F489443

General Info

Members Datasets Scaffolds Average Seq Length
1068 312 2136 139

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0588096|Ga0373925_0588096_13_522
Length 169
Sequence MYDKILVTLDGTPRDRAIIEHVKQLAKLAHSRLVLLHVADGWAARTYGQDAVSPEIAEDTAYLEKVRSEFQVMDIPTEAELAYGEPVKEIIRWIEQKGCDLVAMSTHGHRFLADIFLGTTASRVQHRISVPVRRECDDATMFRLSAGIADGGRAFCRRAARDGYIEEVR

Samples

Sample ID Description Type Environment
1 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
111 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
112 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
113 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
114 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
115 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
116 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
117 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
173 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
174 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
175 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
176 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
177 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
178 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
179 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
180 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
181 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
182 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
184 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
185 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
186 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
187 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
188 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
189 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
190 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
191 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
192 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
193 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
194 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
195 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
196 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
200 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
201 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
202 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
205 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
206 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
207 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
208 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
209 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
210 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
211 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
212 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
213 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
214 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
215 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
217 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
218 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
219 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
221 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
222 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
223 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
224 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
225 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
226 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
227 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
228 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
229 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
230 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
231 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
232 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
233 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
234 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
235 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
236 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
237 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
238 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
239 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
240 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
241 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
242 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
243 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
244 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
245 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
246 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
247 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
248 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
249 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
250 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
251 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
252 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
253 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
254 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
255 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
256 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
257 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
258 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
259 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
260 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
261 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
262 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
263 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
264 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
265 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
266 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
267 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
268 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
269 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
270 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
271 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
272 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
273 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
274 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
275 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
276 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
277 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
278 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
279 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
280 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
281 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
282 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
283 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
284 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
285 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
286 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
287 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
288 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
289 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
290 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
291 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
292 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
293 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
294 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
295 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
296 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
297 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
298 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
301 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
302 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
303 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
304 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
305 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
306 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
307 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
308 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
309 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
310 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
311 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0.37
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.69
Nodule 0
Rhizoplane 2.25
Rhizosphere 94.94
Stem 0
Stem Tuber 0
Unclassified 26.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373925_0588096 3300037068 Bacteria 916
2 rootH2_10231894 3300003320 Bacteria 1845
3 Ga0065712_10094197 3300005290 Bacteria 2188
4 Ga0070658_10058248 3300005327 Bacteria 3143
5 Ga0070658_10184645 3300005327 Bacteria 1756
6 Ga0070683_100035026 3300005329 Bacteria 4589
7 Ga0070683_100144800 3300005329 Bacteria 2251
8 Ga0070683_100191643 3300005329 Bacteria 1941
9 Ga0070683_100261347 3300005329 Bacteria 1647
10 Ga0070690_100037280 3300005330 Bacteria 3063
11 Ga0070670_100001671 3300005331 Bacteria 18007
12 Ga0070670_100041646 3300005331 Bacteria 3947
13 Ga0070670_100196186 3300005331 Bacteria 1754
14 Ga0070670_101105421 3300005331 Unclassified 723
15 Ga0068869_100014829 3300005334 Bacteria 5212
16 Ga0068869_100037074 3300005334 Bacteria 3465
17 Ga0068869_101908937 3300005334 Unclassified 532
18 Ga0070680_100173118 3300005336 Bacteria 1817
19 Ga0070680_100281584 3300005336 Bacteria 1409
20 Ga0070682_100056200 3300005337 Bacteria 2475
21 Ga0070682_101484000 3300005337 Unclassified 582
22 Ga0068868_100001978 3300005338 Bacteria 14073
23 Ga0068868_100002128 3300005338 Bacteria 13662
24 Ga0068868_100718929 3300005338 Bacteria 895
25 Ga0070660_100082778 3300005339 Bacteria 2520
26 Ga0070660_100208428 3300005339 Bacteria 1586
27 Ga0070691_10077617 3300005341 Bacteria 1621
28 Ga0070691_10083245 3300005341 Bacteria 1569
29 Ga0070687_100044499 3300005343 Bacteria 2262
30 Ga0070687_100564906 3300005343 Unclassified 776
31 Ga0070661_100036253 3300005344 Bacteria 3585
32 Ga0070661_100059537 3300005344 Unclassified 2801
33 Ga0070661_100242259 3300005344 Bacteria 1389
34 Ga0070661_100272411 3300005344 Bacteria 1311
35 Ga0070661_100703833 3300005344 Bacteria 823
36 Ga0070692_10444766 3300005345 Unclassified 828
37 Ga0070675_100071694 3300005354 Bacteria 2875
38 Ga0070671_100022623 3300005355 Bacteria 5135
39 Ga0070671_100819163 3300005355 Bacteria 811
40 Ga0070671_101533250 3300005355 Unclassified 590
41 Ga0070674_100552448 3300005356 Unclassified 966
42 Ga0070674_100571412 3300005356 Bacteria 951
43 Ga0070673_100063620 3300005364 Bacteria 2936
44 Ga0070673_100400791 3300005364 Unclassified 1227
45 Ga0070688_100366973 3300005365 Bacteria 1058
46 Ga0070688_100751141 3300005365 Unclassified 759
47 Ga0070659_100035299 3300005366 Bacteria 3894
48 Ga0070667_100081826 3300005367 Bacteria 2763
49 Ga0070667_100422190 3300005367 Bacteria 1216
50 Ga0070709_10000124 3300005434 Bacteria 51386
51 Ga0070709_10004385 3300005434 Bacteria 7608
52 Ga0070709_10007336 3300005434 Bacteria 6040
