F489474

General Info

Members Datasets Scaffolds Average Seq Length
1070 624 2140 317

Family's Representative Sequence

Representative Sequence 3300046674|Ga0495588_0122706|Ga0495588_0122706_24_1022
Length 332
Sequence MGALMSTQQTASFSRAPIQFDRASGALEGANAWERLAALALSTGSKISSHFSHMGYIACANLLRKTLPERNIAIRLNPDAVFEFPYGDGYWSKLLNRSYNYEDELEVLFADSIDVDYTLLDCGANYGYWSVLVSSRPFGSHKAIAIEPSGQNYPKLANNARVNGNRFETLKCAIGAARGTARLSGTKHEAFSIAGAPSAGGEDVPVLALDNLIDDGKVAAHGKYLIKLDVEGVEIEAIKGGARLLETDSVIMCEEHGSDRSHAVSRFILEQTPLKLIVFDPRSNRMETVTELSILDRIKVSTHVGYNVFGTASAFWQDRIDALNAKTARRMQ

Samples

Sample ID Description Type Environment
1 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
71 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
96 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
97 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
98 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
99 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
102 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
106 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
110 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
161 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
162 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
163 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
167 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
168 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
169 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
170 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
171 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
172 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
173 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
176 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
177 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
178 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
179 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
180 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
181 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
184 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
185 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
186 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
187 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
188 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
192 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
193 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
194 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
195 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
196 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
197 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
200 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
201 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
202 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
203 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
204 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
205 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
209 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
210 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
211 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
217 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
218 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
219 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
220 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
221 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
222 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
223 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
224 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
225 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
226 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
227 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
228 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
229 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
230 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
231 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
232 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
233 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
234 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
235 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
236 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
237 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
238 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
239 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
240 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
241 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
242 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
243 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
244 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
245 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
246 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
247 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
248 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
249 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
250 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
251 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
252 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
253 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
254 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
255 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
256 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
257 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
258 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
259 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
260 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
261 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
262 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
263 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
264 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
265 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
266 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
267 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
268 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
269 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
270 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
271 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
272 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
273 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
274 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
275 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
276 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
277 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
278 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
279 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
280 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
281 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
282 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
283 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
284 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
285 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
286 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
287 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
288 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
289 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
290 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
291 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
292 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
293 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
294 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
295 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
296 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
297 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
298 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
299 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
300 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
301 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
302 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
303 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
304 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
305 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
306 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
307 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
308 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
309 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
310 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
311 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
312 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
313 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
314 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
315 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
316 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
317 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
318 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
319 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
320 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
321 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
322 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
323 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
324 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
325 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
326 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
327 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
342 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
343 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
344 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
345 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
346 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
347 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
348 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
349 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
350 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
351 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
352 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
353 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
354 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
357 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
358 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
359 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
360 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
361 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
362 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
363 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
364 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
365 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
366 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
367 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
368 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
369 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
370 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
371 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
372 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
373 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
374 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
375 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
376 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
377 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
378 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
379 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
380 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
381 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
382 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
383 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
384 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
385 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
386 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
387 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
388 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
389 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
390 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
391 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
392 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
393 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
394 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
395 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
