F489443
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1068 | 312 | 2136 | 139 |
Family's Representative Sequence
| Representative Sequence | 3300037068|Ga0373925_0588096|Ga0373925_0588096_13_522 |
| Length | 169 |
| Sequence | MYDKILVTLDGTPRDRAIIEHVKQLAKLAHSRLVLLHVADGWAARTYGQDAVSPEIAEDTAYLEKVRSEFQVMDIPTEAELAYGEPVKEIIRWIEQKGCDLVAMSTHGHRFLADIFLGTTASRVQHRISVPVRRECDDATMFRLSAGIADGGRAFCRRAARDGYIEEVR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 66 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 67 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 68 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 72 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 73 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 83 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 111 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 112 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 113 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 114 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 115 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 116 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 117 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 118 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 173 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 174 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 175 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 176 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 177 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 178 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 179 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 180 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 182 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 183 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 184 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 186 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 187 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 188 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 189 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 190 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 191 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 192 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 193 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 194 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 197 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 198 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 199 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 200 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 202 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 204 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 205 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 206 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 207 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 209 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 210 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 211 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 212 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 213 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 214 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 217 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 218 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 219 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 221 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 222 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 223 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 224 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 225 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 226 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 227 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 228 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 229 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 230 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 231 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 232 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 233 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 234 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 235 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 236 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 237 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 238 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 239 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 240 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 241 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 285 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 286 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 287 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 288 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 289 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 290 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 292 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 293 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 294 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 295 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 296 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 297 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 298 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 302 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 303 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 304 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 305 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.63 |
| Metatranscriptomes | 0.37 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.69 |
| Nodule | 0 |
| Rhizoplane | 2.25 |
| Rhizosphere | 94.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 26.4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373925_0588096 | 3300037068 | Bacteria | 916 |
| 2 | rootH2_10231894 | 3300003320 | Bacteria | 1845 |
| 3 | Ga0065712_10094197 | 3300005290 | Bacteria | 2188 |
| 4 | Ga0070658_10058248 | 3300005327 | Bacteria | 3143 |
| 5 | Ga0070658_10184645 | 3300005327 | Bacteria | 1756 |
| 6 | Ga0070683_100035026 | 3300005329 | Bacteria | 4589 |
| 7 | Ga0070683_100144800 | 3300005329 | Bacteria | 2251 |
| 8 | Ga0070683_100191643 | 3300005329 | Bacteria | 1941 |
| 9 | Ga0070683_100261347 | 3300005329 | Bacteria | 1647 |
| 10 | Ga0070690_100037280 | 3300005330 | Bacteria | 3063 |
| 11 | Ga0070670_100001671 | 3300005331 | Bacteria | 18007 |
