 Bacteria 1403
483 Ga0207674_10115242 3300026116 Bacteria 2659
484 Ga0207675_100026434 3300026118 Bacteria 5403
485 Ga0207675_100044811 3300026118 Bacteria 4133
486 Ga0207675_100649183 3300026118 Bacteria 1061
487 Ga0207683_10000637 3300026121 Bacteria 32050
488 Ga0207683_10003484 3300026121 Bacteria 13733
489 Ga0207683_10221944 3300026121 Bacteria 1722
490 Ga0207683_10701901 3300026121 Bacteria 938
491 Ga0207698_10099642 3300026142 Bacteria 2404
492 Ga0207698_10141023 3300026142 Bacteria 2077
493 Ga0207698_10954587 3300026142 Bacteria 867
494 Ga0207698_11144337 3300026142 Bacteria 792
495 Ga0209969_1029322 3300027360 Bacteria 838
496 Ga0209982_1063422 3300027552 Bacteria 602
497 Ga0210002_1018275 3300027617 Bacteria 1120
498 Ga0209966_1002882 3300027695 Bacteria 2884
499 Ga0209998_10001644 3300027717 Bacteria 5349
500 Ga0209998_10002534 3300027717 Bacteria 4160
501 Ga0209813_10184459 3300027866 Bacteria 765
502 Ga0209974_10011146 3300027876 Bacteria 3024
503 Ga0209974_10032112 3300027876 Bacteria 1740
504 Ga0207428_10000216 3300027907 Bacteria 79777
505 Ga0207428_10003413 3300027907 Bacteria 15431
506 Ga0207428_10441756 3300027907 Bacteria 949
507 Ga0268266_10073574 3300028379 Bacteria 2965
508 Ga0268264_10021057 3300028381 Bacteria 5329
509 Ga0268264_10035058 3300028381 Bacteria 4131
510 Ga0268264_10266637 3300028381 Bacteria 1598
511 Ga0265337_1006048 3300028556 Bacteria 4719
512 Ga0265338_10019445 3300028800 Bacteria 7205
513 Ga0265338_10370517 3300028800 Bacteria 1026
514 Ga0265324_10057089 3300029957 Bacteria 1337
515 Ga0265330_10009349 3300031235 Bacteria 4660
516 Ga0265332_10193662 3300031238 Bacteria 846
517 Ga0265325_10000048 3300031241 Bacteria 82899
518 Ga0265325_10002795 3300031241 Bacteria 11656
519 Ga0265340_10294916 3300031247 Bacteria 719
520 Ga0265339_10092760 3300031249 Bacteria 1580
521 Ga0265339_10253327 3300031249 Bacteria 851
522 Ga0265339_10422707 3300031249 Bacteria 621
523 Ga0265316_10304513 3300031344 Bacteria 1160
524 Ga0307408_101593076 3300031548 Bacteria 620
525 Ga0265313_10001040 3300031595 Bacteria 26998
526 Ga0265313_10062629 3300031595 Bacteria 1737
527 Ga0265313_10072518 3300031595 Bacteria 1582
528 Ga0265313_10104320 3300031595 Bacteria 1254
529 Ga0265314_10012970 3300031711 Bacteria 6767
530 Ga0265314_10013779 3300031711 Bacteria 6514
531 Ga0265314_10107338 3300031711 Bacteria 1782
532 Ga0265342_10001167 3300031712 Bacteria 25007
533 Ga0265342_10038412 3300031712 Bacteria 2916
534 Ga0307416_101348522 3300032002 Bacteria 819
535 Ga0307416_101488664 3300032002 Bacteria 783
536 Ga0373930_0000195 3300034816 Bacteria 7365
537 Ga0373948_0000184 3300034817 Bacteria 7132
538 Ga0373948_0002050 3300034817 Bacteria 2916
539 Ga0373948_0080489 3300034817 Bacteria 742
540 Ga0373958_0000536 3300034819 Bacteria 4730
541 Ga0373958_0017470 3300034819 Bacteria 1290
542 Ga0373958_0112284 3300034819 Bacteria 650
543 Ga0373938_0000244 3300034957 Bacteria 8511
544 Ga0373938_0003184 3300034957 Bacteria 2667
545 Ga0373926_0238562 3300035083 Bacteria 703
546 Ga0373928_0000913 3300035084 Bacteria 5780
547 Ga0373928_0015463 3300035084 Bacteria 1554
548 Ga0373928_0030076 3300035084 Bacteria 1198
549 Ga0373929_0000485 3300035085 Bacteria 7622
550 Ga0373934_0056483 3300035086 Bacteria 1561
551 Ga0373940_0003410 3300035088 Bacteria 3242
552 Ga0373944_0003351 3300035089 Bacteria 4129
553 Ga0373944_0129726 3300035089 Bacteria 875
554 Ga0373949_0001916 3300035090 Bacteria 5616
555 Ga0373951_0000488 3300035091 Bacteria 11307
556 Ga0373951_0006475 3300035091 Bacteria 2679
557 Ga0373951_0009239 3300035091 Bacteria 2221
558 Ga0373951_0013143 3300035091 Bacteria 1861
559 Ga0373952_0013828 3300035092 Bacteria 1607
560 Ga0373952_0014806 3300035092 Bacteria 1566
561 Ga0373923_0006436 3300035111 Bacteria 4061
562 Ga0373923_0037821 3300035111 Bacteria 1975
563 Ga0373923_0053042 3300035111 Bacteria 1705
564 Ga0373923_0152950 3300035111 Bacteria 1049
565 Ga0373923_0277459 3300035111 Unclassified 789
566 Ga0373932_0000474 3300035112 Bacteria 12323
567 Ga0373932_0010986 3300035112 Bacteria 2203
568 Ga0373936_0001095 3300035113 Bacteria 9709
569 Ga0373936_0423109 3300035113 Bacteria 613
570 Ga0373939_0003026 3300035114 Bacteria 3947
571 Ga0373939_0009971 3300035114 Bacteria 2364
572 Ga0373939_0036871 3300035114 Bacteria 1449
573 Ga0373941_0000598 3300035115 Bacteria 7310
574 Ga0373941_0001282 3300035115 Bacteria 5289
575 Ga0373941_0031575 3300035115 Bacteria 1579
576 Ga0373945_0004964 3300035116 Bacteria 4239
577 Ga0373945_0064074 3300035116 Bacteria 1377
578 Ga0373953_0045167 3300035117 Bacteria 1764
579 Ga0373953_0329677 3300035117 Unclassified 668
580 Ga0373954_0001049 3300035118 Bacteria 10992
581 Ga0373954_0007478 3300035118 Bacteria 4781
582 Ga0373954_0022383 3300035118 Bacteria 2866
583 Ga0373954_0145592 3300035118 Bacteria 1156
584 Ga0373956_0012907 3300035119 Bacteria 3470
585 Ga0373956_0027704 3300035119 Bacteria 2462
586 Ga0373956_0225722 3300035119 Bacteria 889
587 Ga0373957_0048717 3300035120 Bacteria 1615
588 Ga0373957_0105672 3300035120 Bacteria 1130
589 Ga0373957_0184433 3300035120 Bacteria 866
590 Ga0373960_0002102 3300035121 Bacteria 4484
591 Ga0373960_0010943 3300035121 Bacteria 2224
592 Ga0373960_0140885 3300035121 Bacteria 816
593 Ga0373943_0007130 3300035170 Bacteria 5015
594 Ga0373943_0308913 3300035170 Bacteria 899
595 Ga0373943_0430409 3300035170 Unclassified 764
596 Ga0373946_0162633 3300035171 Bacteria 1049
597 Ga0373946_0162920 3300035171 Bacteria 1048
598 Ga0373946_0202778 3300035171 Bacteria 951
599 Ga0373955_0002451 3300035172 Bacteria 8100
600 Ga0373955_0004483 3300035172 Bacteria 6182
601 Ga0373955_0028546 3300035172 Bacteria 2893
602 Ga0373955_0038348 3300035172 Bacteria 2552
603 Ga0373955_0374197 3300035172 Unclassified 864
604 Ga0373942_0012221 3300035207 Bacteria 2047
605 Ga0373961_0010502 3300035241 Bacteria 2282
606 Ga0373961_0044103 3300035241 Bacteria 1299
607 Ga0373962_0001456 3300035242 Bacteria 5597
608 Ga0373924_0012343 3300035410 Bacteria 3190
609 Ga0373924_0053727 3300035410 Bacteria 1674
610 Ga0373931_0006069 3300035691 Bacteria 5628
611 Ga0373931_0058742 3300035691 Bacteria 2067
612 Ga0373931_0078670 3300035691 Bacteria 1815
613 Ga0373931_0202490 3300035691 Bacteria 1186
614 Ga0373935_0047238 3300035692 Bacteria 2721
615 Ga0373935_0154529 3300035692 Bacteria 1559
616 Ga0373935_0217937 3300035692 Bacteria 1325
617 Ga0373927_0004039 3300035695 Bacteria 10376
618 Ga0373927_0236385 3300035695 Bacteria 1200
619 Ga0373933_0004781 3300035724 Bacteria 7402
620 Ga0373933_0006526 3300035724 Bacteria 6354
621 Ga0373933_0012091 3300035724 Bacteria 4766
622 Ga0373933_0072025 3300035724 Bacteria 2104
623 Ga0373947_0006399 3300035725 Bacteria 6844
624 Ga0373947_0073431 3300035725 Bacteria 2102
625 Ga0373947_0322930 3300035725 Bacteria 1032
626 Ga0373937_0001398 3300036401 Bacteria 20148
627 Ga0373937_0005069 3300036401 Bacteria 11213
628 Ga0373937_0020720 3300036401 Bacteria 5897
629 Ga0373937_0040141 3300036401 Bacteria 4266
630 Ga0373925_0011839 3300037068 Bacteria 6312
631 Ga0373925_0014118 3300037068 Bacteria 5781
632 Ga0373925_0076162 3300037068 Bacteria 2543
633 Ga0373925_0101464 3300037068 Bacteria 2212
634 Ga0373925_1293294 3300037068 Bacteria 598
635 Ga0436365_0078382 3300039437 Bacteria 11270
636 Ga0436365_0274005 3300039437 Bacteria 1927
637 Ga0436365_1041486 3300039437 Bacteria 4052
638 Ga0436360_0486235 3300039438 Bacteria 544
639 Ga0436361_0180502 3300039447 Bacteria 897
640 Ga0436361_0891923 3300039447 Bacteria 586
641 Ga0436363_0783221 3300039450 Bacteria 3216
642 Ga0436362_0716023 3300039453 Bacteria 892
643 Ga0439448_0011374 3300042005 Bacteria 2653
644 Ga0439448_0086178 3300042005 Bacteria 1058
645 Ga0439455_0025023 3300042012 Unclassified 1448
646 Ga0439463_027721 3300042016 Bacteria 1427
647 Ga0439463_075937 3300042016 Unclassified 862
648 Ga0439444_0155412 3300042437 Bacteria 555
649 Ga0439464_0043449 3300042439 Bacteria 1285
650 Ga0451577_0379689 3300042876 Bacteria 1282
651 Ga0453683_0663487 3300044673 Unclassified 682
652 Ga0466963_0886681 3300044694 Bacteria 629
653 Ga0466957_0272386 3300044842 Bacteria 1131
654 Ga0451576_0013929 3300045051 Bacteria 8979
655 Ga0466967_2175979 3300045976 Bacteria 551
656 Ga0495617_171132 3300046452 Bacteria 686
657 Ga0495592_0013463 3300046454 Bacteria 6223
658 Ga0495592_0033058 3300046454 Bacteria 3902
659 Ga0495592_0113605 3300046454 Bacteria 1913
660 Ga0495592_0190898 3300046454 Bacteria 1389
661 Ga0495592_0453515 3300046454 Unclassified 803
662 Ga0495603_0005357 3300046455 Bacteria 7649
663 Ga0495603_0050431 3300046455 Bacteria 2475
664 Ga0495603_0232151 3300046455 Bacteria 1063
665 Ga0495629_0059841 3300046459 Bacteria 2662
666 Ga0495629_0119732 3300046459 Bacteria 1834
667 Ga0495641_0091367 3300046461 Bacteria 1360
668 Ga0495641_0091740 3300046461 Bacteria 1357
669 Ga0495651_0003153 3300046462 Bacteria 12701
670 Ga0495651_0012826 3300046462 Bacteria 6472
671 Ga0495653_0001202 3300046463 Bacteria 20094
672 Ga0495653_0009980 3300046463 Bacteria 7766
673 Ga0495580_0004568 3300046472 Bacteria 11617
674 Ga0495580_0227886 3300046472 Bacteria 1280
675 Ga0495580_0327189 3300046472 Unclassified 1041
676 Ga0495582_0065925 3300046473 Bacteria 2001
677 Ga0495639_0002223 3300046475 Bacteria 8536
678 Ga0495662_0002421 3300046476 Bacteria 9371
679 Ga0495662_0021180 3300046476 Bacteria 3144
680 Ga0495664_0008194 3300046477 Bacteria 5818
681 Ga0495664_0009168 3300046477 Bacteria 5531
682 Ga0495664_0016181 3300046477 Bacteria 4247
683 Ga0495584_0013126 3300046491 Bacteria 4226
684 Ga0495584_0119623 3300046491 Bacteria 1334
685 Ga0495584_0136805 3300046491 Bacteria 1244
686 Ga0495585_0000995 3300046492 Bacteria 23693
687 Ga0495594_0003519 3300046499 Bacteria 8068
688 Ga0495594_0046647 3300046499 Bacteria 2380
689 Ga0495607_0013487 3300046501 Bacteria 5354
690 Ga0495608_0000363 3300046511 Bacteria 31688
691 Ga0495608_0095348 3300046511 Bacteria 1922
692 Ga0495608_0919995 3300046511 Bacteria 511
693 Ga0495618_0001897 3300046514 Bacteria 13753
694 Ga0495618_0009777 3300046514 Bacteria 5796
695 Ga0495628_0001606 3300046516 Bacteria 20730
696 Ga0495628_0012443 3300046516 Bacteria 7177
697 Ga0495628_0305453 3300046516 Bacteria 1177
698 Ga0495628_0661419 3300046516 Bacteria 741
699 Ga0495630_0131028 3300046517 Bacteria 1904
700 Ga0495630_0768066 3300046517 Bacteria 736
701 Ga0495644_0002021 3300046523 Bacteria 8158
702 Ga0495663_0026199 3300046525 Bacteria 1706
703 Ga0495666_0164251 3300046526 Bacteria 1029
704 Ga0495652_0002586 3300046529 Bacteria 18522
705 Ga0495652_0052019 3300046529 Bacteria 3494
706 Ga0495652_0328679 3300046529 Bacteria 1102
707 Ga0495652_0362400 3300046529 Bacteria 1036
708 Ga0495652_1006363 3300046529 Bacteria 545
709 Ga0495640_0009382 3300046533 Bacteria 7620
710 Ga0495640_0023798 3300046533 Bacteria 4456
711 Ga0495640_0091974 3300046533 Bacteria 2001
712 Ga0495640_0100025 3300046533 Bacteria 1904
713 Ga0495640_0950387 3300046533 Bacteria 508
714 Ga0495586_0167057 3300046535 Bacteria 1242
715 Ga0495587_0003533 3300046536 Bacteria 10409
716 Ga0495587_0008605 3300046536 Bacteria 6560
717 Ga0495587_0206520 3300046536 Bacteria 1110
718 Ga0495587_0251534 3300046536 Bacteria 993
719 Ga0495609_0080934 3300046538 Bacteria 1420
720 Ga0495609_0205501 3300046538 Bacteria 822
721 Ga0495645_0032742 3300046543 Bacteria 3792
722 Ga0495645_0451690 3300046543 Bacteria 810
723 Ga0495645_0743485 3300046543 Bacteria 592
724 Ga0495622_0020475 3300046557 Bacteria 3079
725 Ga0495622_0043097 3300046557 Bacteria 2098
726 Ga0495622_0227494 3300046557 Unclassified 825
727 Ga0495633_0009135 3300046558 Bacteria 5502
728 Ga0495667_0001863 3300046559 Bacteria 13986
729 Ga0495667_0002910 3300046559 Bacteria 11494
730 Ga0495667_0012561 3300046559 Bacteria 5743
731 Ga0495667_0019111 3300046559 Bacteria 4625
732 Ga0495667_0069747 3300046559 Bacteria 2294
733 Ga0495667_0165497 3300046559 Bacteria 1421
734 Ga0495656_0011054 3300046615 Bacteria 3303
735 Ga0495634_0023444 3300046642 Bacteria 4338