396 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
397 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
398 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
399 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
400 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
401 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
402 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
403 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
404 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
405 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
406 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
407 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
408 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
409 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
410 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
411 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
412 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
413 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
414 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
415 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
416 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
417 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
418 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
421 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
422 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
423 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
424 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
425 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
426 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
427 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
428 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
429 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
430 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
431 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
432 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
433 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
434 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
435 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
436 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
437 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
438 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
439 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
440 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
441 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
442 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
443 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
444 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
445 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
446 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
447 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
448 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
449 2791355199
450 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
451 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
452 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
453 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
454 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
455 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
456 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
457 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
458 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
459 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
460 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
461 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
462 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
463 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
464 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
465 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
466 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
467 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
468 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
469 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
470 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
471 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
472 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
473 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
474 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
475 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
476 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
477 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
478 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
479 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
480 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
481 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
482 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
483 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
484 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
485 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
486 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
487 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
488 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
489 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
490 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
491 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
492 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
493 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
494 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
495 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
496 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
497 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
498 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
499 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
500 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
501 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
502 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
503 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
504 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
505 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
506 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
507 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
508 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
509 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
510 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
511 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
512 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
513 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
514 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
515 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
516 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
517 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
518 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
519 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
520 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
521 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
522 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
523 2922368715
524 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
525 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
526 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
527 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
528 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
529 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
530 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
531 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
532 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
533 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
534 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
535 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
536 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
537 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
538 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
539 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
540 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
541 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
542 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
543 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
544 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
545 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
546 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
547 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
548 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
549 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
550 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
551 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
552 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
553 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
554 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
555 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
556 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
557 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
558 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
559 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
560 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
561 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
562 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
563 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
564 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
565 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
566 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
567 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
568 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
569 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
570 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
571 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
572 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
573 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
574 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
575 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
576 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
577 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
578 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
579 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
580 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
581 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
582 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
583 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
584 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
585 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
586 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
587 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
588 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
589 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
590 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
591 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
592 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
593 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
594 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
595 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
596 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
597 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
598 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
599 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
600 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
601 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
602 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
603 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
604 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
605 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
606 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
607 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
608 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
609 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
610 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
611 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
612 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
613 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
614 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
615 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
616 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
617 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