53 Ga0070709_10079571 3300005434 Bacteria 2135
54 Ga0070709_10137306 3300005434 Bacteria 1676
55 Ga0070709_10147119 3300005434 Bacteria 1624
56 Ga0070709_10158379 3300005434 Bacteria 1572
57 Ga0070709_10542832 3300005434 Unclassified 888
58 Ga0070709_10656022 3300005434 Unclassified 813
59 Ga0070709_11022584 3300005434 Unclassified 658
60 Ga0070714_100001513 3300005435 Bacteria 16933
61 Ga0070714_100004992 3300005435 Bacteria 10086
62 Ga0070714_100013058 3300005435 Bacteria 6647
63 Ga0070714_100203159 3300005435 Bacteria 1813
64 Ga0070714_100245595 3300005435 Bacteria 1654
65 Ga0070714_100265531 3300005435 Bacteria 1590
66 Ga0070714_100786083 3300005435 Unclassified 921
67 Ga0070714_101144947 3300005435 Unclassified 759
68 Ga0070714_101168549 3300005435 Unclassified 750
69 Ga0070714_101190810 3300005435 Bacteria 743
70 Ga0070714_101238479 3300005435 Unclassified 728
71 Ga0070714_101556120 3300005435 Unclassified 646
72 Ga0070713_100007817 3300005436 Bacteria 7539
73 Ga0070713_100021351 3300005436 Bacteria 4977
74 Ga0070713_100023074 3300005436 Bacteria 4820
75 Ga0070713_100029951 3300005436 Bacteria 4316
76 Ga0070713_100035750 3300005436 Bacteria 4002
77 Ga0070713_100049791 3300005436 Bacteria 3458
78 Ga0070713_100056043 3300005436 Bacteria 3278
79 Ga0070713_100086252 3300005436 Bacteria 2691
80 Ga0070713_100136892 3300005436 Bacteria 2165
81 Ga0070713_100163140 3300005436 Bacteria 1991
82 Ga0070713_100304627 3300005436 Bacteria 1468
83 Ga0070713_100536428 3300005436 Bacteria 1107
84 Ga0070713_100699443 3300005436 Bacteria 968
85 Ga0070713_100701554 3300005436 Unclassified 966
86 Ga0070713_101109195 3300005436 Unclassified 765
87 Ga0070713_101195463 3300005436 Bacteria 736
88 Ga0070713_101207446 3300005436 Unclassified 732
89 Ga0070713_101210468 3300005436 Unclassified 731
90 Ga0070713_101305794 3300005436 Unclassified 703
91 Ga0070713_102021067 3300005436 Bacteria 559
92 Ga0070710_10004411 3300005437 Bacteria 6659
93 Ga0070710_10007525 3300005437 Bacteria 5277
94 Ga0070710_10014242 3300005437 Bacteria 3999
95 Ga0070710_10072591 3300005437 Bacteria 1988
96 Ga0070710_10104544 3300005437 Bacteria 1692
97 Ga0070710_10104858 3300005437 Bacteria 1689
98 Ga0070710_10388130 3300005437 Unclassified 933
99 Ga0070711_100000177 3300005439 Bacteria 33896
100 Ga0070711_100000967 3300005439 Bacteria 15200
101 Ga0070711_100023772 3300005439 Bacteria 3990
102 Ga0070711_100025207 3300005439 Bacteria 3888
103 Ga0070711_100032311 3300005439 Bacteria 3479
104 Ga0070711_100060428 3300005439 Bacteria 2634
105 Ga0070711_100104453 3300005439 Bacteria 2067
106 Ga0070711_100137982 3300005439 Unclassified 1825
107 Ga0070711_100849622 3300005439 Unclassified 776
108 Ga0070708_100000233 3300005445 Bacteria 41575
109 Ga0070708_100020645 3300005445 Bacteria 5559
110 Ga0070708_100064714 3300005445 Bacteria 3277
111 Ga0070708_100078071 3300005445 Bacteria 2993
112 Ga0070708_100079102 3300005445 Bacteria 2974
113 Ga0070708_100094858 3300005445 Bacteria 2723
114 Ga0070708_100121776 3300005445 Bacteria 2407
115 Ga0070708_100193488 3300005445 Bacteria 1903
116 Ga0070708_100391958 3300005445 Bacteria 1310
117 Ga0070708_100469889 3300005445 Bacteria 1187
118 Ga0070663_100917911 3300005455 Unclassified 757
119 Ga0070678_100765393 3300005456 Bacteria 874
120 Ga0070662_100081746 3300005457 Bacteria 2408
121 Ga0070681_10016810 3300005458 Bacteria 7306
122 Ga0070681_10040101 3300005458 Bacteria 4695
123 Ga0070681_10054948 3300005458 Bacteria 3967
124 Ga0070681_10096949 3300005458 Bacteria 2896
125 Ga0070681_10505964 3300005458 Unclassified 1121
126 Ga0070681_10706662 3300005458 Unclassified 924
127 Ga0070681_10740468 3300005458 Bacteria 899
128 Ga0068867_100003355 3300005459 Bacteria 11279
129 Ga0070685_10102500 3300005466 Bacteria 1750
130 Ga0070706_100004545 3300005467 Bacteria 13348
131 Ga0070706_100005808 3300005467 Bacteria 11725
132 Ga0070706_100007343 3300005467 Bacteria 10338
133 Ga0070706_100102770 3300005467 Bacteria 2657
134 Ga0070706_100328296 3300005467 Bacteria 1426
135 Ga0070707_100001178 3300005468 Bacteria 25716
136 Ga0070707_100027882 3300005468 Bacteria 5372
137 Ga0070707_100046302 3300005468 Bacteria 4163
138 Ga0070707_100078728 3300005468 Bacteria 3180
139 Ga0070707_100148882 3300005468 Bacteria 2279
140 Ga0070707_100294927 3300005468 Bacteria 1576
141 Ga0070707_100385093 3300005468 Bacteria 1362
142 Ga0070707_100439675 3300005468 Unclassified 1265
143 Ga0070707_100467235 3300005468 Bacteria 1223
144 Ga0070707_100700380 3300005468 Unclassified 976
145 Ga0070707_101413022 3300005468 Unclassified 662
146 Ga0070707_101570759 3300005468 Bacteria 625
147 Ga0070707_101602776 3300005468 Unclassified 618
148 Ga0070698_100008031 3300005471 Bacteria 11414
149 Ga0070698_100029536 3300005471 Bacteria 5691
150 Ga0070698_100600432 3300005471 Bacteria 1041
151 Ga0070698_100882603 3300005471 Bacteria 840
152 Ga0070699_100000726 3300005518 Bacteria 30560
153 Ga0070699_100021953 3300005518 Bacteria 5500
154 Ga0070699_100111175 3300005518 Bacteria 2406
155 Ga0070699_100276125 3300005518 Bacteria 1505
156 Ga0070699_100352041 3300005518 Unclassified 1327
157 Ga0070699_100361281 3300005518 Bacteria 1309
158 Ga0070679_100123029 3300005530 Bacteria 2578
159 Ga0070679_100147917 3300005530 Bacteria 2326
160 Ga0070679_100765905 3300005530 Unclassified 908
161 Ga0070679_101176456 3300005530 Bacteria 712
162 Ga0070684_100566819 3300005535 Bacteria 1054
163 Ga0070684_100628489 3300005535 Bacteria 999
164 Ga0070697_100000178 3300005536 Bacteria 52143
165 Ga0070697_100000417 3300005536 Bacteria 32884
166 Ga0070697_100000825 3300005536 Bacteria 23250
167 Ga0070697_100022312 3300005536 Bacteria 5024
168 Ga0070697_100061198 3300005536 Bacteria 3070
169 Ga0070697_100134084 3300005536 Bacteria 2079
170 Ga0070697_100160430 3300005536 Bacteria 1899
171 Ga0070697_100651459 3300005536 Unclassified 927
172 Ga0070697_101406072 3300005536 Unclassified 623
173 Ga0070672_100123688 3300005543 Unclassified 2120
174 Ga0070672_100546010 3300005543 Bacteria 1006
175 Ga0070672_100896142 3300005543 Unclassified 783
176 Ga0070686_100595862 3300005544 Bacteria 870
177 Ga0070695_100259560 3300005545 Unclassified 1268
178 Ga0070696_101031749 3300005546 Unclassified 688
179 Ga0070693_100029120 3300005547 Bacteria 3009
180 Ga0070693_100144831 3300005547 Bacteria 1499
181 Ga0070693_100147914 3300005547 Unclassified 1485
182 Ga0070665_100269864 3300005548 Bacteria 1703
183 Ga0070665_100361783 3300005548 Bacteria 1457
184 Ga0068855_100009907 3300005563 Bacteria 11492
185 Ga0068855_100068957 3300005563 Bacteria 4116
186 Ga0068855_100148046 3300005563 Bacteria 2671
187 Ga0068855_100297555 3300005563 Bacteria 1788
188 Ga0068855_101683435 3300005563 Unclassified 647
189 Ga0070664_100004208 3300005564 Bacteria 11568
190 Ga0070664_100017530 3300005564 Bacteria 5882
191 Ga0070664_100034600 3300005564 Bacteria 4238
192 Ga0070664_100451052 3300005564 Bacteria 1181
193 Ga0068857_100000121 3300005577 Bacteria 46931
194 Ga0068857_100010837 3300005577 Bacteria 7936
195 Ga0068857_100013517 3300005577 Bacteria 7111
196 Ga0068857_100614748 3300005577 Bacteria 1028
197 Ga0068857_101097631 3300005577 Unclassified 768
198 Ga0068854_100005151 3300005578 Bacteria 8240
199 Ga0068856_100000735 3300005614 Bacteria 35512
200 Ga0068856_100003101 3300005614 Bacteria 16968
201 Ga0068856_100009396 3300005614 Bacteria 9498
202 Ga0068856_100013903 3300005614 Bacteria 7785
203 Ga0068856_100328411 3300005614 Bacteria 1547
204 Ga0068856_100599568 3300005614 Bacteria 1122
205 Ga0068856_100651215 3300005614 Unclassified 1074
206 Ga0068856_101289878 3300005614 Unclassified 746
207 Ga0070702_100202836 3300005615 Bacteria 1314
208 Ga0068852_100182018 3300005616 Bacteria 1977
209 Ga0068852_101977655 3300005616 Unclassified 605
210 Ga0068859_100000415 3300005617 Bacteria 42515
211 Ga0068859_101027065 3300005617 Bacteria 906
212 Ga0068864_100001353 3300005618 Bacteria 20389
213 Ga0068864_100062163 3300005618 Bacteria 3235
214 Ga0068864_101448515 3300005618 Unclassified 689
215 Ga0068864_102599655 3300005618 Unclassified 512
216 Ga0068861_100577529 3300005719 Unclassified 1028
217 Ga0068851_10010311 3300005834 Bacteria 4358
218 Ga0068851_10010643 3300005834 Bacteria 4295
219 Ga0068851_10101494 3300005834 Bacteria 1527
220 Ga0068863_100125245 3300005841 Bacteria 2451
221 Ga0068863_100365545 3300005841 Bacteria 1407
222 Ga0068863_100802156 3300005841 Unclassified 939
223 Ga0068863_101650809 3300005841 Unclassified 650
224 Ga0068858_100001756 3300005842 Bacteria 22108
225 Ga0068860_100147508 3300005843 Bacteria 2264
226 Ga0068860_100281833 3300005843 Bacteria 1624
227 Ga0068860_100835963 3300005843 Bacteria 935
228 Ga0068862_100036840 3300005844 Bacteria 4146
229 Ga0070717_10002031 3300006028 Bacteria 14168
230 Ga0070717_10002353 3300006028 Bacteria 13321
231 Ga0070717_10004967 3300006028 Bacteria 9676
232 Ga0070717_10017838 3300006028 Bacteria 5533
233 Ga0070717_10047477 3300006028 Unclassified 3518
234 Ga0070717_10052640 3300006028 Bacteria 3354
235 Ga0070717_10104206 3300006028 Bacteria 2412
236 Ga0070717_10133449 3300006028 Bacteria 2137
237 Ga0070717_10177361 3300006028 Bacteria 1856
238 Ga0070717_10369156 3300006028 Bacteria 1285
239 Ga0070717_10373231 3300006028 Unclassified 1278
240 Ga0070717_10441313 3300006028 Unclassified 1172
241 Ga0070717_10533583 3300006028 Unclassified 1062
242 Ga0070717_10621710 3300006028 Bacteria 980
243 Ga0070717_11326124 3300006028 Unclassified 654
244 Ga0075365_10113081 3300006038 Bacteria 1867
245 Ga0075365_10842243 3300006038 Bacteria 647
246 Ga0075368_10015612 3300006042 Bacteria 2821
247 Ga0075368_10049797 3300006042 Bacteria 1663
248 Ga0075364_10035156 3300006051 Bacteria 3237
249 Ga0075364_10056817 3300006051 Bacteria 2563
250 Ga0070715_10005113 3300006163 Bacteria 4355
251 Ga0070715_10007964 3300006163 Bacteria 3672
252 Ga0070715_10066248 3300006163 Bacteria 1601
253 Ga0070715_10111290 3300006163 Unclassified 1292
254 Ga0070716_100001161 3300006173 Bacteria 11608
255 Ga0070716_100001202 3300006173 Bacteria 11400
256 Ga0070716_100006315 3300006173 Bacteria 5786
257 Ga0070716_100008072 3300006173 Bacteria 5211
258 Ga0070716_100008298 3300006173 Bacteria 5152
259 Ga0070716_100009175 3300006173 Bacteria 4925
260 Ga0070716_100227038 3300006173 Bacteria 1258
261 Ga0070716_100621268 3300006173 Unclassified 815
262 Ga0070716_100670863 3300006173 Bacteria 788
263 Ga0070716_100688384 3300006173 Unclassified 780
264 Ga0070712_100000563 3300006175 Bacteria 21576
265 Ga0070712_100002311 3300006175 Bacteria 11744
266 Ga0070712_100002744 3300006175 Bacteria 10883
267 Ga0070712_100008454 3300006175 Bacteria 6478
268 Ga0070712_100009284 3300006175 Bacteria 6196
269 Ga0070712_100018486 3300006175 Bacteria 4529
270 Ga0070712_100041353 3300006175 Bacteria 3165
271 Ga0070712_100075627 3300006175 Bacteria 2422
272 Ga0070712_100167270 3300006175 Unclassified 1703
273 Ga0070712_100175616 3300006175 Bacteria 1665
274 Ga0070712_100406335 3300006175 Unclassified 1126
275 Ga0070712_100662894 3300006175 Unclassified 887