736 Ga0495634_0114050 3300046642 Bacteria 1735
737 Ga0495634_0257703 3300046642 Bacteria 1065
738 Ga0495634_0415384 3300046642 Bacteria 797
739 Ga0495611_0550340 3300046648 Bacteria 523
740 Ga0495635_0000730 3300046663 Bacteria 21233
741 Ga0495635_0030540 3300046663 Bacteria 3744
742 Ga0495635_0041243 3300046663 Bacteria 3189
743 Ga0495635_0088565 3300046663 Bacteria 2118
744 Ga0495635_0135391 3300046663 Bacteria 1679
745 Ga0495659_0002692 3300046664 Bacteria 5717
746 Ga0495588_0001656 3300046674 Bacteria 9523
747 Ga0495657_0044286 3300046675 Bacteria 3028
748 Ga0495657_0045003 3300046675 Bacteria 2997
749 Ga0495657_0052229 3300046675 Bacteria 2741
750 Ga0495599_0003607 3300046678 Bacteria 9079
751 Ga0495599_0033518 3300046678 Bacteria 3227
752 Ga0495599_0498860 3300046678 Bacteria 717
753 Ga0495623_0002343 3300046679 Bacteria 12621
754 Ga0495623_0435271 3300046679 Bacteria 700
755 Ga0495623_0558491 3300046679 Unclassified 598
756 Ga0495646_0042319 3300046680 Bacteria 2795
757 Ga0495646_0053119 3300046680 Bacteria 2444
758 Ga0495647_0000967 3300046681 Bacteria 8697
759 Ga0495647_0033610 3300046681 Bacteria 1917
760 Ga0495647_0349899 3300046681 Bacteria 672
761 Ga0495658_0002102 3300046683 Bacteria 10107
762 Ga0495658_0174362 3300046683 Bacteria 1332
763 Ga0495613_0012394 3300046689 Bacteria 6335
764 Ga0495613_0082103 3300046689 Bacteria 2341
765 Ga0495613_0242328 3300046689 Bacteria 1260
766 Ga0495613_0267584 3300046689 Bacteria 1189
767 Ga0495624_0067799 3300046690 Bacteria 2225
768 Ga0495624_0070412 3300046690 Bacteria 2177
769 Ga0495624_0250181 3300046690 Unclassified 1072
770 Ga0495600_0000703 3300046809 Bacteria 17538
771 Ga0495600_0061545 3300046809 Bacteria 2452
772 Ga0495600_0082623 3300046809 Bacteria 2096
773 Ga0495600_0170384 3300046809 Bacteria 1405
774 Ga0495600_0387519 3300046809 Unclassified 871
775 Ga0495600_0608940 3300046809 Bacteria 663
776 Ga0495581_0059282 3300047315 Bacteria 2212
777 Ga0495581_0077256 3300047315 Bacteria 1926
778 Ga0495581_0438989 3300047315 Unclassified 761
779 Ga0495604_0001606 3300047317 Bacteria 18631
780 Ga0495604_0017676 3300047317 Bacteria 5707
781 Ga0495604_0033728 3300047317 Bacteria 4052
782 Ga0495604_0072048 3300047317 Bacteria 2612
783 Ga0495674_0008713 3300047319 Bacteria 9648
784 Ga0495674_0008815 3300047319 Bacteria 9592
785 Ga0495674_0085519 3300047319 Bacteria 2701
786 Ga0495674_0101934 3300047319 Bacteria 2441
787 Ga0495674_0387766 3300047319 Bacteria 1129
788 Ga0495676_0234102 3300047321 Bacteria 1260
789 Ga0495676_0316850 3300047321 Bacteria 1048
790 Ga0495676_0460952 3300047321 Bacteria 838
791 Ga0495680_0003233 3300047322 Bacteria 16170
792 Ga0495680_0012545 3300047322 Bacteria 7451
793 Ga0495680_0023301 3300047322 Bacteria 5149
794 Ga0495680_0136433 3300047322 Bacteria 1798
795 Ga0495680_0204334 3300047322 Bacteria 1416
796 Ga0495680_0492068 3300047322 Unclassified 834
797 Ga0495675_0002258 3300047444 Bacteria 11506
798 Ga0495675_0020910 3300047444 Bacteria 4165
799 Ga0495675_0136683 3300047444 Bacteria 1521
800 Ga0495675_0356515 3300047444 Bacteria 859
801 Ga0495677_0029496 3300047445 Bacteria 1995
802 Ga0495677_0130107 3300047445 Bacteria 963
803 Ga0495684_0000749 3300047471 Bacteria 26152
804 Ga0495684_0147471 3300047471 Bacteria 1761
805 Ga0495684_0343079 3300047471 Bacteria 1062
806 Ga0495684_0535854 3300047471 Bacteria 799
807 Ga0495684_0597452 3300047471 Bacteria 745
808 Ga0495593_0028750 3300047673 Bacteria 3052
809 Ga0495593_0236985 3300047673 Bacteria 914
810 Ga0495602_0006328 3300048088 Bacteria 12420
811 Ga0495602_0018809 3300048088 Bacteria 6881
812 Ga0495602_0050105 3300048088 Bacteria 3735
813 Ga0495602_0308040 3300048088 Bacteria 1157
814 Ga0495614_0175714 3300048089 Unclassified 962
815 Ga0496100_0032026 3300048903 Bacteria 3273
816 Ga0496100_0190751 3300048903 Bacteria 1488
817 Ga0496100_0599216 3300048903 Bacteria 855
818 Ga0496101_0024419 3300048904 Bacteria 4183
819 Ga0496101_0033791 3300048904 Bacteria 3609
820 Ga0496101_0054158 3300048904 Bacteria 2896
821 Ga0496101_0107992 3300048904 Bacteria 2092
822 Ga0496101_0251885 3300048904 Bacteria 1376
823 Ga0496101_0621902 3300048904 Bacteria 854
824 Ga0496101_0623432 3300048904 Bacteria 852
825 Ga0496102_0017443 3300048905 Bacteria 6289
826 Ga0496102_0052687 3300048905 Bacteria 3708
827 Ga0496102_0125349 3300048905 Bacteria 2400
828 Ga0496102_0142734 3300048905 Bacteria 2246
829 Ga0496102_0204308 3300048905 Bacteria 1862
830 Ga0496102_0210331 3300048905 Bacteria 1834
831 Ga0496102_0972969 3300048905 Bacteria 769
832 Ga0496102_1468756 3300048905 Bacteria 600
833 Ga0496103_0044329 3300048906 Bacteria 2740
834 Ga0496103_0098323 3300048906 Bacteria 1850
835 Ga0496103_0121012 3300048906 Bacteria 1667
836 Ga0496103_0316085 3300048906 Bacteria 1004
837 Ga0496104_0001904 3300048907 Bacteria 18078
838 Ga0496104_0013010 3300048907 Bacteria 7493
839 Ga0496104_0084737 3300048907 Bacteria 3024
840 Ga0496104_0159692 3300048907 Bacteria 2162
841 Ga0496104_0196151 3300048907 Bacteria 1931
842 Ga0496104_0209351 3300048907 Bacteria 1862
843 Ga0496104_0515962 3300048907 Bacteria 1106
844 Ga0496104_0549804 3300048907 Bacteria 1065
845 Ga0496105_0002041 3300048908 Bacteria 14603
846 Ga0496105_0021534 3300048908 Bacteria 5216
847 Ga0496106_0010397 3300048909 Bacteria 6876
848 Ga0496106_0011583 3300048909 Bacteria 6517
849 Ga0496106_0063855 3300048909 Bacteria 2799
850 Ga0496106_0188841 3300048909 Bacteria 1637
851 Ga0496106_0668654 3300048909 Bacteria 829
852 Ga0496107_0008549 3300048910 Bacteria 7084
853 Ga0496107_0028132 3300048910 Bacteria 3994
854 Ga0496107_0116088 3300048910 Bacteria 1970
855 Ga0496107_0139696 3300048910 Bacteria 1790
856 Ga0496107_0373942 3300048910 Bacteria 1060
857 Ga0496108_0013021 3300048911 Bacteria 6776
858 Ga0496108_0019320 3300048911 Bacteria 5595
859 Ga0496108_0033824 3300048911 Bacteria 4246
860 Ga0496108_0857521 3300048911 Bacteria 781
861 Ga0496109_0023038 3300048912 Bacteria 5522
862 Ga0496109_0029705 3300048912 Bacteria 4897
863 Ga0496109_0158598 3300048912 Bacteria 2119
864 Ga0496109_0163060 3300048912 Bacteria 2089
865 Ga0496109_0776515 3300048912 Bacteria 896
866 Ga0496110_0116236 3300048913 Bacteria 2408
867 Ga0496110_1051692 3300048913 Unclassified 722
868 Ga0496110_1358607 3300048913 Bacteria 620
869 Ga0496111_0009938 3300048914 Bacteria 6362
870 Ga0496111_0030686 3300048914 Bacteria 3823
871 Ga0496111_0195562 3300048914 Bacteria 1503
872 Ga0496111_0226342 3300048914 Bacteria 1389
873 Ga0496111_0630867 3300048914 Bacteria 783
874 Ga0496112_0000520 3300048915 Bacteria 26242
875 Ga0496112_0525294 3300048915 Bacteria 1118
876 Ga0496112_1497682 3300048915 Bacteria 589
877 Ga0496113_0043070 3300048916 Bacteria 3338
878 Ga0496113_0325365 3300048916 Bacteria 1233
879 Ga0496113_1153236 3300048916 Bacteria 606
880 Ga0496114_0055845 3300048917 Bacteria 3294
881 Ga0496114_0088502 3300048917 Bacteria 2626
882 Ga0496114_0764433 3300048917 Bacteria 844
883 Ga0496115_0040684 3300048918 Bacteria 3696
884 Ga0496115_0096831 3300048918 Bacteria 2416
885 Ga0496115_0113903 3300048918 Bacteria 2222
886 Ga0496115_0114999 3300048918 Bacteria 2212
887 Ga0496115_0474907 3300048918 Bacteria 1007
888 Ga0496115_1051472 3300048918 Bacteria 620
889 Ga0496119_0320688 3300048922 Bacteria 759
890 Ga0501031_0123896 3300049568 Bacteria 1688
891 Ga0501032_0045575 3300049569 Bacteria 2965
892 Ga0501032_0059269 3300049569 Bacteria 2569
893 Ga0501032_0089571 3300049569 Bacteria 2042
894 Ga0501032_0288193 3300049569 Bacteria 1062
895 Ga0501033_0054944 3300049570 Bacteria 2944
896 Ga0501033_0076233 3300049570 Bacteria 2461
897 Ga0501034_0000211 3300049571 Bacteria 110858
898 Ga0501034_0003250 3300049571 Bacteria 18591
899 Ga0501034_0011273 3300049571 Bacteria 9278
900 Ga0501034_0114986 3300049571 Bacteria 2679
901 Ga0501034_0119188 3300049571 Bacteria 2625
902 Ga0501034_0214617 3300049571 Bacteria 1879
903 Ga0501034_0398319 3300049571 Bacteria 1300
904 Ga0501034_0467470 3300049571 Bacteria 1177
905 Ga0501034_1169737 3300049571 Bacteria 648
906 Ga0501034_1203019 3300049571 Bacteria 636
907 Ga0501036_0012016 3300049572 Bacteria 7177
908 Ga0501036_0050002 3300049572 Bacteria 3540
909 Ga0501036_0455716 3300049572 Bacteria 1065
910 Ga0501036_0620044 3300049572 Bacteria 896
911 Ga0501037_0002596 3300049573 Bacteria 13040
912 Ga0501037_0040990 3300049573 Bacteria 3406
913 Ga0501037_0057305 3300049573 Bacteria 2844
914 Ga0501037_0500297 3300049573 Bacteria 824
915 Ga0501037_0781313 3300049573 Bacteria 631
916 Ga0501038_0206825 3300049574 Bacteria 1572
917 Ga0501038_0582875 3300049574 Bacteria 848
918 Ga0501039_0020522 3300049575 Bacteria 5063
919 Ga0501039_0437018 3300049575 Bacteria 1028
920 Ga0501039_0726494 3300049575 Bacteria 776
921 Ga0501040_0662657 3300049576 Bacteria 754
922 Ga0501042_0180698 3300049578 Bacteria 1522
923 Ga0501043_0061902 3300049579 Bacteria 2938
924 Ga0501043_0229418 3300049579 Bacteria 1434
925 Ga0501043_0319393 3300049579 Bacteria 1184
926 Ga0501043_0369987 3300049579 Bacteria 1086
927 Ga0501043_0512022 3300049579 Bacteria 895
928 Ga0501046_0119499 3300049580 Bacteria 2006
929 Ga0501046_0121205 3300049580 Bacteria 1989
930 Ga0501046_0174145 3300049580 Bacteria 1613
931 Ga0501046_0270306 3300049580 Bacteria 1247
932 Ga0501046_0571493 3300049580 Bacteria 804
933 Ga0501047_0000010 3300049581 Bacteria 429357
934 Ga0501047_0076895 3300049581 Bacteria 3212
935 Ga0501047_0149451 3300049581 Bacteria 2212
936 Ga0501047_0184993 3300049581 Bacteria 1949
937 Ga0501047_0210335 3300049581 Bacteria 1804
938 Ga0501047_0325019 3300049581 Bacteria 1377
939 Ga0501047_0395446 3300049581 Bacteria 1215
940 Ga0501048_0000784 3300049582 Bacteria 23265
941 Ga0501048_0194801 3300049582 Bacteria 1436
942 Ga0501048_0329887 3300049582 Bacteria 1087
943 Ga0501067_0016880 3300049583 Bacteria 4033
944 Ga0501067_0044997 3300049583 Bacteria 2452
945 Ga0501068_0012136 3300049584 Bacteria 4873
946 Ga0501068_0027868 3300049584 Bacteria 3338
947 Ga0501068_0092452 3300049584 Bacteria 1867
948 Ga0501068_1044995 3300049584 Bacteria 539
949 Ga0501069_0021060 3300049585 Bacteria 3536
950 Ga0501069_0030179 3300049585 Bacteria 2976
951 Ga0501069_0183300 3300049585 Bacteria 1210
952 Ga0501069_0424322 3300049585 Bacteria 788
953 Ga0501070_0012798 3300049586 Bacteria 7072
954 Ga0501070_0036167 3300049586 Bacteria 4124
955 Ga0501070_0077077 3300049586 Bacteria 2759
956 Ga0501070_0080055 3300049586 Bacteria 2703
957 Ga0501070_0157256 3300049586 Bacteria 1874
958 Ga0501070_0174968 3300049586 Bacteria 1767
959 Ga0501070_0407204 3300049586 Bacteria 1099
960 Ga0501070_0425188 3300049586 Bacteria 1072
961 Ga0501070_0488897 3300049586 Bacteria 989
962 Ga0501071_0101832 3300049587 Bacteria 2117
963 Ga0501071_0616289 3300049587 Bacteria 834
964 Ga0501072_0023227 3300049588 Bacteria 4816
965 Ga0501072_0161503 3300049588 Bacteria 1787
966 Ga0501072_0256878 3300049588 Bacteria 1391
967 Ga0501072_0541175 3300049588 Bacteria 920
968 Ga0501073_0011704 3300049589 Bacteria 6405
969 Ga0501073_0026355 3300049589 Bacteria 4166
970 Ga0501073_0063098 3300049589 Bacteria 2584
971 Ga0501073_0200807 3300049589 Bacteria 1379
972 Ga0501073_0590934 3300049589 Bacteria 767
973 Ga0501073_0880959 3300049589 Bacteria 616
974 Ga0501074_0015467 3300049590 Bacteria 5546
975 Ga0501074_0026995 3300049590 Bacteria 4160
976 Ga0501074_0188316 3300049590 Bacteria 1471
977 Ga0501074_0210681 3300049590 Bacteria 1384
978 Ga0501074_1043945 3300049590 Bacteria 574
979 Ga0501075_0151608 3300049591 Bacteria 1767
980 Ga0501076_0210029 3300049592 Bacteria 1590
981 Ga0501076_1351611 3300049592 Bacteria 586
982 Ga0501077_0023345 3300049593 Bacteria 3922
983 Ga0501077_0259530 3300049593 Bacteria 1105
984 Ga0501079_0001490 3300049741 Bacteria 16573
985 Ga0501079_0705058 3300049741 Bacteria 794
986 Ga0501080_0090573 3300049742 Bacteria 2841
987 Ga0501080_0124247 3300049742 Bacteria 2390
988 Ga0501080_0125376 3300049742 Bacteria 2378
989 Ga0501080_0151953 3300049742 Bacteria 2140