618 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
619 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
620 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
621 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
622 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
623 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
624 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.9
Metatranscriptomes 0.28
Isolates 18.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.18
Nodule 14.86
Rhizoplane 4.95
Rhizosphere 55.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495588_0122706 3300046674 Bacteria 1370
2 LJQas_1003452 3300000549 Bacteria 2114
3 JGI24740J21852_10003514 3300001979 Bacteria 6869
4 JGI24739J22299_10004040 3300001989 Bacteria 5612
5 JGI24739J22299_10023184 3300001989 Bacteria 2196
6 JGI24735J21928_10041635 3300002067 Bacteria 1338
7 JGI25406J46586_10000681 3300003203 Bacteria 15800
8 JGI25406J46586_10007934 3300003203 Bacteria 4829
9 JGI25406J46586_10010769 3300003203 Bacteria 4038
10 JGI25153J46596_10001663 3300003215 Bacteria 13186
11 JGI25153J46596_10009558 3300003215 Bacteria 4485
12 JGI25153J46596_10021943 3300003215 Bacteria 2368
13 JGI25160J50197_1006279 3300003354 Bacteria 4828
14 Ga0065165_1010229 3300005262 Bacteria 4086
15 Ga0065165_1015921 3300005262 Bacteria 2842
16 Ga0065165_1017568 3300005262 Bacteria 2629
17 Ga0065165_1035060 3300005262 Bacteria 1545
18 Ga0070676_10073860 3300005328 Bacteria 2052
19 Ga0070683_100012067 3300005329 Bacteria 7496
20 Ga0070670_100220830 3300005331 Bacteria 1649
21 Ga0068869_100053313 3300005334 Bacteria 2939
22 Ga0070680_100103061 3300005336 Bacteria 2370
23 Ga0070682_100071524 3300005337 Bacteria 2220
24 Ga0068868_100140883 3300005338 Bacteria 1979
25 Ga0070689_100068147 3300005340 Bacteria 2775
26 Ga0070661_100207003 3300005344 Bacteria 1500
27 Ga0070669_100076157 3300005353 Bacteria 2489
28 Ga0070675_100328591 3300005354 Bacteria 1352
29 Ga0070671_100510736 3300005355 Bacteria 1034
30 Ga0070674_100035769 3300005356 Bacteria 3328
31 Ga0070667_100446420 3300005367 Bacteria 1181
32 Ga0070709_10006429 3300005434 Bacteria 6407
33 Ga0070709_10069938 3300005434 Bacteria 2262
34 Ga0070714_100066333 3300005435 Bacteria 3111
35 Ga0070714_100205608 3300005435 Bacteria 1803
36 Ga0070713_100040032 3300005436 Bacteria 3809
37 Ga0070713_100044479 3300005436 Bacteria 3635
38 Ga0070713_100092759 3300005436 Bacteria 2601
39 Ga0070713_100334506 3300005436 Bacteria 1402
40 Ga0070713_100337344 3300005436 Bacteria 1396
41 Ga0070710_10060511 3300005437 Bacteria 2155
42 Ga0070711_100006622 3300005439 Bacteria 6999
43 Ga0070711_100026652 3300005439 Bacteria 3788
44 Ga0070711_100085676 3300005439 Bacteria 2257
45 Ga0070711_100294780 3300005439 Bacteria 1288
46 Ga0070663_100013100 3300005455 Bacteria 5271
47 Ga0070663_100123466 3300005455 Bacteria 1958
48 Ga0070663_100174671 3300005455 Bacteria 1663
49 Ga0070678_100209656 3300005456 Bacteria 1614
50 Ga0070681_10405718 3300005458 Bacteria 1274
51 Ga0070706_100050747 3300005467 Bacteria 3828
52 Ga0070698_100070517 3300005471 Bacteria 3507
53 Ga0070679_100017345 3300005530 Bacteria 6969
54 Ga0070679_100085691 3300005530 Bacteria 3137
55 Ga0070684_100007669 3300005535 Bacteria 8414
56 Ga0070684_100083032 3300005535 Bacteria 2838
57 Ga0068853_100038146 3300005539 Bacteria 4091
58 Ga0068853_100125163 3300005539 Bacteria 2296
59 Ga0068853_100273987 3300005539 Bacteria 1554
60 Ga0068853_100313701 3300005539 Bacteria 1452
61 Ga0068853_100354446 3300005539 Bacteria 1365
62 Ga0070665_100052156 3300005548 Bacteria 4104
63 Ga0070665_100100312 3300005548 Bacteria 2899
64 Ga0070665_100195162 3300005548 Bacteria 2025
65 Ga0070665_100260283 3300005548 Bacteria 1736
66 Ga0068855_100025224 3300005563 Bacteria 7118
67 Ga0068855_100028801 3300005563 Bacteria 6645
68 Ga0068855_100712891 3300005563 Bacteria 1073
69 Ga0068857_100025174 3300005577 Bacteria 5240
70 Ga0068854_100014933 3300005578 Bacteria 5129
71 Ga0068856_100000206 3300005614 Bacteria 63167
72 Ga0068856_100001326 3300005614 Bacteria 26060
73 Ga0068856_100068934 3300005614 Bacteria 3497
74 Ga0068856_100484731 3300005614 Bacteria 1257
75 Ga0068856_100527725 3300005614 Bacteria 1202
76 Ga0068852_100035095 3300005616 Bacteria 4179
77 Ga0068852_100170819 3300005616 Bacteria 2038
78 Ga0068852_100183842 3300005616 Bacteria 1967
79 Ga0068859_100127304 3300005617 Bacteria 2617
80 Ga0068864_100199011 3300005618 Bacteria 1839
81 Ga0068851_10008264 3300005834 Bacteria 4806
82 Ga0068863_100095029 3300005841 Bacteria 2829
83 Ga0068858_100098589 3300005842 Bacteria 2724
84 Ga0068860_100002375 3300005843 Bacteria 19777
85 Ga0068862_100068047 3300005844 Bacteria 3071
86 Ga0081455_10042961 3300005937 Bacteria 3960
87 Ga0081455_10091358 3300005937 Bacteria 2466
88 Ga0081455_10125752 3300005937 Bacteria 2013
89 Ga0081538_10036458 3300005981 Bacteria 3208
90 Ga0081540_1008342 3300005983 Bacteria 7244
91 Ga0081540_1010657 3300005983 Bacteria 6202
92 Ga0081540_1011623 3300005983 Bacteria 5872
93 Ga0081540_1015698 3300005983 Bacteria 4781
94 Ga0081540_1016078 3300005983 Bacteria 4706
95 Ga0081540_1020343 3300005983 Bacteria 3996
96 Ga0081540_1036212 3300005983 Bacteria 2635
97 Ga0081540_1048398 3300005983 Bacteria 2130
98 Ga0081539_10000250 3300005985 Bacteria 125352
99 Ga0081539_10000269 3300005985 Bacteria 119082
100 Ga0081539_10027360 3300005985 Bacteria 3614
101 Ga0070717_10057850 3300006028 Bacteria 3205
102 Ga0070717_10134231 3300006028 Bacteria 2130
103 Ga0070717_10519734 3300006028 Bacteria 1077
104 Ga0075365_10069850 3300006038 Bacteria 2361
105 Ga0075365_10150026 3300006038 Bacteria 1621
106 Ga0075365_10246942 3300006038 Bacteria 1254
107 Ga0075368_10048775 3300006042 Bacteria 1678
108 Ga0075363_100005065 3300006048 Bacteria 5827
109 Ga0075363_100009347 3300006048 Bacteria 4607
110 Ga0075363_100010490 3300006048 Bacteria 4404
111 Ga0075364_10236518 3300006051 Bacteria 1240
112 Ga0070716_100037021 3300006173 Bacteria 2694
113 Ga0070716_100250244 3300006173 Bacteria 1207
114 Ga0070712_100055641 3300006175 Bacteria 2771
115 Ga0070712_100059043 3300006175 Bacteria 2700
116 Ga0070712_100116165 3300006175 Bacteria 2006
117 Ga0075362_10030652 3300006177 Bacteria 2323
118 Ga0075367_10015272 3300006178 Bacteria 4169
119 Ga0075367_10044543 3300006178 Bacteria 2601
120 Ga0075367_10107624 3300006178 Bacteria 1709
121 Ga0075367_10124755 3300006178 Bacteria 1588
122 Ga0075367_10159841 3300006178 Bacteria 1401
123 Ga0075369_10032400 3300006186 Bacteria 2211
124 Ga0075369_10063059 3300006186 Bacteria 1620
125 Ga0075369_10068356 3300006186 Bacteria 1561
126 Ga0075370_10009268 3300006353 Bacteria 5105
127 Ga0075370_10042123 3300006353 Bacteria 2579
128 Ga0068871_100109380 3300006358 Bacteria 2323
129 Ga0075434_100033334 3300006871 Bacteria 5082
130 Ga0075434_100148429 3300006871 Bacteria 2364
131 Ga0075429_100284262 3300006880 Bacteria 1449
132 Ga0075436_100339594 3300006914 Bacteria 1081
133 Ga0097620_100127308 3300006931 Bacteria 2617
134 Ga0099824_1010776 3300006942 Bacteria 10606
135 Ga0099822_1007032 3300006943 Bacteria 14601
136 Ga0075435_100172117 3300007076 Bacteria 1827
137 Ga0075435_100217598 3300007076 Bacteria 1621
138 Ga0105240_10004110 3300009093 Bacteria 22341
139 Ga0105240_10020952 3300009093 Bacteria 8702
140 Ga0105240_10136296 3300009093 Bacteria 2940
141 Ga0105240_10198672 3300009093 Bacteria 2352
142 Ga0105240_10211423 3300009093 Bacteria 2267
143 Ga0105240_10245748 3300009093 Bacteria 2072
144 Ga0111539_10616935 3300009094 Bacteria 1263
145 Ga0105245_10316279 3300009098 Bacteria 1537
146 Ga0105245_10707677 3300009098 Bacteria 1041
147 Ga0105247_10030092 3300009101 Bacteria 3291
148 Ga0105241_10003155 3300009174 Bacteria 12264
149 Ga0105241_10166359 3300009174 Bacteria 1817
150 Ga0105241_10278762 3300009174 Bacteria 1427
151 Ga0105248_10134532 3300009177 Bacteria 2789
152 Ga0105248_10597218 3300009177 Bacteria 1245
153 Ga0105248_10693657 3300009177 Bacteria 1149
154 Ga0105237_10136757 3300009545 Bacteria 2445
155 Ga0105237_10231033 3300009545 Bacteria 1851
156 Ga0105237_10237303 3300009545 Bacteria 1825
157 Ga0105237_10239637 3300009545 Bacteria 1815
158 Ga0105237_10255481 3300009545 Bacteria 1755
159 Ga0105238_10006149 3300009551 Bacteria 11917
160 Ga0105238_10011037 3300009551 Bacteria 9084
161 Ga0105238_10163736 3300009551 Bacteria 2200
162 Ga0105249_10324105 3300009553 Bacteria 1552
163 Ga0099796_10049270 3300010159 Bacteria 1456
164 Ga0105239_10089983 3300010375 Bacteria 3386
165 Ga0105239_10140766 3300010375 Bacteria 2688
166 Ga0105239_10154714 3300010375 Bacteria 2560
167 Ga0105239_10155496 3300010375 Bacteria 2553
168 Ga0105239_10157174 3300010375 Bacteria 2540
169 Ga0105239_10412160 3300010375 Bacteria 1530
170 Ga0105246_10080117 3300011119 Bacteria 2324
171 Ga0105246_10130698 3300011119 Bacteria 1875
172 Ga0105246_10192340 3300011119 Bacteria 1580
173 Ga0105246_10416175 3300011119 Bacteria 1120
174 Ga0157343_1001037 3300012488 Bacteria 1274
175 Ga0157373_10131884 3300013100 Bacteria 1757
176 Ga0157370_10168811 3300013104 Bacteria 2034
177 Ga0157370_10250559 3300013104 Bacteria 1638
178 Ga0157370_10293360 3300013104 Bacteria 1502
179 Ga0157369_10011202 3300013105 Bacteria 10192
180 Ga0157374_10093029 3300013296 Bacteria 2878
181 Ga0157374_10312218 3300013296 Bacteria 1557
182 Ga0157378_10033388 3300013297 Bacteria 4548
183 Ga0157378_10759876 3300013297 Bacteria 993
184 Ga0157372_10298676 3300013307 Bacteria 1873
185 Ga0157372_10583608 3300013307 Bacteria 1303
186 Ga0157375_10441064 3300013308 Bacteria 1468
187 Ga0157375_10612230 3300013308 Bacteria 1248
188 Ga0163163_10129461 3300014325 Bacteria 2564
189 Ga0157376_10061271 3300014969 Bacteria 3162
190 Ga0214544_1000009 3300021320 Bacteria 285865
191 Ga0214542_1000002 3300021321 Bacteria 720798
192 Ga0214545_1000002 3300021324 Bacteria 727485
193 Ga0214545_1031392 3300021324 Bacteria 2154
194 Ga0214543_1000013 3300021327 Bacteria 329117
195 Ga0214543_1037592 3300021327 Bacteria 1433
196 Ga0213873_10010664 3300021358 Bacteria 1943
197 Ga0213876_10004973 3300021384 Bacteria 7346
198 Ga0213871_10045487 3300021441 Bacteria 1189
199 Ga0224712_10034645 3300022467 Bacteria 1858
200 Ga0209677_100736 3300025253 Bacteria 16664
201 Ga0209677_108959 3300025253 Bacteria 1858
202 Ga0209148_1006655 3300025254 Bacteria 2481
203 Ga0209233_1001809 3300025261 Bacteria 8232
204 Ga0209233_1004669 3300025261 Bacteria 4625
205 Ga0209233_1007743 3300025261 Bacteria 3376
206 Ga0209455_1002875 3300025272 Bacteria 6375
207 Ga0209130_1017710 3300025284 Bacteria 1690
208 Ga0209564_1000943 3300025295 Bacteria 37519
209 Ga0209564_1010264 3300025295 Bacteria 4338
210 Ga0209564_1021493 3300025295 Bacteria 2318
211 Ga0209564_1027239 3300025295 Bacteria 1862
212 Ga0209758_1000021 3300025297 Bacteria 697691
213 Ga0209758_1001379 3300025297 Bacteria 28987
214 Ga0209758_1002994 3300025297 Bacteria 16178
215 Ga0209758_1003248 3300025297 Bacteria 15075
216 Ga0209758_1003460 3300025297 Bacteria 14315
217 Ga0209758_1006119 3300025297 Bacteria 8825
218 Ga0209256_1001949 3300025299 Bacteria 18730
219 Ga0209256_1020036 3300025299 Bacteria 2104
220 Ga0207426_1001467 3300025302 Bacteria 19421
221 Ga0207426_1005148 3300025302 Bacteria 6086
222 Ga0207426_1010935 3300025302 Bacteria 3491
223 Ga0209257_1003545 3300025304 Bacteria 13262
224 Ga0207697_10039413 3300025315 Bacteria 1938
225 Ga0207653_10017165 3300025885 Bacteria 2276
226 Ga0207682_10047633 3300025893 Bacteria 1765
227 Ga0207692_10134061 3300025898 Bacteria 1402
228 Ga0207710_10020119 3300025900 Bacteria 2852
229 Ga0207688_10029081 3300025901 Bacteria 3041
230 Ga0207688_10233745 3300025901 Bacteria 1110
231 Ga0207647_10005487 3300025904 Bacteria 9284
232 Ga0207699_10001483 3300025906 Bacteria 11150
233 Ga0207699_10017822 3300025906 Bacteria 3749
234 Ga0207699_10074296 3300025906 Bacteria 2088
235 Ga0207645_10054365 3300025907 Bacteria 2557
236 Ga0207705_10063067 3300025909 Bacteria 2677
237 Ga0207705_10368050 3300025909 Bacteria 1109
238 Ga0207684_10028455 3300025910 Bacteria 4762
239 Ga0207684_10356277 3300025910 Bacteria 1259
240 Ga0207654_10000304 3300025911 Bacteria 29981
241 Ga0207707_10003136 3300025912 Bacteria 14679
242 Ga0207707_10043241 3300025912 Bacteria 3930
243 Ga0207695_10000278 3300025913 Bacteria 127446
244 Ga0207695_10000402 3300025913 Bacteria 96771
245 Ga0207695_10025863 3300025913 Bacteria 6559
246 Ga0207695_10115163 3300025913 Bacteria 2663
247 Ga0207695_10319576 3300025913 Bacteria 1442
248 Ga0207695_10348644 3300025913 Bacteria 1368
249 Ga0207671_10021353 3300025914 Bacteria 4913
250 Ga0207671_10200281 3300025914 Bacteria 1559
251 Ga0207671_10259434 3300025914 Bacteria 1368
252 Ga0207693_10059682 3300025915 Bacteria 2988