| 12 | Ga0070670_100041646 | 3300005331 | Bacteria | 3947 |
| 13 | Ga0070670_100196186 | 3300005331 | Bacteria | 1754 |
| 14 | Ga0070670_101105421 | 3300005331 | Unclassified | 723 |
| 15 | Ga0068869_100014829 | 3300005334 | Bacteria | 5212 |
| 16 | Ga0068869_100037074 | 3300005334 | Bacteria | 3465 |
| 17 | Ga0068869_101908937 | 3300005334 | Unclassified | 532 |
| 18 | Ga0070680_100173118 | 3300005336 | Bacteria | 1817 |
| 19 | Ga0070680_100281584 | 3300005336 | Bacteria | 1409 |
| 20 | Ga0070682_100056200 | 3300005337 | Bacteria | 2475 |
| 21 | Ga0070682_101484000 | 3300005337 | Unclassified | 582 |
| 22 | Ga0068868_100001978 | 3300005338 | Bacteria | 14073 |
| 23 | Ga0068868_100002128 | 3300005338 | Bacteria | 13662 |
| 24 | Ga0068868_100718929 | 3300005338 | Bacteria | 895 |
| 25 | Ga0070660_100082778 | 3300005339 | Bacteria | 2520 |
| 26 | Ga0070660_100208428 | 3300005339 | Bacteria | 1586 |
| 27 | Ga0070691_10077617 | 3300005341 | Bacteria | 1621 |
| 28 | Ga0070691_10083245 | 3300005341 | Bacteria | 1569 |
| 29 | Ga0070687_100044499 | 3300005343 | Bacteria | 2262 |
| 30 | Ga0070687_100564906 | 3300005343 | Unclassified | 776 |
| 31 | Ga0070661_100036253 | 3300005344 | Bacteria | 3585 |
| 32 | Ga0070661_100059537 | 3300005344 | Unclassified | 2801 |
| 33 | Ga0070661_100242259 | 3300005344 | Bacteria | 1389 |
| 34 | Ga0070661_100272411 | 3300005344 | Bacteria | 1311 |
| 35 | Ga0070661_100703833 | 3300005344 | Bacteria | 823 |
| 36 | Ga0070692_10444766 | 3300005345 | Unclassified | 828 |
| 37 | Ga0070675_100071694 | 3300005354 | Bacteria | 2875 |
| 38 | Ga0070671_100022623 | 3300005355 | Bacteria | 5135 |
| 39 | Ga0070671_100819163 | 3300005355 | Bacteria | 811 |
| 40 | Ga0070671_101533250 | 3300005355 | Unclassified | 590 |
| 41 | Ga0070674_100552448 | 3300005356 | Unclassified | 966 |
| 42 | Ga0070674_100571412 | 3300005356 | Bacteria | 951 |
| 43 | Ga0070673_100063620 | 3300005364 | Bacteria | 2936 |
| 44 | Ga0070673_100400791 | 3300005364 | Unclassified | 1227 |
| 45 | Ga0070688_100366973 | 3300005365 | Bacteria | 1058 |
| 46 | Ga0070688_100751141 | 3300005365 | Unclassified | 759 |
| 47 | Ga0070659_100035299 | 3300005366 | Bacteria | 3894 |
| 48 | Ga0070667_100081826 | 3300005367 | Bacteria | 2763 |
| 49 | Ga0070667_100422190 | 3300005367 | Bacteria | 1216 |
| 50 | Ga0070709_10000124 | 3300005434 | Bacteria | 51386 |
| 51 | Ga0070709_10004385 | 3300005434 | Bacteria | 7608 |
| 52 | Ga0070709_10007336 | 3300005434 | Bacteria | 6040 |
| 53 | Ga0070709_10079571 | 3300005434 | Bacteria | 2135 |
| 54 | Ga0070709_10137306 | 3300005434 | Bacteria | 1676 |
| 55 | Ga0070709_10147119 | 3300005434 | Bacteria | 1624 |
| 56 | Ga0070709_10158379 | 3300005434 | Bacteria | 1572 |
| 57 | Ga0070709_10542832 | 3300005434 | Unclassified | 888 |
| 58 | Ga0070709_10656022 | 3300005434 | Unclassified | 813 |
| 59 | Ga0070709_11022584 | 3300005434 | Unclassified | 658 |
| 60 | Ga0070714_100001513 | 3300005435 | Bacteria | 16933 |
| 61 | Ga0070714_100004992 | 3300005435 | Bacteria | 10086 |
| 62 | Ga0070714_100013058 | 3300005435 | Bacteria | 6647 |
| 63 | Ga0070714_100203159 | 3300005435 | Bacteria | 1813 |
| 64 | Ga0070714_100245595 | 3300005435 | Bacteria | 1654 |
| 65 | Ga0070714_100265531 | 3300005435 | Bacteria | 1590 |