990 Ga0501080_0376510 3300049742 Bacteria 1279
991 Ga0501080_0795918 3300049742 Bacteria 829
992 Ga0501081_0338156 3300049743 Bacteria 1108
993 Ga0501083_0009626 3300049744 Bacteria 6827
994 Ga0501083_0129901 3300049744 Bacteria 1651
995 Ga0501083_0374712 3300049744 Bacteria 926
996 Ga0501035_0002108 3300049822 Bacteria 19783
997 Ga0501035_0025158 3300049822 Bacteria 5457
998 Ga0501035_0257687 3300049822 Bacteria 1479
999 Ga0501035_0398980 3300049822 Bacteria 1144
1000 Ga0501035_0584438 3300049822 Bacteria 912
1001 Ga0501035_0904897 3300049822 Bacteria 699
1002 Ga0501044_0086065 3300049823 Bacteria 3175
1003 Ga0501044_0422395 3300049823 Bacteria 1243
1004 Ga0501044_0689648 3300049823 Bacteria 907
1005 Ga0501045_0549322 3300049824 Bacteria 857
1006 Ga0501045_0600342 3300049824 Bacteria 815
1007 nmdc:mga03n38_471280_c1 3300050490 Bacteria 701
1008 nmdc:mga06z11_11064_c1 3300050494 Bacteria 3874
1009 nmdc:mga06z11_622479_c1 3300050494 Bacteria 657
1010 nmdc:mga05p37_3652_c1 3300050507 Bacteria 17997
1011 nmdc:mga05p37_5580_c1 3300050507 Bacteria 14793
1012 nmdc:mga09592_1558720_c1 3300050508 Bacteria 536
1013 nmdc:mga09592_714_c1 3300050508 Bacteria 25508
1014 nmdc:mga0qj67_1449_c1 3300050509 Bacteria 16619
1015 nmdc:mga06r32_1863_c1 3300050510 Bacteria 18774
1016 nmdc:mga08y16_1194501_c1 3300050511 Bacteria 732
1017 nmdc:mga08y16_1350709_c1 3300050511 Bacteria 678
1018 nmdc:mga08y16_3547_c1 3300050511 Bacteria 16202
1019 nmdc:mga08y16_3652_c1 3300050511 Bacteria 16005
1020 nmdc:mga0n895_20971_c1 3300050512 Bacteria 6104
1021 nmdc:mga0n895_4615_c1 3300050512 Bacteria 11357
1022 nmdc:mga0n895_54609_c1 3300050512 Bacteria 3930
1023 nmdc:mga0n895_63874_c1 3300050512 Bacteria 3641
1024 nmdc:mga0rr50_1014913_c1 3300050513 Unclassified 707
1025 nmdc:mga0rr50_117189_c1 3300050513 Bacteria 2115
1026 nmdc:mga0rr50_253059_c1 3300050513 Bacteria 1463
1027 nmdc:mga0rr50_33356_c1 3300050513 Bacteria 3677
1028 nmdc:mga0rr50_510044_c1 3300050513 Bacteria 1023
1029 nmdc:mga08x19_104028_c1 3300050514 Bacteria 1886
1030 nmdc:mga08x19_938391_c1 3300050514 Unclassified 615
1031 nmdc:mga0a205_17847_c1 3300050515 Bacteria 6659
1032 nmdc:mga0a205_2116_c1 3300050515 Bacteria 17419
1033 Ga0495601_0003041 3300053077 Bacteria 9559
1034 Ga0495601_0016804 3300053077 Bacteria 4438
1035 Ga0495601_0018616 3300053077 Bacteria 4227
1036 Ga0495601_0029013 3300053077 Bacteria 3429
1037 Ga0495601_0032983 3300053077 Bacteria 3225
1038 Ga0495601_0146683 3300053077 Bacteria 1540
1039 Ga0495612_0006375 3300053078 Bacteria 4857
1040 Ga0495612_0016428 3300053078 Bacteria 2966
1041 Ga0495612_0018815 3300053078 Bacteria 2765
1042 Ga0495612_0041646 3300053078 Bacteria 1873
1043 Ga0495612_0119603 3300053078 Bacteria 1132
1044 Ga0495612_0234324 3300053078 Bacteria 814
1045 Ga0495612_0408857 3300053078 Bacteria 617
1046 Ga0495595_0000337 3300053084 Bacteria 18087
1047 Ga0495595_0000525 3300053084 Bacteria 14621
1048 Ga0495595_0016453 3300053084 Bacteria 3164
1049 Ga0495595_0072786 3300053084 Bacteria 1627
1050 Ga0495595_0091400 3300053084 Bacteria 1460
1051 Ga0495595_0180254 3300053084 Unclassified 1047
1052 Ga0495595_0207116 3300053084 Bacteria 977
1053 Ga0495619_0000043 3300053085 Bacteria 109865
1054 Ga0495619_0000333 3300053085 Bacteria 33042
1055 Ga0495619_0000405 3300053085 Bacteria 29348
1056 Ga0495619_0006520 3300053085 Bacteria 7387
1057 Ga0495619_0006915 3300053085 Bacteria 7172
1058 Ga0495619_0009776 3300053085 Bacteria 6048
1059 Ga0495619_0012577 3300053085 Bacteria 5328
1060 Ga0495619_0016850 3300053085 Bacteria 4627
1061 Ga0500651_0045526 3300053093 Bacteria 2760
1062 Ga0500641_0001180 3300053096 Bacteria 9311
1063 Ga0500655_018226 3300053133 Unclassified 1303
1064 Ga0501084_0223084 3300054114 Bacteria 1590
1065 Ga0501082_0059799 3300060353 Bacteria 3283
1066 Ga0501082_0459592 3300060353 Bacteria 1112
1067 Ga0501082_0476869 3300060353 Bacteria 1090
1068 Ga0501082_0885052 3300060353 Bacteria 781
1069 Ga0501082_1592165 3300060353 Bacteria 570
1070 Ga0501082_1605047 3300060353 Bacteria 568
1071 Ga0530510_0194729 3300061734 Bacteria 1505

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005336 Ga0070680_100597644 Ga0070680_1005976441 131
2 3300005530 Ga0070679_100967421 Ga0070679_1009674211 131
3 3300025918 Ga0207662_10104243 Ga0207662_101042433 131
4 3300025921 Ga0207652_10869977 Ga0207652_108699772 131
5 2209111006 2214544907 2213593048 132
6 3300000042 ARSoilYngRDRAFT_c00070 ARSoilYngRDRAFT_0007014 132
7 3300000043 ARcpr5yngRDRAFT_c000043 ARcpr5yngRDRAFT_0000434 132
8 3300000044 ARSoilOldRDRAFT_c000047 ARSoilOldRDRAFT_00004720 132
9 3300000652 ARCol0yngRDRAFT_1000027 ARCol0yngRDRAFT_100002710 132
10 3300001990 JGI24737J22298_10001922 JGI24737J22298_100019223 132
11 3300002126 JGI24035J26624_1033123 JGI24035J26624_10331232 132
12 3300003349 JGI26129J50193_1005822 JGI26129J50193_10058222 132
13 3300003371 JGI26145J50221_1033792 JGI26145J50221_10337921 132
14 3300003911 JGI25405J52794_10003919 JGI25405J52794_100039192 132
15 3300005288 Ga0065714_10267576 Ga0065714_102675762 132
16 3300005289 Ga0065704_10072440 Ga0065704_100724403 132
17 3300005290 Ga0065712_10002336 Ga0065712_100023365 132
18 3300005290 Ga0065712_10072434 Ga0065712_100724342 132
19 3300005293 Ga0065715_10001032 Ga0065715_100010323 132
20 3300005293 Ga0065715_10002398 Ga0065715_100023982 132
21 3300005327 Ga0070658_10019414 Ga0070658_100194145 132
22 3300005327 Ga0070658_10284183 Ga0070658_102841831 132
23 3300005328 Ga0070676_10032919 Ga0070676_100329192 132
24 3300005328 Ga0070676_10662816 Ga0070676_106628161 132
25 3300005329 Ga0070683_100053087 Ga0070683_1000530872 132
26 3300005329 Ga0070683_100420172 Ga0070683_1004201721 132
27 3300005330 Ga0070690_100024375 Ga0070690_1000243753 132
28 3300005330 Ga0070690_100028881 Ga0070690_1000288814 132
29 3300005330 Ga0070690_100167386 Ga0070690_1001673862 132
30 3300005331 Ga0070670_100239964 Ga0070670_1002399642 132
31 3300005331 Ga0070670_100285636 Ga0070670_1002856362 132
32 3300005331 Ga0070670_101607530 Ga0070670_1016075301 132
33 3300005333 Ga0070677_10000677 Ga0070677_100006779 132
34 3300005334 Ga0068869_100283008 Ga0068869_1002830082 132
35 3300005334 Ga0068869_100718018 Ga0068869_1007180182 132
36 3300005335 Ga0070666_10098868 Ga0070666_100988682 132
37 3300005336 Ga0070680_100009897 Ga0070680_1000098972 132
38 3300005336 Ga0070680_100013833 Ga0070680_1000138332 132
39 3300005336 Ga0070680_100020270 Ga0070680_1000202702 132
40 3300005336 Ga0070680_100023290 Ga0070680_1000232904 132
41 3300005336 Ga0070680_100026950 Ga0070680_1000269503 132
42 3300005336 Ga0070680_100100236 Ga0070680_1001002362 132
43 3300005336 Ga0070680_100485627 Ga0070680_1004856272 132
44 3300005337 Ga0070682_100022819 Ga0070682_1000228193 132
45 3300005337 Ga0070682_100128902 Ga0070682_1001289021 132
46 3300005337 Ga0070682_100514128 Ga0070682_1005141281 132
47 3300005338 Ga0068868_100516961 Ga0068868_1005169611 132
48 3300005339 Ga0070660_100002005 Ga0070660_1000020052 132
49 3300005339 Ga0070660_100004632 Ga0070660_1000046325 132
50 3300005339 Ga0070660_100041291 Ga0070660_1000412913 132
51 3300005339 Ga0070660_100059038 Ga0070660_1000590382 132
52 3300005339 Ga0070660_100059853 Ga0070660_1000598532 132
53 3300005339 Ga0070660_100065885 Ga0070660_1000658853 132
54 3300005339 Ga0070660_100486464 Ga0070660_1004864642 132
55 3300005340 Ga0070689_100377583 Ga0070689_1003775832 132
56 3300005340 Ga0070689_100468232 Ga0070689_1004682321 132
57 3300005343 Ga0070687_100041535 Ga0070687_1000415352 132
58 3300005343 Ga0070687_100111046 Ga0070687_1001110462 132
59 3300005343 Ga0070687_100133143 Ga0070687_1001331432 132
60 3300005343 Ga0070687_100248022 Ga0070687_1002480222 132
61 3300005343 Ga0070687_100449661 Ga0070687_1004496612 132
62 3300005344 Ga0070661_100072176 Ga0070661_1000721762 132
63 3300005344 Ga0070661_100364980 Ga0070661_1003649802 132
64 3300005344 Ga0070661_100570855 Ga0070661_1005708551 132
65 3300005345 Ga0070692_10004569 Ga0070692_100045692 132
66 3300005347 Ga0070668_100119182 Ga0070668_1001191822 132
67 3300005347 Ga0070668_100180093 Ga0070668_1001800932 132
68 3300005353 Ga0070669_100016220 Ga0070669_1000162202 132
69 3300005354 Ga0070675_100018511 Ga0070675_1000185116 132
70 3300005354 Ga0070675_100140249 Ga0070675_1001402492 132
71 3300005355 Ga0070671_100015777 Ga0070671_1000157775 132
72 3300005355 Ga0070671_100459852 Ga0070671_1004598522 132
73 3300005355 Ga0070671_100541485 Ga0070671_1005414852 132
74 3300005356 Ga0070674_100028093 Ga0070674_1000280932 132
75 3300005356 Ga0070674_100103022 Ga0070674_1001030222 132
76 3300005356 Ga0070674_100293954 Ga0070674_1002939542 132
77 3300005364 Ga0070673_100000255 Ga0070673_1000002552 132
78 3300005364 Ga0070673_100298930 Ga0070673_1002989302 132
79 3300005365 Ga0070688_100028065 Ga0070688_1000280653 132
80 3300005366 Ga0070659_100960564 Ga0070659_1009605641 132
81 3300005367 Ga0070667_100017357 Ga0070667_1000173572 132
82 3300005367 Ga0070667_100094283 Ga0070667_1000942832 132
83 3300005367 Ga0070667_100276034 Ga0070667_1002760342 132
84 3300005367 Ga0070667_100392722 Ga0070667_1003927222 132
85 3300005406 Ga0070703_10008671 Ga0070703_100086714 132
86 3300005434 Ga0070709_10044618 Ga0070709_100446182 132
87 3300005434 Ga0070709_10167627 Ga0070709_101676271 132
88 3300005435 Ga0070714_100041120 Ga0070714_1000411203 132
89 3300005435 Ga0070714_100045002 Ga0070714_1000450021 132
90 3300005435 Ga0070714_100228879 Ga0070714_1002288792 132
91 3300005435 Ga0070714_100267112 Ga0070714_1002671122 132
92 3300005435 Ga0070714_101265039 Ga0070714_1012650391 132
93 3300005436 Ga0070713_100104840 Ga0070713_1001048401 132
94 3300005436 Ga0070713_100144031 Ga0070713_1001440312 132
95 3300005436 Ga0070713_100262538 Ga0070713_1002625382 132
96 3300005436 Ga0070713_101498795 Ga0070713_1014987951 132
97 3300005437 Ga0070710_10131622 Ga0070710_101316222 132
98 3300005438 Ga0070701_10092619 Ga0070701_100926191 132
99 3300005439 Ga0070711_100032264 Ga0070711_1000322642 132
100 3300005439 Ga0070711_100048815 Ga0070711_1000488152 132
101 3300005439 Ga0070711_100080886 Ga0070711_1000808862 132
102 3300005439 Ga0070711_100127304 Ga0070711_1001273042 132
103 3300005439 Ga0070711_100186716 Ga0070711_1001867162 132
104 3300005439 Ga0070711_100200657 Ga0070711_1002006572 132
105 3300005439 Ga0070711_100958262 Ga0070711_1009582622 132
106 3300005439 Ga0070711_101481379 Ga0070711_1014813791 132
107 3300005440 Ga0070705_100035185 Ga0070705_1000351852 132
108 3300005440 Ga0070705_100057750 Ga0070705_1000577502 132
109 3300005440 Ga0070705_100116182 Ga0070705_1001161822 132
110 3300005440 Ga0070705_100748054 Ga0070705_1007480542 132
111 3300005441 Ga0070700_100812943 Ga0070700_1008129431 132
112 3300005444 Ga0070694_100002689 Ga0070694_1000026899 132
113 3300005444 Ga0070694_100769137 Ga0070694_1007691372 132
114 3300005445 Ga0070708_100486404 Ga0070708_1004864042 132
115 3300005455 Ga0070663_100053406 Ga0070663_1000534062 132
116 3300005456 Ga0070678_100479328 Ga0070678_1004793281 132
117 3300005456 Ga0070678_100717645 Ga0070678_1007176451 132
118 3300005456 Ga0070678_101337458 Ga0070678_1013374581 132
119 3300005457 Ga0070662_100006353 Ga0070662_1000063533 132
120 3300005457 Ga0070662_100190499 Ga0070662_1001904992 132
121 3300005457 Ga0070662_100262622 Ga0070662_1002626222 132
122 3300005457 Ga0070662_100533893 Ga0070662_1005338932 132
123 3300005458 Ga0070681_10030461 Ga0070681_100304612 132
124 3300005458 Ga0070681_10143539 Ga0070681_101435391 132
125 3300005458 Ga0070681_10176707 Ga0070681_101767072 132
126 3300005458 Ga0070681_10272939 Ga0070681_102729393 132
127 3300005458 Ga0070681_11407656 Ga0070681_114076561 132
128 3300005458 Ga0070681_11408980 Ga0070681_114089801 132
129 3300005459 Ga0068867_100298668 Ga0068867_1002986682 132
130 3300005459 Ga0068867_102018976 Ga0068867_1020189761 132
131 3300005466 Ga0070685_10009552 Ga0070685_100095525 132
132 3300005466 Ga0070685_10033256 Ga0070685_100332564 132
133 3300005518 Ga0070699_101275724 Ga0070699_1012757242 132