253 Ga0207693_10065183 3300025915 Bacteria 2853
254 Ga0207663_10020032 3300025916 Bacteria 3782
255 Ga0207663_10040030 3300025916 Bacteria 2845
256 Ga0207663_10067480 3300025916 Bacteria 2294
257 Ga0207660_10037773 3300025917 Bacteria 3367
258 Ga0207660_10052062 3300025917 Bacteria 2913
259 Ga0207660_10245089 3300025917 Bacteria 1413
260 Ga0207657_10023474 3300025919 Bacteria 5742
261 Ga0207657_10099572 3300025919 Bacteria 2414
262 Ga0207652_10015934 3300025921 Bacteria 6126
263 Ga0207652_10169893 3300025921 Bacteria 1956
264 Ga0207681_10191633 3300025923 Bacteria 1564
265 Ga0207681_10465509 3300025923 Bacteria 1030
266 Ga0207694_10009967 3300025924 Bacteria 7163
267 Ga0207694_10055453 3300025924 Bacteria 3076
268 Ga0207694_10344219 3300025924 Bacteria 1233
269 Ga0207694_10364781 3300025924 Bacteria 1197
270 Ga0207659_10194976 3300025926 Bacteria 1614
271 Ga0207687_10151637 3300025927 Bacteria 1769
272 Ga0207700_10000968 3300025928 Bacteria 16567
273 Ga0207700_10113238 3300025928 Bacteria 2187
274 Ga0207664_10050335 3300025929 Bacteria 3285
275 Ga0207664_10107071 3300025929 Bacteria 2319
276 Ga0207644_10282103 3300025931 Bacteria 1334
277 Ga0207686_10067968 3300025934 Bacteria 2281
278 Ga0207709_10037439 3300025935 Bacteria 2883
279 Ga0207670_10062461 3300025936 Bacteria 2546
280 Ga0207704_10144315 3300025938 Bacteria 1670
281 Ga0207665_10066360 3300025939 Bacteria 2456
282 Ga0207665_10120738 3300025939 Bacteria 1851
283 Ga0207711_10109585 3300025941 Bacteria 2454
284 Ga0207661_10000608 3300025944 Bacteria 22916
285 Ga0207661_10071211 3300025944 Bacteria 2840
286 Ga0207667_10014503 3300025949 Bacteria 8982
287 Ga0207667_10017031 3300025949 Bacteria 8198
288 Ga0207667_10146885 3300025949 Bacteria 2427
289 Ga0207667_10179114 3300025949 Bacteria 2177
290 Ga0207667_10271307 3300025949 Bacteria 1734
291 Ga0207668_10461085 3300025972 Bacteria 1086
292 Ga0207640_10003075 3300025981 Bacteria 8983
293 Ga0207703_10278533 3300026035 Bacteria 1518
294 Ga0207703_10293120 3300026035 Bacteria 1481
295 Ga0207639_10067327 3300026041 Bacteria 2786
296 Ga0207639_10175652 3300026041 Bacteria 1818
297 Ga0207639_10176190 3300026041 Bacteria 1815
298 Ga0207639_10358962 3300026041 Bacteria 1303
299 Ga0207639_10391381 3300026041 Bacteria 1250
300 Ga0207678_10046087 3300026067 Bacteria 3771
301 Ga0207678_10058194 3300026067 Bacteria 3325
302 Ga0207678_10075216 3300026067 Bacteria 2893
303 Ga0207678_10103715 3300026067 Bacteria 2427
304 Ga0207678_10128326 3300026067 Bacteria 2163
305 Ga0207708_10068571 3300026075 Bacteria 2715
306 Ga0207702_10000025 3300026078 Bacteria 186312
307 Ga0207702_10000516 3300026078 Bacteria 43552
308 Ga0207702_10043651 3300026078 Bacteria 3766
309 Ga0207702_10639760 3300026078 Bacteria 1045
310 Ga0207641_10255587 3300026088 Bacteria 1638
311 Ga0207648_10096241 3300026089 Bacteria 2590
312 Ga0207674_10021247 3300026116 Bacteria 6996
313 Ga0207674_10117089 3300026116 Bacteria 2635
314 Ga0207674_10328342 3300026116 Bacteria 1479
315 Ga0207683_10268887 3300026121 Bacteria 1557
316 Ga0207683_10278600 3300026121 Bacteria 1528
317 Ga0207698_10095506 3300026142 Bacteria 2447
318 Ga0207698_10197631 3300026142 Bacteria 1798
319 Ga0207698_10332633 3300026142 Bacteria 1427
320 Ga0207698_10488091 3300026142 Bacteria 1196
321 Ga0209589_1000003 3300027357 Bacteria 629130
322 Ga0209589_1000022 3300027357 Bacteria 180757
323 Ga0209489_100003 3300027361 Bacteria 663105
324 Ga0209489_100070 3300027361 Bacteria 138580
325 Ga0209489_100878 3300027361 Bacteria 60105
326 Ga0209700_100003 3300027363 Bacteria 663105
327 Ga0209700_100021 3300027363 Bacteria 230859
328 Ga0209588_1020251 3300027671 Bacteria 2083
329 Ga0268266_10003299 3300028379 Bacteria 16216
330 Ga0268266_10097490 3300028379 Bacteria 2585
331 Ga0268266_10366111 3300028379 Bacteria 1357
332 Ga0268266_10497609 3300028379 Bacteria 1163
333 Ga0268264_10000022 3300028381 Bacteria 476624
334 Ga0268264_10214929 3300028381 Bacteria 1767
335 Ga0265337_1001610 3300028556 Bacteria 11005
336 Ga0265319_1012982 3300028563 Bacteria 3337
337 Ga0265334_10002314 3300028573 Bacteria 8965
338 Ga0265334_10044834 3300028573 Bacteria 1715
339 Ga0265323_10000259 3300028653 Bacteria 31032
340 Ga0265322_10003364 3300028654 Bacteria 4843
341 Ga0265336_10000154 3300028666 Bacteria 48665
342 Ga0307517_10000111 3300028786 Bacteria 120304
343 Ga0307515_10048142 3300028794 Bacteria 6455
344 Ga0265338_10000337 3300028800 Bacteria 85427
345 Ga0265324_10001168 3300029957 Bacteria 15641
346 Ga0265330_10064470 3300031235 Bacteria 1591
347 Ga0265325_10004621 3300031241 Bacteria 8645
348 Ga0265340_10003393 3300031247 Bacteria 8995
349 Ga0265339_10009277 3300031249 Bacteria 6199
350 Ga0265339_10044167 3300031249 Bacteria 2459
351 Ga0265331_10021389 3300031250 Bacteria 3311
352 Ga0307509_10012010 3300031507 Bacteria 10398
353 Ga0307408_100050491 3300031548 Bacteria 2992
354 Ga0307508_10000038 3300031616 Bacteria 150186
355 Ga0307508_10011459 3300031616 Bacteria 8102
356 Ga0265314_10007972 3300031711 Bacteria 9136
357 Ga0265342_10057717 3300031712 Bacteria 2296
358 Ga0307516_10008874 3300031730 Bacteria 11284
359 Ga0307413_10063826 3300031824 Bacteria 2285
360 Ga0307410_10187602 3300031852 Bacteria 1570
361 Ga0307412_10239359 3300031911 Bacteria 1403
362 Ga0307416_100481998 3300032002 Bacteria 1300
363 Ga0307507_10020903 3300033179 Bacteria 7310
364 Ga0307510_10002750 3300033180 Bacteria 20142
365 Ga0307510_10036687 3300033180 Bacteria 5453
366 Ga0307510_10055966 3300033180 Bacteria 4114
367 Ga0316215_1003549 3300033544 Bacteria 1488
368 Ga0373934_0018580 3300035086 Bacteria 2661
369 Ga0373934_0019258 3300035086 Bacteria 2619
370 Ga0373944_0003594 3300035089 Bacteria 4007
371 Ga0373952_0003893 3300035092 Bacteria 2701
372 Ga0373923_0001160 3300035111 Bacteria 7320
373 Ga0373923_0006220 3300035111 Bacteria 4109
374 Ga0373923_0006381 3300035111 Bacteria 4073
375 Ga0373936_0019879 3300035113 Bacteria 2605
376 Ga0373939_0052502 3300035114 Bacteria 1271
377 Ga0373945_0007328 3300035116 Bacteria 3576
378 Ga0373953_0000167 3300035117 Bacteria 17273
379 Ga0373954_0000035 3300035118 Bacteria 51266
380 Ga0373954_0028047 3300035118 Bacteria 2586
381 Ga0373956_0021698 3300035119 Bacteria 2740
382 Ga0373956_0033964 3300035119 Bacteria 2245
383 Ga0373957_0001600 3300035120 Bacteria 6196
384 Ga0373943_0014948 3300035170 Bacteria 3523
385 Ga0373955_0010954 3300035172 Bacteria 4304
386 Ga0373935_0000758 3300035692 Bacteria 17187
387 Ga0373935_0008150 3300035692 Bacteria 6280
388 Ga0373935_0024595 3300035692 Bacteria 3708
389 Ga0373927_0002965 3300035695 Bacteria 12316
390 Ga0373927_0013368 3300035695 Bacteria 5458
391 Ga0373927_0029866 3300035695 Bacteria 3555
392 Ga0373933_0000037 3300035724 Bacteria 81092
393 Ga0373933_0000185 3300035724 Bacteria 41223
394 Ga0373933_0097431 3300035724 Bacteria 1821
395 Ga0373947_0004260 3300035725 Bacteria 8395
396 Ga0373947_0019128 3300035725 Bacteria 3947
397 Ga0373947_0041806 3300035725 Bacteria 2735
398 Ga0373937_0000118 3300036401 Bacteria 75902
399 Ga0373937_0035246 3300036401 Bacteria 4554
400 Ga0373937_0079178 3300036401 Bacteria 3037
401 Ga0373937_0099569 3300036401 Bacteria 2696
402 Ga0373925_0068140 3300037068 Bacteria 2685
403 Ga0395900_0000502 3300037418 Bacteria 55040
404 Ga0395900_0037349 3300037418 Bacteria 5009
405 Ga0395898_0009378 3300037466 Bacteria 10281
406 Ga0395898_0071832 3300037466 Bacteria 3344
407 Ga0395898_0182586 3300037466 Bacteria 2005
408 Ga0395898_0315693 3300037466 Bacteria 1491
409 Ga0395905_0028697 3300037471 Bacteria 5244
410 Ga0395905_0042349 3300037471 Bacteria 4273
411 Ga0395905_0097081 3300037471 Bacteria 2766
412 Ga0395905_0148646 3300037471 Bacteria 2204
413 Ga0436364_0361397 3300037853 Bacteria 5221
414 Ga0395901_0264576 3300038443 Bacteria 1789
415 Ga0436365_0896488 3300039437 Bacteria 5750
416 Ga0436360_0091295 3300039438 Bacteria 2973
417 Ga0436360_0291982 3300039438 Bacteria 1388
418 Ga0439465_0034812 3300041413 Bacteria 1613
419 Ga0439465_0036831 3300041413 Bacteria 1572
420 Ga0450902_016645 3300042137 Bacteria 1199
421 Ga0439459_0003620 3300042438 Bacteria 2463
422 Ga0466972_0002195 3300044658 Bacteria 9577
423 Ga0466972_0002509 3300044658 Bacteria 9073
424 Ga0466965_0038102 3300044683 Bacteria 2361
425 Ga0466966_0008461 3300044684 Bacteria 6813
426 Ga0466966_0173448 3300044684 Bacteria 1310
427 Ga0466961_0000206 3300044693 Bacteria 39651
428 Ga0466963_0098287 3300044694 Bacteria 2001
429 Ga0466963_0403139 3300044694 Bacteria 964
430 Ga0466968_0118631 3300044735 Bacteria 1195
431 Ga0466970_0039214 3300044765 Bacteria 2514
432 Ga0466957_0068239 3300044842 Bacteria 2195
433 Ga0466957_0071292 3300044842 Bacteria 2149
434 Ga0466959_0020150 3300045049 Bacteria 4910
435 Ga0466959_0186875 3300045049 Bacteria 1447
436 Ga0466967_0363164 3300045976 Bacteria 1403
437 Ga0495627_092269 3300046453 Bacteria 870
438 Ga0495592_0002185 3300046454 Bacteria 13770
439 Ga0495592_0006804 3300046454 Bacteria 8533
440 Ga0495592_0148471 3300046454 Bacteria 1623
441 Ga0495592_0260516 3300046454 Bacteria 1142
442 Ga0495603_0000027 3300046455 Bacteria 61238
443 Ga0495603_0155930 3300046455 Bacteria 1325
444 Ga0495629_0000290 3300046459 Bacteria 43459
445 Ga0495629_0010294 3300046459 Bacteria 6812
446 Ga0495629_0024592 3300046459 Bacteria 4288
447 Ga0495638_0030570 3300046460 Bacteria 3465
448 Ga0495638_0072703 3300046460 Bacteria 2100
449 Ga0495641_0005129 3300046461 Bacteria 8967
450 Ga0495651_0000412 3300046462 Bacteria 33198
451 Ga0495651_0014516 3300046462 Bacteria 6090
452 Ga0495651_0077280 3300046462 Bacteria 2520
453 Ga0495651_0254552 3300046462 Bacteria 1197
454 Ga0495653_0000161 3300046463 Bacteria 55322
455 Ga0495653_0095886 3300046463 Bacteria 2158
456 Ga0495650_0072529 3300046471 Bacteria 1347
457 Ga0495580_0003356 3300046472 Bacteria 13678
458 Ga0495580_0008821 3300046472 Bacteria 7981
459 Ga0495580_0133134 3300046472 Bacteria 1724
460 Ga0495582_0000157 3300046473 Bacteria 36665
461 Ga0495605_0080205 3300046474 Bacteria 1528
462 Ga0495639_0000048 3300046475 Bacteria 53257
463 Ga0495639_0016694 3300046475 Bacteria 3188
464 Ga0495662_0000814 3300046476 Bacteria 15152
465 Ga0495664_0007669 3300046477 Bacteria 6002
466 Ga0495664_0012222 3300046477 Bacteria 4861
467 Ga0495664_0020336 3300046477 Bacteria 3828
468 Ga0495664_0062121 3300046477 Bacteria 2224
469 Ga0495594_0001217 3300046499 Bacteria 13445
470 Ga0495594_0064473 3300046499 Bacteria 2031
471 Ga0495607_0016331 3300046501 Bacteria 4791
472 Ga0495606_0002560 3300046507 Bacteria 20874
473 Ga0495606_0128747 3300046507 Bacteria 1507
474 Ga0495606_0169805 3300046507 Bacteria 1266
475 Ga0495608_0000337 3300046511 Bacteria 33005
476 Ga0495616_0016785 3300046513 Bacteria 4046
477 Ga0495616_0064372 3300046513 Bacteria 1789
478 Ga0495618_0016579 3300046514 Bacteria 4510
479 Ga0495618_0086096 3300046514 Bacteria 2009
480 Ga0495628_0052165 3300046516 Bacteria 3231
481 Ga0495628_0052285 3300046516 Bacteria 3227
482 Ga0495628_0134604 3300046516 Bacteria 1889
483 Ga0495628_0195218 3300046516 Bacteria 1527
484 Ga0495630_0000846 3300046517 Bacteria 21588
485 Ga0495631_0021047 3300046518 Bacteria 3040
486 Ga0495631_0189598 3300046518 Bacteria 880
487 Ga0495632_0071994 3300046519 Bacteria 1659
488 Ga0495643_0132492 3300046522 Bacteria 1250
489 Ga0495648_0001999 3300046524 Bacteria 19316
490 Ga0495648_0021130 3300046524 Bacteria 4517
491 Ga0495648_0049453 3300046524 Bacteria 2577
492 Ga0495648_0115839 3300046524 Bacteria 1449
493 Ga0495652_0012092 3300046529 Bacteria 7798
494 Ga0495652_0023266 3300046529 Bacteria 5493
495 Ga0495652_0053413 3300046529 Bacteria 3443
496 Ga0495652_0136558 3300046529 Bacteria 1934
497 Ga0495665_0002259 3300046531 Bacteria 10438
498 Ga0495665_0036407 3300046531 Bacteria 2627
499 Ga0495640_0004105 3300046533 Bacteria 11649
500 Ga0495640_0004805 3300046533 Bacteria 10757
501 Ga0495640_0018408 3300046533 Bacteria 5179
502 Ga0495640_0066290 3300046533 Bacteria 2435
503 Ga0495586_0093770 3300046535 Bacteria 1660
504 Ga0495587_0000668 3300046536 Bacteria 22979
505 Ga0495587_0027939 3300046536 Bacteria 3435
506 Ga0495621_0060161 3300046539 Bacteria 1377
507 Ga0495597_0041695 3300046542 Bacteria 2049
508 Ga0495645_0009785 3300046543 Bacteria 6707
509 Ga0495645_0038675 3300046543 Bacteria 3480
510 Ga0495622_0016465 3300046557 Bacteria 3443
511 Ga0495622_0045986 3300046557 Bacteria 2028
512 Ga0495622_0105339 3300046557 Bacteria 1292
513 Ga0495667_0000147 3300046559 Bacteria 47993
514 Ga0495667_0076619 3300046559 Bacteria 2176
515 Ga0495656_0084252 3300046615 Bacteria 1441
516 Ga0495656_0166207 3300046615 Bacteria 1075
517 Ga0495668_0071426 3300046616 Bacteria 1908
518 Ga0495634_0001002 3300046642 Bacteria 26604