276 Ga0070712_101894810 3300006175 Unclassified 522
277 Ga0075362_10022193 3300006177 Bacteria 2672
278 Ga0075362_10415068 3300006177 Unclassified 680
279 Ga0075367_10006965 3300006178 Bacteria 5758
280 Ga0075366_10027836 3300006195 Bacteria 3317
281 Ga0075366_10110587 3300006195 Bacteria 1652
282 Ga0097621_100012384 3300006237 Bacteria 6321
283 Ga0097621_100205019 3300006237 Unclassified 1713
284 Ga0097621_100743607 3300006237 Unclassified 905
285 Ga0097621_101686531 3300006237 Unclassified 603
286 Ga0075370_10003793 3300006353 Bacteria 7236
287 Ga0068871_100000258 3300006358 Bacteria 36543
288 Ga0068871_100038342 3300006358 Bacteria 3826
289 Ga0068871_100045931 3300006358 Bacteria 3517
290 Ga0068871_100730359 3300006358 Unclassified 909
291 Ga0068871_101110719 3300006358 Bacteria 739
292 Ga0068871_101876141 3300006358 Unclassified 569
293 Ga0075433_10001437 3300006852 Bacteria 17563
294 Ga0075433_10026265 3300006852 Bacteria 4929
295 Ga0075433_10161078 3300006852 Bacteria 1997
296 Ga0075434_100000558 3300006871 Bacteria 28576
297 Ga0075434_100002002 3300006871 Bacteria 17697
298 Ga0075434_100013048 3300006871 Bacteria 7890
299 Ga0075434_100409948 3300006871 Unclassified 1376
300 Ga0075436_100002093 3300006914 Bacteria 13779
301 Ga0075436_100004685 3300006914 Bacteria 9379
302 Ga0075436_100215758 3300006914 Bacteria 1361
303 Ga0075436_100333048 3300006914 Bacteria 1092
304 Ga0097620_100000415 3300006931 Bacteria 42515
305 Ga0097620_101027003 3300006931 Bacteria 906
306 Ga0075435_100001773 3300007076 Bacteria 14054
307 Ga0075435_100004419 3300007076 Bacteria 9652
308 Ga0075435_100015210 3300007076 Bacteria 5779
309 Ga0075435_100235759 3300007076 Bacteria 1555
310 Ga0099794_10172448 3300007265 Bacteria 1103
311 Ga0099794_10215001 3300007265 Unclassified 987
312 Ga0099795_10052652 3300007788 Bacteria 1487
313 Ga0099795_10445561 3300007788 Unclassified 595
314 Ga0099795_10639228 3300007788 Unclassified 508
315 Ga0105240_10003977 3300009093 Bacteria 22806
316 Ga0105240_10007614 3300009093 Bacteria 15684
317 Ga0105240_10039816 3300009093 Bacteria 6016
318 Ga0105240_10054248 3300009093 Bacteria 5024
319 Ga0105240_10086289 3300009093 Bacteria 3844
320 Ga0105240_10092117 3300009093 Bacteria 3702
321 Ga0105240_10122519 3300009093 Unclassified 3129
322 Ga0105240_10183442 3300009093 Bacteria 2468
323 Ga0105240_10354365 3300009093 Bacteria 1664
324 Ga0105240_10726039 3300009093 Unclassified 1082
325 Ga0105240_10970798 3300009093 Unclassified 910
326 Ga0111539_10688636 3300009094 Bacteria 1190
327 Ga0111539_10857201 3300009094 Bacteria 1057
328 Ga0105245_10015031 3300009098 Bacteria 6745
329 Ga0105245_10215226 3300009098 Bacteria 1851
330 Ga0105245_11018774 3300009098 Unclassified 873
331 Ga0105247_10004638 3300009101 Bacteria 8762
332 Ga0105247_10236657 3300009101 Bacteria 1242
333 Ga0105243_10050842 3300009148 Bacteria 3276
334 Ga0105241_10004555 3300009174 Bacteria 10257
335 Ga0105241_10008310 3300009174 Bacteria 7641
336 Ga0105241_10017510 3300009174 Bacteria 5267
337 Ga0105241_10185594 3300009174 Bacteria 1728
338 Ga0105241_10414027 3300009174 Bacteria 1185
339 Ga0105241_10587269 3300009174 Unclassified 1005
340 Ga0105241_10824946 3300009174 Unclassified 856
341 Ga0105242_11043623 3300009176 Unclassified 828
342 Ga0105248_10081116 3300009177 Bacteria 3647
343 Ga0105248_10136897 3300009177 Bacteria 2763
344 Ga0105248_10305204 3300009177 Bacteria 1792
345 Ga0105248_11699379 3300009177 Unclassified 715
346 Ga0105237_10144235 3300009545 Bacteria 2375
347 Ga0105237_11148862 3300009545 Unclassified 783
348 Ga0105238_10006041 3300009551 Bacteria 12007
349 Ga0105238_10016999 3300009551 Bacteria 7385
350 Ga0105238_10063599 3300009551 Bacteria 3690
351 Ga0105238_10190750 3300009551 Bacteria 2025
352 Ga0105238_10238257 3300009551 Bacteria 1797
353 Ga0099796_10040799 3300010159 Unclassified 1569
354 Ga0099796_10043294 3300010159 Bacteria 1533
355 Ga0105239_10014037 3300010375 Bacteria 8892
356 Ga0105239_10075736 3300010375 Bacteria 3700
357 Ga0105239_10203699 3300010375 Bacteria 2217
358 Ga0105239_10300144 3300010375 Bacteria 1809
359 Ga0105239_11638313 3300010375 Unclassified 744
360 Ga0105246_10013145 3300011119 Bacteria 5182
361 Ga0105246_10576540 3300011119 Unclassified 968
362 Ga0157373_10008141 3300013100 Bacteria 7796
363 Ga0157373_10127212 3300013100 Bacteria 1792
364 Ga0157373_10136551 3300013100 Unclassified 1724
365 Ga0157373_10323684 3300013100 Bacteria 1097
366 Ga0157373_10434130 3300013100 Bacteria 944
367 Ga0157371_10164825 3300013102 Bacteria 1583
368 Ga0157371_10267475 3300013102 Bacteria 1233
369 Ga0157371_10442934 3300013102 Unclassified 954
370 Ga0157371_11173220 3300013102 Bacteria 591
371 Ga0157370_10020143 3300013104 Bacteria 6667
372 Ga0157370_10315432 3300013104 Bacteria 1443
373 Ga0157370_11164084 3300013104 Bacteria 696
374 Ga0157369_10020040 3300013105 Bacteria 7480
375 Ga0157369_10082844 3300013105 Bacteria 3432
376 Ga0157369_10162270 3300013105 Bacteria 2359
377 Ga0157369_10286471 3300013105 Bacteria 1715
378 Ga0157369_10389207 3300013105 Bacteria 1447
379 Ga0157369_10451522 3300013105 Bacteria 1331
380 Ga0157369_10545999 3300013105 Unclassified 1198
381 Ga0157369_12234097 3300013105 Unclassified 555
382 Ga0157374_10000881 3300013296 Bacteria 26194
383 Ga0157374_10023522 3300013296 Bacteria 5512
384 Ga0157374_10056035 3300013296 Bacteria 3680
385 Ga0157374_10132191 3300013296 Bacteria 2416
386 Ga0157374_10363263 3300013296 Bacteria 1440
387 Ga0157374_10623516 3300013296 Unclassified 1089
388 Ga0157374_11244455 3300013296 Bacteria 766
389 Ga0157374_11330216 3300013296 Bacteria 741
390 Ga0157378_10000030 3300013297 Bacteria 124811
391 Ga0163162_10015539 3300013306 Bacteria 7438
392 Ga0163162_10224506 3300013306 Unclassified 2008
393 Ga0163162_10689287 3300013306 Bacteria 1144
394 Ga0157372_10000576 3300013307 Bacteria 40151
395 Ga0157372_10001714 3300013307 Bacteria 23796
396 Ga0157372_10007600 3300013307 Bacteria 11524
397 Ga0157372_10018023 3300013307 Bacteria 7589
398 Ga0157372_10019657 3300013307 Bacteria 7278
399 Ga0157372_10031691 3300013307 Bacteria 5789
400 Ga0157372_10040611 3300013307 Bacteria 5139
401 Ga0157372_10229211 3300013307 Bacteria 2153
402 Ga0157372_10319807 3300013307 Bacteria 1807
403 Ga0157372_10356902 3300013307 Bacteria 1703
404 Ga0157372_10429893 3300013307 Unclassified 1539
405 Ga0157372_10817672 3300013307 Unclassified 1082
406 Ga0157372_13263363 3300013307 Unclassified 517
407 Ga0157375_11374238 3300013308 Bacteria 831
408 Ga0163163_10021735 3300014325 Bacteria 6060
409 Ga0163163_10146463 3300014325 Bacteria 2405
410 Ga0163163_10392764 3300014325 Bacteria 1445
411 Ga0163163_10805906 3300014325 Bacteria 1002
412 Ga0182008_10021984 3300014497 Bacteria 3269
413 Ga0157379_10078092 3300014968 Bacteria 2964
414 Ga0157379_11238277 3300014968 Unclassified 719
415 Ga0157376_10112949 3300014969 Bacteria 2395
416 Ga0157376_10379918 3300014969 Bacteria 1360
417 Ga0157376_10871276 3300014969 Bacteria 917
418 Ga0157376_11222815 3300014969 Unclassified 780
419 Ga0157376_11504722 3300014969 Unclassified 706
420 Ga0182006_1033395 3300015261 Bacteria 2064
421 Ga0182007_10003047 3300015262 Bacteria 8080
422 Ga0182005_1009721 3300015265 Bacteria 2786
423 Ga0213872_10028523 3300021361 Bacteria 2559
424 Ga0213872_10072584 3300021361 Unclassified 1550
425 Ga0213872_10085000 3300021361 Unclassified 1419
426 Ga0213874_10019603 3300021377 Bacteria 1843
427 Ga0213876_10005622 3300021384 Bacteria 6881
428 Ga0213875_10053355 3300021388 Bacteria 1893
429 Ga0213871_10002734 3300021441 Bacteria 3291
430 Ga0207656_10013934 3300025321 Bacteria 3084
431 Ga0207656_10021529 3300025321 Bacteria 2577
432 Ga0207692_10006378 3300025898 Bacteria 4782
433 Ga0207692_10044734 3300025898 Bacteria 2211
434 Ga0207692_10103082 3300025898 Bacteria 1570
435 Ga0207692_10103202 3300025898 Bacteria 1569
436 Ga0207692_10142385 3300025898 Bacteria 1365
437 Ga0207692_10238359 3300025898 Bacteria 1085
438 Ga0207710_10005580 3300025900 Bacteria 5413
439 Ga0207647_10044739 3300025904 Unclassified 2765
440 Ga0207685_10007324 3300025905 Bacteria 3069
441 Ga0207685_10026595 3300025905 Bacteria 2014
442 Ga0207685_10035468 3300025905 Bacteria 1821
443 Ga0207685_10068198 3300025905 Unclassified 1432
444 Ga0207685_10249888 3300025905 Unclassified 857
445 Ga0207699_10001362 3300025906 Bacteria 11623
446 Ga0207699_10024434 3300025906 Bacteria 3305
447 Ga0207699_10066158 3300025906 Bacteria 2193
448 Ga0207699_10081850 3300025906 Unclassified 2004
449 Ga0207699_10131673 3300025906 Bacteria 1632
450 Ga0207699_10184463 3300025906 Unclassified 1404
451 Ga0207699_10602782 3300025906 Bacteria 800
452 Ga0207699_10877485 3300025906 Unclassified 661
453 Ga0207645_10279493 3300025907 Bacteria 1108
454 Ga0207705_10176487 3300025909 Bacteria 1611
455 Ga0207705_10664370 3300025909 Unclassified 810
456 Ga0207684_10000642 3300025910 Bacteria 41399
457 Ga0207684_10011628 3300025910 Bacteria 7687
458 Ga0207684_10048277 3300025910 Bacteria 3610
459 Ga0207684_10091823 3300025910 Bacteria 2588
460 Ga0207654_10003178 3300025911 Bacteria 8297
461 Ga0207654_10004021 3300025911 Bacteria 7401
462 Ga0207654_10089674 3300025911 Bacteria 1871
463 Ga0207654_10179546 3300025911 Bacteria 1380
464 Ga0207654_10368000 3300025911 Unclassified 993
465 Ga0207707_10120564 3300025912 Bacteria 2293
466 Ga0207707_10186536 3300025912 Bacteria 1810
467 Ga0207707_10203104 3300025912 Unclassified 1728
468 Ga0207707_10420770 3300025912 Unclassified 1145
469 Ga0207695_10008149 3300025913 Bacteria 13175
470 Ga0207695_10014420 3300025913 Bacteria 9364
471 Ga0207695_10020213 3300025913 Bacteria 7633
472 Ga0207695_10029610 3300025913 Bacteria 6043
473 Ga0207695_10036245 3300025913 Bacteria 5334
474 Ga0207695_10090156 3300025913 Bacteria 3082
475 Ga0207695_10125324 3300025913 Bacteria 2531
476 Ga0207695_10171345 3300025913 Bacteria 2096
477 Ga0207695_10380552 3300025913 Bacteria 1297
478 Ga0207695_10570765 3300025913 Bacteria 1013
479 Ga0207695_11688536 3300025913 Unclassified 514
480 Ga0207671_10009016 3300025914 Bacteria 8391
481 Ga0207693_10000084 3300025915 Bacteria 84105
482 Ga0207693_10003411 3300025915 Bacteria 13562
483 Ga0207693_10004079 3300025915 Bacteria 12409
484 Ga0207693_10004685 3300025915 Bacteria 11519
485 Ga0207693_10009120 3300025915 Bacteria 8099
486 Ga0207693_10016835 3300025915 Bacteria 5835
487 Ga0207693_10021197 3300025915 Bacteria 5166
488 Ga0207693_10028599 3300025915 Bacteria 4405
489 Ga0207693_10066652 3300025915 Bacteria 2819
490 Ga0207693_10118820 3300025915 Bacteria 2076
491 Ga0207693_10605389 3300025915 Unclassified 853
492 Ga0207663_10001613 3300025916 Bacteria 10612
493 Ga0207663_10004197 3300025916 Bacteria 7140
494 Ga0207663_10013450 3300025916 Bacteria 4450
495 Ga0207663_10045290 3300025916 Bacteria 2705
496 Ga0207663_10050257 3300025916 Bacteria 2590
497 Ga0207663_10108995 3300025916 Unclassified 1876
498 Ga0207663_10388910 3300025916 Unclassified 1064
499 Ga0207663_10503218 3300025916 Unclassified 941
500 Ga0207663_11529943 3300025916 Unclassified 537