134 3300005518 Ga0070699_101333816 Ga0070699_1013338161 132
135 3300005530 Ga0070679_100006208 Ga0070679_1000062089 132
136 3300005530 Ga0070679_100038245 Ga0070679_1000382452 132
137 3300005530 Ga0070679_100135759 Ga0070679_1001357591 132
138 3300005530 Ga0070679_100141809 Ga0070679_1001418093 132
139 3300005530 Ga0070679_100309344 Ga0070679_1003093442 132
140 3300005530 Ga0070679_100463540 Ga0070679_1004635401 132
141 3300005535 Ga0070684_100013666 Ga0070684_1000136662 132
142 3300005535 Ga0070684_100036747 Ga0070684_1000367474 132
143 3300005535 Ga0070684_100061157 Ga0070684_1000611573 132
144 3300005535 Ga0070684_100420727 Ga0070684_1004207272 132
145 3300005536 Ga0070697_100342282 Ga0070697_1003422822 132
146 3300005539 Ga0068853_100088369 Ga0068853_1000883692 132
147 3300005539 Ga0068853_101203413 Ga0068853_1012034131 132
148 3300005544 Ga0070686_100007712 Ga0070686_1000077126 132
149 3300005544 Ga0070686_100010718 Ga0070686_1000107183 132
150 3300005544 Ga0070686_100362408 Ga0070686_1003624082 132
151 3300005544 Ga0070686_101245662 Ga0070686_1012456621 132
152 3300005545 Ga0070695_100022979 Ga0070695_1000229793 132
153 3300005545 Ga0070695_100092809 Ga0070695_1000928092 132
154 3300005546 Ga0070696_100019739 Ga0070696_1000197392 132
155 3300005546 Ga0070696_100047338 Ga0070696_1000473384 132
156 3300005546 Ga0070696_100047966 Ga0070696_1000479662 132
157 3300005546 Ga0070696_100117942 Ga0070696_1001179422 132
158 3300005547 Ga0070693_100009300 Ga0070693_1000093004 132
159 3300005547 Ga0070693_100121597 Ga0070693_1001215972 132
160 3300005547 Ga0070693_100125414 Ga0070693_1001254142 132
161 3300005549 Ga0070704_100002044 Ga0070704_1000020449 132
162 3300005549 Ga0070704_100010230 Ga0070704_1000102303 132
163 3300005549 Ga0070704_102126807 Ga0070704_1021268071 132
164 3300005563 Ga0068855_100038030 Ga0068855_1000380304 132
165 3300005563 Ga0068855_100219705 Ga0068855_1002197052 132
166 3300005563 Ga0068855_100269713 Ga0068855_1002697132 132
167 3300005564 Ga0070664_100411669 Ga0070664_1004116692 132
168 3300005564 Ga0070664_100808148 Ga0070664_1008081482 132
169 3300005577 Ga0068857_100120265 Ga0068857_1001202652 132
170 3300005577 Ga0068857_100250051 Ga0068857_1002500513 132
171 3300005578 Ga0068854_100096026 Ga0068854_1000960263 132
172 3300005578 Ga0068854_101634436 Ga0068854_1016344361 132
173 3300005614 Ga0068856_100213107 Ga0068856_1002131072 132
174 3300005614 Ga0068856_100223126 Ga0068856_1002231262 132
175 3300005614 Ga0068856_100512498 Ga0068856_1005124982 132
176 3300005614 Ga0068856_100578881 Ga0068856_1005788812 132
177 3300005614 Ga0068856_100655776 Ga0068856_1006557762 132
178 3300005615 Ga0070702_100031250 Ga0070702_1000312502 132
179 3300005615 Ga0070702_100401407 Ga0070702_1004014071 132
180 3300005616 Ga0068852_100014845 Ga0068852_1000148453 132
181 3300005616 Ga0068852_100143760 Ga0068852_1001437603 132
182 3300005616 Ga0068852_101290022 Ga0068852_1012900222 132
183 3300005616 Ga0068852_101471827 Ga0068852_1014718271 132
184 3300005617 Ga0068859_100011201 Ga0068859_1000112017 132
185 3300005617 Ga0068859_100060897 Ga0068859_1000608973 132
186 3300005718 Ga0068866_10004084 Ga0068866_100040846 132
187 3300005718 Ga0068866_10149670 Ga0068866_101496701 132
188 3300005719 Ga0068861_100012446 Ga0068861_1000124462 132
189 3300005719 Ga0068861_101181174 Ga0068861_1011811742 132
190 3300005834 Ga0068851_10419441 Ga0068851_104194412 132
191 3300005840 Ga0068870_10682419 Ga0068870_106824192 132
192 3300005842 Ga0068858_100089734 Ga0068858_1000897342 132
193 3300005842 Ga0068858_100742742 Ga0068858_1007427422 132
194 3300005843 Ga0068860_100079707 Ga0068860_1000797073 132
195 3300005843 Ga0068860_100096697 Ga0068860_1000966972 132
196 3300005843 Ga0068860_100099546 Ga0068860_1000995464 132
197 3300005843 Ga0068860_102070090 Ga0068860_1020700901 132
198 3300005844 Ga0068862_100002658 Ga0068862_10000265812 132
199 3300005844 Ga0068862_100245568 Ga0068862_1002455681 132
200 3300005844 Ga0068862_101232422 Ga0068862_1012324222 132
201 3300005937 Ga0081455_10000009 Ga0081455_10000009180 132
202 3300005937 Ga0081455_10007711 Ga0081455_100077119 132
203 3300005937 Ga0081455_10680515 Ga0081455_106805151 132
204 3300005983 Ga0081540_1027731 Ga0081540_10277312 132
205 3300006028 Ga0070717_10048664 Ga0070717_100486642 132
206 3300006028 Ga0070717_10106660 Ga0070717_101066602 132
207 3300006058 Ga0075432_10008112 Ga0075432_100081122 132
208 3300006058 Ga0075432_10042732 Ga0075432_100427322 132
209 3300006058 Ga0075432_10054797 Ga0075432_100547972 132
210 3300006163 Ga0070715_10291194 Ga0070715_102911941 132
211 3300006163 Ga0070715_10407091 Ga0070715_104070912 132
212 3300006173 Ga0070716_100186803 Ga0070716_1001868032 132
213 3300006175 Ga0070712_100159477 Ga0070712_1001594772 132
214 3300006175 Ga0070712_100169264 Ga0070712_1001692642 132
215 3300006175 Ga0070712_100467989 Ga0070712_1004679892 132
216 3300006175 Ga0070712_100620393 Ga0070712_1006203932 132
217 3300006175 Ga0070712_100794227 Ga0070712_1007942272 132
218 3300006194 Ga0075427_10001451 Ga0075427_100014513 132
219 3300006237 Ga0097621_100057274 Ga0097621_1000572743 132
220 3300006237 Ga0097621_100135984 Ga0097621_1001359842 132
221 3300006237 Ga0097621_101789411 Ga0097621_1017894111 132
222 3300006353 Ga0075370_10913201 Ga0075370_109132011 132
223 3300006358 Ga0068871_100024571 Ga0068871_1000245714 132
224 3300006844 Ga0075428_100015961 Ga0075428_1000159618 132
225 3300006846 Ga0075430_100002634 Ga0075430_1000026349 132
226 3300006847 Ga0075431_100003630 Ga0075431_1000036309 132
227 3300006852 Ga0075433_10000215 Ga0075433_100002158 132
228 3300006852 Ga0075433_10235105 Ga0075433_102351052 132
229 3300006871 Ga0075434_100001991 Ga0075434_1000019917 132
230 3300006871 Ga0075434_100059088 Ga0075434_1000590882 132
231 3300006880 Ga0075429_100002688 Ga0075429_1000026888 132
232 3300006880 Ga0075429_100924060 Ga0075429_1009240601 132
233 3300006881 Ga0068865_100810042 Ga0068865_1008100422 132
234 3300006914 Ga0075436_100184815 Ga0075436_1001848152 132
235 3300006914 Ga0075436_100264850 Ga0075436_1002648502 132
236 3300006931 Ga0097620_100011201 Ga0097620_1000112014 132
237 3300006931 Ga0097620_100060901 Ga0097620_1000609013 132
238 3300007076 Ga0075435_100007981 Ga0075435_1000079816 132
239 3300007076 Ga0075435_100066715 Ga0075435_1000667153 132
240 3300007076 Ga0075435_100218531 Ga0075435_1002185312 132
241 3300007076 Ga0075435_101134762 Ga0075435_1011347621 132
242 3300009011 Ga0105251_10056491 Ga0105251_100564912 132
243 3300009011 Ga0105251_10099896 Ga0105251_100998962 132
244 3300009093 Ga0105240_10066233 Ga0105240_100662332 132
245 3300009093 Ga0105240_10650210 Ga0105240_106502102 132
246 3300009093 Ga0105240_10926383 Ga0105240_109263831 132
247 3300009093 Ga0105240_11091847 Ga0105240_110918472 132
248 3300009094 Ga0111539_10001588 Ga0111539_1000158822 132
249 3300009094 Ga0111539_10008998 Ga0111539_100089988 132
250 3300009094 Ga0111539_10104213 Ga0111539_101042133 132
251 3300009094 Ga0111539_11555143 Ga0111539_115551432 132
252 3300009098 Ga0105245_10095625 Ga0105245_100956253 132
253 3300009098 Ga0105245_10261154 Ga0105245_102611542 132
254 3300009101 Ga0105247_10013175 Ga0105247_100131754 132
255 3300009101 Ga0105247_10078238 Ga0105247_100782383 132
256 3300009101 Ga0105247_10106779 Ga0105247_101067792 132
257 3300009101 Ga0105247_10185323 Ga0105247_101853232 132
258 3300009101 Ga0105247_10264520 Ga0105247_102645201 132
259 3300009147 Ga0114129_10008124 Ga0114129_100081248 132
260 3300009147 Ga0114129_10008445 Ga0114129_100084456 132
261 3300009148 Ga0105243_10137800 Ga0105243_101378002 132
262 3300009148 Ga0105243_10412734 Ga0105243_104127342 132
263 3300009148 Ga0105243_11222977 Ga0105243_112229772 132
264 3300009174 Ga0105241_10012702 Ga0105241_100127026 132
265 3300009174 Ga0105241_10059957 Ga0105241_100599575 132
266 3300009174 Ga0105241_10128270 Ga0105241_101282702 132
267 3300009176 Ga0105242_10004424 Ga0105242_100044249 132
268 3300009176 Ga0105242_10213652 Ga0105242_102136522 132
269 3300009176 Ga0105242_11161773 Ga0105242_111617732 132
270 3300009177 Ga0105248_10010513 Ga0105248_100105139 132
271 3300009177 Ga0105248_10098855 Ga0105248_100988552 132
272 3300009177 Ga0105248_10965915 Ga0105248_109659152 132
273 3300009545 Ga0105237_10014708 Ga0105237_100147088 132
274 3300009545 Ga0105237_10032544 Ga0105237_100325442 132
275 3300009545 Ga0105237_10075611 Ga0105237_100756112 132
276 3300009551 Ga0105238_10042664 Ga0105238_100426643 132
277 3300009551 Ga0105238_10128853 Ga0105238_101288532 132
278 3300009551 Ga0105238_10134227 Ga0105238_101342272 132
279 3300009551 Ga0105238_12620923 Ga0105238_126209231 132
280 3300009553 Ga0105249_10007257 Ga0105249_100072579 132
281 3300009553 Ga0105249_10063203 Ga0105249_100632032 132
282 3300010375 Ga0105239_10352838 Ga0105239_103528382 132
283 3300010375 Ga0105239_11088212 Ga0105239_110882122 132
284 3300011119 Ga0105246_10086388 Ga0105246_100863884 132
285 3300011119 Ga0105246_10144787 Ga0105246_101447872 132
286 3300012507 Ga0157342_1006506 Ga0157342_10065062 132
287 3300012510 Ga0157316_1086012 Ga0157316_10860122 132
288 3300012513 Ga0157326_1005229 Ga0157326_10052292 132
289 3300012515 Ga0157338_1002982 Ga0157338_10029821 132
290 3300013100 Ga0157373_10041889 Ga0157373_100418892 132
291 3300013102 Ga0157371_10030517 Ga0157371_100305173 132
292 3300013102 Ga0157371_10050502 Ga0157371_100505022 132
293 3300013102 Ga0157371_10067753 Ga0157371_100677534 132
294 3300013102 Ga0157371_10699682 Ga0157371_106996821 132
295 3300013104 Ga0157370_10103404 Ga0157370_101034042 132
296 3300013104 Ga0157370_10630457 Ga0157370_106304572 132
297 3300013105 Ga0157369_10299762 Ga0157369_102997622 132
298 3300013105 Ga0157369_10435835 Ga0157369_104358352 132
299 3300013105 Ga0157369_10792375 Ga0157369_107923752 132
300 3300013296 Ga0157374_10010431 Ga0157374_100104316 132
301 3300013296 Ga0157374_10377691 Ga0157374_103776912 132
302 3300013296 Ga0157374_10392179 Ga0157374_103921792 132
303 3300013296 Ga0157374_12774910 Ga0157374_127749101 132
304 3300013297 Ga0157378_10013910 Ga0157378_100139104 132
305 3300013297 Ga0157378_10208723 Ga0157378_102087232 132
306 3300013297 Ga0157378_10211096 Ga0157378_102110961 132
307 3300013297 Ga0157378_10298705 Ga0157378_102987052 132
308 3300013306 Ga0163162_10135662 Ga0163162_101356623 132
309 3300013306 Ga0163162_10179571 Ga0163162_101795712 132
310 3300013307 Ga0157372_10079573 Ga0157372_100795732 132
311 3300013307 Ga0157372_10273554 Ga0157372_102735542 132
312 3300013307 Ga0157372_10499287 Ga0157372_104992872 132
313 3300013308 Ga0157375_10032055 Ga0157375_100320552 132
314 3300013308 Ga0157375_10249621 Ga0157375_102496213 132
315 3300013308 Ga0157375_10849761 Ga0157375_108497612 132
316 3300014325 Ga0163163_10012423 Ga0163163_100124232 132
317 3300014325 Ga0163163_10013602 Ga0163163_100136024 132
318 3300014326 Ga0157380_10042945 Ga0157380_100429452 132
319 3300014745 Ga0157377_10000240 Ga0157377_100002402 132
320 3300014745 Ga0157377_10051480 Ga0157377_100514802 132
321 3300014968 Ga0157379_10005177 Ga0157379_100051772 132
322 3300014968 Ga0157379_10080639 Ga0157379_100806393 132
323 3300014968 Ga0157379_10090623 Ga0157379_100906234 132
324 3300014968 Ga0157379_11062064 Ga0157379_110620641 132
325 3300014968 Ga0157379_11755730 Ga0157379_117557301 132
326 3300014969 Ga0157376_10003312 Ga0157376_100033129 132
327 3300014969 Ga0157376_10083195 Ga0157376_100831952 132
328 3300014969 Ga0157376_10801883 Ga0157376_108018832 132
329 3300014969 Ga0157376_11050228 Ga0157376_110502282 132
330 3300017792 Ga0163161_10194928 Ga0163161_101949282 132
331 3300017792 Ga0163161_10318552 Ga0163161_103185521 132
332 3300020082 Ga0206353_10912259 Ga0206353_109122592 132
333 3300021384 Ga0213876_10099297 Ga0213876_100992972 132
334 3300021384 Ga0213876_10135708 Ga0213876_101357081 132
335 3300025271 Ga0207666_1002040 Ga0207666_10020402 132
336 3300025315 Ga0207697_10004957 Ga0207697_100049572 132