| 66 | Ga0070714_100786083 | 3300005435 | Unclassified | 921 |
| 67 | Ga0070714_101144947 | 3300005435 | Unclassified | 759 |
| 68 | Ga0070714_101168549 | 3300005435 | Unclassified | 750 |
| 69 | Ga0070714_101190810 | 3300005435 | Bacteria | 743 |
| 70 | Ga0070714_101238479 | 3300005435 | Unclassified | 728 |
| 71 | Ga0070714_101556120 | 3300005435 | Unclassified | 646 |
| 72 | Ga0070713_100007817 | 3300005436 | Bacteria | 7539 |
| 73 | Ga0070713_100021351 | 3300005436 | Bacteria | 4977 |
| 74 | Ga0070713_100023074 | 3300005436 | Bacteria | 4820 |
| 75 | Ga0070713_100029951 | 3300005436 | Bacteria | 4316 |
| 76 | Ga0070713_100035750 | 3300005436 | Bacteria | 4002 |
| 77 | Ga0070713_100049791 | 3300005436 | Bacteria | 3458 |
| 78 | Ga0070713_100056043 | 3300005436 | Bacteria | 3278 |
| 79 | Ga0070713_100086252 | 3300005436 | Bacteria | 2691 |
| 80 | Ga0070713_100136892 | 3300005436 | Bacteria | 2165 |
| 81 | Ga0070713_100163140 | 3300005436 | Bacteria | 1991 |
| 82 | Ga0070713_100304627 | 3300005436 | Bacteria | 1468 |
| 83 | Ga0070713_100536428 | 3300005436 | Bacteria | 1107 |
| 84 | Ga0070713_100699443 | 3300005436 | Bacteria | 968 |
| 85 | Ga0070713_100701554 | 3300005436 | Unclassified | 966 |
| 86 | Ga0070713_101109195 | 3300005436 | Unclassified | 765 |
| 87 | Ga0070713_101195463 | 3300005436 | Bacteria | 736 |
| 88 | Ga0070713_101207446 | 3300005436 | Unclassified | 732 |
| 89 | Ga0070713_101210468 | 3300005436 | Unclassified | 731 |
| 90 | Ga0070713_101305794 | 3300005436 | Unclassified | 703 |
| 91 | Ga0070713_102021067 | 3300005436 | Bacteria | 559 |
| 92 | Ga0070710_10004411 | 3300005437 | Bacteria | 6659 |
| 93 | Ga0070710_10007525 | 3300005437 | Bacteria | 5277 |
| 94 | Ga0070710_10014242 | 3300005437 | Bacteria | 3999 |
| 95 | Ga0070710_10072591 | 3300005437 | Bacteria | 1988 |
| 96 | Ga0070710_10104544 | 3300005437 | Bacteria | 1692 |
| 97 | Ga0070710_10104858 | 3300005437 | Bacteria | 1689 |
| 98 | Ga0070710_10388130 | 3300005437 | Unclassified | 933 |
| 99 | Ga0070711_100000177 | 3300005439 | Bacteria | 33896 |
| 100 | Ga0070711_100000967 | 3300005439 | Bacteria | 15200 |
| 101 | Ga0070711_100023772 | 3300005439 | Bacteria | 3990 |
| 102 | Ga0070711_100025207 | 3300005439 | Bacteria | 3888 |
| 103 | Ga0070711_100032311 | 3300005439 | Bacteria | 3479 |
| 104 | Ga0070711_100060428 | 3300005439 | Bacteria | 2634 |
| 105 | Ga0070711_100104453 | 3300005439 | Bacteria | 2067 |
| 106 | Ga0070711_100137982 | 3300005439 | Unclassified | 1825 |
| 107 | Ga0070711_100849622 | 3300005439 | Unclassified | 776 |
| 108 | Ga0070708_100000233 | 3300005445 | Bacteria | 41575 |
| 109 | Ga0070708_100020645 | 3300005445 | Bacteria | 5559 |
| 110 | Ga0070708_100064714 | 3300005445 | Bacteria | 3277 |
| 111 | Ga0070708_100078071 | 3300005445 | Bacteria | 2993 |
| 112 | Ga0070708_100079102 | 3300005445 | Bacteria | 2974 |
| 113 | Ga0070708_100094858 | 3300005445 | Bacteria | 2723 |
| 114 | Ga0070708_100121776 | 3300005445 | Bacteria | 2407 |
| 115 | Ga0070708_100193488 | 3300005445 | Bacteria | 1903 |
| 116 | Ga0070708_100391958 | 3300005445 | Bacteria | 1310 |
| 117 | Ga0070708_100469889 | 3300005445 | Bacteria | 1187 |
| 118 | Ga0070663_100917911 | 3300005455 | Unclassified | 757 |
| 119 | Ga0070678_100765393 | 3300005456 | Bacteria | 874 |