501 Ga0207660_10296504 3300025917 Bacteria 1287
502 Ga0207660_10540738 3300025917 Unclassified 947
503 Ga0207657_10002596 3300025919 Bacteria 19553
504 Ga0207657_10444749 3300025919 Bacteria 1017
505 Ga0207649_10064156 3300025920 Bacteria 2321
506 Ga0207652_10078946 3300025921 Bacteria 2875
507 Ga0207652_10209251 3300025921 Unclassified 1756
508 Ga0207652_10363136 3300025921 Bacteria 1307
509 Ga0207646_10001331 3300025922 Bacteria 30697
510 Ga0207646_10055286 3300025922 Bacteria 3549
511 Ga0207646_10082750 3300025922 Bacteria 2871
512 Ga0207646_10103335 3300025922 Bacteria 2555
513 Ga0207646_10203351 3300025922 Bacteria 1789
514 Ga0207646_10225067 3300025922 Bacteria 1695
515 Ga0207646_10435216 3300025922 Bacteria 1183
516 Ga0207646_11004761 3300025922 Unclassified 737
517 Ga0207646_11061673 3300025922 Unclassified 714
518 Ga0207681_10183688 3300025923 Bacteria 1595
519 Ga0207694_10009060 3300025924 Bacteria 7510
520 Ga0207694_10151219 3300025924 Bacteria 1870
521 Ga0207694_10196088 3300025924 Bacteria 1642
522 Ga0207694_10332036 3300025924 Bacteria 1256
523 Ga0207694_11120767 3300025924 Unclassified 666
524 Ga0207650_10014559 3300025925 Bacteria 5464
525 Ga0207650_10074894 3300025925 Bacteria 2553
526 Ga0207650_10230359 3300025925 Unclassified 1494
527 Ga0207650_10461366 3300025925 Unclassified 1058
528 Ga0207659_10094513 3300025926 Bacteria 2240
529 Ga0207659_11101396 3300025926 Unclassified 683
530 Ga0207687_10059373 3300025927 Bacteria 2694
531 Ga0207687_10131282 3300025927 Unclassified 1888
532 Ga0207700_10000293 3300025928 Bacteria 29699
533 Ga0207700_10012079 3300025928 Bacteria 5548
534 Ga0207700_10042787 3300025928 Bacteria 3323
535 Ga0207700_10044006 3300025928 Bacteria 3284
536 Ga0207700_10047878 3300025928 Unclassified 3172
537 Ga0207700_10069480 3300025928 Bacteria 2703
538 Ga0207700_10084458 3300025928 Bacteria 2489
539 Ga0207700_10092181 3300025928 Bacteria 2395
540 Ga0207700_10102024 3300025928 Bacteria 2290
541 Ga0207700_10156228 3300025928 Bacteria 1890
542 Ga0207700_10249297 3300025928 Bacteria 1516
543 Ga0207700_10308189 3300025928 Bacteria 1369
544 Ga0207700_10316855 3300025928 Bacteria 1351
545 Ga0207700_10574749 3300025928 Unclassified 1002
546 Ga0207700_10864980 3300025928 Unclassified 809
547 Ga0207700_11504446 3300025928 Unclassified 597
548 Ga0207700_11662893 3300025928 Unclassified 564
549 Ga0207664_10013366 3300025929 Bacteria 5889
550 Ga0207664_10032843 3300025929 Bacteria 3982
551 Ga0207664_10035600 3300025929 Bacteria 3842
552 Ga0207664_10147146 3300025929 Bacteria 1998
553 Ga0207664_10301212 3300025929 Bacteria 1410
554 Ga0207664_10314730 3300025929 Unclassified 1380
555 Ga0207664_10335761 3300025929 Bacteria 1335
556 Ga0207664_10585939 3300025929 Unclassified 1001
557 Ga0207664_10587940 3300025929 Unclassified 1000
558 Ga0207664_11384106 3300025929 Unclassified 624
559 Ga0207644_10200193 3300025931 Bacteria 1575
560 Ga0207644_11405168 3300025931 Unclassified 586
561 Ga0207706_10064191 3300025933 Bacteria 3233
562 Ga0207706_11453764 3300025933 Unclassified 561
563 Ga0207686_10995702 3300025934 Unclassified 680
564 Ga0207670_10056188 3300025936 Unclassified 2664
565 Ga0207669_11557201 3300025937 Unclassified 564
566 Ga0207665_10001047 3300025939 Bacteria 18599
567 Ga0207665_10001060 3300025939 Bacteria 18503
568 Ga0207665_10008698 3300025939 Bacteria 6680
569 Ga0207665_10013254 3300025939 Bacteria 5420
570 Ga0207665_10013876 3300025939 Bacteria 5299
571 Ga0207665_10031738 3300025939 Bacteria 3496
572 Ga0207665_10044585 3300025939 Bacteria 2967
573 Ga0207665_10076642 3300025939 Bacteria 2293
574 Ga0207665_10079395 3300025939 Bacteria 2255
575 Ga0207665_10198518 3300025939 Bacteria 1461
576 Ga0207665_10270025 3300025939 Bacteria 1263
577 Ga0207665_10729506 3300025939 Unclassified 780
578 Ga0207691_10574452 3300025940 Bacteria 955
579 Ga0207691_10580187 3300025940 Unclassified 950
580 Ga0207711_10007922 3300025941 Bacteria 8886
581 Ga0207711_10087071 3300025941 Bacteria 2740
582 Ga0207711_10360384 3300025941 Bacteria 1347
583 Ga0207689_10083876 3300025942 Bacteria 2620
584 Ga0207661_10152439 3300025944 Unclassified 1999
585 Ga0207661_10307916 3300025944 Unclassified 1421
586 Ga0207679_10181150 3300025945 Bacteria 1743
587 Ga0207679_10238997 3300025945 Unclassified 1538
588 Ga0207679_10439172 3300025945 Bacteria 1155
589 Ga0207679_10540662 3300025945 Unclassified 1044
590 Ga0207667_10013776 3300025949 Bacteria 9240
591 Ga0207667_10055953 3300025949 Bacteria 4146
592 Ga0207667_10163648 3300025949 Bacteria 2287
593 Ga0207667_10401622 3300025949 Bacteria 1395
594 Ga0207651_10027098 3300025960 Bacteria 3594
595 Ga0207651_10034949 3300025960 Bacteria 3262
596 Ga0207640_10002147 3300025981 Bacteria 10603
597 Ga0207640_10170513 3300025981 Bacteria 1621
598 Ga0207658_10103993 3300025986 Bacteria 2230
599 Ga0207658_10716841 3300025986 Bacteria 905
600 Ga0207677_10001194 3300026023 Bacteria 14078
601 Ga0207677_10002578 3300026023 Bacteria 9523
602 Ga0207703_10002718 3300026035 Bacteria 15154
603 Ga0207703_11273438 3300026035 Bacteria 707
604 Ga0207703_11378968 3300026035 Bacteria 678
605 Ga0207639_10114943 3300026041 Bacteria 2200
606 Ga0207639_11232867 3300026041 Bacteria 702
607 Ga0207702_10000764 3300026078 Bacteria 34175
608 Ga0207702_10001551 3300026078 Bacteria 22731
609 Ga0207702_10027156 3300026078 Bacteria 4753
610 Ga0207702_10073909 3300026078 Bacteria 2940
611 Ga0207702_10080814 3300026078 Bacteria 2821
612 Ga0207702_10240822 3300026078 Bacteria 1695
613 Ga0207702_10264003 3300026078 Bacteria 1622
614 Ga0207702_10266245 3300026078 Bacteria 1615
615 Ga0207702_10325787 3300026078 Bacteria 1464
616 Ga0207702_10547207 3300026078 Unclassified 1132
617 Ga0207641_10128289 3300026088 Bacteria 2274
618 Ga0207641_10132001 3300026088 Bacteria 2244
619 Ga0207641_10180534 3300026088 Unclassified 1933
620 Ga0207641_10245754 3300026088 Bacteria 1669
621 Ga0207676_10001298 3300026095 Bacteria 18583
622 Ga0207676_10225648 3300026095 Bacteria 1671
623 Ga0207676_11592726 3300026095 Unclassified 651
624 Ga0207676_11911856 3300026095 Unclassified 592
625 Ga0207674_10000281 3300026116 Bacteria 64232
626 Ga0207674_10003756 3300026116 Bacteria 18524
627 Ga0207674_10032182 3300026116 Bacteria 5502
628 Ga0207674_10393609 3300026116 Bacteria 1339
629 Ga0207674_10797843 3300026116 Unclassified 911
630 Ga0207683_10845972 3300026121 Bacteria 849
631 Ga0207698_12239765 3300026142 Unclassified 559
632 Ga0268266_10139119 3300028379 Bacteria 2178
633 Ga0268266_10462046 3300028379 Bacteria 1208
634 Ga0268265_10026847 3300028380 Bacteria 4101
635 Ga0268264_10270805 3300028381 Bacteria 1586
636 Ga0268264_10478644 3300028381 Bacteria 1211
637 Ga0265337_1000542 3300028556 Bacteria 20142
638 Ga0265337_1002344 3300028556 Bacteria 8773
639 Ga0265337_1004508 3300028556 Bacteria 5764
640 Ga0265337_1007731 3300028556 Bacteria 3988
641 Ga0265337_1017646 3300028556 Bacteria 2285
642 Ga0265337_1021906 3300028556 Bacteria 1986
643 Ga0265337_1043296 3300028556 Bacteria 1287
644 Ga0265337_1061535 3300028556 Bacteria 1040
645 Ga0265337_1160717 3300028556 Unclassified 609
646 Ga0265326_10060961 3300028558 Unclassified 1067
647 Ga0265326_10115618 3300028558 Unclassified 762
648 Ga0265326_10129695 3300028558 Unclassified 718
649 Ga0265319_1000082 3300028563 Bacteria 74926
650 Ga0265319_1000383 3300028563 Bacteria 32025
651 Ga0265319_1005048 3300028563 Bacteria 6415
652 Ga0265319_1024476 3300028563 Bacteria 2173
653 Ga0265319_1032006 3300028563 Unclassified 1827
654 Ga0265334_10002529 3300028573 Bacteria 8546
655 Ga0265334_10005317 3300028573 Bacteria 5627
656 Ga0265334_10024695 3300028573 Bacteria 2436
657 Ga0265334_10043209 3300028573 Bacteria 1754
658 Ga0265334_10045812 3300028573 Bacteria 1693
659 Ga0265334_10071229 3300028573 Bacteria 1294
660 Ga0265334_10240661 3300028573 Unclassified 624
661 Ga0265318_10000611 3300028577 Bacteria 24727
662 Ga0265318_10001111 3300028577 Bacteria 16883
663 Ga0265318_10002270 3300028577 Bacteria 10338
664 Ga0265318_10015696 3300028577 Bacteria 3143
665 Ga0265318_10074196 3300028577 Bacteria 1260
666 Ga0265318_10119213 3300028577 Bacteria 970
667 Ga0265323_10000293 3300028653 Bacteria 28866
668 Ga0265323_10001094 3300028653 Bacteria 14023
669 Ga0265323_10007601 3300028653 Bacteria 4496
670 Ga0265322_10000028 3300028654 Bacteria 85065
671 Ga0265322_10000169 3300028654 Bacteria 30040
672 Ga0265322_10000329 3300028654 Bacteria 19970
673 Ga0265322_10006814 3300028654 Bacteria 3353
674 Ga0265322_10034070 3300028654 Bacteria 1452
675 Ga0265322_10105281 3300028654 Bacteria 802
676 Ga0265336_10000152 3300028666 Bacteria 49208
677 Ga0265336_10057325 3300028666 Bacteria 1170
678 Ga0265338_10000295 3300028800 Bacteria 89990
679 Ga0265338_10000468 3300028800 Bacteria 72027
680 Ga0265338_10001464 3300028800 Bacteria 38231
681 Ga0265338_10003449 3300028800 Bacteria 22276
682 Ga0265338_10004220 3300028800 Bacteria 19557
683 Ga0265338_10009337 3300028800 Bacteria 11719
684 Ga0265338_10015175 3300028800 Bacteria 8492
685 Ga0265338_10016370 3300028800 Bacteria 8074
686 Ga0265338_10017637 3300028800 Bacteria 7681
687 Ga0265338_10022106 3300028800 Bacteria 6605
688 Ga0265338_10027649 3300028800 Bacteria 5684
689 Ga0265338_10031867 3300028800 Bacteria 5158
690 Ga0265338_10068523 3300028800 Bacteria 3056
691 Ga0265338_10075087 3300028800 Bacteria 2871
692 Ga0265338_10120361 3300028800 Bacteria 2094
693 Ga0265338_10129432 3300028800 Bacteria 1996
694 Ga0265338_10220234 3300028800 Unclassified 1418
695 Ga0265338_10245876 3300028800 Unclassified 1322
696 Ga0265338_10319714 3300028800 Unclassified 1124
697 Ga0265338_10473809 3300028800 Unclassified 884
698 Ga0265338_10543990 3300028800 Unclassified 813
699 Ga0265338_10591021 3300028800 Unclassified 774
700 Ga0265338_10727345 3300028800 Bacteria 683
701 Ga0265338_10795672 3300028800 Unclassified 648
702 Ga0265338_10805672 3300028800 Unclassified 643
703 Ga0265338_11161840 3300028800 Unclassified 519
704 Ga0265324_10000484 3300029957 Bacteria 27886
705 Ga0265324_10001659 3300029957 Bacteria 12315
706 Ga0265324_10002703 3300029957 Bacteria 8850
707 Ga0265324_10002940 3300029957 Bacteria 8344
708 Ga0265324_10009253 3300029957 Bacteria 3855
709 Ga0265324_10011687 3300029957 Unclassified 3341
710 Ga0265324_10036441 3300029957 Bacteria 1710
711 Ga0265324_10038878 3300029957 Bacteria 1650
712 Ga0265324_10076732 3300029957 Unclassified 1137
713 Ga0265324_10145941 3300029957 Bacteria 803
714 Ga0265324_10257280 3300029957 Unclassified 593
715 Ga0265760_10028670 3300031090 Bacteria 1634
716 Ga0265760_10153259 3300031090 Bacteria 757
717 Ga0265330_10001419 3300031235 Bacteria 14021
718 Ga0265330_10023290 3300031235 Bacteria 2813
719 Ga0265330_10070411 3300031235 Bacteria 1513
720 Ga0265330_10160517 3300031235 Bacteria 955
721 Ga0265332_10024493 3300031238 Bacteria 2655
722 Ga0265332_10050583 3300031238 Bacteria 1786
723 Ga0265332_10127060 3300031238 Unclassified 1070
724 Ga0265332_10335527 3300031238 Unclassified 624
725 Ga0265328_10000745 3300031239 Bacteria 15095
726 Ga0265328_10139598 3300031239 Unclassified 909