337 3300025885 Ga0207653_10003884 Ga0207653_100038844 132
338 3300025898 Ga0207692_10011972 Ga0207692_100119721 132
339 3300025898 Ga0207692_10016281 Ga0207692_100162812 132
340 3300025898 Ga0207692_10066772 Ga0207692_100667722 132
341 3300025898 Ga0207692_10248956 Ga0207692_102489562 132
342 3300025899 Ga0207642_10014306 Ga0207642_100143063 132
343 3300025900 Ga0207710_10026649 Ga0207710_100266492 132
344 3300025900 Ga0207710_10069084 Ga0207710_100690842 132
345 3300025901 Ga0207688_10019028 Ga0207688_100190284 132
346 3300025903 Ga0207680_10727632 Ga0207680_107276322 132
347 3300025904 Ga0207647_10037802 Ga0207647_100378023 132
348 3300025905 Ga0207685_10023862 Ga0207685_100238622 132
349 3300025906 Ga0207699_10004579 Ga0207699_100045792 132
350 3300025906 Ga0207699_10005624 Ga0207699_100056244 132
351 3300025906 Ga0207699_10105731 Ga0207699_101057312 132
352 3300025906 Ga0207699_10147340 Ga0207699_101473402 132
353 3300025907 Ga0207645_10048112 Ga0207645_100481122 132
354 3300025907 Ga0207645_10443135 Ga0207645_104431352 132
355 3300025907 Ga0207645_10744116 Ga0207645_107441162 132
356 3300025911 Ga0207654_10221302 Ga0207654_102213022 132
357 3300025912 Ga0207707_10007972 Ga0207707_100079722 132
358 3300025912 Ga0207707_10015798 Ga0207707_100157983 132
359 3300025912 Ga0207707_10074155 Ga0207707_100741551 132
360 3300025912 Ga0207707_10200543 Ga0207707_102005432 132
361 3300025912 Ga0207707_10229861 Ga0207707_102298611 132
362 3300025913 Ga0207695_10142546 Ga0207695_101425461 132
363 3300025913 Ga0207695_10604817 Ga0207695_106048173 132
364 3300025914 Ga0207671_10042353 Ga0207671_100423532 132
365 3300025914 Ga0207671_10347525 Ga0207671_103475252 132
366 3300025915 Ga0207693_10027515 Ga0207693_100275152 132
367 3300025915 Ga0207693_10180346 Ga0207693_101803462 132
368 3300025915 Ga0207693_10210845 Ga0207693_102108452 132
369 3300025915 Ga0207693_10284603 Ga0207693_102846032 132
370 3300025915 Ga0207693_10653159 Ga0207693_106531592 132
371 3300025916 Ga0207663_10016764 Ga0207663_100167643 132
372 3300025916 Ga0207663_10060759 Ga0207663_100607592 132
373 3300025916 Ga0207663_10066265 Ga0207663_100662652 132
374 3300025916 Ga0207663_10204796 Ga0207663_102047962 132
375 3300025916 Ga0207663_10433102 Ga0207663_104331021 132
376 3300025916 Ga0207663_10587971 Ga0207663_105879712 132
377 3300025916 Ga0207663_10887062 Ga0207663_108870621 132
378 3300025916 Ga0207663_11355244 Ga0207663_113552442 132
379 3300025917 Ga0207660_10025258 Ga0207660_100252583 132
380 3300025917 Ga0207660_10031041 Ga0207660_100310412 132
381 3300025917 Ga0207660_10038443 Ga0207660_100384432 132
382 3300025917 Ga0207660_10243304 Ga0207660_102433042 132
383 3300025917 Ga0207660_10254838 Ga0207660_102548381 132
384 3300025917 Ga0207660_10584368 Ga0207660_105843681 132
385 3300025918 Ga0207662_10008126 Ga0207662_100081267 132
386 3300025918 Ga0207662_10010377 Ga0207662_100103772 132
387 3300025918 Ga0207662_10136862 Ga0207662_101368622 132
388 3300025919 Ga0207657_10013699 Ga0207657_100136996 132
389 3300025919 Ga0207657_10024313 Ga0207657_100243134 132
390 3300025919 Ga0207657_10037506 Ga0207657_100375062 132
391 3300025919 Ga0207657_10038255 Ga0207657_100382555 132
392 3300025919 Ga0207657_10233000 Ga0207657_102330002 132
393 3300025919 Ga0207657_10350272 Ga0207657_103502722 132
394 3300025920 Ga0207649_10260613 Ga0207649_102606132 132
395 3300025920 Ga0207649_10755619 Ga0207649_107556192 132
396 3300025921 Ga0207652_10021283 Ga0207652_100212834 132
397 3300025921 Ga0207652_10021687 Ga0207652_100216872 132
398 3300025921 Ga0207652_10088833 Ga0207652_100888332 132
399 3300025921 Ga0207652_10335404 Ga0207652_103354042 132
400 3300025922 Ga0207646_10416498 Ga0207646_104164982 132
401 3300025923 Ga0207681_10067102 Ga0207681_100671022 132
402 3300025924 Ga0207694_10598258 Ga0207694_105982582 132
403 3300025925 Ga0207650_10032643 Ga0207650_100326433 132
404 3300025925 Ga0207650_10089960 Ga0207650_100899602 132
405 3300025925 Ga0207650_10228704 Ga0207650_102287042 132
406 3300025926 Ga0207659_10055540 Ga0207659_100555404 132
407 3300025927 Ga0207687_10159028 Ga0207687_101590281 132
408 3300025928 Ga0207700_10002272 Ga0207700_100022722 132
409 3300025928 Ga0207700_10246304 Ga0207700_102463042 132
410 3300025928 Ga0207700_10298168 Ga0207700_102981682 132
411 3300025929 Ga0207664_10083642 Ga0207664_100836421 132
412 3300025929 Ga0207664_10085037 Ga0207664_100850372 132
413 3300025929 Ga0207664_10092615 Ga0207664_100926153 132
414 3300025929 Ga0207664_10345365 Ga0207664_103453652 132
415 3300025931 Ga0207644_10014800 Ga0207644_100148004 132
416 3300025931 Ga0207644_10561439 Ga0207644_105614392 132
417 3300025932 Ga0207690_10198092 Ga0207690_101980922 132
418 3300025932 Ga0207690_11186755 Ga0207690_111867552 132
419 3300025933 Ga0207706_10012224 Ga0207706_100122245 132
420 3300025933 Ga0207706_10040156 Ga0207706_100401564 132
421 3300025933 Ga0207706_10355946 Ga0207706_103559462 132
422 3300025933 Ga0207706_10914411 Ga0207706_109144112 132
423 3300025934 Ga0207686_10032361 Ga0207686_100323613 132
424 3300025934 Ga0207686_10242797 Ga0207686_102427972 132
425 3300025935 Ga0207709_10160658 Ga0207709_101606582 132
426 3300025935 Ga0207709_10262764 Ga0207709_102627642 132
427 3300025935 Ga0207709_10922031 Ga0207709_109220311 132
428 3300025936 Ga0207670_10219884 Ga0207670_102198843 132
429 3300025936 Ga0207670_11001045 Ga0207670_110010452 132
430 3300025937 Ga0207669_10188652 Ga0207669_101886522 132
431 3300025937 Ga0207669_10255890 Ga0207669_102558901 132
432 3300025937 Ga0207669_10426675 Ga0207669_104266752 132
433 3300025938 Ga0207704_10055382 Ga0207704_100553821 132
434 3300025938 Ga0207704_10363737 Ga0207704_103637372 132
435 3300025939 Ga0207665_10001471 Ga0207665_1000147117 132
436 3300025939 Ga0207665_10084415 Ga0207665_100844152 132
437 3300025940 Ga0207691_10168625 Ga0207691_101686251 132
438 3300025940 Ga0207691_10204014 Ga0207691_102040142 132
439 3300025940 Ga0207691_10279728 Ga0207691_102797282 132
440 3300025941 Ga0207711_10053237 Ga0207711_100532373 132
441 3300025941 Ga0207711_10076219 Ga0207711_100762194 132
442 3300025941 Ga0207711_10941853 Ga0207711_109418532 132
443 3300025942 Ga0207689_10199835 Ga0207689_101998352 132
444 3300025942 Ga0207689_10290770 Ga0207689_102907702 132
445 3300025944 Ga0207661_10152218 Ga0207661_101522182 132
446 3300025944 Ga0207661_10244868 Ga0207661_102448682 132
447 3300025945 Ga0207679_10345753 Ga0207679_103457532 132
448 3300025945 Ga0207679_10659465 Ga0207679_106594652 132
449 3300025945 Ga0207679_10762004 Ga0207679_107620041 132
450 3300025949 Ga0207667_10130869 Ga0207667_101308693 132
451 3300025949 Ga0207667_10539762 Ga0207667_105397622 132
452 3300025949 Ga0207667_10551166 Ga0207667_105511662 132
453 3300025949 Ga0207667_11088897 Ga0207667_110888972 132
454 3300025949 Ga0207667_11896952 Ga0207667_118969521 132
455 3300025960 Ga0207651_10019390 Ga0207651_100193902 132
456 3300025960 Ga0207651_10914355 Ga0207651_109143551 132
457 3300025961 Ga0207712_10809637 Ga0207712_108096372 132
458 3300025972 Ga0207668_10407432 Ga0207668_104074321 132
459 3300025981 Ga0207640_10549423 Ga0207640_105494231 132
460 3300025981 Ga0207640_11746005 Ga0207640_117460051 132
461 3300025986 Ga0207658_10151064 Ga0207658_101510642 132
462 3300025986 Ga0207658_10182302 Ga0207658_101823022 132
463 3300025986 Ga0207658_10322345 Ga0207658_103223452 132
464 3300025986 Ga0207658_10846736 Ga0207658_108467361 132
465 3300026035 Ga0207703_10177361 Ga0207703_101773612 132
466 3300026035 Ga0207703_10697962 Ga0207703_106979622 132
467 3300026041 Ga0207639_10426935 Ga0207639_104269352 132
468 3300026041 Ga0207639_10702978 Ga0207639_107029781 132
469 3300026041 Ga0207639_11333068 Ga0207639_113330682 132
470 3300026067 Ga0207678_10013090 Ga0207678_100130905 132
471 3300026067 Ga0207678_10037906 Ga0207678_100379061 132
472 3300026075 Ga0207708_10005734 Ga0207708_100057346 132
473 3300026075 Ga0207708_10655696 Ga0207708_106556962 132
474 3300026078 Ga0207702_10161179 Ga0207702_101611792 132
475 3300026078 Ga0207702_10446922 Ga0207702_104469222 132
476 3300026078 Ga0207702_11127662 Ga0207702_111276622 132
477 3300026078 Ga0207702_11131617 Ga0207702_111316171 132
478 3300026089 Ga0207648_10013903 Ga0207648_100139034 132
479 3300026089 Ga0207648_10078303 Ga0207648_100783032 132
480 3300026095 Ga0207676_10221629 Ga0207676_102216292 132
481 3300026095 Ga0207676_10292169 Ga0207676_102921692 132
482 3300026095 Ga0207676_10330084 Ga0207676_103300841 132
483 3300026116 Ga0207674_10115242 Ga0207674_101152423 132
484 3300026118 Ga0207675_100026434 Ga0207675_1000264342 132
485 3300026118 Ga0207675_100044811 Ga0207675_1000448112 132
486 3300026118 Ga0207675_100649183 Ga0207675_1006491832 132
487 3300026121 Ga0207683_10000637 Ga0207683_100006372 132
488 3300026121 Ga0207683_10003484 Ga0207683_100034847 132
489 3300026121 Ga0207683_10221944 Ga0207683_102219442 132
490 3300026121 Ga0207683_10701901 Ga0207683_107019011 132
491 3300026142 Ga0207698_10099642 Ga0207698_100996422 132
492 3300026142 Ga0207698_10141023 Ga0207698_101410233 132
493 3300026142 Ga0207698_10954587 Ga0207698_109545871 132
494 3300026142 Ga0207698_11144337 Ga0207698_111443372 132
495 3300027360 Ga0209969_1029322 Ga0209969_10293222 132
496 3300027552 Ga0209982_1063422 Ga0209982_10634221 132
497 3300027617 Ga0210002_1018275 Ga0210002_10182751 132
498 3300027695 Ga0209966_1002882 Ga0209966_10028825 132
499 3300027717 Ga0209998_10001644 Ga0209998_100016443 132
500 3300027717 Ga0209998_10002534 Ga0209998_100025342 132
501 3300027866 Ga0209813_10184459 Ga0209813_101844592 132
502 3300027876 Ga0209974_10011146 Ga0209974_100111463 132
503 3300027876 Ga0209974_10032112 Ga0209974_100321122 132
504 3300027907 Ga0207428_10000216 Ga0207428_1000021676 132
505 3300027907 Ga0207428_10003413 Ga0207428_100034134 132
506 3300027907 Ga0207428_10441756 Ga0207428_104417562 132
507 3300028379 Ga0268266_10073574 Ga0268266_100735742 132
508 3300028381 Ga0268264_10021057 Ga0268264_100210574 132
509 3300028381 Ga0268264_10035058 Ga0268264_100350583 132
510 3300028381 Ga0268264_10266637 Ga0268264_102666372 132
511 3300028556 Ga0265337_1006048 Ga0265337_10060484 132
512 3300028800 Ga0265338_10019445 Ga0265338_100194456 132
513 3300028800 Ga0265338_10370517 Ga0265338_103705172 132
514 3300029957 Ga0265324_10057089 Ga0265324_100570892 132
515 3300031235 Ga0265330_10009349 Ga0265330_100093495 132
516 3300031238 Ga0265332_10193662 Ga0265332_101936621 132
517 3300031241 Ga0265325_10000048 Ga0265325_1000004839 132
518 3300031241 Ga0265325_10002795 Ga0265325_100027953 132
519 3300031247 Ga0265340_10294916 Ga0265340_102949162 132
520 3300031249 Ga0265339_10092760 Ga0265339_100927602 132
521 3300031249 Ga0265339_10253327 Ga0265339_102533272 132
522 3300031249 Ga0265339_10422707 Ga0265339_104227071 132
523 3300031344 Ga0265316_10304513 Ga0265316_103045131 132
524 3300031548 Ga0307408_101593076 Ga0307408_1015930761 132
525 3300031595 Ga0265313_10001040 Ga0265313_1000104019 132
526 3300031595 Ga0265313_10062629 Ga0265313_100626291 132
527 3300031595 Ga0265313_10072518 Ga0265313_100725182 132
528 3300031595 Ga0265313_10104320 Ga0265313_101043201 132
529 3300031711 Ga0265314_10012970 Ga0265314_100129707 132
530 3300031711 Ga0265314_10013779 Ga0265314_100137792 132
531 3300031711 Ga0265314_10107338 Ga0265314_101073381 132
532 3300031712 Ga0265342_10001167 Ga0265342_1000116725 132
533 3300031712 Ga0265342_10038412 Ga0265342_100384122 132
534 3300032002 Ga0307416_101348522 Ga0307416_1013485222 132
535 3300032002 Ga0307416_101488664 Ga0307416_1014886642 132
536 3300034816 Ga0373930_0000195 Ga0373930_0000195_6736_7134 132
537 3300034817 Ga0373948_0000184 Ga0373948_0000184_4984_5382 132
538 3300034817 Ga0373948_0002050 Ga0373948_0002050_226_624 132
539 3300034817 Ga0373948_0080489 Ga0373948_0080489_46_444 132
540 3300034819 Ga0373958_0000536 Ga0373958_0000536_453_851 132
541 3300034819 Ga0373958_0017470 Ga0373958_0017470_636_1034 132