519 Ga0495634_0057519 3300046642 Bacteria 2595
520 Ga0495634_0079169 3300046642 Bacteria 2152
521 Ga0495635_0000094 3300046663 Bacteria 52578
522 Ga0495635_0001877 3300046663 Bacteria 14243
523 Ga0495635_0025756 3300046663 Bacteria 4097
524 Ga0495635_0045365 3300046663 Bacteria 3033
525 Ga0495635_0108386 3300046663 Bacteria 1897
526 Ga0495661_0032955 3300046665 Bacteria 3270
527 Ga0495657_0001420 3300046675 Bacteria 20703
528 Ga0495657_0010267 3300046675 Bacteria 7048
529 Ga0495657_0067447 3300046675 Bacteria 2348
530 Ga0495599_0000253 3300046678 Bacteria 33822
531 Ga0495599_0050680 3300046678 Bacteria 2601
532 Ga0495599_0106227 3300046678 Bacteria 1749
533 Ga0495623_0000768 3300046679 Bacteria 21497
534 Ga0495646_0002668 3300046680 Bacteria 11037
535 Ga0495646_0055083 3300046680 Bacteria 2390
536 Ga0495647_0005907 3300046681 Bacteria 4031
537 Ga0495647_0015078 3300046681 Bacteria 2702
538 Ga0495658_0017804 3300046683 Bacteria 3679
539 Ga0495669_0065869 3300046684 Bacteria 1645
540 Ga0495669_0074956 3300046684 Bacteria 1547
541 Ga0495669_0167618 3300046684 Bacteria 1044
542 Ga0495669_0219714 3300046684 Bacteria 911
543 Ga0495613_0006428 3300046689 Bacteria 8785
544 Ga0495613_0074546 3300046689 Bacteria 2471
545 Ga0495613_0117817 3300046689 Bacteria 1909
546 Ga0495624_0000380 3300046690 Bacteria 35436
547 Ga0495624_0142157 3300046690 Bacteria 1470
548 Ga0495671_0132004 3300046692 Bacteria 1218
549 Ga0495671_0143439 3300046692 Bacteria 1164
550 Ga0495600_0002207 3300046809 Bacteria 11075
551 Ga0495600_0005220 3300046809 Bacteria 7812
552 Ga0495600_0062570 3300046809 Bacteria 2431
553 Ga0495581_0000233 3300047315 Bacteria 26288
554 Ga0495604_0000253 3300047317 Bacteria 47392
555 Ga0495604_0017102 3300047317 Bacteria 5801
556 Ga0495674_0002874 3300047319 Bacteria 16742
557 Ga0495674_0054162 3300047319 Bacteria 3524
558 Ga0495674_0060388 3300047319 Bacteria 3308
559 Ga0495674_0159190 3300047319 Bacteria 1890
560 Ga0495672_0013492 3300047320 Bacteria 5637
561 Ga0495672_0074263 3300047320 Bacteria 1915
562 Ga0495676_0027599 3300047321 Bacteria 4864
563 Ga0495676_0150036 3300047321 Bacteria 1660
564 Ga0495676_0206826 3300047321 Bacteria 1360
565 Ga0495680_0000406 3300047322 Bacteria 48300
566 Ga0495680_0010391 3300047322 Bacteria 8308
567 Ga0495683_0022647 3300047323 Bacteria 3230
568 Ga0495675_0000285 3300047444 Bacteria 36643
569 Ga0495675_0048069 3300047444 Bacteria 2714
570 Ga0495681_0068863 3300047470 Bacteria 1609
571 Ga0495684_0000184 3300047471 Bacteria 47730
572 Ga0495684_0006226 3300047471 Bacteria 9272
573 Ga0495684_0119135 3300047471 Bacteria 1989
574 Ga0495686_0113968 3300047472 Bacteria 1619
575 Ga0495686_0151251 3300047472 Bacteria 1362
576 Ga0495593_0003039 3300047673 Bacteria 10111
577 Ga0495593_0004547 3300047673 Bacteria 8243
578 Ga0495593_0064578 3300047673 Bacteria 1911
579 Ga0495602_0001148 3300048088 Bacteria 25888
580 Ga0495602_0099795 3300048088 Bacteria 2386
581 Ga0496100_0008823 3300048903 Bacteria 5638
582 Ga0496100_0017735 3300048903 Bacteria 4210
583 Ga0496101_0014849 3300048904 Bacteria 5240
584 Ga0496101_0099807 3300048904 Bacteria 2171
585 Ga0496101_0129930 3300048904 Bacteria 1912
586 Ga0496102_0044533 3300048905 Bacteria 4028
587 Ga0496102_0095490 3300048905 Bacteria 2755
588 Ga0496102_0188883 3300048905 Bacteria 1941
589 Ga0496102_0329639 3300048905 Bacteria 1438
590 Ga0496102_0793139 3300048905 Bacteria 870
591 Ga0496103_0051455 3300048906 Bacteria 2549
592 Ga0496104_0018966 3300048907 Bacteria 6284
593 Ga0496104_0100267 3300048907 Bacteria 2772
594 Ga0496104_0105635 3300048907 Bacteria 2698
595 Ga0496104_0212907 3300048907 Bacteria 1844
596 Ga0496104_0331325 3300048907 Bacteria 1435
597 Ga0496105_0003152 3300048908 Bacteria 12139
598 Ga0496105_0026746 3300048908 Bacteria 4709
599 Ga0496106_0008915 3300048909 Bacteria 7416
600 Ga0496106_0020373 3300048909 Bacteria 4921
601 Ga0496106_0022284 3300048909 Bacteria 4705
602 Ga0496106_0056224 3300048909 Bacteria 2974
603 Ga0496106_0163280 3300048909 Bacteria 1762
604 Ga0496107_0009868 3300048910 Bacteria 6621
605 Ga0496107_0010008 3300048910 Bacteria 6577
606 Ga0496107_0188546 3300048910 Bacteria 1532
607 Ga0496107_0215430 3300048910 Bacteria 1428
608 Ga0496108_0002970 3300048911 Bacteria 13628
609 Ga0496108_0014497 3300048911 Bacteria 6435
610 Ga0496108_0085688 3300048911 Bacteria 2674
611 Ga0496108_0365672 3300048911 Bacteria 1259
612 Ga0496109_0001625 3300048912 Bacteria 18767
613 Ga0496109_0053669 3300048912 Bacteria 3676
614 Ga0496109_0080471 3300048912 Bacteria 3001
615 Ga0496110_0011002 3300048913 Bacteria 7383
616 Ga0496110_0016721 3300048913 Bacteria 6127
617 Ga0496110_0056079 3300048913 Bacteria 3467
618 Ga0496111_0040949 3300048914 Bacteria 3323
619 Ga0496111_0059366 3300048914 Bacteria 2771
620 Ga0496111_0172033 3300048914 Bacteria 1609
621 Ga0496112_0000067 3300048915 Bacteria 68767
622 Ga0496112_0001486 3300048915 Bacteria 18040
623 Ga0496112_0012497 3300048915 Bacteria 7802
624 Ga0496112_0349941 3300048915 Bacteria 1420
625 Ga0496113_0044386 3300048916 Bacteria 3293
626 Ga0496113_0089913 3300048916 Bacteria 2364
627 Ga0496113_0105496 3300048916 Bacteria 2188
628 Ga0496114_0032361 3300048917 Bacteria 4304
629 Ga0496115_0000957 3300048918 Bacteria 20941
630 Ga0496115_0017252 3300048918 Bacteria 5513
631 Ga0496115_0146970 3300048918 Bacteria 1946
632 Ga0496115_0165958 3300048918 Bacteria 1826
633 Ga0496117_0020701 3300048920 Bacteria 5355
634 Ga0496117_0072978 3300048920 Bacteria 2291
635 Ga0496117_0101918 3300048920 Bacteria 1813
636 Ga0496118_0003921 3300048921 Bacteria 18212
637 Ga0496118_0027881 3300048921 Bacteria 4770
638 Ga0496118_0130451 3300048921 Bacteria 1615
639 Ga0496118_0133893 3300048921 Bacteria 1585
640 Ga0496118_0242686 3300048921 Bacteria 1030
641 Ga0496119_0038204 3300048922 Bacteria 3106
642 Ga0496119_0049624 3300048922 Bacteria 2593
643 Ga0496119_0075073 3300048922 Bacteria 1966
644 Ga0496119_0077974 3300048922 Bacteria 1918
645 Ga0496120_0104170 3300048923 Bacteria 1493
646 Ga0496121_0002482 3300048924 Bacteria 28104
647 Ga0496121_0005239 3300048924 Bacteria 16773
648 Ga0496121_0012487 3300048924 Bacteria 9251
649 Ga0496121_0013038 3300048924 Bacteria 8977
650 Ga0496121_0014450 3300048924 Bacteria 8377
651 Ga0496121_0018073 3300048924 Bacteria 7136
652 Ga0496121_0027618 3300048924 Bacteria 5306
653 Ga0496121_0036115 3300048924 Bacteria 4409
654 Ga0496121_0057910 3300048924 Bacteria 3208
655 Ga0496121_0091869 3300048924 Bacteria 2368
656 Ga0496121_0112327 3300048924 Bacteria 2076
657 Ga0496121_0118614 3300048924 Bacteria 2002
658 Ga0496121_0151439 3300048924 Bacteria 1706
659 Ga0496121_0225375 3300048924 Bacteria 1317
660 Ga0496122_0059028 3300048925 Bacteria 2835
661 Ga0496122_0093554 3300048925 Bacteria 2038
662 Ga0496123_0035988 3300048926 Bacteria 3518
663 Ga0496124_0005282 3300048927 Bacteria 14613
664 Ga0496124_0127104 3300048927 Bacteria 2029
665 Ga0496124_0267765 3300048927 Bacteria 1253
666 Ga0496125_0001539 3300048928 Bacteria 32996
667 Ga0496125_0004356 3300048928 Bacteria 16410
668 Ga0496125_0020341 3300048928 Bacteria 6229
669 Ga0496125_0027614 3300048928 Bacteria 5141
670 Ga0496125_0213838 3300048928 Bacteria 1249
671 Ga0496126_0003507 3300048929 Bacteria 19762
672 Ga0496126_0010129 3300048929 Bacteria 9928
673 Ga0496126_0012947 3300048929 Bacteria 8517
674 Ga0496126_0016130 3300048929 Bacteria 7486
675 Ga0496126_0019990 3300048929 Bacteria 6579
676 Ga0496126_0061446 3300048929 Bacteria 3374
677 Ga0496126_0137250 3300048929 Bacteria 2108
678 Ga0496126_0180411 3300048929 Bacteria 1794
679 Ga0496126_0186246 3300048929 Bacteria 1760
680 Ga0496126_0230146 3300048929 Bacteria 1553
681 Ga0496126_0258947 3300048929 Bacteria 1447
682 Ga0495678_041922 3300049459 Bacteria 1828
683 Ga0495682_0011221 3300049460 Bacteria 3451
684 Ga0501031_0013153 3300049568 Bacteria 5400
685 Ga0501031_0017108 3300049568 Bacteria 4710
686 Ga0501031_0024938 3300049568 Bacteria 3900
687 Ga0501031_0057877 3300049568 Bacteria 2525
688 Ga0501031_0058673 3300049568 Bacteria 2508
689 Ga0501032_0000228 3300049569 Bacteria 46774
690 Ga0501032_0011743 3300049569 Bacteria 6280
691 Ga0501032_0086257 3300049569 Bacteria 2086
692 Ga0501033_0000256 3300049570 Bacteria 50977
693 Ga0501033_0000801 3300049570 Bacteria 28787
694 Ga0501033_0096473 3300049570 Bacteria 2160
695 Ga0501034_0000175 3300049571 Bacteria 119465
696 Ga0501034_0105460 3300049571 Bacteria 2811
697 Ga0501034_0186844 3300049571 Bacteria 2035
698 Ga0501036_0000158 3300049572 Bacteria 44516
699 Ga0501036_0024612 3300049572 Bacteria 5077
700 Ga0501036_0136257 3300049572 Bacteria 2072
701 Ga0501036_0181888 3300049572 Bacteria 1769
702 Ga0501037_0000126 3300049573 Bacteria 71116
703 Ga0501037_0001919 3300049573 Bacteria 15082
704 Ga0501037_0026941 3300049573 Bacteria 4246
705 Ga0501037_0126269 3300049573 Bacteria 1836
706 Ga0501037_0248409 3300049573 Bacteria 1245
707 Ga0501038_0000114 3300049574 Bacteria 68140
708 Ga0501038_0129917 3300049574 Bacteria 2069
709 Ga0501038_0193504 3300049574 Bacteria 1635
710 Ga0501038_0371342 3300049574 Bacteria 1111
711 Ga0501039_0002583 3300049575 Bacteria 13528
712 Ga0501039_0030218 3300049575 Bacteria 4176
713 Ga0501041_0166364 3300049577 Bacteria 1379
714 Ga0501042_0019785 3300049578 Bacteria 4680
715 Ga0501042_0146194 3300049578 Bacteria 1704
716 Ga0501042_0147581 3300049578 Bacteria 1695
717 Ga0501043_0002516 3300049579 Bacteria 15489
718 Ga0501043_0005805 3300049579 Bacteria 9929
719 Ga0501043_0241623 3300049579 Bacteria 1392
720 Ga0501046_0000575 3300049580 Bacteria 36255
721 Ga0501046_0042974 3300049580 Bacteria 3600
722 Ga0501046_0238877 3300049580 Bacteria 1340
723 Ga0501047_0001252 3300049581 Bacteria 25141
724 Ga0501047_0038451 3300049581 Bacteria 4630
725 Ga0501047_0058668 3300049581 Bacteria 3717
726 Ga0501048_0004556 3300049582 Bacteria 10545
727 Ga0501067_0000096 3300049583 Bacteria 50761
728 Ga0501068_0001140 3300049584 Bacteria 14063
729 Ga0501068_0025754 3300049584 Bacteria 3461
730 Ga0501068_0083355 3300049584 Bacteria 1965
731 Ga0501069_0002391 3300049585 Bacteria 9524
732 Ga0501069_0022910 3300049585 Bacteria 3401
733 Ga0501069_0136713 3300049585 Bacteria 1405
734 Ga0501070_0063565 3300049586 Bacteria 3057
735 Ga0501071_0038904 3300049587 Bacteria 3401
736 Ga0501072_0010681 3300049588 Bacteria 6992
737 Ga0501072_0116458 3300049588 Bacteria 2128
738 Ga0501072_0497586 3300049588 Bacteria 964
739 Ga0501073_0000035 3300049589 Bacteria 94077
740 Ga0501073_0071424 3300049589 Bacteria 2418
741 Ga0501074_0000266 3300049590 Bacteria 29764
742 Ga0501074_0079733 3300049590 Bacteria 2349
743 Ga0501075_0091990 3300049591 Bacteria 2302
744 Ga0501075_0183436 3300049591 Bacteria 1597
745 Ga0501077_0069453 3300049593 Bacteria 2233
746 Ga0501080_0002934 3300049742 Bacteria 14979
747 Ga0501080_0035061 3300049742 Bacteria 4684
748 Ga0501081_0107442 3300049743 Bacteria 1979
749 Ga0501083_0001979 3300049744 Bacteria 14089
750 Ga0501083_0012473 3300049744 Bacteria 5943
751 Ga0501035_0067061 3300049822 Bacteria 3185
752 Ga0501044_0000061 3300049823 Bacteria 133207
753 Ga0501044_0013261 3300049823 Bacteria 8922
754 Ga0501044_0114958 3300049823 Bacteria 2696
755 Ga0501044_0226125 3300049823 Bacteria 1820
756 Ga0501045_0021478 3300049824 Bacteria 4617
757 Ga0501045_0024070 3300049824 Bacteria 4370
758 Ga0501045_0229531 3300049824 Bacteria 1382
759 nmdc:mga03n38_1950_c1 3300050490 Bacteria 6191
760 nmdc:mga03n38_4297_c1 3300050490 Bacteria 4697
761 nmdc:mga00v17_350526_c1 3300050491 Bacteria 960
762 nmdc:mga0yw44_17702_c1 3300050492 Bacteria 3885
763 nmdc:mga0yw44_202602_c1 3300050492 Bacteria 1311
764 nmdc:mga0yw44_49203_c1 3300050492 Bacteria 2543
765 nmdc:mga06z11_11702_c1 3300050494 Bacteria 3791
766 nmdc:mga06z11_163350_c1 3300050494 Bacteria 1274
767 nmdc:mga06z11_18394_c1 3300050494 Bacteria 3191
768 nmdc:mga06z11_5095_c1 3300050494 Bacteria 5236
769 nmdc:mga06z11_72258_c1 3300050494 Bacteria 1829
770 nmdc:mga06z11_78177_c1 3300050494 Bacteria 1768
771 nmdc:mga07m45_43911_c1 3300050496 Bacteria 2507
772 nmdc:mga07m45_56443_c1 3300050496 Bacteria 2220
773 nmdc:mga07m45_56705_c1 3300050496 Bacteria 2215
774 nmdc:mga0qj67_233456_c1 3300050509 Bacteria 1492
775 nmdc:mga0n895_17823_c1 3300050512 Bacteria 6556
776 nmdc:mga0rr50_203500_c1 3300050513 Bacteria 1628
777 nmdc:mga0a205_193190_c1 3300050515 Bacteria 1927
778 nmdc:mga0sz30_97499_c1 3300050516 Bacteria 1283
779 Ga0495601_0027651 3300053077 Bacteria 3507
780 Ga0495601_0043689 3300053077 Bacteria 2814
781 Ga0495601_0237248 3300053077 Bacteria 1191
782 Ga0500635_0031591 3300053080 Bacteria 1715
783 Ga0495595_0008133 3300053084 Bacteria 4300
784 Ga0495619_0000209 3300053085 Bacteria 42507