727 Ga0265320_10000497 3300031240 Bacteria 30621
728 Ga0265320_10003678 3300031240 Bacteria 10242
729 Ga0265320_10011997 3300031240 Bacteria 5068
730 Ga0265320_10080605 3300031240 Bacteria 1520
731 Ga0265320_10084941 3300031240 Bacteria 1473
732 Ga0265320_10185875 3300031240 Unclassified 930
733 Ga0265320_10219421 3300031240 Unclassified 847
734 Ga0265320_10229723 3300031240 Bacteria 825
735 Ga0265320_10367674 3300031240 Unclassified 635
736 Ga0265325_10001557 3300031241 Bacteria 15984
737 Ga0265325_10004103 3300031241 Bacteria 9278
738 Ga0265325_10005940 3300031241 Bacteria 7478
739 Ga0265325_10027823 3300031241 Bacteria 3053
740 Ga0265325_10194129 3300031241 Bacteria 939
741 Ga0265329_10001143 3300031242 Bacteria 13047
742 Ga0265329_10025571 3300031242 Bacteria 1952
743 Ga0265329_10047227 3300031242 Bacteria 1374
744 Ga0265340_10004591 3300031247 Bacteria 7688
745 Ga0265340_10007530 3300031247 Bacteria 5910
746 Ga0265340_10019971 3300031247 Bacteria 3446
747 Ga0265340_10025222 3300031247 Bacteria 3013
748 Ga0265340_10052609 3300031247 Unclassified 1969
749 Ga0265340_10118413 3300031247 Unclassified 1220
750 Ga0265339_10003636 3300031249 Bacteria 10757
751 Ga0265339_10004406 3300031249 Bacteria 9607
752 Ga0265339_10066402 3300031249 Bacteria 1931
753 Ga0265339_10209138 3300031249 Unclassified 959
754 Ga0265339_10554626 3300031249 Unclassified 528
755 Ga0265331_10001038 3300031250 Bacteria 21666
756 Ga0265331_10328197 3300031250 Unclassified 685
757 Ga0265331_10416425 3300031250 Unclassified 603
758 Ga0265331_10518106 3300031250 Unclassified 537
759 Ga0265327_10002648 3300031251 Bacteria 18430
760 Ga0265327_10008343 3300031251 Bacteria 7739
761 Ga0265327_10320443 3300031251 Unclassified 680
762 Ga0265316_10003484 3300031344 Bacteria 15898
763 Ga0265316_10004394 3300031344 Bacteria 14042
764 Ga0265316_10006331 3300031344 Bacteria 11325
765 Ga0265316_10028996 3300031344 Bacteria 4557
766 Ga0265316_10066512 3300031344 Bacteria 2789
767 Ga0265316_10078133 3300031344 Bacteria 2541
768 Ga0265316_10079353 3300031344 Bacteria 2519
769 Ga0265316_10130069 3300031344 Bacteria 1897
770 Ga0265316_10142749 3300031344 Bacteria 1797
771 Ga0265316_10160516 3300031344 Bacteria 1681
772 Ga0265316_10200146 3300031344 Unclassified 1481
773 Ga0265316_10607919 3300031344 Bacteria 775
774 Ga0265316_10632945 3300031344 Bacteria 757
775 Ga0265316_10686117 3300031344 Bacteria 723
776 Ga0265316_11124707 3300031344 Unclassified 544
777 Ga0265313_10000945 3300031595 Bacteria 28829
778 Ga0265313_10003307 3300031595 Bacteria 13198
779 Ga0265313_10013437 3300031595 Bacteria 4914
780 Ga0265313_10015127 3300031595 Bacteria 4515
781 Ga0265313_10061673 3300031595 Bacteria 1754
782 Ga0265313_10069853 3300031595 Unclassified 1620
783 Ga0265314_10001204 3300031711 Bacteria 29721
784 Ga0265314_10058439 3300031711 Bacteria 2642
785 Ga0265314_10072895 3300031711 Bacteria 2292
786 Ga0265314_10078044 3300031711 Bacteria 2194
787 Ga0265314_10121129 3300031711 Unclassified 1646
788 Ga0265314_10252900 3300031711 Unclassified 1011
789 Ga0265342_10000219 3300031712 Bacteria 64778
790 Ga0265342_10006314 3300031712 Bacteria 8839
791 Ga0265342_10009671 3300031712 Bacteria 6762
792 Ga0265342_10018239 3300031712 Bacteria 4551
793 Ga0265342_10032556 3300031712 Bacteria 3215
794 Ga0265342_10042317 3300031712 Bacteria 2753
795 Ga0265342_10159956 3300031712 Unclassified 1245
796 Ga0307409_100051117 3300031995 Bacteria 3161
797 Ga0307409_101270328 3300031995 Bacteria 761
798 Ga0307416_100807059 3300032002 Bacteria 1034
799 Ga0307416_101567512 3300032002 Unclassified 764
800 Ga0373926_0035045 3300035083 Unclassified 1779
801 Ga0373926_0175219 3300035083 Bacteria 822
802 Ga0373934_0033468 3300035086 Bacteria 2017
803 Ga0373944_0132193 3300035089 Bacteria 868
804 Ga0373944_0395479 3300035089 Unclassified 532
805 Ga0373923_0084353 3300035111 Bacteria 1382
806 Ga0373923_0120032 3300035111 Unclassified 1174
807 Ga0373936_0002702 3300035113 Bacteria 6621
808 Ga0373936_0082477 3300035113 Bacteria 1340
809 Ga0373936_0320152 3300035113 Unclassified 702
810 Ga0373939_0417639 3300035114 Bacteria 559
811 Ga0373953_0284072 3300035117 Unclassified 721
812 Ga0373954_0062318 3300035118 Bacteria 1762
813 Ga0373954_0118256 3300035118 Bacteria 1285
814 Ga0373956_0289372 3300035119 Unclassified 780
815 Ga0373956_0419727 3300035119 Unclassified 638
816 Ga0373957_0060953 3300035120 Bacteria 1461
817 Ga0373957_0170364 3300035120 Unclassified 900
818 Ga0373960_0006213 3300035121 Bacteria 2795
819 Ga0373943_0008803 3300035170 Bacteria 4524
820 Ga0373943_0067290 3300035170 Bacteria 1806
821 Ga0373943_0182752 3300035170 Bacteria 1153
822 Ga0373943_0296381 3300035170 Bacteria 917
823 Ga0373943_0300417 3300035170 Bacteria 911
824 Ga0373946_0019548 3300035171 Unclassified 2611
825 Ga0373946_0116268 3300035171 Bacteria 1216
826 Ga0373955_0053675 3300035172 Bacteria 2201
827 Ga0373955_0264788 3300035172 Bacteria 1032
828 Ga0373962_0095696 3300035242 Unclassified 920
829 Ga0373931_0486795 3300035691 Unclassified 794
830 Ga0373935_0006293 3300035692 Bacteria 7073
831 Ga0373935_0037578 3300035692 Unclassified 3031
832 Ga0373935_0147226 3300035692 Unclassified 1595
833 Ga0373935_0236664 3300035692 Bacteria 1273
834 Ga0373935_1015824 3300035692 Bacteria 616
835 Ga0373927_0020828 3300035695 Bacteria 4298
836 Ga0373927_0049204 3300035695 Bacteria 2726
837 Ga0373927_0078242 3300035695 Bacteria 2142
838 Ga0373927_0475768 3300035695 Unclassified 825
839 Ga0373927_1132874 3300035695 Unclassified 516
840 Ga0373933_0000058 3300035724 Bacteria 66002
841 Ga0373933_0026651 3300035724 Bacteria 3321
842 Ga0373933_0264794 3300035724 Unclassified 1109
843 Ga0373947_0018181 3300035725 Bacteria 4045
844 Ga0373947_0018296 3300035725 Bacteria 4032
845 Ga0373947_0083697 3300035725 Bacteria 1979
846 Ga0373947_0260051 3300035725 Unclassified 1150
847 Ga0373947_0278910 3300035725 Unclassified 1111
848 Ga0373947_0401192 3300035725 Unclassified 925
849 Ga0373947_0697419 3300035725 Unclassified 693
850 Ga0373937_0000008 3300036401 Bacteria 170075
851 Ga0373937_0157358 3300036401 Bacteria 2130
852 Ga0373937_0227229 3300036401 Bacteria 1757
853 Ga0373937_0309923 3300036401 Bacteria 1493
854 Ga0373937_1022690 3300036401 Bacteria 775
855 Ga0373937_1090025 3300036401 Unclassified 747
856 Ga0373937_1323030 3300036401 Unclassified 668
857 Ga0373937_1547096 3300036401 Unclassified 611
858 Ga0373925_0005774 3300037068 Bacteria 9198
859 Ga0373925_0013923 3300037068 Bacteria 5822
860 Ga0373925_0017898 3300037068 Bacteria 5143
861 Ga0373925_0033781 3300037068 Bacteria 3769
862 Ga0373925_0057398 3300037068 Bacteria 2917
863 Ga0373925_0097392 3300037068 Bacteria 2256
864 Ga0373925_0208372 3300037068 Bacteria 1557
865 Ga0373925_0278103 3300037068 Bacteria 1348
866 Ga0373925_0284902 3300037068 Bacteria 1331
867 Ga0395900_0186273 3300037418 Bacteria 2107
868 Ga0395900_0308367 3300037418 Bacteria 1567
869 Ga0395900_1565074 3300037418 Unclassified 571
870 Ga0395898_0101342 3300037466 Bacteria 2765
871 Ga0395905_0058193 3300037471 Bacteria 3615
872 Ga0395905_0161058 3300037471 Bacteria 2109
873 Ga0436364_0503746 3300037853 Bacteria 1923
874 Ga0436364_0713119 3300037853 Unclassified 741
875 Ga0395901_0022807 3300038443 Bacteria 6418
876 Ga0395901_1022276 3300038443 Bacteria 801
877 Ga0395901_1118825 3300038443 Bacteria 757
878 Ga0395901_1130743 3300038443 Bacteria 752
879 Ga0436365_0596749 3300039437 Bacteria 23938
880 Ga0436365_0660570 3300039437 Unclassified 761
881 Ga0436360_0274844 3300039438 Bacteria 1104
882 Ga0436360_0428817 3300039438 Bacteria 5415
883 Ga0436360_0480910 3300039438 Bacteria 4594
884 Ga0436360_1072958 3300039438 Bacteria 620
885 Ga0436361_0085950 3300039447 Unclassified 791
886 Ga0436361_0234159 3300039447 Bacteria 1346
887 Ga0436361_0311977 3300039447 Unclassified 1341
888 Ga0436361_0365009 3300039447 Unclassified 4351
889 Ga0436361_1107455 3300039447 Bacteria 4012
890 Ga0436363_0061087 3300039450 Unclassified 716
891 Ga0436363_1378733 3300039450 Bacteria 6972
892 Ga0436362_1173817 3300039453 Unclassified 2427
893 Ga0451839_1135551 3300041496 Unclassified 804
894 Ga0451577_0000241 3300042876 Bacteria 108191
895 Ga0451577_0042149 3300042876 Bacteria 4094
896 Ga0451577_0916874 3300042876 Unclassified 789
897 Ga0466972_0560089 3300044658 Unclassified 539
898 Ga0453683_0013032 3300044673 Bacteria 5435
899 Ga0453683_0218397 3300044673 Bacteria 1212
900 Ga0466963_0280566 3300044694 Bacteria 1171
901 Ga0466963_0335600 3300044694 Unclassified 1064
902 Ga0466964_0024093 3300044706 Bacteria 2370
903 Ga0466964_0093278 3300044706 Bacteria 1314
904 Ga0453684_0000366 3300044712 Bacteria 186117
905 Ga0453684_0389644 3300044712 Bacteria 1563
906 Ga0466957_0165502 3300044842 Bacteria 1438
907 Ga0466959_0338365 3300045049 Unclassified 1027
908 Ga0451576_0013105 3300045051 Bacteria 9283
909 Ga0451576_0118234 3300045051 Bacteria 2759
910 Ga0451576_0353266 3300045051 Bacteria 1539
911 Ga0451576_0555111 3300045051 Bacteria 1207
912 Ga0451576_1300128 3300045051 Unclassified 758
913 Ga0466967_0648168 3300045976 Unclassified 1044
914 Ga0466967_0757018 3300045976 Unclassified 963
915 Ga0495592_0567087 3300046454 Unclassified 696
916 Ga0495603_0202664 3300046455 Unclassified 1147
917 Ga0495590_0039548 3300046457 Bacteria 1645
918 Ga0495590_0179517 3300046457 Unclassified 774
919 Ga0495629_0007545 3300046459 Bacteria 8016
920 Ga0495641_0066599 3300046461 Unclassified 1620
921 Ga0495651_0131206 3300046462 Bacteria 1829
922 Ga0495651_0134892 3300046462 Bacteria 1797
923 Ga0495651_0326210 3300046462 Bacteria 1022
924 Ga0495653_0515485 3300046463 Unclassified 744
925 Ga0495653_0765050 3300046463 Unclassified 583
926 Ga0495580_0000038 3300046472 Bacteria 71800
927 Ga0495580_0000970 3300046472 Bacteria 25166
928 Ga0495580_0001331 3300046472 Bacteria 21781
929 Ga0495580_0008880 3300046472 Bacteria 7952
930 Ga0495580_0010292 3300046472 Bacteria 7295
931 Ga0495580_0010572 3300046472 Bacteria 7182
932 Ga0495580_0011519 3300046472 Bacteria 6842
933 Ga0495580_0102909 3300046472 Bacteria 1985
934 Ga0495580_0287432 3300046472 Bacteria 1121
935 Ga0495580_0325001 3300046472 Bacteria 1045
936 Ga0495580_0439075 3300046472 Unclassified 876
937 Ga0495580_0497555 3300046472 Unclassified 814
938 Ga0495580_0548071 3300046472 Unclassified 768
939 Ga0495580_1073933 3300046472 Unclassified 510
940 Ga0495582_0004582 3300046473 Bacteria 7764
941 Ga0495582_0005852 3300046473 Bacteria 6852
942 Ga0495582_0120781 3300046473 Bacteria 1476
943 Ga0495582_0442767 3300046473 Bacteria 750
944 Ga0495639_0058131 3300046475 Bacteria 1768
945 Ga0495639_0062297 3300046475 Bacteria 1711
946 Ga0495639_0152189 3300046475 Bacteria 1116
947 Ga0495639_0219026 3300046475 Unclassified 935
948 Ga0495662_0218410 3300046476 Bacteria 939
949 Ga0495664_0316845 3300046477 Bacteria 941
950 Ga0495584_0531891 3300046491 Unclassified 599
951 Ga0495594_0150539 3300046499 Bacteria 1321
952 Ga0495608_0101658 3300046511 Bacteria 1853
953 Ga0495608_0219676 3300046511 Bacteria 1193
954 Ga0495608_0257223 3300046511 Bacteria 1088