542 3300034819 Ga0373958_0112284 Ga0373958_0112284_146_544 132
543 3300034957 Ga0373938_0000244 Ga0373938_0000244_2362_2760 132
544 3300034957 Ga0373938_0003184 Ga0373938_0003184_1837_2235 132
545 3300035083 Ga0373926_0238562 Ga0373926_0238562_247_645 132
546 3300035084 Ga0373928_0000913 Ga0373928_0000913_3921_4319 132
547 3300035084 Ga0373928_0015463 Ga0373928_0015463_601_999 132
548 3300035084 Ga0373928_0030076 Ga0373928_0030076_565_963 132
549 3300035085 Ga0373929_0000485 Ga0373929_0000485_2353_2751 132
550 3300035086 Ga0373934_0056483 Ga0373934_0056483_104_502 132
551 3300035088 Ga0373940_0003410 Ga0373940_0003410_2004_2402 132
552 3300035089 Ga0373944_0003351 Ga0373944_0003351_1873_2271 132
553 3300035089 Ga0373944_0129726 Ga0373944_0129726_196_594 132
554 3300035090 Ga0373949_0001916 Ga0373949_0001916_5148_5546 132
555 3300035091 Ga0373951_0000488 Ga0373951_0000488_378_776 132
556 3300035091 Ga0373951_0006475 Ga0373951_0006475_1836_2234 132
557 3300035091 Ga0373951_0009239 Ga0373951_0009239_1378_1776 132
558 3300035091 Ga0373951_0013143 Ga0373951_0013143_209_607 132
559 3300035092 Ga0373952_0013828 Ga0373952_0013828_556_954 132
560 3300035092 Ga0373952_0014806 Ga0373952_0014806_768_1166 132
561 3300035111 Ga0373923_0006436 Ga0373923_0006436_1621_2019 132
562 3300035111 Ga0373923_0037821 Ga0373923_0037821_1192_1590 132
563 3300035111 Ga0373923_0053042 Ga0373923_0053042_257_661 132
564 3300035111 Ga0373923_0152950 Ga0373923_0152950_436_834 132
565 3300035111 Ga0373923_0277459 Ga0373923_0277459_104_502 132
566 3300035112 Ga0373932_0000474 Ga0373932_0000474_8921_9319 132
567 3300035112 Ga0373932_0010986 Ga0373932_0010986_47_445 132
568 3300035113 Ga0373936_0001095 Ga0373936_0001095_2523_2921 132
569 3300035113 Ga0373936_0423109 Ga0373936_0423109_59_457 132
570 3300035114 Ga0373939_0003026 Ga0373939_0003026_2350_2748 132
571 3300035114 Ga0373939_0009971 Ga0373939_0009971_1077_1481 132
572 3300035114 Ga0373939_0036871 Ga0373939_0036871_396_794 132
573 3300035115 Ga0373941_0000598 Ga0373941_0000598_4631_5029 132
574 3300035115 Ga0373941_0001282 Ga0373941_0001282_2429_2827 132
575 3300035115 Ga0373941_0031575 Ga0373941_0031575_675_1073 132
576 3300035116 Ga0373945_0004964 Ga0373945_0004964_1976_2374 132
577 3300035116 Ga0373945_0064074 Ga0373945_0064074_688_1086 132
578 3300035117 Ga0373953_0045167 Ga0373953_0045167_1011_1409 132
579 3300035117 Ga0373953_0329677 Ga0373953_0329677_132_530 132
580 3300035118 Ga0373954_0001049 Ga0373954_0001049_4177_4575 132
581 3300035118 Ga0373954_0007478 Ga0373954_0007478_1467_1865 132
582 3300035118 Ga0373954_0022383 Ga0373954_0022383_186_590 132
583 3300035118 Ga0373954_0145592 Ga0373954_0145592_123_521 132
584 3300035119 Ga0373956_0012907 Ga0373956_0012907_647_1045 132
585 3300035119 Ga0373956_0027704 Ga0373956_0027704_1798_2196 132
586 3300035119 Ga0373956_0225722 Ga0373956_0225722_248_652 132
587 3300035120 Ga0373957_0048717 Ga0373957_0048717_15_413 132
588 3300035120 Ga0373957_0105672 Ga0373957_0105672_415_813 132
589 3300035120 Ga0373957_0184433 Ga0373957_0184433_427_825 132
590 3300035121 Ga0373960_0002102 Ga0373960_0002102_363_761 132
591 3300035121 Ga0373960_0010943 Ga0373960_0010943_586_984 132
592 3300035121 Ga0373960_0140885 Ga0373960_0140885_408_806 132
593 3300035170 Ga0373943_0007130 Ga0373943_0007130_2796_3194 132
594 3300035170 Ga0373943_0308913 Ga0373943_0308913_95_493 132
595 3300035170 Ga0373943_0430409 Ga0373943_0430409_156_554 132
596 3300035171 Ga0373946_0162633 Ga0373946_0162633_34_516 132
597 3300035171 Ga0373946_0162920 Ga0373946_0162920_604_1002 132
598 3300035171 Ga0373946_0202778 Ga0373946_0202778_129_527 132
599 3300035172 Ga0373955_0002451 Ga0373955_0002451_1069_1473 132
600 3300035172 Ga0373955_0004483 Ga0373955_0004483_5627_6025 132
601 3300035172 Ga0373955_0028546 Ga0373955_0028546_101_499 132
602 3300035172 Ga0373955_0038348 Ga0373955_0038348_637_1035 132
603 3300035172 Ga0373955_0374197 Ga0373955_0374197_456_854 132
604 3300035207 Ga0373942_0012221 Ga0373942_0012221_1550_1948 132
605 3300035241 Ga0373961_0010502 Ga0373961_0010502_1462_1860 132
606 3300035241 Ga0373961_0044103 Ga0373961_0044103_247_645 132
607 3300035242 Ga0373962_0001456 Ga0373962_0001456_3173_3571 132
608 3300035410 Ga0373924_0012343 Ga0373924_0012343_2669_3067 132
609 3300035410 Ga0373924_0053727 Ga0373924_0053727_1144_1542 132
610 3300035691 Ga0373931_0006069 Ga0373931_0006069_1278_1676 132
611 3300035691 Ga0373931_0058742 Ga0373931_0058742_1267_1665 132
612 3300035691 Ga0373931_0078670 Ga0373931_0078670_553_951 132
613 3300035691 Ga0373931_0202490 Ga0373931_0202490_622_1020 132
614 3300035692 Ga0373935_0047238 Ga0373935_0047238_391_789 132
615 3300035692 Ga0373935_0154529 Ga0373935_0154529_811_1209 132
616 3300035692 Ga0373935_0217937 Ga0373935_0217937_456_854 132
617 3300035695 Ga0373927_0004039 Ga0373927_0004039_2203_2601 132
618 3300035695 Ga0373927_0236385 Ga0373927_0236385_375_773 132
619 3300035724 Ga0373933_0004781 Ga0373933_0004781_5773_6177 132
620 3300035724 Ga0373933_0006526 Ga0373933_0006526_826_1224 132
621 3300035724 Ga0373933_0012091 Ga0373933_0012091_2515_2913 132
622 3300035724 Ga0373933_0072025 Ga0373933_0072025_1142_1540 132
623 3300035725 Ga0373947_0006399 Ga0373947_0006399_5859_6341 132
624 3300035725 Ga0373947_0073431 Ga0373947_0073431_1312_1710 132
625 3300035725 Ga0373947_0322930 Ga0373947_0322930_444_842 132
626 3300036401 Ga0373937_0001398 Ga0373937_0001398_16094_16492 132
627 3300036401 Ga0373937_0005069 Ga0373937_0005069_7457_7855 132
628 3300036401 Ga0373937_0020720 Ga0373937_0020720_4930_5328 132
629 3300036401 Ga0373937_0040141 Ga0373937_0040141_1747_2145 132
630 3300037068 Ga0373925_0011839 Ga0373925_0011839_3044_3442 132
631 3300037068 Ga0373925_0014118 Ga0373925_0014118_4960_5442 132
632 3300037068 Ga0373925_0076162 Ga0373925_0076162_1941_2339 132
633 3300037068 Ga0373925_0101464 Ga0373925_0101464_729_1127 132
634 3300037068 Ga0373925_1293294 Ga0373925_1293294_134_532 132
635 3300039437 Ga0436365_0078382 Ga0436365_0078382_1313_1711 132
636 3300039437 Ga0436365_0274005 Ga0436365_0274005_862_1260 132
637 3300039437 Ga0436365_1041486 Ga0436365_1041486_832_1230 132
638 3300039438 Ga0436360_0486235 Ga0436360_0486235_122_520 132
639 3300039447 Ga0436361_0180502 Ga0436361_0180502_392_790 132
640 3300039447 Ga0436361_0891923 Ga0436361_0891923_47_445 132
641 3300039450 Ga0436363_0783221 Ga0436363_0783221_764_1162 132
642 3300039453 Ga0436362_0716023 Ga0436362_0716023_415_813 132
643 3300042005 Ga0439448_0011374 Ga0439448_0011374_908_1306 132
644 3300042005 Ga0439448_0086178 Ga0439448_0086178_556_954 132
645 3300042012 Ga0439455_0025023 Ga0439455_0025023_730_1128 132
646 3300042016 Ga0439463_027721 Ga0439463_027721_485_883 132
647 3300042016 Ga0439463_075937 Ga0439463_075937_59_457 132
648 3300042437 Ga0439444_0155412 Ga0439444_0155412_45_443 132
649 3300042439 Ga0439464_0043449 Ga0439464_0043449_471_869 132
650 3300042876 Ga0451577_0379689 Ga0451577_0379689_640_1038 132
651 3300044673 Ga0453683_0663487 Ga0453683_0663487_93_491 132
652 3300044694 Ga0466963_0886681 Ga0466963_0886681_27_428 132
653 3300044842 Ga0466957_0272386 Ga0466957_0272386_272_670 132
654 3300045051 Ga0451576_0013929 Ga0451576_0013929_4362_4760 132
655 3300045976 Ga0466967_2175979 Ga0466967_2175979_35_433 132
656 3300046452 Ga0495617_171132 Ga0495617_171132_133_531 132
657 3300046454 Ga0495592_0013463 Ga0495592_0013463_5518_5916 132
658 3300046454 Ga0495592_0033058 Ga0495592_0033058_2858_3256 132
659 3300046454 Ga0495592_0113605 Ga0495592_0113605_1473_1871 132
660 3300046454 Ga0495592_0190898 Ga0495592_0190898_255_659 132
661 3300046454 Ga0495592_0453515 Ga0495592_0453515_230_628 132
662 3300046455 Ga0495603_0005357 Ga0495603_0005357_3490_3888 132
663 3300046455 Ga0495603_0050431 Ga0495603_0050431_1137_1535 132
664 3300046455 Ga0495603_0232151 Ga0495603_0232151_323_721 132
665 3300046459 Ga0495629_0059841 Ga0495629_0059841_2054_2452 132
666 3300046459 Ga0495629_0119732 Ga0495629_0119732_704_1102 132
667 3300046461 Ga0495641_0091367 Ga0495641_0091367_775_1173 132
668 3300046461 Ga0495641_0091740 Ga0495641_0091740_312_710 132
669 3300046462 Ga0495651_0003153 Ga0495651_0003153_10721_11119 132
670 3300046462 Ga0495651_0012826 Ga0495651_0012826_1121_1519 132
671 3300046463 Ga0495653_0001202 Ga0495653_0001202_8631_9029 132
672 3300046463 Ga0495653_0009980 Ga0495653_0009980_5364_5762 132
673 3300046472 Ga0495580_0004568 Ga0495580_0004568_1747_2145 132
674 3300046472 Ga0495580_0227886 Ga0495580_0227886_517_915 132
675 3300046472 Ga0495580_0327189 Ga0495580_0327189_367_849 132
676 3300046473 Ga0495582_0065925 Ga0495582_0065925_1119_1601 132
677 3300046475 Ga0495639_0002223 Ga0495639_0002223_6645_7043 132
678 3300046476 Ga0495662_0002421 Ga0495662_0002421_7905_8303 132
679 3300046476 Ga0495662_0021180 Ga0495662_0021180_188_586 132
680 3300046477 Ga0495664_0008194 Ga0495664_0008194_2521_2919 132
681 3300046477 Ga0495664_0009168 Ga0495664_0009168_4606_5004 132
682 3300046477 Ga0495664_0016181 Ga0495664_0016181_2528_2926 132
683 3300046491 Ga0495584_0013126 Ga0495584_0013126_2698_3096 132
684 3300046491 Ga0495584_0119623 Ga0495584_0119623_614_1012 132
685 3300046491 Ga0495584_0136805 Ga0495584_0136805_658_1056 132
686 3300046492 Ga0495585_0000995 Ga0495585_0000995_19458_19856 132
687 3300046499 Ga0495594_0003519 Ga0495594_0003519_263_661 132
688 3300046499 Ga0495594_0046647 Ga0495594_0046647_1357_1755 132
689 3300046501 Ga0495607_0013487 Ga0495607_0013487_732_1130 132
690 3300046511 Ga0495608_0000363 Ga0495608_0000363_27525_27923 132
691 3300046511 Ga0495608_0095348 Ga0495608_0095348_760_1158 132
692 3300046511 Ga0495608_0919995 Ga0495608_0919995_95_493 132
693 3300046514 Ga0495618_0001897 Ga0495618_0001897_4973_5371 132
694 3300046514 Ga0495618_0009777 Ga0495618_0009777_4185_4583 132
695 3300046516 Ga0495628_0001606 Ga0495628_0001606_2858_3256 132
696 3300046516 Ga0495628_0012443 Ga0495628_0012443_1695_2093 132
697 3300046516 Ga0495628_0305453 Ga0495628_0305453_718_1116 132
698 3300046516 Ga0495628_0661419 Ga0495628_0661419_98_502 132
699 3300046517 Ga0495630_0131028 Ga0495630_0131028_1346_1744 132
700 3300046517 Ga0495630_0768066 Ga0495630_0768066_44_442 132
701 3300046523 Ga0495644_0002021 Ga0495644_0002021_7747_8145 132
702 3300046525 Ga0495663_0026199 Ga0495663_0026199_1056_1454 132
703 3300046526 Ga0495666_0164251 Ga0495666_0164251_66_464 132
704 3300046529 Ga0495652_0002586 Ga0495652_0002586_16082_16480 132
705 3300046529 Ga0495652_0052019 Ga0495652_0052019_1894_2292 132
706 3300046529 Ga0495652_0328679 Ga0495652_0328679_429_827 132
707 3300046529 Ga0495652_0362400 Ga0495652_0362400_535_933 132
708 3300046529 Ga0495652_1006363 Ga0495652_1006363_89_487 132
709 3300046533 Ga0495640_0009382 Ga0495640_0009382_4358_4756 132
710 3300046533 Ga0495640_0023798 Ga0495640_0023798_3084_3482 132
711 3300046533 Ga0495640_0091974 Ga0495640_0091974_1570_1968 132
712 3300046533 Ga0495640_0100025 Ga0495640_0100025_1475_1873 132
713 3300046533 Ga0495640_0950387 Ga0495640_0950387_39_437 132
714 3300046535 Ga0495586_0167057 Ga0495586_0167057_491_889 132
715 3300046536 Ga0495587_0003533 Ga0495587_0003533_8288_8686 132
716 3300046536 Ga0495587_0008605 Ga0495587_0008605_2397_2795 132
717 3300046536 Ga0495587_0206520 Ga0495587_0206520_185_583 132
718 3300046536 Ga0495587_0251534 Ga0495587_0251534_335_739 132
719 3300046538 Ga0495609_0080934 Ga0495609_0080934_249_647 132
720 3300046538 Ga0495609_0205501 Ga0495609_0205501_320_718 132
721 3300046543 Ga0495645_0032742 Ga0495645_0032742_968_1366 132
722 3300046543 Ga0495645_0451690 Ga0495645_0451690_390_788 132
723 3300046543 Ga0495645_0743485 Ga0495645_0743485_113_511 132
724 3300046557 Ga0495622_0020475 Ga0495622_0020475_2524_2922 132
725 3300046557 Ga0495622_0043097 Ga0495622_0043097_1499_1897 132
726 3300046557 Ga0495622_0227494 Ga0495622_0227494_163_645 132
727 3300046558 Ga0495633_0009135 Ga0495633_0009135_3419_3817 132
728 3300046559 Ga0495667_0001863 Ga0495667_0001863_10861_11259 132