785 Ga0495619_0034899 3300053085 Bacteria 3270
786 Ga0495619_0037389 3300053085 Bacteria 3163
787 Ga0500643_000073 3300053087 Bacteria 112517
788 Ga0500643_023825 3300053087 Bacteria 1951
789 Ga0500644_0014943 3300053088 Bacteria 2202
790 Ga0500646_0021456 3300053090 Bacteria 1721
791 Ga0500651_0142090 3300053093 Bacteria 1446
792 Ga0500566_0000287 3300053094 Bacteria 27092
793 Ga0500566_0008946 3300053094 Bacteria 5921
794 Ga0500566_0031270 3300053094 Bacteria 3104
795 Ga0500566_0147484 3300053094 Bacteria 1241
796 Ga0500640_016238 3300053095 Bacteria 3138
797 Ga0500641_0041366 3300053096 Bacteria 1864
798 Ga0500648_112162 3300053097 Bacteria 1504
799 Ga0500650_0025611 3300053098 Bacteria 2638
800 Ga0500556_0000002 3300053104 Bacteria 773626
801 Ga0500557_000075 3300053105 Bacteria 38272
802 Ga0500562_019814 3300053108 Bacteria 1743
803 Ga0500569_007833 3300053109 Bacteria 2417
804 Ga0500572_003304 3300053111 Bacteria 3711
805 Ga0500572_003442 3300053111 Bacteria 3619
806 Ga0500591_043953 3300053115 Bacteria 2116
807 Ga0500592_001974 3300053116 Bacteria 3302
808 Ga0500593_086294 3300053117 Bacteria 1336
809 Ga0500595_002765 3300053119 Bacteria 8449
810 Ga0500595_010232 3300053119 Bacteria 3736
811 Ga0500595_030083 3300053119 Bacteria 1834
812 Ga0500608_003832 3300053122 Bacteria 5724
813 Ga0500608_058757 3300053122 Bacteria 1841
814 Ga0500614_003481 3300053123 Bacteria 3382
815 Ga0500618_012457 3300053125 Bacteria 2227
816 Ga0500642_0000058 3300053130 Bacteria 66200
817 Ga0500642_0042197 3300053130 Bacteria 1976
818 Ga0500652_000951 3300053131 Bacteria 9598
819 Ga0500559_0000950 3300053136 Bacteria 18255
820 Ga0500559_0001333 3300053136 Bacteria 14208
821 Ga0500559_0002249 3300053136 Bacteria 10197
822 Ga0500559_0051614 3300053136 Bacteria 1816
823 Ga0500564_086045 3300053138 Bacteria 1403
824 Ga0500564_098986 3300053138 Bacteria 1291
825 Ga0500568_0000901 3300053139 Bacteria 20600
826 Ga0500568_0046425 3300053139 Bacteria 1724
827 Ga0500568_0050066 3300053139 Bacteria 1647
828 Ga0500568_0068785 3300053139 Bacteria 1359
829 Ga0500573_0010293 3300053140 Bacteria 5215
830 Ga0500589_034877 3300053147 Bacteria 2349
831 Ga0500603_001567 3300053150 Bacteria 5171
832 Ga0500603_002092 3300053150 Bacteria 4419
833 Ga0500603_066706 3300053150 Bacteria 1017
834 Ga0500604_0057420 3300053151 Bacteria 1215
835 Ga0500616_0000045 3300053153 Bacteria 339292
836 Ga0500616_0000069 3300053153 Bacteria 234334
837 Ga0500619_074766 3300053154 Bacteria 1131
838 Ga0500622_0001010 3300053156 Bacteria 23689
839 Ga0500627_0011994 3300053158 Bacteria 3228
840 Ga0500630_003479 3300053159 Bacteria 7615
841 Ga0500634_0090164 3300053161 Bacteria 1558
842 Ga0500638_022337 3300053162 Bacteria 2997
843 Ga0500638_082705 3300053162 Bacteria 1522
844 Ga0500639_001271 3300053163 Bacteria 12769
845 Ga0500636_0002782 3300053177 Bacteria 9762
846 Ga0500636_0041083 3300053177 Bacteria 2735
847 Ga0500636_0058335 3300053177 Bacteria 2256
848 Ga0500636_0129232 3300053177 Bacteria 1409
849 Ga0500637_0000464 3300053178 Bacteria 15643
850 Ga0500637_0038564 3300053178 Bacteria 2692
851 Ga0500637_0069756 3300053178 Bacteria 2021
852 Ga0500637_0109848 3300053178 Bacteria 1599
853 Ga0500576_037297 3300053725 Bacteria 2197
854 Ga0500625_028970 3300053729 Bacteria 2628
855 Ga0500645_013379 3300053730 Bacteria 2633
856 Ga0500609_014298 3300053731 Bacteria 1075
857 Ga0500596_001508 3300053735 Bacteria 4712
858 Ga0500601_000330 3300053737 Bacteria 8649
859 Ga0500601_001593 3300053737 Bacteria 2457
860 Ga0501084_0004658 3300054114 Bacteria 11194
861 Ga0501084_0008344 3300054114 Bacteria 8551
862 Ga0587073_0008817 3300059492 Bacteria 1644
863 Ga0587076_005304 3300059645 Bacteria 1660
864 Ga0501082_0009197 3300060353 Bacteria 8517
865 Ga0501082_0019107 3300060353 Bacteria 5904
866 Ga0501082_0280619 3300060353 Bacteria 1450
867 Ga0530510_0342768 3300061734 Bacteria 1122
868 2507509348 2507262055 Bacteria 8048963
869 2508543404 2508501009 Bacteria 7784016
870 2508698822 2508501042 Bacteria 8719808
871 2509147321 2508501128 Bacteria 8613869
872 2511396859 2511231028 Bacteria 8046582
873 2513626826 2513237092 Bacteria 8341956
874 2513637915 2513237094 Bacteria 8789602
875 2513646648 2513237095 Bacteria 8976980
876 2513672262 2513237098 Bacteria 9902361
877 2513691842 2513237101 Bacteria 7952346
878 2513701324 2513237102 Bacteria 7703324
879 2513718518 2513237104 Bacteria 10034502
880 2513876454 2513237139 Bacteria 8737671
881 2513895025 2513237141 Bacteria 8496279
882 2514010795 2513237161 Bacteria 8871253
883 2515628940 2515154112 Bacteria 8294334
884 2517102003 2517093001 Bacteria 9002274
885 2524436568 2524023205 Bacteria 8918781
886 2524466921 2524023210 Bacteria 9029266
887 2528851554 2528768022 Bacteria 10457665
888 2603858871 2602042107 Bacteria 6226103
889 2617352307 2617270735 Bacteria 9163226
890 2617376480 2617270741 Bacteria 8201522
891 2723845758 2721755755 Bacteria 8322773
892 2728753238 2728368998 Bacteria 8720350
893 2745081140 2744054633 Bacteria 8678936
894 2793064041 2791355196 Bacteria 7323613
895 2793077268
896 2805919733 2802429603 Bacteria 8777136
897 2818240158 2816332527 Bacteria 8933356
898 2824603288 2824600985 Bacteria 8488197
899 2824614063 2824609381 Bacteria 8672835
900 2824619815 2824617872 Bacteria 8814715
901 2824629423 2824626560 Bacteria 8813858
902 2824637065 2824635225 Bacteria 8785348
903 2824648500 2824644064 Bacteria 8743947
904 2824656611 2824653114 Bacteria 8493680
905 2824667865 2824661429 Bacteria 9877870
906 2824676492 2824671348 Bacteria 8369588
907 2824684912 2824679649 Bacteria 8248951
908 2824692926 2824687955 Bacteria 8360029
909 2824701568 2824696289 Bacteria 8335049
910 2824710218 2824704595 Bacteria 9667483
911 2824716306 2824714736 Bacteria 8717648
912 2824726144 2824723954 Bacteria 8758240
913 2824736984 2824732956 Bacteria 7810675
914 2824750866 2824746037 Bacteria 7911610
915 2824758590 2824753945 Bacteria 9787441
916 2824768329 2824763712 Bacteria 9792355
917 2824779149 2824773399 Bacteria 8360218
918 2838126545 2838122688 Bacteria 8803140
919 2841947204 2841941048 Bacteria 8688029
920 2841950646 2841949485 Bacteria 8680857
921 2841957976 2841957949 Bacteria 8652217
922 2841966961 2841966195 Bacteria 8673214
923 2841975711 2841974524 Bacteria 8931498
924 2841990072 2841983080 Bacteria 8395090
925 2842039761 2842038055 Bacteria 8002051
926 2842047293 2842045827 Bacteria 8006841
927 2844318377 2844315083 Bacteria 8138177
928 2847935267 2847930680 Bacteria 9342022
929 2847945858 2847939898 Bacteria 8606328
930 2849080007 2849076700 Bacteria 7039503
931 2857510621 2857509624 Bacteria 7472071
932 2857528024 2857524615 Bacteria 6615449
933 2874597457 2874590934 Bacteria 8299676
934 2874609624 2874604998 Bacteria 7834745
935 2874612841 2874612657 Bacteria 8252029
936 2874627886 2874620515 Bacteria 8290088
937 2874636250 2874628541 Bacteria 8630250
938 2874648533 2874645413 Bacteria 8214782
939 2876770725 2876761206 Bacteria 10111113
940 2876777746 2876771140 Bacteria 8287509
941 2876809510 2876808645 Bacteria 8824342
942 2876822495 2876818435 Bacteria 8274608
943 2879078154 2879074833 Bacteria 8279565
944 2879088990 2879083081 Bacteria 8587928
945 2879102603 2879099564 Bacteria 10442239
946 2879118516 2879110137 Bacteria 8907982
947 2879134505 2879127579 Bacteria 8294491
948 2879149960 2879142872 Bacteria 8267021
949 2881366695 2881364244 Bacteria 7710352
950 2881669547 2881665667 Bacteria 8175609
951 2885371772 2885366525 Bacteria 8326213
952 2885383824 2885383462 Bacteria 9473874
953 2885416979 2885409591 Bacteria 9235467
954 2888383320 2888378607 Bacteria 9652610
955 2888394602 2888388044 Bacteria 7304136
956 2888423708 2888419890 Bacteria 7857137
957 2889040574 2889033259 Bacteria 9099371
958 2893068441 2893066018 Bacteria 6158120
959 2903729325 2903727486 Bacteria 8281579
960 2903772721 2903768456 Bacteria 9749579
961 2904672794 2904666416 Bacteria 8226587
962 2904717164 2904711408 Bacteria 9771557
963 2906606034 2906602504 Bacteria 8295279
964 2906627841 2906626472 Bacteria 8826946
965 2906648766 2906643746 Bacteria 8722424
966 2908779418 2908775508 Bacteria 8092255
967 2919075421 2919073203 Bacteria 6531949
968 2922367703 2922361189 Bacteria 7436256
969 2922373478
970 2922392401 2922386360 Bacteria 7017218
971 2922395630 2922393267 Bacteria 8285685
972 2929617224 2929615660 Bacteria 9193770
973 2929626928 2929624759 Bacteria 9339455
974 2932787758 2932784394 Bacteria 9704911
975 2932796499 2932794094 Bacteria 7915132
976 2932803505 2932801729 Bacteria 7987968
977 2932813086 2932809354 Bacteria 9135765
978 2932820998 2932818245 Bacteria 9955613
979 2932835215 2932828146 Bacteria 9745859
980 2933579181 2933577622 Bacteria 9116884
981 2935611763 2935608549 Bacteria 8203142
982 2935621594 2935616580 Bacteria 9032984
983 2935645527 2935638405 Bacteria 10015038
984 2935651832 2935648319 Bacteria 8801166
985 2935660642 2935656913 Bacteria 8965014
986 2935667645 2935665750 Bacteria 9571747
987 2935681807 2935675223 Bacteria 9928132
988 2935688393 2935684952 Bacteria 9590419
989 2935695737 2935694250 Bacteria 9291695
990 2935706486 2935703347 Bacteria 10242284
991 2935715412 2935713505 Bacteria 9608509
992 2935726024 2935722832 Bacteria 9608746
993 2935734231 2935732158 Bacteria 9706831
994 2935743610 2935741537 Bacteria 9707219
995 2935754353 2935750917 Bacteria 9590372
996 2935768531 2935760218 Bacteria 9817913
997 2935774008 2935769743 Bacteria 7878163
998 2935780554 2935777560 Bacteria 8077691
999 2935789598 2935785616 Bacteria 7962367
1000 2935797375 2935793552 Bacteria 8012592
1001 2935806547 2935801545 Bacteria 9301974
1002 2935813140 2935810662 Bacteria 9401221
1003 2935821241 2935819856 Bacteria 8261050
1004 2935830793 2935827899 Bacteria 10038562
1005 2935840819 2935837841 Bacteria 9454360
1006 2935850498 2935847175 Bacteria 8228321
1007 2935859841 2935855204 Bacteria 9035059
1008 2935869059 2935864058 Bacteria 9784707
1009 2935880721 2935873716 Bacteria 9632195
1010 2935886575 2935883170 Bacteria 7964738
1011 2935914102 2935908558 Bacteria 8568796
1012 2935921271 2935916978 Bacteria 9113783
1013 2935931709 2935926038 Bacteria 8601059
1014 2935940356 2935934488 Bacteria 8602579
1015 2935947819 2935942939 Bacteria 8599779
1016 2935956640 2935951376 Bacteria 8602333
1017 2935960452 2935959822 Bacteria 7869783
1018 2935973433 2935967501 Bacteria 8603075
1019 2935980952 2935975950 Bacteria 8347125
1020 2935989601 2935984226 Bacteria 8302647
1021 2935999369 2935992306 Bacteria 9802711
1022 2936006648 2936002035 Bacteria 9362176
1023 2936014698 2936011229 Bacteria 8801034
1024 2936023505 2936019824 Bacteria 8804134
1025 2936032533 2936028420 Bacteria 8965941
1026 2936043692 2936037263 Bacteria 9446081
1027 2936050439 2936046547 Bacteria 8903709
1028 2936059069 2936055302 Bacteria 8785755
1029 2940560271 2940556831 Bacteria 9590747
1030 2941534136 2941531003 Bacteria 7653939
1031 2941541050 2941538514 Bacteria 9402094
1032 3005489456 3005483717 Bacteria 7877331
1033 3005511886 3005506211 Bacteria 6943378
1034 3005588599 3005587118 Bacteria 7794411
1035 3005598468 3005594810 Bacteria 8716512
1036 3005714151 3005710791 Bacteria 7622528
1037 3005721657 3005718088 Bacteria 8283608
1038 8006928405 8006926726 Bacteria 6749210
1039 8006967400 8006964411 Bacteria 8966052
1040 8006988143 8006984368 Bacteria 9651211
1041 8006997714 8006994254 Bacteria 8309700
1042 8016514196 8016511872 Bacteria 9921665
1043 8016530389 8016522445 Bacteria 8156687
1044 8016535656 8016530956 Bacteria 8155261
1045 8016539942 8016539877 Bacteria 8155419
1046 8016553291 8016548790 Bacteria 8155074
1047 8016561669 8016557553 Bacteria 8154380
1048 8016573992 8016566248 Bacteria 8158151
1049 8016578113 8016575299 Bacteria 8154085
1050 8016592763 8016583857 Bacteria 10421953
1051 8016599505 8016595262 Bacteria 8149947
1052 8016611483 8016603502 Bacteria 8731218
1053 8016622311 8016613128 Bacteria 8794220
1054 8017062224 8017057580 Bacteria 10023680
1055 8019535380 8019530166 Bacteria 8155624
1056 8019544117 8019538911 Bacteria 7872763
1057 8019554686 8019547302 Bacteria 7996444
1058 8019581674 8019576017 Bacteria 10049540
1059 8019589338 8019586578 Bacteria 10212056
1060 8019601921 8019597564 Bacteria 10041141
1061 8019616631 8019608314 Bacteria 10042931
1062 8019627341 8019619141 Bacteria 9218857
1063 8019635230 8019629233 Bacteria 8687553
1064 8019657511 8019648815 Bacteria 10014479
1065 8019663073 8019659431 Bacteria 8577854
1066 8019689233 8019687851 Bacteria 8712826
1067 8055747161 8055742211 Bacteria 9226248
1068 8056674506 8056673599 Bacteria 7871253
1069 8056685343 8056681323 Bacteria 8472857
1070 8056972734 8056967851 Bacteria 9038162
1071 Ga0495588_0122706
1072 LJQas_1003452