955 Ga0495628_0141981 3300046516 Bacteria 1833
956 Ga0495630_0006895 3300046517 Bacteria 8100
957 Ga0495630_0024679 3300046517 Bacteria 4443
958 Ga0495630_0073287 3300046517 Bacteria 2579
959 Ga0495630_0230567 3300046517 Bacteria 1415
960 Ga0495630_0263812 3300046517 Unclassified 1316
961 Ga0495630_0372776 3300046517 Bacteria 1093
962 Ga0495630_0450136 3300046517 Bacteria 987
963 Ga0495630_0718286 3300046517 Unclassified 764
964 Ga0495666_0082377 3300046526 Bacteria 1521
965 Ga0495652_0107767 3300046529 Bacteria 2247
966 Ga0495652_0162000 3300046529 Bacteria 1736
967 Ga0495652_0771646 3300046529 Unclassified 642
968 Ga0495665_0007054 3300046531 Bacteria 6064
969 Ga0495665_0014261 3300046531 Bacteria 4287
970 Ga0495665_0353200 3300046531 Unclassified 748
971 Ga0495665_0665389 3300046531 Unclassified 518
972 Ga0495640_0487871 3300046533 Bacteria 750
973 Ga0495586_0018720 3300046535 Bacteria 3687
974 Ga0495586_0443122 3300046535 Unclassified 748
975 Ga0495586_0567564 3300046535 Unclassified 655
976 Ga0495587_0000423 3300046536 Bacteria 29685
977 Ga0495587_0080020 3300046536 Bacteria 1894
978 Ga0495645_0364981 3300046543 Unclassified 927
979 Ga0495645_0813237 3300046543 Bacteria 560
980 Ga0495667_0425893 3300046559 Unclassified 835
981 Ga0495635_0692717 3300046663 Bacteria 661
982 Ga0495588_0248786 3300046674 Unclassified 937
983 Ga0495657_0459608 3300046675 Unclassified 745
984 Ga0495657_0480019 3300046675 Unclassified 726
985 Ga0495599_0467508 3300046678 Unclassified 745
986 Ga0495623_0009865 3300046679 Bacteria 6187
987 Ga0495658_0004737 3300046683 Bacteria 6681
988 Ga0495658_0004768 3300046683 Bacteria 6654
989 Ga0495658_0045434 3300046683 Bacteria 2465
990 Ga0495669_0238759 3300046684 Bacteria 872
991 Ga0495613_0043783 3300046689 Bacteria 3312
992 Ga0495613_0224412 3300046689 Bacteria 1318
993 Ga0495624_0138659 3300046690 Unclassified 1490
994 Ga0495624_0234871 3300046690 Bacteria 1110
995 Ga0495624_0339443 3300046690 Unclassified 904
996 Ga0495674_0150475 3300047319 Bacteria 1952
997 Ga0495674_0271250 3300047319 Bacteria 1392
998 Ga0495674_0298263 3300047319 Unclassified 1317
999 Ga0495674_0389798 3300047319 Unclassified 1126
1000 Ga0495674_0798719 3300047319 Bacteria 734
1001 Ga0495676_0903476 3300047321 Unclassified 566
1002 Ga0495675_0030452 3300047444 Bacteria 3443
1003 Ga0495684_0001583 3300047471 Bacteria 18237
1004 Ga0495684_0355036 3300047471 Unclassified 1040
1005 Ga0495684_0466043 3300047471 Bacteria 875
1006 Ga0495684_1090627 3300047471 Unclassified 501
1007 Ga0495593_0254453 3300047673 Unclassified 879
1008 Ga0495602_0000026 3300048088 Bacteria 148063
1009 Ga0495602_0032590 3300048088 Bacteria 4904
1010 Ga0495602_0382004 3300048088 Bacteria 1009
1011 Ga0495614_0230448 3300048089 Unclassified 844
1012 Ga0496100_1497606 3300048903 Unclassified 533
1013 Ga0496101_0784020 3300048904 Unclassified 752
1014 Ga0496101_0955241 3300048904 Unclassified 674
1015 Ga0496102_0060962 3300048905 Bacteria 3451
1016 Ga0496103_0076041 3300048906 Bacteria 2106
1017 Ga0496104_0161978 3300048907 Bacteria 2146
1018 Ga0496104_0401849 3300048907 Bacteria 1282
1019 Ga0496105_0695435 3300048908 Unclassified 781
1020 Ga0496106_0422834 3300048909 Bacteria 1071
1021 Ga0496106_1001351 3300048909 Unclassified 657
1022 Ga0496107_0139292 3300048910 Bacteria 1793
1023 Ga0496107_0614913 3300048910 Unclassified 802
1024 Ga0496108_0044623 3300048911 Bacteria 3700
1025 Ga0496108_0716807 3300048911 Unclassified 867
1026 Ga0496110_0026275 3300048913 Bacteria 4979
1027 Ga0496111_0044118 3300048914 Bacteria 3205
1028 Ga0496112_0015301 3300048915 Bacteria 7154
1029 Ga0496112_0090422 3300048915 Bacteria 3030
1030 Ga0496112_0123505 3300048915 Bacteria 2560
1031 Ga0496112_0714532 3300048915 Bacteria 929
1032 Ga0496113_0158785 3300048916 Bacteria 1787
1033 Ga0496113_0605264 3300048916 Unclassified 877
1034 Ga0496114_0680576 3300048917 Bacteria 903
1035 Ga0496115_0003221 3300048918 Bacteria 11716
1036 Ga0496119_0444387 3300048922 Unclassified 612
1037 Ga0501033_0038382 3300049570 Bacteria 3581
1038 Ga0501034_0221363 3300049571 Bacteria 1845
1039 Ga0501080_0063443 3300049742 Bacteria 3439
1040 nmdc:mga03683_33616_c1 3300050489 Bacteria 2071
1041 nmdc:mga0yw44_231182_c1 3300050492 Bacteria 1227
1042 nmdc:mga0yw44_782260_c1 3300050492 Bacteria 648
1043 nmdc:mga0k408_23503_c2 3300050493 Bacteria 665
1044 nmdc:mga06z11_210394_c1 3300050494 Unclassified 1133
1045 nmdc:mga06z11_31825_c1 3300050494 Bacteria 2567
1046 nmdc:mga0n895_1767718_c1 3300050512 Unclassified 580
1047 nmdc:mga0n895_2241_c1 3300050512 Bacteria 14970
1048 nmdc:mga0n895_249_c1 3300050512 Bacteria 34575
1049 nmdc:mga0n895_5529_c1 3300050512 Bacteria 10581
1050 nmdc:mga0rr50_110_c2 3300050513 Bacteria 25403
1051 nmdc:mga0rr50_18748_c1 3300050513 Bacteria 4656
1052 nmdc:mga0rr50_446054_c1 3300050513 Unclassified 1097
1053 nmdc:mga0rr50_461694_c1 3300050513 Unclassified 1077
1054 nmdc:mga0rr50_599394_c1 3300050513 Unclassified 939
1055 nmdc:mga0rr50_9343_c1 3300050513 Bacteria 6160
1056 nmdc:mga08x19_2015_c1 3300050514 Bacteria 12441
1057 nmdc:mga08x19_2054_c1 3300050514 Bacteria 12346
1058 nmdc:mga08x19_290469_c1 3300050514 Bacteria 1134
1059 nmdc:mga08x19_663989_c1 3300050514 Unclassified 739
1060 nmdc:mga08x19_916339_c1 3300050514 Unclassified 622
1061 nmdc:mga08x19_93400_c1 3300050514 Bacteria 1988
1062 nmdc:mga0a205_131_c1 3300050515 Bacteria 46472
1063 nmdc:mga0a205_32965_c1 3300050515 Bacteria 4968
1064 Ga0495601_0086974 3300053077 Bacteria 2009
1065 Ga0495601_0825665 3300053077 Unclassified 588
1066 Ga0495619_0453961 3300053085 Unclassified 883
1067 Ga0587080_121393 3300059503 Unclassified 580
1068 Ga0587071_150359 3300060344 Bacteria 578
1069 Ga0373925_0588096
1070 rootH2_10231894
1071 Ga0065712_10094197
1072 Ga0070658_10058248
1073 Ga0070658_10184645
1074 Ga0070683_100035026
1075 Ga0070683_100144800
1076 Ga0070683_100191643
1077 Ga0070683_100261347
1078 Ga0070690_100037280
1079 Ga0070670_100001671
1080 Ga0070670_100041646
1081 Ga0070670_100196186
1082 Ga0070670_101105421
1083 Ga0068869_100014829
1084 Ga0068869_100037074
1085 Ga0068869_101908937
1086 Ga0070680_100173118
1087 Ga0070680_100281584
1088 Ga0070682_100056200
1089 Ga0070682_101484000
1090 Ga0068868_100001978
1091 Ga0068868_100002128
1092 Ga0068868_100718929
1093 Ga0070660_100082778
1094 Ga0070660_100208428
1095 Ga0070691_10077617
1096 Ga0070691_10083245
1097 Ga0070687_100044499
1098 Ga0070687_100564906
1099 Ga0070661_100036253
1100 Ga0070661_100059537
1101 Ga0070661_100242259
1102 Ga0070661_100272411
1103 Ga0070661_100703833
1104 Ga0070692_10444766
1105 Ga0070675_100071694
1106 Ga0070671_100022623
1107 Ga0070671_100819163
1108 Ga0070671_101533250
1109 Ga0070674_100552448
1110 Ga0070674_100571412
1111 Ga0070673_100063620
1112 Ga0070673_100400791
1113 Ga0070688_100366973
1114 Ga0070688_100751141
1115 Ga0070659_100035299
1116 Ga0070667_100081826
1117 Ga0070667_100422190
1118 Ga0070709_10000124
1119 Ga0070709_10004385
1120 Ga0070709_10007336
1121 Ga0070709_10079571
1122 Ga0070709_10137306
1123 Ga0070709_10147119
1124 Ga0070709_10158379
1125 Ga0070709_10542832
1126 Ga0070709_10656022
1127 Ga0070709_11022584
1128 Ga0070714_100001513
1129 Ga0070714_100004992
1130 Ga0070714_100013058
1131 Ga0070714_100203159
1132 Ga0070714_100245595
1133 Ga0070714_100265531
1134 Ga0070714_100786083
1135 Ga0070714_101144947
1136 Ga0070714_101168549
1137 Ga0070714_101190810
1138 Ga0070714_101238479
1139 Ga0070714_101556120
1140 Ga0070713_100007817
1141 Ga0070713_100021351
1142 Ga0070713_100023074
1143 Ga0070713_100029951
1144 Ga0070713_100035750
1145 Ga0070713_100049791
1146 Ga0070713_100056043
1147 Ga0070713_100086252
1148 Ga0070713_100136892
1149 Ga0070713_100163140
1150 Ga0070713_100304627
1151 Ga0070713_100536428
1152 Ga0070713_100699443
1153 Ga0070713_100701554
1154 Ga0070713_101109195
1155 Ga0070713_101195463
1156 Ga0070713_101207446
1157 Ga0070713_101210468
1158 Ga0070713_101305794
1159 Ga0070713_102021067
1160 Ga0070710_10004411
1161 Ga0070710_10007525
1162 Ga0070710_10014242
1163 Ga0070710_10072591
1164 Ga0070710_10104544
1165 Ga0070710_10104858
1166 Ga0070710_10388130
1167 Ga0070711_100000177
1168 Ga0070711_100000967
1169 Ga0070711_100023772
1170 Ga0070711_100025207
1171 Ga0070711_100032311
1172 Ga0070711_100060428
1173 Ga0070711_100104453
1174 Ga0070711_100137982
1175 Ga0070711_100849622
1176 Ga0070708_100000233
1177 Ga0070708_100020645
1178 Ga0070708_100064714
1179 Ga0070708_100078071
1180 Ga0070708_100079102
1181 Ga0070708_100094858
1182 Ga0070708_100121776
1183 Ga0070708_100193488
1184 Ga0070708_100391958
1185 Ga0070708_100469889
1186 Ga0070663_100917911
1187 Ga0070678_100765393
1188 Ga0070662_100081746
1189 Ga0070681_10016810
1190 Ga0070681_10040101
1191 Ga0070681_10054948
1192 Ga0070681_10096949
1193 Ga0070681_10505964
1194 Ga0070681_10706662
1195 Ga0070681_10740468
1196 Ga0068867_100003355
1197 Ga0070685_10102500
1198 Ga0070706_100004545
1199 Ga0070706_100005808
1200 Ga0070706_100007343
1201 Ga0070706_100102770
1202 Ga0070706_100328296
1203 Ga0070707_100001178
1204 Ga0070707_100027882
1205 Ga0070707_100046302
1206 Ga0070707_100078728
1207 Ga0070707_100148882
1208 Ga0070707_100294927
1209 Ga0070707_100385093
1210 Ga0070707_100439675
1211 Ga0070707_100467235
1212 Ga0070707_100700380
1213 Ga0070707_101413022
1214 Ga0070707_101570759
1215 Ga0070707_101602776
1216 Ga0070698_100008031
1217 Ga0070698_100029536
1218 Ga0070698_100600432
1219 Ga0070698_100882603
1220 Ga0070699_100000726
1221 Ga0070699_100021953
1222 Ga0070699_100111175
1223 Ga0070699_100276125
1224 Ga0070699_100352041
1225 Ga0070699_100361281
1226 Ga0070679_100123029
1227 Ga0070679_100147917
1228 Ga0070679_100765905
1229 Ga0070679_101176456
1230 Ga0070684_100566819
1231 Ga0070684_100628489
1232 Ga0070697_100000178
1233 Ga0070697_100000417
1234 Ga0070697_100000825
1235 Ga0070697_100022312
1236 Ga0070697_100061198
1237 Ga0070697_100134084
1238 Ga0070697_100160430
1239 Ga0070697_100651459
1240 Ga0070697_101406072
1241 Ga0070672_100123688
1242 Ga0070672_100546010
1243 Ga0070672_100896142
1244 Ga0070686_100595862
1245 Ga0070695_100259560
1246 Ga0070696_101031749
1247 Ga0070693_100029120
1248 Ga0070693_100144831
1249 Ga0070693_100147914
1250 Ga0070665_100269864
1251 Ga0070665_100361783
1252 Ga0068855_100009907
1253 Ga0068855_100068957
1254 Ga0068855_100148046
1255 Ga0068855_100297555
1256 Ga0068855_101683435
1257 Ga0070664_100004208
1258 Ga0070664_100017530
1259 Ga0070664_100034600
1260 Ga0070664_100451052
1261 Ga0068857_100000121
1262 Ga0068857_100010837
1263 Ga0068857_100013517
1264 Ga0068857_100614748
1265 Ga0068857_101097631
1266 Ga0068854_100005151
1267 Ga0068856_100000735
1268 Ga0068856_100003101
1269 Ga0068856_100009396
1270 Ga0068856_100013903
1271 Ga0068856_100328411
1272 Ga0068856_100599568
1273 Ga0068856_100651215
1274 Ga0068856_101289878
1275 Ga0070702_100202836
1276 Ga0068852_100182018
1277 Ga0068852_101977655
1278 Ga0068859_100000415
1279 Ga0068859_101027065
1280 Ga0068864_100001353
1281 Ga0068864_100062163
1282 Ga0068864_101448515
1283 Ga0068864_102599655