729 3300046559 Ga0495667_0002910 Ga0495667_0002910_4577_4975 132
730 3300046559 Ga0495667_0012561 Ga0495667_0012561_1331_1729 132
731 3300046559 Ga0495667_0019111 Ga0495667_0019111_3210_3614 132
732 3300046559 Ga0495667_0069747 Ga0495667_0069747_1803_2201 132
733 3300046559 Ga0495667_0165497 Ga0495667_0165497_996_1394 132
734 3300046615 Ga0495656_0011054 Ga0495656_0011054_2028_2426 132
735 3300046642 Ga0495634_0023444 Ga0495634_0023444_3620_4018 132
736 3300046642 Ga0495634_0114050 Ga0495634_0114050_947_1345 132
737 3300046642 Ga0495634_0257703 Ga0495634_0257703_93_491 132
738 3300046642 Ga0495634_0415384 Ga0495634_0415384_325_723 132
739 3300046648 Ga0495611_0550340 Ga0495611_0550340_97_495 132
740 3300046663 Ga0495635_0000730 Ga0495635_0000730_9805_10203 132
741 3300046663 Ga0495635_0030540 Ga0495635_0030540_3145_3543 132
742 3300046663 Ga0495635_0041243 Ga0495635_0041243_2463_2861 132
743 3300046663 Ga0495635_0088565 Ga0495635_0088565_1509_1913 132
744 3300046663 Ga0495635_0135391 Ga0495635_0135391_717_1115 132
745 3300046664 Ga0495659_0002692 Ga0495659_0002692_2158_2556 132
746 3300046674 Ga0495588_0001656 Ga0495588_0001656_8047_8445 132
747 3300046675 Ga0495657_0044286 Ga0495657_0044286_1307_1705 132
748 3300046675 Ga0495657_0045003 Ga0495657_0045003_2496_2894 132
749 3300046675 Ga0495657_0052229 Ga0495657_0052229_122_520 132
750 3300046678 Ga0495599_0003607 Ga0495599_0003607_4480_4878 132
751 3300046678 Ga0495599_0033518 Ga0495599_0033518_2776_3174 132
752 3300046678 Ga0495599_0498860 Ga0495599_0498860_196_594 132
753 3300046679 Ga0495623_0002343 Ga0495623_0002343_1546_1944 132
754 3300046679 Ga0495623_0435271 Ga0495623_0435271_209_607 132
755 3300046679 Ga0495623_0558491 Ga0495623_0558491_178_576 132
756 3300046680 Ga0495646_0042319 Ga0495646_0042319_393_791 132
757 3300046680 Ga0495646_0053119 Ga0495646_0053119_153_551 132
758 3300046681 Ga0495647_0000967 Ga0495647_0000967_2550_2948 132
759 3300046681 Ga0495647_0033610 Ga0495647_0033610_1428_1826 132
760 3300046681 Ga0495647_0349899 Ga0495647_0349899_34_432 132
761 3300046683 Ga0495658_0002102 Ga0495658_0002102_1982_2380 132
762 3300046683 Ga0495658_0174362 Ga0495658_0174362_408_806 132
763 3300046689 Ga0495613_0012394 Ga0495613_0012394_4592_4990 132
764 3300046689 Ga0495613_0082103 Ga0495613_0082103_424_822 132
765 3300046689 Ga0495613_0242328 Ga0495613_0242328_381_779 132
766 3300046689 Ga0495613_0267584 Ga0495613_0267584_194_592 132
767 3300046690 Ga0495624_0067799 Ga0495624_0067799_385_783 132
768 3300046690 Ga0495624_0070412 Ga0495624_0070412_155_553 132
769 3300046690 Ga0495624_0250181 Ga0495624_0250181_202_600 132
770 3300046809 Ga0495600_0000703 Ga0495600_0000703_15729_16127 132
771 3300046809 Ga0495600_0061545 Ga0495600_0061545_902_1306 132
772 3300046809 Ga0495600_0082623 Ga0495600_0082623_1116_1514 132
773 3300046809 Ga0495600_0170384 Ga0495600_0170384_569_967 132
774 3300046809 Ga0495600_0387519 Ga0495600_0387519_54_452 132
775 3300046809 Ga0495600_0608940 Ga0495600_0608940_245_643 132
776 3300047315 Ga0495581_0059282 Ga0495581_0059282_656_1054 132
777 3300047315 Ga0495581_0077256 Ga0495581_0077256_1266_1664 132
778 3300047315 Ga0495581_0438989 Ga0495581_0438989_12_494 132
779 3300047317 Ga0495604_0001606 Ga0495604_0001606_2648_3046 132
780 3300047317 Ga0495604_0017676 Ga0495604_0017676_2247_2645 132
781 3300047317 Ga0495604_0033728 Ga0495604_0033728_1938_2342 132
782 3300047317 Ga0495604_0072048 Ga0495604_0072048_261_659 132
783 3300047319 Ga0495674_0008713 Ga0495674_0008713_4016_4414 132
784 3300047319 Ga0495674_0008815 Ga0495674_0008815_3259_3657 132
785 3300047319 Ga0495674_0085519 Ga0495674_0085519_2202_2600 132
786 3300047319 Ga0495674_0101934 Ga0495674_0101934_49_447 132
787 3300047319 Ga0495674_0387766 Ga0495674_0387766_57_455 132
788 3300047321 Ga0495676_0234102 Ga0495676_0234102_826_1224 132
789 3300047321 Ga0495676_0316850 Ga0495676_0316850_260_658 132
790 3300047321 Ga0495676_0460952 Ga0495676_0460952_314_796 132
791 3300047322 Ga0495680_0003233 Ga0495680_0003233_1331_1729 132
792 3300047322 Ga0495680_0012545 Ga0495680_0012545_1337_1735 132
793 3300047322 Ga0495680_0023301 Ga0495680_0023301_4647_5045 132
794 3300047322 Ga0495680_0136433 Ga0495680_0136433_1052_1450 132
795 3300047322 Ga0495680_0204334 Ga0495680_0204334_170_652 132
796 3300047322 Ga0495680_0492068 Ga0495680_0492068_173_571 132
797 3300047444 Ga0495675_0002258 Ga0495675_0002258_2494_2892 132
798 3300047444 Ga0495675_0020910 Ga0495675_0020910_1974_2372 132
799 3300047444 Ga0495675_0136683 Ga0495675_0136683_454_858 132
800 3300047444 Ga0495675_0356515 Ga0495675_0356515_409_807 132
801 3300047445 Ga0495677_0029496 Ga0495677_0029496_527_925 132
802 3300047445 Ga0495677_0130107 Ga0495677_0130107_11_409 132
803 3300047471 Ga0495684_0000749 Ga0495684_0000749_23021_23419 132
804 3300047471 Ga0495684_0147471 Ga0495684_0147471_849_1247 132
805 3300047471 Ga0495684_0343079 Ga0495684_0343079_599_997 132
806 3300047471 Ga0495684_0535854 Ga0495684_0535854_30_428 132
807 3300047471 Ga0495684_0597452 Ga0495684_0597452_167_565 132
808 3300047673 Ga0495593_0028750 Ga0495593_0028750_382_864 132
809 3300047673 Ga0495593_0236985 Ga0495593_0236985_34_432 132
810 3300048088 Ga0495602_0006328 Ga0495602_0006328_9617_10015 132
811 3300048088 Ga0495602_0018809 Ga0495602_0018809_1638_2036 132
812 3300048088 Ga0495602_0050105 Ga0495602_0050105_3219_3623 132
813 3300048088 Ga0495602_0308040 Ga0495602_0308040_122_520 132
814 3300048089 Ga0495614_0175714 Ga0495614_0175714_203_685 132
815 3300048903 Ga0496100_0032026 Ga0496100_0032026_2752_3150 132
816 3300048903 Ga0496100_0190751 Ga0496100_0190751_846_1244 132
817 3300048903 Ga0496100_0599216 Ga0496100_0599216_21_419 132
818 3300048904 Ga0496101_0024419 Ga0496101_0024419_252_650 132
819 3300048904 Ga0496101_0033791 Ga0496101_0033791_2768_3166 132
820 3300048904 Ga0496101_0054158 Ga0496101_0054158_1517_1915 132
821 3300048904 Ga0496101_0107992 Ga0496101_0107992_142_540 132
822 3300048904 Ga0496101_0251885 Ga0496101_0251885_717_1115 132
823 3300048904 Ga0496101_0621902 Ga0496101_0621902_392_811 132
824 3300048904 Ga0496101_0623432 Ga0496101_0623432_11_409 132
825 3300048905 Ga0496102_0017443 Ga0496102_0017443_2719_3117 132
826 3300048905 Ga0496102_0052687 Ga0496102_0052687_2690_3088 132
827 3300048905 Ga0496102_0125349 Ga0496102_0125349_252_650 132
828 3300048905 Ga0496102_0142734 Ga0496102_0142734_1500_1898 132
829 3300048905 Ga0496102_0204308 Ga0496102_0204308_386_784 132
830 3300048905 Ga0496102_0210331 Ga0496102_0210331_789_1187 132
831 3300048905 Ga0496102_0972969 Ga0496102_0972969_211_609 132
832 3300048905 Ga0496102_1468756 Ga0496102_1468756_35_433 132
833 3300048906 Ga0496103_0044329 Ga0496103_0044329_1508_1906 132
834 3300048906 Ga0496103_0098323 Ga0496103_0098323_114_512 132
835 3300048906 Ga0496103_0121012 Ga0496103_0121012_422_820 132
836 3300048906 Ga0496103_0316085 Ga0496103_0316085_540_938 132
837 3300048907 Ga0496104_0001904 Ga0496104_0001904_11641_12045 132
838 3300048907 Ga0496104_0013010 Ga0496104_0013010_4261_4659 132
839 3300048907 Ga0496104_0084737 Ga0496104_0084737_849_1247 132
840 3300048907 Ga0496104_0159692 Ga0496104_0159692_455_853 132
841 3300048907 Ga0496104_0196151 Ga0496104_0196151_348_746 132
842 3300048907 Ga0496104_0209351 Ga0496104_0209351_940_1338 132
843 3300048907 Ga0496104_0515962 Ga0496104_0515962_209_607 132
844 3300048907 Ga0496104_0549804 Ga0496104_0549804_397_795 132
845 3300048908 Ga0496105_0002041 Ga0496105_0002041_4463_4867 132
846 3300048908 Ga0496105_0021534 Ga0496105_0021534_188_586 132
847 3300048909 Ga0496106_0010397 Ga0496106_0010397_3696_4094 132
848 3300048909 Ga0496106_0011583 Ga0496106_0011583_982_1380 132
849 3300048909 Ga0496106_0063855 Ga0496106_0063855_14_412 132
850 3300048909 Ga0496106_0188841 Ga0496106_0188841_739_1137 132
851 3300048909 Ga0496106_0668654 Ga0496106_0668654_184_582 132
852 3300048910 Ga0496107_0008549 Ga0496107_0008549_1844_2242 132
853 3300048910 Ga0496107_0028132 Ga0496107_0028132_2214_2612 132
854 3300048910 Ga0496107_0116088 Ga0496107_0116088_547_945 132
855 3300048910 Ga0496107_0139696 Ga0496107_0139696_231_629 132
856 3300048910 Ga0496107_0373942 Ga0496107_0373942_109_507 132
857 3300048911 Ga0496108_0013021 Ga0496108_0013021_3141_3539 132
858 3300048911 Ga0496108_0019320 Ga0496108_0019320_132_530 132
859 3300048911 Ga0496108_0033824 Ga0496108_0033824_2897_3295 132
860 3300048911 Ga0496108_0857521 Ga0496108_0857521_96_494 132
861 3300048912 Ga0496109_0023038 Ga0496109_0023038_2221_2619 132
862 3300048912 Ga0496109_0029705 Ga0496109_0029705_2855_3253 132
863 3300048912 Ga0496109_0158598 Ga0496109_0158598_29_427 132
864 3300048912 Ga0496109_0163060 Ga0496109_0163060_1040_1438 132
865 3300048912 Ga0496109_0776515 Ga0496109_0776515_343_741 132
866 3300048913 Ga0496110_0116236 Ga0496110_0116236_1144_1542 132
867 3300048913 Ga0496110_1051692 Ga0496110_1051692_184_582 132
868 3300048913 Ga0496110_1358607 Ga0496110_1358607_33_437 132
869 3300048914 Ga0496111_0009938 Ga0496111_0009938_2727_3125 132
870 3300048914 Ga0496111_0030686 Ga0496111_0030686_25_423 132
871 3300048914 Ga0496111_0195562 Ga0496111_0195562_211_609 132
872 3300048914 Ga0496111_0226342 Ga0496111_0226342_479_877 132
873 3300048914 Ga0496111_0630867 Ga0496111_0630867_345_743 132
874 3300048915 Ga0496112_0000520 Ga0496112_0000520_14031_14429 132
875 3300048915 Ga0496112_0525294 Ga0496112_0525294_690_1088 132
876 3300048915 Ga0496112_1497682 Ga0496112_1497682_113_511 132
877 3300048916 Ga0496113_0043070 Ga0496113_0043070_1801_2199 132
878 3300048916 Ga0496113_0325365 Ga0496113_0325365_669_1067 132
879 3300048916 Ga0496113_1153236 Ga0496113_1153236_175_573 132
880 3300048917 Ga0496114_0055845 Ga0496114_0055845_2664_3062 132
881 3300048917 Ga0496114_0088502 Ga0496114_0088502_295_693 132
882 3300048917 Ga0496114_0764433 Ga0496114_0764433_90_488 132
883 3300048918 Ga0496115_0040684 Ga0496115_0040684_2855_3253 132
884 3300048918 Ga0496115_0096831 Ga0496115_0096831_1389_1787 132
885 3300048918 Ga0496115_0113903 Ga0496115_0113903_1269_1667 132
886 3300048918 Ga0496115_0114999 Ga0496115_0114999_861_1259 132
887 3300048918 Ga0496115_0474907 Ga0496115_0474907_53_451 132
888 3300048918 Ga0496115_1051472 Ga0496115_1051472_79_477 132
889 3300048922 Ga0496119_0320688 Ga0496119_0320688_293_691 132
890 3300049568 Ga0501031_0123896 Ga0501031_0123896_18_416 132
891 3300049569 Ga0501032_0045575 Ga0501032_0045575_2293_2691 132
892 3300049569 Ga0501032_0059269 Ga0501032_0059269_273_671 132
893 3300049569 Ga0501032_0089571 Ga0501032_0089571_1286_1684 132
894 3300049569 Ga0501032_0288193 Ga0501032_0288193_557_955 132
895 3300049570 Ga0501033_0054944 Ga0501033_0054944_2115_2513 132
896 3300049570 Ga0501033_0076233 Ga0501033_0076233_289_687 132
897 3300049571 Ga0501034_0000211 Ga0501034_0000211_36584_36982 132
898 3300049571 Ga0501034_0003250 Ga0501034_0003250_11546_11944 132
899 3300049571 Ga0501034_0011273 Ga0501034_0011273_6280_6678 132
900 3300049571 Ga0501034_0114986 Ga0501034_0114986_1606_2004 132
901 3300049571 Ga0501034_0119188 Ga0501034_0119188_827_1225 132
902 3300049571 Ga0501034_0214617 Ga0501034_0214617_440_838 132
903 3300049571 Ga0501034_0398319 Ga0501034_0398319_100_498 132
904 3300049571 Ga0501034_0467470 Ga0501034_0467470_277_675 132
905 3300049571 Ga0501034_1169737 Ga0501034_1169737_67_465 132
906 3300049571 Ga0501034_1203019 Ga0501034_1203019_32_430 132
907 3300049572 Ga0501036_0012016 Ga0501036_0012016_6642_7040 132
908 3300049572 Ga0501036_0050002 Ga0501036_0050002_2819_3217 132
909 3300049572 Ga0501036_0455716 Ga0501036_0455716_495_893 132
910 3300049572 Ga0501036_0620044 Ga0501036_0620044_241_639 132
911 3300049573 Ga0501037_0002596 Ga0501037_0002596_6447_6845 132
912 3300049573 Ga0501037_0040990 Ga0501037_0040990_2656_3054 132
913 3300049573 Ga0501037_0057305 Ga0501037_0057305_1167_1565 132
914 3300049573 Ga0501037_0500297 Ga0501037_0500297_154_552 132
915 3300049573 Ga0501037_0781313 Ga0501037_0781313_220_618 132