1073 JGI24740J21852_10003514
1074 JGI24739J22299_10004040
1075 JGI24739J22299_10023184
1076 JGI24735J21928_10041635
1077 JGI25406J46586_10000681
1078 JGI25406J46586_10007934
1079 JGI25406J46586_10010769
1080 JGI25153J46596_10001663
1081 JGI25153J46596_10009558
1082 JGI25153J46596_10021943
1083 JGI25160J50197_1006279
1084 Ga0065165_1010229
1085 Ga0065165_1015921
1086 Ga0065165_1017568
1087 Ga0065165_1035060
1088 Ga0070676_10073860
1089 Ga0070683_100012067
1090 Ga0070670_100220830
1091 Ga0068869_100053313
1092 Ga0070680_100103061
1093 Ga0070682_100071524
1094 Ga0068868_100140883
1095 Ga0070689_100068147
1096 Ga0070661_100207003
1097 Ga0070669_100076157
1098 Ga0070675_100328591
1099 Ga0070671_100510736
1100 Ga0070674_100035769
1101 Ga0070667_100446420
1102 Ga0070709_10006429
1103 Ga0070709_10069938
1104 Ga0070714_100066333
1105 Ga0070714_100205608
1106 Ga0070713_100040032
1107 Ga0070713_100044479
1108 Ga0070713_100092759
1109 Ga0070713_100334506
1110 Ga0070713_100337344
1111 Ga0070710_10060511
1112 Ga0070711_100006622
1113 Ga0070711_100026652
1114 Ga0070711_100085676
1115 Ga0070711_100294780
1116 Ga0070663_100013100
1117 Ga0070663_100123466
1118 Ga0070663_100174671
1119 Ga0070678_100209656
1120 Ga0070681_10405718
1121 Ga0070706_100050747
1122 Ga0070698_100070517
1123 Ga0070679_100017345
1124 Ga0070679_100085691
1125 Ga0070684_100007669
1126 Ga0070684_100083032
1127 Ga0068853_100038146
1128 Ga0068853_100125163
1129 Ga0068853_100273987
1130 Ga0068853_100313701
1131 Ga0068853_100354446
1132 Ga0070665_100052156
1133 Ga0070665_100100312
1134 Ga0070665_100195162
1135 Ga0070665_100260283
1136 Ga0068855_100025224
1137 Ga0068855_100028801
1138 Ga0068855_100712891
1139 Ga0068857_100025174
1140 Ga0068854_100014933
1141 Ga0068856_100000206
1142 Ga0068856_100001326
1143 Ga0068856_100068934
1144 Ga0068856_100484731
1145 Ga0068856_100527725
1146 Ga0068852_100035095
1147 Ga0068852_100170819
1148 Ga0068852_100183842
1149 Ga0068859_100127304
1150 Ga0068864_100199011
1151 Ga0068851_10008264
1152 Ga0068863_100095029
1153 Ga0068858_100098589
1154 Ga0068860_100002375
1155 Ga0068862_100068047
1156 Ga0081455_10042961
1157 Ga0081455_10091358
1158 Ga0081455_10125752
1159 Ga0081538_10036458
1160 Ga0081540_1008342
1161 Ga0081540_1010657
1162 Ga0081540_1011623
1163 Ga0081540_1015698
1164 Ga0081540_1016078
1165 Ga0081540_1020343
1166 Ga0081540_1036212
1167 Ga0081540_1048398
1168 Ga0081539_10000250
1169 Ga0081539_10000269
1170 Ga0081539_10027360
1171 Ga0070717_10057850
1172 Ga0070717_10134231
1173 Ga0070717_10519734
1174 Ga0075365_10069850
1175 Ga0075365_10150026
1176 Ga0075365_10246942
1177 Ga0075368_10048775
1178 Ga0075363_100005065
1179 Ga0075363_100009347
1180 Ga0075363_100010490
1181 Ga0075364_10236518
1182 Ga0070716_100037021
1183 Ga0070716_100250244
1184 Ga0070712_100055641
1185 Ga0070712_100059043
1186 Ga0070712_100116165
1187 Ga0075362_10030652
1188 Ga0075367_10015272
1189 Ga0075367_10044543
1190 Ga0075367_10107624
1191 Ga0075367_10124755
1192 Ga0075367_10159841
1193 Ga0075369_10032400
1194 Ga0075369_10063059
1195 Ga0075369_10068356
1196 Ga0075370_10009268
1197 Ga0075370_10042123
1198 Ga0068871_100109380
1199 Ga0075434_100033334
1200 Ga0075434_100148429
1201 Ga0075429_100284262
1202 Ga0075436_100339594
1203 Ga0097620_100127308
1204 Ga0099824_1010776
1205 Ga0099822_1007032
1206 Ga0075435_100172117
1207 Ga0075435_100217598
1208 Ga0105240_10004110
1209 Ga0105240_10020952
1210 Ga0105240_10136296
1211 Ga0105240_10198672
1212 Ga0105240_10211423
1213 Ga0105240_10245748
1214 Ga0111539_10616935
1215 Ga0105245_10316279
1216 Ga0105245_10707677
1217 Ga0105247_10030092
1218 Ga0105241_10003155
1219 Ga0105241_10166359
1220 Ga0105241_10278762
1221 Ga0105248_10134532
1222 Ga0105248_10597218
1223 Ga0105248_10693657
1224 Ga0105237_10136757
1225 Ga0105237_10231033
1226 Ga0105237_10237303
1227 Ga0105237_10239637
1228 Ga0105237_10255481
1229 Ga0105238_10006149
1230 Ga0105238_10011037
1231 Ga0105238_10163736
1232 Ga0105249_10324105
1233 Ga0099796_10049270
1234 Ga0105239_10089983
1235 Ga0105239_10140766
1236 Ga0105239_10154714
1237 Ga0105239_10155496
1238 Ga0105239_10157174
1239 Ga0105239_10412160
1240 Ga0105246_10080117
1241 Ga0105246_10130698
1242 Ga0105246_10192340
1243 Ga0105246_10416175
1244 Ga0157343_1001037
1245 Ga0157373_10131884
1246 Ga0157370_10168811
1247 Ga0157370_10250559
1248 Ga0157370_10293360
1249 Ga0157369_10011202
1250 Ga0157374_10093029
1251 Ga0157374_10312218
1252 Ga0157378_10033388
1253 Ga0157378_10759876
1254 Ga0157372_10298676
1255 Ga0157372_10583608
1256 Ga0157375_10441064
1257 Ga0157375_10612230
1258 Ga0163163_10129461
1259 Ga0157376_10061271
1260 Ga0214544_1000009
1261 Ga0214542_1000002
1262 Ga0214545_1000002
1263 Ga0214545_1031392
1264 Ga0214543_1000013
1265 Ga0214543_1037592
1266 Ga0213873_10010664
1267 Ga0213876_10004973
1268 Ga0213871_10045487
1269 Ga0224712_10034645
1270 Ga0209677_100736
1271 Ga0209677_108959
1272 Ga0209148_1006655
1273 Ga0209233_1001809
1274 Ga0209233_1004669
1275 Ga0209233_1007743
1276 Ga0209455_1002875
1277 Ga0209130_1017710
1278 Ga0209564_1000943
1279 Ga0209564_1010264
1280 Ga0209564_1021493
1281 Ga0209564_1027239
1282 Ga0209758_1000021
1283 Ga0209758_1001379
1284 Ga0209758_1002994
1285 Ga0209758_1003248
1286 Ga0209758_1003460
1287 Ga0209758_1006119
1288 Ga0209256_1001949
1289 Ga0209256_1020036
1290 Ga0207426_1001467
1291 Ga0207426_1005148
1292 Ga0207426_1010935
1293 Ga0209257_1003545
1294 Ga0207697_10039413
1295 Ga0207653_10017165
1296 Ga0207682_10047633
1297 Ga0207692_10134061
1298 Ga0207710_10020119
1299 Ga0207688_10029081
1300 Ga0207688_10233745
1301 Ga0207647_10005487
1302 Ga0207699_10001483
1303 Ga0207699_10017822
1304 Ga0207699_10074296
1305 Ga0207645_10054365
1306 Ga0207705_10063067
1307 Ga0207705_10368050
1308 Ga0207684_10028455
1309 Ga0207684_10356277
1310 Ga0207654_10000304
1311 Ga0207707_10003136
1312 Ga0207707_10043241
1313 Ga0207695_10000278
1314 Ga0207695_10000402
1315 Ga0207695_10025863
1316 Ga0207695_10115163
1317 Ga0207695_10319576
1318 Ga0207695_10348644
1319 Ga0207671_10021353
1320 Ga0207671_10200281
1321 Ga0207671_10259434
1322 Ga0207693_10059682
1323 Ga0207693_10065183
1324 Ga0207663_10020032
1325 Ga0207663_10040030
1326 Ga0207663_10067480
1327 Ga0207660_10037773
1328 Ga0207660_10052062
1329 Ga0207660_10245089
1330 Ga0207657_10023474
1331 Ga0207657_10099572
1332 Ga0207652_10015934
1333 Ga0207652_10169893
1334 Ga0207681_10191633
1335 Ga0207681_10465509
1336 Ga0207694_10009967
1337 Ga0207694_10055453
1338 Ga0207694_10344219
1339 Ga0207694_10364781
1340 Ga0207659_10194976
1341 Ga0207687_10151637
1342 Ga0207700_10000968
1343 Ga0207700_10113238
1344 Ga0207664_10050335
1345 Ga0207664_10107071
1346 Ga0207644_10282103
1347 Ga0207686_10067968
1348 Ga0207709_10037439
1349 Ga0207670_10062461
1350 Ga0207704_10144315
1351 Ga0207665_10066360
1352 Ga0207665_10120738
1353 Ga0207711_10109585
1354 Ga0207661_10000608
1355 Ga0207661_10071211
1356 Ga0207667_10014503
1357 Ga0207667_10017031
1358 Ga0207667_10146885
1359 Ga0207667_10179114
1360 Ga0207667_10271307
1361 Ga0207668_10461085
1362 Ga0207640_10003075
1363 Ga0207703_10278533
1364 Ga0207703_10293120
1365 Ga0207639_10067327
1366 Ga0207639_10175652
1367 Ga0207639_10176190
1368 Ga0207639_10358962
1369 Ga0207639_10391381
1370 Ga0207678_10046087
1371 Ga0207678_10058194
1372 Ga0207678_10075216
1373 Ga0207678_10103715
1374 Ga0207678_10128326
1375 Ga0207708_10068571
1376 Ga0207702_10000025
1377 Ga0207702_10000516
1378 Ga0207702_10043651
1379 Ga0207702_10639760
1380 Ga0207641_10255587
1381 Ga0207648_10096241
1382 Ga0207674_10021247
1383 Ga0207674_10117089
1384 Ga0207674_10328342
1385 Ga0207683_10268887
1386 Ga0207683_10278600
1387 Ga0207698_10095506
1388 Ga0207698_10197631
1389 Ga0207698_10332633
1390 Ga0207698_10488091
1391 Ga0209589_1000003
1392 Ga0209589_1000022
1393 Ga0209489_100003
1394 Ga0209489_100070
1395 Ga0209489_100878
1396 Ga0209700_100003
1397 Ga0209700_100021
1398 Ga0209588_1020251
1399 Ga0268266_10003299
1400 Ga0268266_10097490
1401 Ga0268266_10366111
1402 Ga0268266_10497609
1403 Ga0268264_10000022
1404 Ga0268264_10214929
1405 Ga0265337_1001610
1406 Ga0265319_1012982
1407 Ga0265334_10002314
1408 Ga0265334_10044834
1409 Ga0265323_10000259
1410 Ga0265322_10003364
1411 Ga0265336_10000154
1412 Ga0307517_10000111
1413 Ga0307515_10048142
1414 Ga0265338_10000337
1415 Ga0265324_10001168
1416 Ga0265330_10064470
1417 Ga0265325_10004621
1418 Ga0265340_10003393
1419 Ga0265339_10009277
1420 Ga0265339_10044167
1421 Ga0265331_10021389
1422 Ga0307509_10012010
1423 Ga0307408_100050491
1424 Ga0307508_10000038
1425 Ga0307508_10011459
1426 Ga0265314_10007972
1427 Ga0265342_10057717
1428 Ga0307516_10008874
1429 Ga0307413_10063826
1430 Ga0307410_10187602
1431 Ga0307412_10239359
1432 Ga0307416_100481998
1433 Ga0307507_10020903
1434 Ga0307510_10002750
1435 Ga0307510_10036687
1436 Ga0307510_10055966
1437 Ga0316215_1003549
1438 Ga0373934_0018580
1439 Ga0373934_0019258
1440 Ga0373944_0003594
1441 Ga0373952_0003893
1442 Ga0373923_0001160
1443 Ga0373923_0006220
1444 Ga0373923_0006381
1445 Ga0373936_0019879
1446 Ga0373939_0052502
1447 Ga0373945_0007328
1448 Ga0373953_0000167
1449 Ga0373954_0000035
1450 Ga0373954_0028047
1451 Ga0373956_0021698
1452 Ga0373956_0033964
1453 Ga0373957_0001600
1454 Ga0373943_0014948
1455 Ga0373955_0010954
1456 Ga0373935_0000758
1457 Ga0373935_0008150
1458 Ga0373935_0024595
1459 Ga0373927_0002965
1460 Ga0373927_0013368
1461 Ga0373927_0029866
1462 Ga0373933_0000037
1463 Ga0373933_0000185
1464 Ga0373933_0097431
1465 Ga0373947_0004260
1466 Ga0373947_0019128
1467 Ga0373947_0041806
1468 Ga0373937_0000118
1469 Ga0373937_0035246
1470 Ga0373937_0079178
1471 Ga0373937_0099569
1472 Ga0373925_0068140
1473 Ga0395900_0000502
1474 Ga0395900_0037349
1475 Ga0395898_0009378
1476 Ga0395898_0071832
1477 Ga0395898_0182586
1478 Ga0395898_0315693
1479 Ga0395905_0028697
1480 Ga0395905_0042349
1481 Ga0395905_0097081
1482 Ga0395905_0148646
1483 Ga0436364_0361397
1484 Ga0395901_0264576
1485 Ga0436365_0896488
1486 Ga0436360_0091295
1487 Ga0436360_0291982
1488 Ga0439465_0034812
1489 Ga0439465_0036831
1490 Ga0450902_016645
1491 Ga0439459_0003620
1492 Ga0466972_0002195
1493 Ga0466972_0002509
1494 Ga0466965_0038102
1495 Ga0466966_0008461
1496 Ga0466966_0173448
1497 Ga0466961_0000206
1498 Ga0466963_0098287
1499 Ga0466963_0403139
1500 Ga0466968_0118631
1501 Ga0466970_0039214
1502 Ga0466957_0068239
1503 Ga0466957_0071292
1504 Ga0466959_0020150
1505 Ga0466959_0186875
1506 Ga0466967_0363164
1507 Ga0495627_092269
1508 Ga0495592_0002185
1509 Ga0495592_0006804
1510 Ga0495592_0148471
1511 Ga0495592_0260516
1512 Ga0495603_0000027
1513 Ga0495603_0155930
1514 Ga0495629_0000290
1515 Ga0495629_0010294
1516 Ga0495629_0024592
1517 Ga0495638_0030570
1518 Ga0495638_0072703
1519 Ga0495641_0005129
1520 Ga0495651_0000412
1521 Ga0495651_0014516
1522 Ga0495651_0077280
1523 Ga0495651_0254552
1524 Ga0495653_0000161
1525 Ga0495653_0095886
1526 Ga0495650_0072529
1527 Ga0495580_0003356
1528 Ga0495580_0008821
1529 Ga0495580_0133134
1530 Ga0495582_0000157
1531 Ga0495605_0080205
1532 Ga0495639_0000048
1533 Ga0495639_0016694
1534 Ga0495662_0000814
1535 Ga0495664_0007669
1536 Ga0495664_0012222
1537 Ga0495664_0020336
1538 Ga0495664_0062121
1539 Ga0495594_0001217
1540 Ga0495594_0064473
1541 Ga0495607_0016331
1542 Ga0495606_0002560
1543 Ga0495606_0128747
1544 Ga0495606_0169805
1545 Ga0495608_0000337
1546 Ga0495616_0016785
1547 Ga0495616_0064372
1548 Ga0495618_0016579
1549 Ga0495618_0086096
1550 Ga0495628_0052165
1551 Ga0495628_0052285
1552 Ga0495628_0134604
1553 Ga0495628_0195218
1554 Ga0495630_0000846
1555 Ga0495631_0021047
1556 Ga0495631_0189598
1557 Ga0495632_0071994
1558 Ga0495643_0132492
1559 Ga0495648_0001999
1560 Ga0495648_0021130
1561 Ga0495648_0049453
1562 Ga0495648_0115839
1563 Ga0495652_0012092
1564 Ga0495652_0023266
1565 Ga0495652_0053413
1566 Ga0495652_0136558
1567 Ga0495665_0002259
1568 Ga0495665_0036407
1569 Ga0495640_0004105
1570 Ga0495640_0004805
1571 Ga0495640_0018408
1572 Ga0495640_0066290
1573 Ga0495586_0093770
1574 Ga0495587_0000668
1575 Ga0495587_0027939
1576 Ga0495621_0060161
1577 Ga0495597_0041695
1578 Ga0495645_0009785
1579 Ga0495645_0038675
1580 Ga0495622_0016465
1581 Ga0495622_0045986
1582 Ga0495622_0105339
1583 Ga0495667_0000147
1584 Ga0495667_0076619
1585 Ga0495656_0084252
1586 Ga0495656_0166207
1587 Ga0495668_0071426
1588 Ga0495634_0001002
1589 Ga0495634_0057519
1590 Ga0495634_0079169
1591 Ga0495635_0000094
1592 Ga0495635_0001877
1593 Ga0495635_0025756
1594 Ga0495635_0045365
1595 Ga0495635_0108386
1596 Ga0495661_0032955
1597 Ga0495657_0001420
1598 Ga0495657_0010267
1599 Ga0495657_0067447
1600 Ga0495599_0000253
1601 Ga0495599_0050680
1602 Ga0495599_0106227
1603 Ga0495623_0000768
1604 Ga0495646_0002668