| 120 | Ga0070662_100081746 | 3300005457 | Bacteria | 2408 |
| 121 | Ga0070681_10016810 | 3300005458 | Bacteria | 7306 |
| 122 | Ga0070681_10040101 | 3300005458 | Bacteria | 4695 |
| 123 | Ga0070681_10054948 | 3300005458 | Bacteria | 3967 |
| 124 | Ga0070681_10096949 | 3300005458 | Bacteria | 2896 |
| 125 | Ga0070681_10505964 | 3300005458 | Unclassified | 1121 |
| 126 | Ga0070681_10706662 | 3300005458 | Unclassified | 924 |
| 127 | Ga0070681_10740468 | 3300005458 | Bacteria | 899 |
| 128 | Ga0068867_100003355 | 3300005459 | Bacteria | 11279 |
| 129 | Ga0070685_10102500 | 3300005466 | Bacteria | 1750 |
| 130 | Ga0070706_100004545 | 3300005467 | Bacteria | 13348 |
| 131 | Ga0070706_100005808 | 3300005467 | Bacteria | 11725 |
| 132 | Ga0070706_100007343 | 3300005467 | Bacteria | 10338 |
| 133 | Ga0070706_100102770 | 3300005467 | Bacteria | 2657 |
| 134 | Ga0070706_100328296 | 3300005467 | Bacteria | 1426 |
| 135 | Ga0070707_100001178 | 3300005468 | Bacteria | 25716 |
| 136 | Ga0070707_100027882 | 3300005468 | Bacteria | 5372 |
| 137 | Ga0070707_100046302 | 3300005468 | Bacteria | 4163 |
| 138 | Ga0070707_100078728 | 3300005468 | Bacteria | 3180 |
| 139 | Ga0070707_100148882 | 3300005468 | Bacteria | 2279 |
| 140 | Ga0070707_100294927 | 3300005468 | Bacteria | 1576 |
| 141 | Ga0070707_100385093 | 3300005468 | Bacteria | 1362 |
| 142 | Ga0070707_100439675 | 3300005468 | Unclassified | 1265 |
| 143 | Ga0070707_100467235 | 3300005468 | Bacteria | 1223 |
| 144 | Ga0070707_100700380 | 3300005468 | Unclassified | 976 |
| 145 | Ga0070707_101413022 | 3300005468 | Unclassified | 662 |
| 146 | Ga0070707_101570759 | 3300005468 | Bacteria | 625 |
| 147 | Ga0070707_101602776 | 3300005468 | Unclassified | 618 |
| 148 | Ga0070698_100008031 | 3300005471 | Bacteria | 11414 |
| 149 | Ga0070698_100029536 | 3300005471 | Bacteria | 5691 |
| 150 | Ga0070698_100600432 | 3300005471 | Bacteria | 1041 |
| 151 | Ga0070698_100882603 | 3300005471 | Bacteria | 840 |
| 152 | Ga0070699_100000726 | 3300005518 | Bacteria | 30560 |
| 153 | Ga0070699_100021953 | 3300005518 | Bacteria | 5500 |
| 154 | Ga0070699_100111175 | 3300005518 | Bacteria | 2406 |
| 155 | Ga0070699_100276125 | 3300005518 | Bacteria | 1505 |
| 156 | Ga0070699_100352041 | 3300005518 | Unclassified | 1327 |
| 157 | Ga0070699_100361281 | 3300005518 | Bacteria | 1309 |
| 158 | Ga0070679_100123029 | 3300005530 | Bacteria | 2578 |
| 159 | Ga0070679_100147917 | 3300005530 | Bacteria | 2326 |
| 160 | Ga0070679_100765905 | 3300005530 | Unclassified | 908 |
| 161 | Ga0070679_101176456 | 3300005530 | Bacteria | 712 |
| 162 | Ga0070684_100566819 | 3300005535 | Bacteria | 1054 |
| 163 | Ga0070684_100628489 | 3300005535 | Bacteria | 999 |
| 164 | Ga0070697_100000178 | 3300005536 | Bacteria | 52143 |
| 165 | Ga0070697_100000417 | 3300005536 | Bacteria | 32884 |
| 166 | Ga0070697_100000825 | 3300005536 | Bacteria | 23250 |
| 167 | Ga0070697_100022312 | 3300005536 | Bacteria | 5024 |
| 168 | Ga0070697_100061198 | 3300005536 | Bacteria | 3070 |
| 169 | Ga0070697_100134084 | 3300005536 | Bacteria | 2079 |
| 170 | Ga0070697_100160430 | 3300005536 | Bacteria | 1899 |
| 171 | Ga0070697_100651459 | 3300005536 | Unclassified | 927 |
| 172 | Ga0070697_101406072 | 3300005536 | Unclassified | 623 |