1284 Ga0068861_100577529
1285 Ga0068851_10010311
1286 Ga0068851_10010643
1287 Ga0068851_10101494
1288 Ga0068863_100125245
1289 Ga0068863_100365545
1290 Ga0068863_100802156
1291 Ga0068863_101650809
1292 Ga0068858_100001756
1293 Ga0068860_100147508
1294 Ga0068860_100281833
1295 Ga0068860_100835963
1296 Ga0068862_100036840
1297 Ga0070717_10002031
1298 Ga0070717_10002353
1299 Ga0070717_10004967
1300 Ga0070717_10017838
1301 Ga0070717_10047477
1302 Ga0070717_10052640
1303 Ga0070717_10104206
1304 Ga0070717_10133449
1305 Ga0070717_10177361
1306 Ga0070717_10369156
1307 Ga0070717_10373231
1308 Ga0070717_10441313
1309 Ga0070717_10533583
1310 Ga0070717_10621710
1311 Ga0070717_11326124
1312 Ga0075365_10113081
1313 Ga0075365_10842243
1314 Ga0075368_10015612
1315 Ga0075368_10049797
1316 Ga0075364_10035156
1317 Ga0075364_10056817
1318 Ga0070715_10005113
1319 Ga0070715_10007964
1320 Ga0070715_10066248
1321 Ga0070715_10111290
1322 Ga0070716_100001161
1323 Ga0070716_100001202
1324 Ga0070716_100006315
1325 Ga0070716_100008072
1326 Ga0070716_100008298
1327 Ga0070716_100009175
1328 Ga0070716_100227038
1329 Ga0070716_100621268
1330 Ga0070716_100670863
1331 Ga0070716_100688384
1332 Ga0070712_100000563
1333 Ga0070712_100002311
1334 Ga0070712_100002744
1335 Ga0070712_100008454
1336 Ga0070712_100009284
1337 Ga0070712_100018486
1338 Ga0070712_100041353
1339 Ga0070712_100075627
1340 Ga0070712_100167270
1341 Ga0070712_100175616
1342 Ga0070712_100406335
1343 Ga0070712_100662894
1344 Ga0070712_101894810
1345 Ga0075362_10022193
1346 Ga0075362_10415068
1347 Ga0075367_10006965
1348 Ga0075366_10027836
1349 Ga0075366_10110587
1350 Ga0097621_100012384
1351 Ga0097621_100205019
1352 Ga0097621_100743607
1353 Ga0097621_101686531
1354 Ga0075370_10003793
1355 Ga0068871_100000258
1356 Ga0068871_100038342
1357 Ga0068871_100045931
1358 Ga0068871_100730359
1359 Ga0068871_101110719
1360 Ga0068871_101876141
1361 Ga0075433_10001437
1362 Ga0075433_10026265
1363 Ga0075433_10161078
1364 Ga0075434_100000558
1365 Ga0075434_100002002
1366 Ga0075434_100013048
1367 Ga0075434_100409948
1368 Ga0075436_100002093
1369 Ga0075436_100004685
1370 Ga0075436_100215758
1371 Ga0075436_100333048
1372 Ga0097620_100000415
1373 Ga0097620_101027003
1374 Ga0075435_100001773
1375 Ga0075435_100004419
1376 Ga0075435_100015210
1377 Ga0075435_100235759
1378 Ga0099794_10172448
1379 Ga0099794_10215001
1380 Ga0099795_10052652
1381 Ga0099795_10445561
1382 Ga0099795_10639228
1383 Ga0105240_10003977
1384 Ga0105240_10007614
1385 Ga0105240_10039816
1386 Ga0105240_10054248
1387 Ga0105240_10086289
1388 Ga0105240_10092117
1389 Ga0105240_10122519
1390 Ga0105240_10183442
1391 Ga0105240_10354365
1392 Ga0105240_10726039
1393 Ga0105240_10970798
1394 Ga0111539_10688636
1395 Ga0111539_10857201
1396 Ga0105245_10015031
1397 Ga0105245_10215226
1398 Ga0105245_11018774
1399 Ga0105247_10004638
1400 Ga0105247_10236657
1401 Ga0105243_10050842
1402 Ga0105241_10004555
1403 Ga0105241_10008310
1404 Ga0105241_10017510
1405 Ga0105241_10185594
1406 Ga0105241_10414027
1407 Ga0105241_10587269
1408 Ga0105241_10824946
1409 Ga0105242_11043623
1410 Ga0105248_10081116
1411 Ga0105248_10136897
1412 Ga0105248_10305204
1413 Ga0105248_11699379
1414 Ga0105237_10144235
1415 Ga0105237_11148862
1416 Ga0105238_10006041
1417 Ga0105238_10016999
1418 Ga0105238_10063599
1419 Ga0105238_10190750
1420 Ga0105238_10238257
1421 Ga0099796_10040799
1422 Ga0099796_10043294
1423 Ga0105239_10014037
1424 Ga0105239_10075736
1425 Ga0105239_10203699
1426 Ga0105239_10300144
1427 Ga0105239_11638313
1428 Ga0105246_10013145
1429 Ga0105246_10576540
1430 Ga0157373_10008141
1431 Ga0157373_10127212
1432 Ga0157373_10136551
1433 Ga0157373_10323684
1434 Ga0157373_10434130
1435 Ga0157371_10164825
1436 Ga0157371_10267475
1437 Ga0157371_10442934
1438 Ga0157371_11173220
1439 Ga0157370_10020143
1440 Ga0157370_10315432
1441 Ga0157370_11164084
1442 Ga0157369_10020040
1443 Ga0157369_10082844
1444 Ga0157369_10162270
1445 Ga0157369_10286471
1446 Ga0157369_10389207
1447 Ga0157369_10451522
1448 Ga0157369_10545999
1449 Ga0157369_12234097
1450 Ga0157374_10000881
1451 Ga0157374_10023522
1452 Ga0157374_10056035
1453 Ga0157374_10132191
1454 Ga0157374_10363263
1455 Ga0157374_10623516
1456 Ga0157374_11244455
1457 Ga0157374_11330216
1458 Ga0157378_10000030
1459 Ga0163162_10015539
1460 Ga0163162_10224506
1461 Ga0163162_10689287
1462 Ga0157372_10000576
1463 Ga0157372_10001714
1464 Ga0157372_10007600
1465 Ga0157372_10018023
1466 Ga0157372_10019657
1467 Ga0157372_10031691
1468 Ga0157372_10040611
1469 Ga0157372_10229211
1470 Ga0157372_10319807
1471 Ga0157372_10356902
1472 Ga0157372_10429893
1473 Ga0157372_10817672
1474 Ga0157372_13263363
1475 Ga0157375_11374238
1476 Ga0163163_10021735
1477 Ga0163163_10146463
1478 Ga0163163_10392764
1479 Ga0163163_10805906
1480 Ga0182008_10021984
1481 Ga0157379_10078092
1482 Ga0157379_11238277
1483 Ga0157376_10112949
1484 Ga0157376_10379918
1485 Ga0157376_10871276
1486 Ga0157376_11222815
1487 Ga0157376_11504722
1488 Ga0182006_1033395
1489 Ga0182007_10003047
1490 Ga0182005_1009721
1491 Ga0213872_10028523
1492 Ga0213872_10072584
1493 Ga0213872_10085000
1494 Ga0213874_10019603
1495 Ga0213876_10005622
1496 Ga0213875_10053355
1497 Ga0213871_10002734
1498 Ga0207656_10013934
1499 Ga0207656_10021529
1500 Ga0207692_10006378
1501 Ga0207692_10044734
1502 Ga0207692_10103082
1503 Ga0207692_10103202
1504 Ga0207692_10142385
1505 Ga0207692_10238359
1506 Ga0207710_10005580
1507 Ga0207647_10044739
1508 Ga0207685_10007324
1509 Ga0207685_10026595
1510 Ga0207685_10035468
1511 Ga0207685_10068198
1512 Ga0207685_10249888
1513 Ga0207699_10001362
1514 Ga0207699_10024434
1515 Ga0207699_10066158
1516 Ga0207699_10081850
1517 Ga0207699_10131673
1518 Ga0207699_10184463
1519 Ga0207699_10602782
1520 Ga0207699_10877485
1521 Ga0207645_10279493
1522 Ga0207705_10176487
1523 Ga0207705_10664370
1524 Ga0207684_10000642
1525 Ga0207684_10011628
1526 Ga0207684_10048277
1527 Ga0207684_10091823
1528 Ga0207654_10003178
1529 Ga0207654_10004021
1530 Ga0207654_10089674
1531 Ga0207654_10179546
1532 Ga0207654_10368000
1533 Ga0207707_10120564
1534 Ga0207707_10186536
1535 Ga0207707_10203104
1536 Ga0207707_10420770
1537 Ga0207695_10008149
1538 Ga0207695_10014420
1539 Ga0207695_10020213
1540 Ga0207695_10029610
1541 Ga0207695_10036245
1542 Ga0207695_10090156
1543 Ga0207695_10125324
1544 Ga0207695_10171345
1545 Ga0207695_10380552
1546 Ga0207695_10570765
1547 Ga0207695_11688536
1548 Ga0207671_10009016
1549 Ga0207693_10000084
1550 Ga0207693_10003411
1551 Ga0207693_10004079
1552 Ga0207693_10004685
1553 Ga0207693_10009120
1554 Ga0207693_10016835
1555 Ga0207693_10021197
1556 Ga0207693_10028599
1557 Ga0207693_10066652
1558 Ga0207693_10118820
1559 Ga0207693_10605389
1560 Ga0207663_10001613
1561 Ga0207663_10004197
1562 Ga0207663_10013450
1563 Ga0207663_10045290
1564 Ga0207663_10050257
1565 Ga0207663_10108995
1566 Ga0207663_10388910
1567 Ga0207663_10503218
1568 Ga0207663_11529943
1569 Ga0207660_10296504
1570 Ga0207660_10540738
1571 Ga0207657_10002596
1572 Ga0207657_10444749
1573 Ga0207649_10064156
1574 Ga0207652_10078946
1575 Ga0207652_10209251
1576 Ga0207652_10363136
1577 Ga0207646_10001331
1578 Ga0207646_10055286
1579 Ga0207646_10082750
1580 Ga0207646_10103335
1581 Ga0207646_10203351
1582 Ga0207646_10225067
1583 Ga0207646_10435216
1584 Ga0207646_11004761
1585 Ga0207646_11061673
1586 Ga0207681_10183688
1587 Ga0207694_10009060
1588 Ga0207694_10151219
1589 Ga0207694_10196088
1590 Ga0207694_10332036
1591 Ga0207694_11120767
1592 Ga0207650_10014559
1593 Ga0207650_10074894
1594 Ga0207650_10230359
1595 Ga0207650_10461366
1596 Ga0207659_10094513
1597 Ga0207659_11101396
1598 Ga0207687_10059373
1599 Ga0207687_10131282
1600 Ga0207700_10000293
1601 Ga0207700_10012079
1602 Ga0207700_10042787
1603 Ga0207700_10044006
1604 Ga0207700_10047878
1605 Ga0207700_10069480
1606 Ga0207700_10084458
1607 Ga0207700_10092181
1608 Ga0207700_10102024
1609 Ga0207700_10156228
1610 Ga0207700_10249297
1611 Ga0207700_10308189
1612 Ga0207700_10316855
1613 Ga0207700_10574749
1614 Ga0207700_10864980
1615 Ga0207700_11504446
1616 Ga0207700_11662893
1617 Ga0207664_10013366
1618 Ga0207664_10032843
1619 Ga0207664_10035600
1620 Ga0207664_10147146
1621 Ga0207664_10301212
1622 Ga0207664_10314730
1623 Ga0207664_10335761
1624 Ga0207664_10585939
1625 Ga0207664_10587940
1626 Ga0207664_11384106
1627 Ga0207644_10200193
1628 Ga0207644_11405168
1629 Ga0207706_10064191
1630 Ga0207706_11453764
1631 Ga0207686_10995702
1632 Ga0207670_10056188
1633 Ga0207669_11557201
1634 Ga0207665_10001047
1635 Ga0207665_10001060
1636 Ga0207665_10008698
1637 Ga0207665_10013254
1638 Ga0207665_10013876
1639 Ga0207665_10031738
1640 Ga0207665_10044585
1641 Ga0207665_10076642
1642 Ga0207665_10079395
1643 Ga0207665_10198518
1644 Ga0207665_10270025
1645 Ga0207665_10729506
1646 Ga0207691_10574452
1647 Ga0207691_10580187
1648 Ga0207711_10007922
1649 Ga0207711_10087071
1650 Ga0207711_10360384
1651 Ga0207689_10083876
1652 Ga0207661_10152439
1653 Ga0207661_10307916
1654 Ga0207679_10181150
1655 Ga0207679_10238997
1656 Ga0207679_10439172
1657 Ga0207679_10540662
1658 Ga0207667_10013776
1659 Ga0207667_10055953
1660 Ga0207667_10163648
1661 Ga0207667_10401622
1662 Ga0207651_10027098
1663 Ga0207651_10034949
1664 Ga0207640_10002147
1665 Ga0207640_10170513
1666 Ga0207658_10103993
1667 Ga0207658_10716841
1668 Ga0207677_10001194
1669 Ga0207677_10002578
1670 Ga0207703_10002718
1671 Ga0207703_11273438
1672 Ga0207703_11378968
1673 Ga0207639_10114943
1674 Ga0207639_11232867
1675 Ga0207702_10000764
1676 Ga0207702_10001551
1677 Ga0207702_10027156
1678 Ga0207702_10073909
1679 Ga0207702_10080814
1680 Ga0207702_10240822
1681 Ga0207702_10264003
1682 Ga0207702_10266245
1683 Ga0207702_10325787
1684 Ga0207702_10547207
1685 Ga0207641_10128289
1686 Ga0207641_10132001
1687 Ga0207641_10180534
1688 Ga0207641_10245754
1689 Ga0207676_10001298
1690 Ga0207676_10225648
1691 Ga0207676_11592726
1692 Ga0207676_11911856
1693 Ga0207674_10000281
1694 Ga0207674_10003756
1695 Ga0207674_10032182
1696 Ga0207674_10393609
1697 Ga0207674_10797843
1698 Ga0207683_10845972
1699 Ga0207698_12239765
1700 Ga0268266_10139119
1701 Ga0268266_10462046
1702 Ga0268265_10026847
1703 Ga0268264_10270805
1704 Ga0268264_10478644
1705 Ga0265337_1000542
1706 Ga0265337_1002344
1707 Ga0265337_1004508
1708 Ga0265337_1007731
1709 Ga0265337_1017646
1710 Ga0265337_1021906
1711 Ga0265337_1043296
1712 Ga0265337_1061535
1713 Ga0265337_1160717
1714 Ga0265326_10060961
1715 Ga0265326_10115618
1716 Ga0265326_10129695
1717 Ga0265319_1000082
1718 Ga0265319_1000383
1719 Ga0265319_1005048
1720 Ga0265319_1024476
1721 Ga0265319_1032006
1722 Ga0265334_10002529
1723 Ga0265334_10005317
1724 Ga0265334_10024695
1725 Ga0265334_10043209
1726 Ga0265334_10045812
1727 Ga0265334_10071229
1728 Ga0265334_10240661
1729 Ga0265318_10000611
1730 Ga0265318_10001111
1731 Ga0265318_10002270
1732 Ga0265318_10015696
1733 Ga0265318_10074196
1734 Ga0265318_10119213
1735 Ga0265323_10000293
1736 Ga0265323_10001094
1737 Ga0265323_10007601
1738 Ga0265322_10000028
1739 Ga0265322_10000169
1740 Ga0265322_10000329
1741 Ga0265322_10006814