916 3300049574 Ga0501038_0206825 Ga0501038_0206825_480_878 132
917 3300049574 Ga0501038_0582875 Ga0501038_0582875_270_668 132
918 3300049575 Ga0501039_0020522 Ga0501039_0020522_3971_4369 132
919 3300049575 Ga0501039_0437018 Ga0501039_0437018_509_907 132
920 3300049575 Ga0501039_0726494 Ga0501039_0726494_354_752 132
921 3300049576 Ga0501040_0662657 Ga0501040_0662657_136_534 132
922 3300049578 Ga0501042_0180698 Ga0501042_0180698_1004_1402 132
923 3300049579 Ga0501043_0061902 Ga0501043_0061902_1141_1539 132
924 3300049579 Ga0501043_0229418 Ga0501043_0229418_1024_1422 132
925 3300049579 Ga0501043_0319393 Ga0501043_0319393_504_902 132
926 3300049579 Ga0501043_0369987 Ga0501043_0369987_645_1043 132
927 3300049579 Ga0501043_0512022 Ga0501043_0512022_36_434 132
928 3300049580 Ga0501046_0119499 Ga0501046_0119499_1324_1722 132
929 3300049580 Ga0501046_0121205 Ga0501046_0121205_191_589 132
930 3300049580 Ga0501046_0174145 Ga0501046_0174145_67_465 132
931 3300049580 Ga0501046_0270306 Ga0501046_0270306_508_906 132
932 3300049580 Ga0501046_0571493 Ga0501046_0571493_26_424 132
933 3300049581 Ga0501047_0000010 Ga0501047_0000010_224998_225396 132
934 3300049581 Ga0501047_0076895 Ga0501047_0076895_458_859 132
935 3300049581 Ga0501047_0149451 Ga0501047_0149451_1120_1518 132
936 3300049581 Ga0501047_0184993 Ga0501047_0184993_1128_1526 132
937 3300049581 Ga0501047_0210335 Ga0501047_0210335_1332_1730 132
938 3300049581 Ga0501047_0325019 Ga0501047_0325019_81_479 132
939 3300049581 Ga0501047_0395446 Ga0501047_0395446_197_595 132
940 3300049582 Ga0501048_0000784 Ga0501048_0000784_16973_17371 132
941 3300049582 Ga0501048_0194801 Ga0501048_0194801_15_413 132
942 3300049582 Ga0501048_0329887 Ga0501048_0329887_85_483 132
943 3300049583 Ga0501067_0016880 Ga0501067_0016880_1448_1846 132
944 3300049583 Ga0501067_0044997 Ga0501067_0044997_1554_1952 132
945 3300049584 Ga0501068_0012136 Ga0501068_0012136_1898_2296 132
946 3300049584 Ga0501068_0027868 Ga0501068_0027868_1623_2021 132
947 3300049584 Ga0501068_0092452 Ga0501068_0092452_695_1093 132
948 3300049584 Ga0501068_1044995 Ga0501068_1044995_46_444 132
949 3300049585 Ga0501069_0021060 Ga0501069_0021060_2094_2492 132
950 3300049585 Ga0501069_0030179 Ga0501069_0030179_1446_1844 132
951 3300049585 Ga0501069_0183300 Ga0501069_0183300_653_1051 132
952 3300049585 Ga0501069_0424322 Ga0501069_0424322_108_506 132
953 3300049586 Ga0501070_0012798 Ga0501070_0012798_6166_6564 132
954 3300049586 Ga0501070_0036167 Ga0501070_0036167_3078_3476 132
955 3300049586 Ga0501070_0077077 Ga0501070_0077077_1334_1732 132
956 3300049586 Ga0501070_0080055 Ga0501070_0080055_2193_2591 132
957 3300049586 Ga0501070_0157256 Ga0501070_0157256_636_1034 132
958 3300049586 Ga0501070_0174968 Ga0501070_0174968_668_1066 132
959 3300049586 Ga0501070_0407204 Ga0501070_0407204_207_605 132
960 3300049586 Ga0501070_0425188 Ga0501070_0425188_223_621 132
961 3300049586 Ga0501070_0488897 Ga0501070_0488897_57_455 132
962 3300049587 Ga0501071_0101832 Ga0501071_0101832_1476_1874 132
963 3300049587 Ga0501071_0616289 Ga0501071_0616289_197_595 132
964 3300049588 Ga0501072_0023227 Ga0501072_0023227_2647_3045 132
965 3300049588 Ga0501072_0161503 Ga0501072_0161503_1143_1541 132
966 3300049588 Ga0501072_0256878 Ga0501072_0256878_225_623 132
967 3300049588 Ga0501072_0541175 Ga0501072_0541175_49_447 132
968 3300049589 Ga0501073_0011704 Ga0501073_0011704_367_765 132
969 3300049589 Ga0501073_0026355 Ga0501073_0026355_3426_3824 132
970 3300049589 Ga0501073_0063098 Ga0501073_0063098_834_1232 132
971 3300049589 Ga0501073_0200807 Ga0501073_0200807_651_1049 132
972 3300049589 Ga0501073_0590934 Ga0501073_0590934_40_438 132
973 3300049589 Ga0501073_0880959 Ga0501073_0880959_59_457 132
974 3300049590 Ga0501074_0015467 Ga0501074_0015467_268_666 132
975 3300049590 Ga0501074_0026995 Ga0501074_0026995_2992_3390 132
976 3300049590 Ga0501074_0188316 Ga0501074_0188316_1034_1432 132
977 3300049590 Ga0501074_0210681 Ga0501074_0210681_633_1031 132
978 3300049590 Ga0501074_1043945 Ga0501074_1043945_10_408 132
979 3300049591 Ga0501075_0151608 Ga0501075_0151608_1167_1565 132
980 3300049592 Ga0501076_0210029 Ga0501076_0210029_1157_1555 132
981 3300049592 Ga0501076_1351611 Ga0501076_1351611_28_426 132
982 3300049593 Ga0501077_0023345 Ga0501077_0023345_1367_1765 132
983 3300049593 Ga0501077_0259530 Ga0501077_0259530_243_659 132
984 3300049741 Ga0501079_0001490 Ga0501079_0001490_10990_11388 132
985 3300049741 Ga0501079_0705058 Ga0501079_0705058_260_658 132
986 3300049742 Ga0501080_0090573 Ga0501080_0090573_1801_2199 132
987 3300049742 Ga0501080_0124247 Ga0501080_0124247_98_496 132
988 3300049742 Ga0501080_0125376 Ga0501080_0125376_1624_2022 132
989 3300049742 Ga0501080_0151953 Ga0501080_0151953_1614_2012 132
990 3300049742 Ga0501080_0376510 Ga0501080_0376510_443_841 132
991 3300049742 Ga0501080_0795918 Ga0501080_0795918_292_690 132
992 3300049743 Ga0501081_0338156 Ga0501081_0338156_151_549 132
993 3300049744 Ga0501083_0009626 Ga0501083_0009626_68_466 132
994 3300049744 Ga0501083_0129901 Ga0501083_0129901_79_477 132
995 3300049744 Ga0501083_0374712 Ga0501083_0374712_488_886 132
996 3300049822 Ga0501035_0002108 Ga0501035_0002108_16054_16452 132
997 3300049822 Ga0501035_0025158 Ga0501035_0025158_188_586 132
998 3300049822 Ga0501035_0257687 Ga0501035_0257687_452_850 132
999 3300049822 Ga0501035_0398980 Ga0501035_0398980_389_787 132
1000 3300049822 Ga0501035_0584438 Ga0501035_0584438_73_474 132
1001 3300049822 Ga0501035_0904897 Ga0501035_0904897_259_657 132
1002 3300049823 Ga0501044_0086065 Ga0501044_0086065_970_1368 132
1003 3300049823 Ga0501044_0422395 Ga0501044_0422395_530_928 132
1004 3300049823 Ga0501044_0689648 Ga0501044_0689648_301_699 132
1005 3300049824 Ga0501045_0549322 Ga0501045_0549322_230_628 132
1006 3300049824 Ga0501045_0600342 Ga0501045_0600342_158_556 132
1007 3300050490 nmdc:mga03n38_471280_c1 nmdc:mga03n38_471280_c1_168_566 132
1008 3300050494 nmdc:mga06z11_11064_c1 nmdc:mga06z11_11064_c1_3082_3480 132
1009 3300050494 nmdc:mga06z11_622479_c1 nmdc:mga06z11_622479_c1_62_460 132
1010 3300050507 nmdc:mga05p37_3652_c1 nmdc:mga05p37_3652_c1_10008_10406 132
1011 3300050507 nmdc:mga05p37_5580_c1 nmdc:mga05p37_5580_c1_5941_6339 132
1012 3300050508 nmdc:mga09592_1558720_c1 nmdc:mga09592_1558720_c1_93_491 132
1013 3300050508 nmdc:mga09592_714_c1 nmdc:mga09592_714_c1_15979_16377 132
1014 3300050509 nmdc:mga0qj67_1449_c1 nmdc:mga0qj67_1449_c1_5365_5763 132
1015 3300050510 nmdc:mga06r32_1863_c1 nmdc:mga06r32_1863_c1_4046_4444 132
1016 3300050511 nmdc:mga08y16_1194501_c1 nmdc:mga08y16_1194501_c1_232_630 132
1017 3300050511 nmdc:mga08y16_1350709_c1 nmdc:mga08y16_1350709_c1_156_554 132
1018 3300050511 nmdc:mga08y16_3547_c1 nmdc:mga08y16_3547_c1_10440_10838 132
1019 3300050511 nmdc:mga08y16_3652_c1 nmdc:mga08y16_3652_c1_4329_4727 132
1020 3300050512 nmdc:mga0n895_20971_c1 nmdc:mga0n895_20971_c1_1661_2059 132
1021 3300050512 nmdc:mga0n895_4615_c1 nmdc:mga0n895_4615_c1_154_552 132
1022 3300050512 nmdc:mga0n895_54609_c1 nmdc:mga0n895_54609_c1_1803_2201 132
1023 3300050512 nmdc:mga0n895_63874_c1 nmdc:mga0n895_63874_c1_3149_3547 132
1024 3300050513 nmdc:mga0rr50_1014913_c1 nmdc:mga0rr50_1014913_c1_283_681 132
1025 3300050513 nmdc:mga0rr50_117189_c1 nmdc:mga0rr50_117189_c1_91_489 132
1026 3300050513 nmdc:mga0rr50_253059_c1 nmdc:mga0rr50_253059_c1_898_1296 132
1027 3300050513 nmdc:mga0rr50_33356_c1 nmdc:mga0rr50_33356_c1_293_691 132
1028 3300050513 nmdc:mga0rr50_510044_c1 nmdc:mga0rr50_510044_c1_438_836 132
1029 3300050514 nmdc:mga08x19_104028_c1 nmdc:mga08x19_104028_c1_1314_1712 132
1030 3300050514 nmdc:mga08x19_938391_c1 nmdc:mga08x19_938391_c1_46_444 132
1031 3300050515 nmdc:mga0a205_17847_c1 nmdc:mga0a205_17847_c1_3689_4087 132
1032 3300050515 nmdc:mga0a205_2116_c1 nmdc:mga0a205_2116_c1_5957_6355 132
1033 3300053077 Ga0495601_0003041 Ga0495601_0003041_2982_3380 132
1034 3300053077 Ga0495601_0016804 Ga0495601_0016804_2640_3038 132
1035 3300053077 Ga0495601_0018616 Ga0495601_0018616_2366_2764 132
1036 3300053077 Ga0495601_0029013 Ga0495601_0029013_980_1384 132
1037 3300053077 Ga0495601_0032983 Ga0495601_0032983_2694_3092 132
1038 3300053077 Ga0495601_0146683 Ga0495601_0146683_529_927 132
1039 3300053078 Ga0495612_0006375 Ga0495612_0006375_4004_4402 132
1040 3300053078 Ga0495612_0016428 Ga0495612_0016428_1021_1425 132
1041 3300053078 Ga0495612_0018815 Ga0495612_0018815_1658_2056 132
1042 3300053078 Ga0495612_0041646 Ga0495612_0041646_1266_1664 132
1043 3300053078 Ga0495612_0119603 Ga0495612_0119603_499_897 132
1044 3300053078 Ga0495612_0234324 Ga0495612_0234324_384_782 132
1045 3300053078 Ga0495612_0408857 Ga0495612_0408857_135_533 132
1046 3300053084 Ga0495595_0000337 Ga0495595_0000337_1913_2311 132
1047 3300053084 Ga0495595_0000525 Ga0495595_0000525_5609_6007 132
1048 3300053084 Ga0495595_0016453 Ga0495595_0016453_1708_2112 132
1049 3300053084 Ga0495595_0072786 Ga0495595_0072786_965_1369 132
1050 3300053084 Ga0495595_0091400 Ga0495595_0091400_513_911 132
1051 3300053084 Ga0495595_0180254 Ga0495595_0180254_286_684 132
1052 3300053084 Ga0495595_0207116 Ga0495595_0207116_36_434 132
1053 3300053085 Ga0495619_0000043 Ga0495619_0000043_34347_34745 132
1054 3300053085 Ga0495619_0000333 Ga0495619_0000333_11392_11790 132
1055 3300053085 Ga0495619_0000405 Ga0495619_0000405_23182_23580 132
1056 3300053085 Ga0495619_0006520 Ga0495619_0006520_2057_2455 132
1057 3300053085 Ga0495619_0006915 Ga0495619_0006915_6046_6444 132
1058 3300053085 Ga0495619_0009776 Ga0495619_0009776_4729_5133 132
1059 3300053085 Ga0495619_0012577 Ga0495619_0012577_1939_2421 132
1060 3300053085 Ga0495619_0016850 Ga0495619_0016850_3389_3787 132
1061 3300053093 Ga0500651_0045526 Ga0500651_0045526_1618_2016 132
1062 3300053096 Ga0500641_0001180 Ga0500641_0001180_3533_3934 132
1063 3300053133 Ga0500655_018226 Ga0500655_018226_96_494 132
1064 3300054114 Ga0501084_0223084 Ga0501084_0223084_1003_1401 132
1065 3300060353 Ga0501082_0059799 Ga0501082_0059799_737_1135 132
1066 3300060353 Ga0501082_0459592 Ga0501082_0459592_157_555 132
1067 3300060353 Ga0501082_0476869 Ga0501082_0476869_662_1060 132
1068 3300060353 Ga0501082_0885052 Ga0501082_0885052_209_610 132
1069 3300060353 Ga0501082_1592165 Ga0501082_1592165_117_515 132
1070 3300060353 Ga0501082_1605047 Ga0501082_1605047_139_537 132
1071 3300061734 Ga0530510_0194729 Ga0530510_0194729_92_496 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01124

MAPEG

MAPEG family

32

158

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bpm-assembly1.cif.gz_A crystal structure of a human integral membrane enzyme 0.818 3 131
4bpm-assembly1.cif.gz_A crystal structure of a human integral membrane enzyme 0.7958 3 131
4j7t-assembly1.cif.gz_A human ltc4 synthase in complex with product analogs - implications for enzyme catalysis 0.7591 3 131
6ssr-assembly1.cif.gz_A crystal structure of human microsomal glutathione s-transferase 2 at 3.8 angstroms resolution 0.7581 3 131
4jc7-assembly1.cif.gz_A human ltc4 synthase in complex with product analogs - implications for enzyme catalysis 0.7575 3 131
ID Description Score Start End Superfamily
af_P10620_2_155_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8343 3 131 1.20.120.550
af_Q9JHF3_7_153_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8235 3 131 1.20.120.550
4wabA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8159 3 131 1.20.120.550
af_P10620_2_155_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8109 3 131 1.20.120.550
4yl1A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8027 3 131 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A533JAF3-F1-model_v4 deleted 1 45 132
AF-A0A7S7Z5G2-F1-model_v4 MAPEG family protein 0.9965 1 132 GO:0016020
AF-A0A161QMW4-F1-model_v4 MAPEG family protein 0.9961 1 129 GO:0016020
AF-A0A2M8R4K8-F1-model_v4 MAPEG family protein 0.9953 1 132 GO:0016020
AF-A0A5S4X384-F1-model_v4 MAPEG family protein 0.995 1 132 GO:0016020

Feature Viewer

pLDDT pTM Quality
93.53 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map