| 173 | Ga0070672_100123688 | 3300005543 | Unclassified | 2120 |
| 174 | Ga0070672_100546010 | 3300005543 | Bacteria | 1006 |
| 175 | Ga0070672_100896142 | 3300005543 | Unclassified | 783 |
| 176 | Ga0070686_100595862 | 3300005544 | Bacteria | 870 |
| 177 | Ga0070695_100259560 | 3300005545 | Unclassified | 1268 |
| 178 | Ga0070696_101031749 | 3300005546 | Unclassified | 688 |
| 179 | Ga0070693_100029120 | 3300005547 | Bacteria | 3009 |
| 180 | Ga0070693_100144831 | 3300005547 | Bacteria | 1499 |
| 181 | Ga0070693_100147914 | 3300005547 | Unclassified | 1485 |
| 182 | Ga0070665_100269864 | 3300005548 | Bacteria | 1703 |
| 183 | Ga0070665_100361783 | 3300005548 | Bacteria | 1457 |
| 184 | Ga0068855_100009907 | 3300005563 | Bacteria | 11492 |
| 185 | Ga0068855_100068957 | 3300005563 | Bacteria | 4116 |
| 186 | Ga0068855_100148046 | 3300005563 | Bacteria | 2671 |
| 187 | Ga0068855_100297555 | 3300005563 | Bacteria | 1788 |
| 188 | Ga0068855_101683435 | 3300005563 | Unclassified | 647 |
| 189 | Ga0070664_100004208 | 3300005564 | Bacteria | 11568 |
| 190 | Ga0070664_100017530 | 3300005564 | Bacteria | 5882 |
| 191 | Ga0070664_100034600 | 3300005564 | Bacteria | 4238 |
| 192 | Ga0070664_100451052 | 3300005564 | Bacteria | 1181 |
| 193 | Ga0068857_100000121 | 3300005577 | Bacteria | 46931 |
| 194 | Ga0068857_100010837 | 3300005577 | Bacteria | 7936 |
| 195 | Ga0068857_100013517 | 3300005577 | Bacteria | 7111 |
| 196 | Ga0068857_100614748 | 3300005577 | Bacteria | 1028 |
| 197 | Ga0068857_101097631 | 3300005577 | Unclassified | 768 |
| 198 | Ga0068854_100005151 | 3300005578 | Bacteria | 8240 |
| 199 | Ga0068856_100000735 | 3300005614 | Bacteria | 35512 |
| 200 | Ga0068856_100003101 | 3300005614 | Bacteria | 16968 |
| 201 | Ga0068856_100009396 | 3300005614 | Bacteria | 9498 |
| 202 | Ga0068856_100013903 | 3300005614 | Bacteria | 7785 |
| 203 | Ga0068856_100328411 | 3300005614 | Bacteria | 1547 |
| 204 | Ga0068856_100599568 | 3300005614 | Bacteria | 1122 |
| 205 | Ga0068856_100651215 | 3300005614 | Unclassified | 1074 |
| 206 | Ga0068856_101289878 | 3300005614 | Unclassified | 746 |
| 207 | Ga0070702_100202836 | 3300005615 | Bacteria | 1314 |
| 208 | Ga0068852_100182018 | 3300005616 | Bacteria | 1977 |
| 209 | Ga0068852_101977655 | 3300005616 | Unclassified | 605 |
| 210 | Ga0068859_100000415 | 3300005617 | Bacteria | 42515 |
| 211 | Ga0068859_101027065 | 3300005617 | Bacteria | 906 |
| 212 | Ga0068864_100001353 | 3300005618 | Bacteria | 20389 |
| 213 | Ga0068864_100062163 | 3300005618 | Bacteria | 3235 |
| 214 | Ga0068864_101448515 | 3300005618 | Unclassified | 689 |
| 215 | Ga0068864_102599655 | 3300005618 | Unclassified | 512 |
| 216 | Ga0068861_100577529 | 3300005719 | Unclassified | 1028 |
| 217 | Ga0068851_10010311 | 3300005834 | Bacteria | 4358 |
| 218 | Ga0068851_10010643 | 3300005834 | Bacteria | 4295 |
| 219 | Ga0068851_10101494 | 3300005834 | Bacteria | 1527 |
| 220 | Ga0068863_100125245 | 3300005841 | Bacteria | 2451 |
| 221 | Ga0068863_100365545 | 3300005841 | Bacteria | 1407 |
| 222 | Ga0068863_100802156 | 3300005841 | Unclassified | 939 |
| 223 | Ga0068863_101650809 | 3300005841 | Unclassified | 650 |
| 224 | Ga0068858_100001756 | 3300005842 | Bacteria | 22108 |
| 225 | Ga0068860_100147508 | 3300005843 | Bacteria | 2264 |