1742 Ga0265322_10034070
1743 Ga0265322_10105281
1744 Ga0265336_10000152
1745 Ga0265336_10057325
1746 Ga0265338_10000295
1747 Ga0265338_10000468
1748 Ga0265338_10001464
1749 Ga0265338_10003449
1750 Ga0265338_10004220
1751 Ga0265338_10009337
1752 Ga0265338_10015175
1753 Ga0265338_10016370
1754 Ga0265338_10017637
1755 Ga0265338_10022106
1756 Ga0265338_10027649
1757 Ga0265338_10031867
1758 Ga0265338_10068523
1759 Ga0265338_10075087
1760 Ga0265338_10120361
1761 Ga0265338_10129432
1762 Ga0265338_10220234
1763 Ga0265338_10245876
1764 Ga0265338_10319714
1765 Ga0265338_10473809
1766 Ga0265338_10543990
1767 Ga0265338_10591021
1768 Ga0265338_10727345
1769 Ga0265338_10795672
1770 Ga0265338_10805672
1771 Ga0265338_11161840
1772 Ga0265324_10000484
1773 Ga0265324_10001659
1774 Ga0265324_10002703
1775 Ga0265324_10002940
1776 Ga0265324_10009253
1777 Ga0265324_10011687
1778 Ga0265324_10036441
1779 Ga0265324_10038878
1780 Ga0265324_10076732
1781 Ga0265324_10145941
1782 Ga0265324_10257280
1783 Ga0265760_10028670
1784 Ga0265760_10153259
1785 Ga0265330_10001419
1786 Ga0265330_10023290
1787 Ga0265330_10070411
1788 Ga0265330_10160517
1789 Ga0265332_10024493
1790 Ga0265332_10050583
1791 Ga0265332_10127060
1792 Ga0265332_10335527
1793 Ga0265328_10000745
1794 Ga0265328_10139598
1795 Ga0265320_10000497
1796 Ga0265320_10003678
1797 Ga0265320_10011997
1798 Ga0265320_10080605
1799 Ga0265320_10084941
1800 Ga0265320_10185875
1801 Ga0265320_10219421
1802 Ga0265320_10229723
1803 Ga0265320_10367674
1804 Ga0265325_10001557
1805 Ga0265325_10004103
1806 Ga0265325_10005940
1807 Ga0265325_10027823
1808 Ga0265325_10194129
1809 Ga0265329_10001143
1810 Ga0265329_10025571
1811 Ga0265329_10047227
1812 Ga0265340_10004591
1813 Ga0265340_10007530
1814 Ga0265340_10019971
1815 Ga0265340_10025222
1816 Ga0265340_10052609
1817 Ga0265340_10118413
1818 Ga0265339_10003636
1819 Ga0265339_10004406
1820 Ga0265339_10066402
1821 Ga0265339_10209138
1822 Ga0265339_10554626
1823 Ga0265331_10001038
1824 Ga0265331_10328197
1825 Ga0265331_10416425
1826 Ga0265331_10518106
1827 Ga0265327_10002648
1828 Ga0265327_10008343
1829 Ga0265327_10320443
1830 Ga0265316_10003484
1831 Ga0265316_10004394
1832 Ga0265316_10006331
1833 Ga0265316_10028996
1834 Ga0265316_10066512
1835 Ga0265316_10078133
1836 Ga0265316_10079353
1837 Ga0265316_10130069
1838 Ga0265316_10142749
1839 Ga0265316_10160516
1840 Ga0265316_10200146
1841 Ga0265316_10607919
1842 Ga0265316_10632945
1843 Ga0265316_10686117
1844 Ga0265316_11124707
1845 Ga0265313_10000945
1846 Ga0265313_10003307
1847 Ga0265313_10013437
1848 Ga0265313_10015127
1849 Ga0265313_10061673
1850 Ga0265313_10069853
1851 Ga0265314_10001204
1852 Ga0265314_10058439
1853 Ga0265314_10072895
1854 Ga0265314_10078044
1855 Ga0265314_10121129
1856 Ga0265314_10252900
1857 Ga0265342_10000219
1858 Ga0265342_10006314
1859 Ga0265342_10009671
1860 Ga0265342_10018239
1861 Ga0265342_10032556
1862 Ga0265342_10042317
1863 Ga0265342_10159956
1864 Ga0307409_100051117
1865 Ga0307409_101270328
1866 Ga0307416_100807059
1867 Ga0307416_101567512
1868 Ga0373926_0035045
1869 Ga0373926_0175219
1870 Ga0373934_0033468
1871 Ga0373944_0132193
1872 Ga0373944_0395479
1873 Ga0373923_0084353
1874 Ga0373923_0120032
1875 Ga0373936_0002702
1876 Ga0373936_0082477
1877 Ga0373936_0320152
1878 Ga0373939_0417639
1879 Ga0373953_0284072
1880 Ga0373954_0062318
1881 Ga0373954_0118256
1882 Ga0373956_0289372
1883 Ga0373956_0419727
1884 Ga0373957_0060953
1885 Ga0373957_0170364
1886 Ga0373960_0006213
1887 Ga0373943_0008803
1888 Ga0373943_0067290
1889 Ga0373943_0182752
1890 Ga0373943_0296381
1891 Ga0373943_0300417
1892 Ga0373946_0019548
1893 Ga0373946_0116268
1894 Ga0373955_0053675
1895 Ga0373955_0264788
1896 Ga0373962_0095696
1897 Ga0373931_0486795
1898 Ga0373935_0006293
1899 Ga0373935_0037578
1900 Ga0373935_0147226
1901 Ga0373935_0236664
1902 Ga0373935_1015824
1903 Ga0373927_0020828
1904 Ga0373927_0049204
1905 Ga0373927_0078242
1906 Ga0373927_0475768
1907 Ga0373927_1132874
1908 Ga0373933_0000058
1909 Ga0373933_0026651
1910 Ga0373933_0264794
1911 Ga0373947_0018181
1912 Ga0373947_0018296
1913 Ga0373947_0083697
1914 Ga0373947_0260051
1915 Ga0373947_0278910
1916 Ga0373947_0401192
1917 Ga0373947_0697419
1918 Ga0373937_0000008
1919 Ga0373937_0157358
1920 Ga0373937_0227229
1921 Ga0373937_0309923
1922 Ga0373937_1022690
1923 Ga0373937_1090025
1924 Ga0373937_1323030
1925 Ga0373937_1547096
1926 Ga0373925_0005774
1927 Ga0373925_0013923
1928 Ga0373925_0017898
1929 Ga0373925_0033781
1930 Ga0373925_0057398
1931 Ga0373925_0097392
1932 Ga0373925_0208372
1933 Ga0373925_0278103
1934 Ga0373925_0284902
1935 Ga0395900_0186273
1936 Ga0395900_0308367
1937 Ga0395900_1565074
1938 Ga0395898_0101342
1939 Ga0395905_0058193
1940 Ga0395905_0161058
1941 Ga0436364_0503746
1942 Ga0436364_0713119
1943 Ga0395901_0022807
1944 Ga0395901_1022276
1945 Ga0395901_1118825
1946 Ga0395901_1130743
1947 Ga0436365_0596749
1948 Ga0436365_0660570
1949 Ga0436360_0274844
1950 Ga0436360_0428817
1951 Ga0436360_0480910
1952 Ga0436360_1072958
1953 Ga0436361_0085950
1954 Ga0436361_0234159
1955 Ga0436361_0311977
1956 Ga0436361_0365009
1957 Ga0436361_1107455
1958 Ga0436363_0061087
1959 Ga0436363_1378733
1960 Ga0436362_1173817
1961 Ga0451839_1135551
1962 Ga0451577_0000241
1963 Ga0451577_0042149
1964 Ga0451577_0916874
1965 Ga0466972_0560089
1966 Ga0453683_0013032
1967 Ga0453683_0218397
1968 Ga0466963_0280566
1969 Ga0466963_0335600
1970 Ga0466964_0024093
1971 Ga0466964_0093278
1972 Ga0453684_0000366
1973 Ga0453684_0389644
1974 Ga0466957_0165502
1975 Ga0466959_0338365
1976 Ga0451576_0013105
1977 Ga0451576_0118234
1978 Ga0451576_0353266
1979 Ga0451576_0555111
1980 Ga0451576_1300128
1981 Ga0466967_0648168
1982 Ga0466967_0757018
1983 Ga0495592_0567087
1984 Ga0495603_0202664
1985 Ga0495590_0039548
1986 Ga0495590_0179517
1987 Ga0495629_0007545
1988 Ga0495641_0066599
1989 Ga0495651_0131206
1990 Ga0495651_0134892
1991 Ga0495651_0326210
1992 Ga0495653_0515485
1993 Ga0495653_0765050
1994 Ga0495580_0000038
1995 Ga0495580_0000970
1996 Ga0495580_0001331
1997 Ga0495580_0008880
1998 Ga0495580_0010292
1999 Ga0495580_0010572
2000 Ga0495580_0011519
2001 Ga0495580_0102909
2002 Ga0495580_0287432
2003 Ga0495580_0325001
2004 Ga0495580_0439075
2005 Ga0495580_0497555
2006 Ga0495580_0548071
2007 Ga0495580_1073933
2008 Ga0495582_0004582
2009 Ga0495582_0005852
2010 Ga0495582_0120781
2011 Ga0495582_0442767
2012 Ga0495639_0058131
2013 Ga0495639_0062297
2014 Ga0495639_0152189
2015 Ga0495639_0219026
2016 Ga0495662_0218410
2017 Ga0495664_0316845
2018 Ga0495584_0531891
2019 Ga0495594_0150539
2020 Ga0495608_0101658
2021 Ga0495608_0219676
2022 Ga0495608_0257223
2023 Ga0495628_0141981
2024 Ga0495630_0006895
2025 Ga0495630_0024679
2026 Ga0495630_0073287
2027 Ga0495630_0230567
2028 Ga0495630_0263812
2029 Ga0495630_0372776
2030 Ga0495630_0450136
2031 Ga0495630_0718286
2032 Ga0495666_0082377
2033 Ga0495652_0107767
2034 Ga0495652_0162000
2035 Ga0495652_0771646
2036 Ga0495665_0007054
2037 Ga0495665_0014261
2038 Ga0495665_0353200
2039 Ga0495665_0665389
2040 Ga0495640_0487871
2041 Ga0495586_0018720
2042 Ga0495586_0443122
2043 Ga0495586_0567564
2044 Ga0495587_0000423
2045 Ga0495587_0080020
2046 Ga0495645_0364981
2047 Ga0495645_0813237
2048 Ga0495667_0425893
2049 Ga0495635_0692717
2050 Ga0495588_0248786
2051 Ga0495657_0459608
2052 Ga0495657_0480019
2053 Ga0495599_0467508
2054 Ga0495623_0009865
2055 Ga0495658_0004737
2056 Ga0495658_0004768
2057 Ga0495658_0045434
2058 Ga0495669_0238759
2059 Ga0495613_0043783
2060 Ga0495613_0224412
2061 Ga0495624_0138659
2062 Ga0495624_0234871
2063 Ga0495624_0339443
2064 Ga0495674_0150475
2065 Ga0495674_0271250
2066 Ga0495674_0298263
2067 Ga0495674_0389798
2068 Ga0495674_0798719
2069 Ga0495676_0903476
2070 Ga0495675_0030452
2071 Ga0495684_0001583
2072 Ga0495684_0355036
2073 Ga0495684_0466043
2074 Ga0495684_1090627
2075 Ga0495593_0254453
2076 Ga0495602_0000026
2077 Ga0495602_0032590
2078 Ga0495602_0382004
2079 Ga0495614_0230448
2080 Ga0496100_1497606
2081 Ga0496101_0784020
2082 Ga0496101_0955241
2083 Ga0496102_0060962
2084 Ga0496103_0076041
2085 Ga0496104_0161978
2086 Ga0496104_0401849
2087 Ga0496105_0695435
2088 Ga0496106_0422834
2089 Ga0496106_1001351
2090 Ga0496107_0139292
2091 Ga0496107_0614913
2092 Ga0496108_0044623
2093 Ga0496108_0716807
2094 Ga0496110_0026275
2095 Ga0496111_0044118
2096 Ga0496112_0015301
2097 Ga0496112_0090422
2098 Ga0496112_0123505
2099 Ga0496112_0714532
2100 Ga0496113_0158785
2101 Ga0496113_0605264
2102 Ga0496114_0680576
2103 Ga0496115_0003221
2104 Ga0496119_0444387
2105 Ga0501033_0038382
2106 Ga0501034_0221363
2107 Ga0501080_0063443
2108 nmdc:mga03683_33616_c1
2109 nmdc:mga0yw44_231182_c1
2110 nmdc:mga0yw44_782260_c1
2111 nmdc:mga0k408_23503_c2
2112 nmdc:mga06z11_210394_c1
2113 nmdc:mga06z11_31825_c1
2114 nmdc:mga0n895_1767718_c1
2115 nmdc:mga0n895_2241_c1
2116 nmdc:mga0n895_249_c1
2117 nmdc:mga0n895_5529_c1
2118 nmdc:mga0rr50_110_c2
2119 nmdc:mga0rr50_18748_c1
2120 nmdc:mga0rr50_446054_c1
2121 nmdc:mga0rr50_461694_c1
2122 nmdc:mga0rr50_599394_c1
2123 nmdc:mga0rr50_9343_c1
2124 nmdc:mga08x19_2015_c1
2125 nmdc:mga08x19_2054_c1
2126 nmdc:mga08x19_290469_c1
2127 nmdc:mga08x19_663989_c1
2128 nmdc:mga08x19_916339_c1
2129 nmdc:mga08x19_93400_c1
2130 nmdc:mga0a205_131_c1
2131 nmdc:mga0a205_32965_c1
2132 Ga0495601_0086974
2133 Ga0495601_0825665
2134 Ga0495619_0453961
2135 Ga0587080_121393
2136 Ga0587071_150359

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00582

Usp

Universal stress protein family

1

133

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mjh-assembly1.cif.gz_A structure-based assignment of the biochemical function of hypothetical protein mj0577: a test case of structural genomics 0.8399 1 138
3ab7-assembly3.cif.gz_B crystal structure of the hypothetical tandem-type universal stress protein ttha0350 from thermus thermophilus hb8 0.8389 4 134
1mjh-assembly1.cif.gz_A structure-based assignment of the biochemical function of hypothetical protein mj0577: a test case of structural genomics 0.8348 1 138
3loq-assembly2.cif.gz_B the crystal structure of a universal stress protein from archaeoglobus fulgidus dsm 4304 0.8278 3 136
3loq-assembly1.cif.gz_A the crystal structure of a universal stress protein from archaeoglobus fulgidus dsm 4304 0.8273 3 136
ID Description Score Start End Superfamily
1mjhA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8399 1 138 3.40.50.620
1mjhA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8348 1 138 3.40.50.620
2pfsA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.823 2 137 3.40.50.620
3loqB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8206 3 134 3.40.50.620
3qtbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.818 4 136 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A1Q7V4S6-F1-model_v4 UspA domain-containing protein 1.002 1 95
AF-A0A2V8ZVF2-F1-model_v4 Universal stress protein 0.9532 1 138
AF-A0A1Q7V4S6-F1-model_v4 UspA domain-containing protein 0.9423 1 95
AF-A0A2V9UPT1-F1-model_v4 Universal stress protein 0.9409 1 138
AF-A0A2V9UPT1-F1-model_v4 Universal stress protein 0.9342 1 138

Map