1605 Ga0495646_0055083
1606 Ga0495647_0005907
1607 Ga0495647_0015078
1608 Ga0495658_0017804
1609 Ga0495669_0065869
1610 Ga0495669_0074956
1611 Ga0495669_0167618
1612 Ga0495669_0219714
1613 Ga0495613_0006428
1614 Ga0495613_0074546
1615 Ga0495613_0117817
1616 Ga0495624_0000380
1617 Ga0495624_0142157
1618 Ga0495671_0132004
1619 Ga0495671_0143439
1620 Ga0495600_0002207
1621 Ga0495600_0005220
1622 Ga0495600_0062570
1623 Ga0495581_0000233
1624 Ga0495604_0000253
1625 Ga0495604_0017102
1626 Ga0495674_0002874
1627 Ga0495674_0054162
1628 Ga0495674_0060388
1629 Ga0495674_0159190
1630 Ga0495672_0013492
1631 Ga0495672_0074263
1632 Ga0495676_0027599
1633 Ga0495676_0150036
1634 Ga0495676_0206826
1635 Ga0495680_0000406
1636 Ga0495680_0010391
1637 Ga0495683_0022647
1638 Ga0495675_0000285
1639 Ga0495675_0048069
1640 Ga0495681_0068863
1641 Ga0495684_0000184
1642 Ga0495684_0006226
1643 Ga0495684_0119135
1644 Ga0495686_0113968
1645 Ga0495686_0151251
1646 Ga0495593_0003039
1647 Ga0495593_0004547
1648 Ga0495593_0064578
1649 Ga0495602_0001148
1650 Ga0495602_0099795
1651 Ga0496100_0008823
1652 Ga0496100_0017735
1653 Ga0496101_0014849
1654 Ga0496101_0099807
1655 Ga0496101_0129930
1656 Ga0496102_0044533
1657 Ga0496102_0095490
1658 Ga0496102_0188883
1659 Ga0496102_0329639
1660 Ga0496102_0793139
1661 Ga0496103_0051455
1662 Ga0496104_0018966
1663 Ga0496104_0100267
1664 Ga0496104_0105635
1665 Ga0496104_0212907
1666 Ga0496104_0331325
1667 Ga0496105_0003152
1668 Ga0496105_0026746
1669 Ga0496106_0008915
1670 Ga0496106_0020373
1671 Ga0496106_0022284
1672 Ga0496106_0056224
1673 Ga0496106_0163280
1674 Ga0496107_0009868
1675 Ga0496107_0010008
1676 Ga0496107_0188546
1677 Ga0496107_0215430
1678 Ga0496108_0002970
1679 Ga0496108_0014497
1680 Ga0496108_0085688
1681 Ga0496108_0365672
1682 Ga0496109_0001625
1683 Ga0496109_0053669
1684 Ga0496109_0080471
1685 Ga0496110_0011002
1686 Ga0496110_0016721
1687 Ga0496110_0056079
1688 Ga0496111_0040949
1689 Ga0496111_0059366
1690 Ga0496111_0172033
1691 Ga0496112_0000067
1692 Ga0496112_0001486
1693 Ga0496112_0012497
1694 Ga0496112_0349941
1695 Ga0496113_0044386
1696 Ga0496113_0089913
1697 Ga0496113_0105496
1698 Ga0496114_0032361
1699 Ga0496115_0000957
1700 Ga0496115_0017252
1701 Ga0496115_0146970
1702 Ga0496115_0165958
1703 Ga0496117_0020701
1704 Ga0496117_0072978
1705 Ga0496117_0101918
1706 Ga0496118_0003921
1707 Ga0496118_0027881
1708 Ga0496118_0130451
1709 Ga0496118_0133893
1710 Ga0496118_0242686
1711 Ga0496119_0038204
1712 Ga0496119_0049624
1713 Ga0496119_0075073
1714 Ga0496119_0077974
1715 Ga0496120_0104170
1716 Ga0496121_0002482
1717 Ga0496121_0005239
1718 Ga0496121_0012487
1719 Ga0496121_0013038
1720 Ga0496121_0014450
1721 Ga0496121_0018073
1722 Ga0496121_0027618
1723 Ga0496121_0036115
1724 Ga0496121_0057910
1725 Ga0496121_0091869
1726 Ga0496121_0112327
1727 Ga0496121_0118614
1728 Ga0496121_0151439
1729 Ga0496121_0225375
1730 Ga0496122_0059028
1731 Ga0496122_0093554
1732 Ga0496123_0035988
1733 Ga0496124_0005282
1734 Ga0496124_0127104
1735 Ga0496124_0267765
1736 Ga0496125_0001539
1737 Ga0496125_0004356
1738 Ga0496125_0020341
1739 Ga0496125_0027614
1740 Ga0496125_0213838
1741 Ga0496126_0003507
1742 Ga0496126_0010129
1743 Ga0496126_0012947
1744 Ga0496126_0016130
1745 Ga0496126_0019990
1746 Ga0496126_0061446
1747 Ga0496126_0137250
1748 Ga0496126_0180411
1749 Ga0496126_0186246
1750 Ga0496126_0230146
1751 Ga0496126_0258947
1752 Ga0495678_041922
1753 Ga0495682_0011221
1754 Ga0501031_0013153
1755 Ga0501031_0017108
1756 Ga0501031_0024938
1757 Ga0501031_0057877
1758 Ga0501031_0058673
1759 Ga0501032_0000228
1760 Ga0501032_0011743
1761 Ga0501032_0086257
1762 Ga0501033_0000256
1763 Ga0501033_0000801
1764 Ga0501033_0096473
1765 Ga0501034_0000175
1766 Ga0501034_0105460
1767 Ga0501034_0186844
1768 Ga0501036_0000158
1769 Ga0501036_0024612
1770 Ga0501036_0136257
1771 Ga0501036_0181888
1772 Ga0501037_0000126
1773 Ga0501037_0001919
1774 Ga0501037_0026941
1775 Ga0501037_0126269
1776 Ga0501037_0248409
1777 Ga0501038_0000114
1778 Ga0501038_0129917
1779 Ga0501038_0193504
1780 Ga0501038_0371342
1781 Ga0501039_0002583
1782 Ga0501039_0030218
1783 Ga0501041_0166364
1784 Ga0501042_0019785
1785 Ga0501042_0146194
1786 Ga0501042_0147581
1787 Ga0501043_0002516
1788 Ga0501043_0005805
1789 Ga0501043_0241623
1790 Ga0501046_0000575
1791 Ga0501046_0042974
1792 Ga0501046_0238877
1793 Ga0501047_0001252
1794 Ga0501047_0038451
1795 Ga0501047_0058668
1796 Ga0501048_0004556
1797 Ga0501067_0000096
1798 Ga0501068_0001140
1799 Ga0501068_0025754
1800 Ga0501068_0083355
1801 Ga0501069_0002391
1802 Ga0501069_0022910
1803 Ga0501069_0136713
1804 Ga0501070_0063565
1805 Ga0501071_0038904
1806 Ga0501072_0010681
1807 Ga0501072_0116458
1808 Ga0501072_0497586
1809 Ga0501073_0000035
1810 Ga0501073_0071424
1811 Ga0501074_0000266
1812 Ga0501074_0079733
1813 Ga0501075_0091990
1814 Ga0501075_0183436
1815 Ga0501077_0069453
1816 Ga0501080_0002934
1817 Ga0501080_0035061
1818 Ga0501081_0107442
1819 Ga0501083_0001979
1820 Ga0501083_0012473
1821 Ga0501035_0067061
1822 Ga0501044_0000061
1823 Ga0501044_0013261
1824 Ga0501044_0114958
1825 Ga0501044_0226125
1826 Ga0501045_0021478
1827 Ga0501045_0024070
1828 Ga0501045_0229531
1829 nmdc:mga03n38_1950_c1
1830 nmdc:mga03n38_4297_c1
1831 nmdc:mga00v17_350526_c1
1832 nmdc:mga0yw44_17702_c1
1833 nmdc:mga0yw44_202602_c1
1834 nmdc:mga0yw44_49203_c1
1835 nmdc:mga06z11_11702_c1
1836 nmdc:mga06z11_163350_c1
1837 nmdc:mga06z11_18394_c1
1838 nmdc:mga06z11_5095_c1
1839 nmdc:mga06z11_72258_c1
1840 nmdc:mga06z11_78177_c1
1841 nmdc:mga07m45_43911_c1
1842 nmdc:mga07m45_56443_c1
1843 nmdc:mga07m45_56705_c1
1844 nmdc:mga0qj67_233456_c1
1845 nmdc:mga0n895_17823_c1
1846 nmdc:mga0rr50_203500_c1
1847 nmdc:mga0a205_193190_c1
1848 nmdc:mga0sz30_97499_c1
1849 Ga0495601_0027651
1850 Ga0495601_0043689
1851 Ga0495601_0237248
1852 Ga0500635_0031591
1853 Ga0495595_0008133
1854 Ga0495619_0000209
1855 Ga0495619_0034899
1856 Ga0495619_0037389
1857 Ga0500643_000073
1858 Ga0500643_023825
1859 Ga0500644_0014943
1860 Ga0500646_0021456
1861 Ga0500651_0142090
1862 Ga0500566_0000287
1863 Ga0500566_0008946
1864 Ga0500566_0031270
1865 Ga0500566_0147484
1866 Ga0500640_016238
1867 Ga0500641_0041366
1868 Ga0500648_112162
1869 Ga0500650_0025611
1870 Ga0500556_0000002
1871 Ga0500557_000075
1872 Ga0500562_019814
1873 Ga0500569_007833
1874 Ga0500572_003304
1875 Ga0500572_003442
1876 Ga0500591_043953
1877 Ga0500592_001974
1878 Ga0500593_086294
1879 Ga0500595_002765
1880 Ga0500595_010232
1881 Ga0500595_030083
1882 Ga0500608_003832
1883 Ga0500608_058757
1884 Ga0500614_003481
1885 Ga0500618_012457
1886 Ga0500642_0000058
1887 Ga0500642_0042197
1888 Ga0500652_000951
1889 Ga0500559_0000950
1890 Ga0500559_0001333
1891 Ga0500559_0002249
1892 Ga0500559_0051614
1893 Ga0500564_086045
1894 Ga0500564_098986
1895 Ga0500568_0000901
1896 Ga0500568_0046425
1897 Ga0500568_0050066
1898 Ga0500568_0068785
1899 Ga0500573_0010293
1900 Ga0500589_034877
1901 Ga0500603_001567
1902 Ga0500603_002092
1903 Ga0500603_066706
1904 Ga0500604_0057420
1905 Ga0500616_0000045
1906 Ga0500616_0000069
1907 Ga0500619_074766
1908 Ga0500622_0001010
1909 Ga0500627_0011994
1910 Ga0500630_003479
1911 Ga0500634_0090164
1912 Ga0500638_022337
1913 Ga0500638_082705
1914 Ga0500639_001271
1915 Ga0500636_0002782
1916 Ga0500636_0041083
1917 Ga0500636_0058335
1918 Ga0500636_0129232
1919 Ga0500637_0000464
1920 Ga0500637_0038564
1921 Ga0500637_0069756
1922 Ga0500637_0109848
1923 Ga0500576_037297
1924 Ga0500625_028970
1925 Ga0500645_013379
1926 Ga0500609_014298
1927 Ga0500596_001508
1928 Ga0500601_000330
1929 Ga0500601_001593
1930 Ga0501084_0004658
1931 Ga0501084_0008344
1932 Ga0587073_0008817
1933 Ga0587076_005304
1934 Ga0501082_0009197
1935 Ga0501082_0019107
1936 Ga0501082_0280619
1937 Ga0530510_0342768
1938 2507509348
1939 2508543404
1940 2508698822
1941 2509147321
1942 2511396859
1943 2513626826
1944 2513637915
1945 2513646648
1946 2513672262
1947 2513691842
1948 2513701324
1949 2513718518
1950 2513876454
1951 2513895025
1952 2514010795
1953 2515628940
1954 2517102003
1955 2524436568
1956 2524466921
1957 2528851554
1958 2603858871
1959 2617352307
1960 2617376480
1961 2723845758
1962 2728753238
1963 2745081140
1964 2793064041
1965 2793077268
1966 2805919733
1967 2818240158
1968 2824603288
1969 2824614063
1970 2824619815
1971 2824629423
1972 2824637065
1973 2824648500
1974 2824656611
1975 2824667865
1976 2824676492
1977 2824684912
1978 2824692926
1979 2824701568
1980 2824710218
1981 2824716306
1982 2824726144
1983 2824736984
1984 2824750866
1985 2824758590
1986 2824768329
1987 2824779149
1988 2838126545
1989 2841947204
1990 2841950646
1991 2841957976
1992 2841966961
1993 2841975711
1994 2841990072
1995 2842039761
1996 2842047293
1997 2844318377
1998 2847935267
1999 2847945858
2000 2849080007
2001 2857510621
2002 2857528024
2003 2874597457
2004 2874609624
2005 2874612841
2006 2874627886
2007 2874636250
2008 2874648533
2009 2876770725
2010 2876777746
2011 2876809510
2012 2876822495
2013 2879078154
2014 2879088990
2015 2879102603
2016 2879118516
2017 2879134505
2018 2879149960
2019 2881366695
2020 2881669547
2021 2885371772
2022 2885383824
2023 2885416979
2024 2888383320
2025 2888394602
2026 2888423708
2027 2889040574
2028 2893068441
2029 2903729325
2030 2903772721
2031 2904672794
2032 2904717164
2033 2906606034
2034 2906627841
2035 2906648766
2036 2908779418
2037 2919075421
2038 2922367703
2039 2922373478
2040 2922392401
2041 2922395630
2042 2929617224
2043 2929626928
2044 2932787758
2045 2932796499
2046 2932803505
2047 2932813086
2048 2932820998
2049 2932835215
2050 2933579181
2051 2935611763
2052 2935621594
2053 2935645527
2054 2935651832
2055 2935660642
2056 2935667645
2057 2935681807
2058 2935688393
2059 2935695737
2060 2935706486
2061 2935715412
2062 2935726024
2063 2935734231
2064 2935743610
2065 2935754353
2066 2935768531
2067 2935774008
2068 2935780554
2069 2935789598
2070 2935797375
2071 2935806547
2072 2935813140
2073 2935821241
2074 2935830793
2075 2935840819
2076 2935850498
2077 2935859841
2078 2935869059
2079 2935880721
2080 2935886575
2081 2935914102
2082 2935921271
2083 2935931709
2084 2935940356
2085 2935947819
2086 2935956640
2087 2935960452
2088 2935973433
2089 2935980952
2090 2935989601
2091 2935999369
2092 2936006648
2093 2936014698
2094 2936023505
2095 2936032533
2096 2936043692
2097 2936050439
2098 2936059069
2099 2940560271
2100 2941534136
2101 2941541050
2102 3005489456
2103 3005511886
2104 3005588599
2105 3005598468
2106 3005714151
2107 3005721657
2108 8006928405
2109 8006967400
2110 8006988143
2111 8006997714
2112 8016514196
2113 8016530389
2114 8016535656
2115 8016539942
2116 8016553291
2117 8016561669
2118 8016573992
2119 8016578113
2120 8016592763
2121 8016599505
2122 8016611483
2123 8016622311
2124 8017062224
2125 8019535380
2126 8019544117
2127 8019554686
2128 8019581674
2129 8019589338
2130 8019601921
2131 8019616631
2132 8019627341
2133 8019635230
2134 8019657511
2135 8019663073
2136 8019689233
2137 8055747161
2138 8056674506
2139 8056685343
2140 8056972734

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05050

Methyltransf_21

Methyltransferase FkbM domain

121

272

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nue-assembly1.cif.gz_B crystal structure of mouse prmt6 in complex with inhibitor eml736 0.7936 96 160
6sq4-assembly1.cif.gz_B crystal structure of mouse prmt6 in complex with inhibitor u2 0.7855 94 160
6sq3-assembly1.cif.gz_B crystal structure of mouse prmt6 in complex with inhibitor u1 0.7851 92 160
5lv4-assembly1.cif.gz_A-2 crystal structure of mouse prmt6 in complex with inhibitor lh1236 0.783 94 160
5wcf-assembly1.cif.gz_A human hmt1 hnrnp methyltransferase-like protein 6 (s. cerevisiae) 0.7827 94 160
ID Description Score Start End Superfamily
af_K7MAL3_1_105_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8475 107 160 3.40.50.150
af_Q8I3G1_737_866_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.817 105 162 3.40.50.150
af_P95137_118_295_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.814 96 246 3.40.50.150
af_Q57551_161_337_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.759 94 160 3.40.50.150
af_I6Y242_27_197_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7576 95 240 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A0D7E811-F1-model_v4 FkbM family methyltransferase 0.9871 196 321 GO:0008168
GO:0032259
AF-A0A0D7E811-F1-model_v4 FkbM family methyltransferase 0.9794 196 321 GO:0008168
GO:0032259
AF-A0A0D7NDE7-F1-model_v4 FkbM family methyltransferase 0.9764 2 321 GO:0008168
GO:0032259
AF-A0A0D7NDE7-F1-model_v4 FkbM family methyltransferase 0.9734 2 321 GO:0008168
GO:0032259
AF-A0A3D9YZ76-F1-model_v4 FkbM family methyltransferase 0.9693 1 312 GO:0008168
GO:0032259

Map