| 226 | Ga0068860_100281833 | 3300005843 | Bacteria | 1624 |
| 227 | Ga0068860_100835963 | 3300005843 | Bacteria | 935 |
| 228 | Ga0068862_100036840 | 3300005844 | Bacteria | 4146 |
| 229 | Ga0070717_10002031 | 3300006028 | Bacteria | 14168 |
| 230 | Ga0070717_10002353 | 3300006028 | Bacteria | 13321 |
| 231 | Ga0070717_10004967 | 3300006028 | Bacteria | 9676 |
| 232 | Ga0070717_10017838 | 3300006028 | Bacteria | 5533 |
| 233 | Ga0070717_10047477 | 3300006028 | Unclassified | 3518 |
| 234 | Ga0070717_10052640 | 3300006028 | Bacteria | 3354 |
| 235 | Ga0070717_10104206 | 3300006028 | Bacteria | 2412 |
| 236 | Ga0070717_10133449 | 3300006028 | Bacteria | 2137 |
| 237 | Ga0070717_10177361 | 3300006028 | Bacteria | 1856 |
| 238 | Ga0070717_10369156 | 3300006028 | Bacteria | 1285 |
| 239 | Ga0070717_10373231 | 3300006028 | Unclassified | 1278 |
| 240 | Ga0070717_10441313 | 3300006028 | Unclassified | 1172 |
| 241 | Ga0070717_10533583 | 3300006028 | Unclassified | 1062 |
| 242 | Ga0070717_10621710 | 3300006028 | Bacteria | 980 |
| 243 | Ga0070717_11326124 | 3300006028 | Unclassified | 654 |
| 244 | Ga0075365_10113081 | 3300006038 | Bacteria | 1867 |
| 245 | Ga0075365_10842243 | 3300006038 | Bacteria | 647 |
| 246 | Ga0075368_10015612 | 3300006042 | Bacteria | 2821 |
| 247 | Ga0075368_10049797 | 3300006042 | Bacteria | 1663 |
| 248 | Ga0075364_10035156 | 3300006051 | Bacteria | 3237 |
| 249 | Ga0075364_10056817 | 3300006051 | Bacteria | 2563 |
| 250 | Ga0070715_10005113 | 3300006163 | Bacteria | 4355 |
| 251 | Ga0070715_10007964 | 3300006163 | Bacteria | 3672 |
| 252 | Ga0070715_10066248 | 3300006163 | Bacteria | 1601 |
| 253 | Ga0070715_10111290 | 3300006163 | Unclassified | 1292 |
| 254 | Ga0070716_100001161 | 3300006173 | Bacteria | 11608 |
| 255 | Ga0070716_100001202 | 3300006173 | Bacteria | 11400 |
| 256 | Ga0070716_100006315 | 3300006173 | Bacteria | 5786 |
| 257 | Ga0070716_100008072 | 3300006173 | Bacteria | 5211 |
| 258 | Ga0070716_100008298 | 3300006173 | Bacteria | 5152 |
| 259 | Ga0070716_100009175 | 3300006173 | Bacteria | 4925 |
| 260 | Ga0070716_100227038 | 3300006173 | Bacteria | 1258 |
| 261 | Ga0070716_100621268 | 3300006173 | Unclassified | 815 |
| 262 | Ga0070716_100670863 | 3300006173 | Bacteria | 788 |
| 263 | Ga0070716_100688384 | 3300006173 | Unclassified | 780 |
| 264 | Ga0070712_100000563 | 3300006175 | Bacteria | 21576 |
| 265 | Ga0070712_100002311 | 3300006175 | Bacteria | 11744 |
| 266 | Ga0070712_100002744 | 3300006175 | Bacteria | 10883 |
| 267 | Ga0070712_100008454 | 3300006175 | Bacteria | 6478 |
| 268 | Ga0070712_100009284 | 3300006175 | Bacteria | 6196 |
| 269 | Ga0070712_100018486 | 3300006175 | Bacteria | 4529 |
| 270 | Ga0070712_100041353 | 3300006175 | Bacteria | 3165 |
| 271 | Ga0070712_100075627 | 3300006175 | Bacteria | 2422 |
| 272 | Ga0070712_100167270 | 3300006175 | Unclassified | 1703 |
| 273 | Ga0070712_100175616 | 3300006175 | Bacteria | 1665 |
| 274 | Ga0070712_100406335 | 3300006175 | Unclassified | 1126 |
| 275 | Ga0070712_100662894 | 3300006175 | Unclassified | 887 |
| 276 | Ga0070712_101894810 | 3300006175 | Unclassified | 522 |
| 277 | Ga0075362_10022193 | 3300006177 | Bacteria | 2672 |
| 278 | Ga0075362_10415068 | 3300006177 | Unclassified | 680 |
| 279 | Ga0075367_10006965 | 3300006178 | Bacteria | 5758 |
| 280 | Ga0075366_10027836 | 3300006195 | Bacteria | 3317 |
| 281 | Ga0075366_10110587 | 3300006195 | Bacteria | 1652 |
| 282 | Ga0097621_100012384 | 3300006237 | Bacteria | 6321 |
| 283 | Ga0097621_100205019 | 3300006237 | Unclassified | 1713 |
| 284 | Ga0097621_100743607 | 3300006237 | Unclassified | 905 |
| 285 | Ga0097621_101686531 | 3300006237 | Unclassified | 603 |
| 286 | Ga0075370_10003793 | 3300006353 | Bacteria | 7236 |
| 287 | Ga0068871_100000258 | 3300006358 | Bacteria | 36543 |
| 288 | Ga0068871_100038342 | 3300006358 | Bacteria | 3826 |
| 289 | Ga0068871_100045931 | 3300006358 | Bacteria | 3517 |
| 290 | Ga0068871_100730359 | 3300006358 | Unclassified | 909 |
| 291 | Ga0068871_101110719 | 3300006358 | Bacteria | 739 |
| 292 | Ga0068871_101876141 | 3300006358 | Unclassified | 569 |
| 293 | Ga0075433_10001437 | 3300006852 | Bacteria | 17563 |
| 294 | Ga0075433_10026265 | 3300006852 | Bacteria | 4929 |
| 295 | Ga0075433_10161078 | 3300006852 | Bacteria | 1997 |
| 296 | Ga0075434_100000558 | 3300006871 | Bacteria | 28576 |
| 297 | Ga0075434_100002002 | 3300006871 | Bacteria | 17697 |
| 298 | Ga0075434_100013048 | 3300006871 | Bacteria | 7890 |
| 299 | Ga0075434_100409948 | 3300006871 | Unclassified | 1376 |
| 300 | Ga0075436_100002093 | 3300006914 | Bacteria | 13779 |
| 301 | Ga0075436_100004685 | 3300006914 | Bacteria | 9379 |
| 302 | Ga0075436_100215758 | 3300006914 | Bacteria | 1361 |
| 303 | Ga0075436_100333048 | 3300006914 | Bacteria | 1092 |
| 304 | Ga0097620_100000415 | 3300006931 | Bacteria | 42515 |
| 305 | Ga0097620_101027003 | 3300006931 | Bacteria | 906 |
| 306 | Ga0075435_100001773 | 3300007076 | Bacteria | 14054 |
| 307 | Ga0075435_100004419 | 3300007076 | Bacteria | 9652 |
| 308 | Ga0075435_100015210 | 3300007076 | Bacteria | 5779 |
| 309 | Ga0075435_100235759 | 3300007076 | Bacteria | 1555 |
| 310 | Ga0099794_10172448 | 3300007265 | Bacteria | 1103 |
| 311 | Ga0099794_10215001 | 3300007265 | Unclassified | 987 |
| 312 | Ga0099795_10052652 | 3300007788 | Bacteria | 1487 |
| 313 | Ga0099795_10445561 | 3300007788 | Unclassified | 595 |
| 314 | Ga0099795_10639228 | 3300007788 | Unclassified | 508 |
| 315 | Ga0105240_10003977 | 3300009093 | Bacteria | 22806 |
| 316 | Ga0105240_10007614 | 3300009093 | Bacteria | 15684 |
| 317 | Ga0105240_10039816 | 3300009093 | Bacteria | 6016 |
| 318 | Ga0105240_10054248 | 3300009093 | Bacteria | 5024 |
| 319 | Ga0105240_10086289 | 3300009093 | Bacteria | 3844 |
| 320 | Ga0105240_10092117 | 3300009093 | Bacteria | 3702 |
| 321 | Ga0105240_10122519 | 3300009093 | Unclassified | 3129 |
| 322 | Ga0105240_10183442 | 3300009093 | Bacteria | 2468 |
| 323 | Ga0105240_10354365 | 3300009093 | Bacteria | 1664 |
| 324 | Ga0105240_10726039 | 3300009093 | Unclassified | 1082 |
| 325 | Ga0105240_10970798 | 3300009093 | Unclassified | 910 |
| 326 | Ga0111539_10688636 | 3300009094 | Bacteria | 1190 |
| 327 | Ga0111539_10857201 | 3300009094 | Bacteria | 1057 |
| 328 | Ga0105245_10015031 | 3300009098 | Bacteria | 6745 |
| 329 | Ga0105245_10215226 | 3300009098 | Bacteria | 1851 |
| 330 | Ga0105245_11018774 | 3300009098 | Unclassified | 873 |
| 331 | Ga0105247_10004638 | 3300009101 | Bacteria | 8762 |
| 332 | Ga0105247_10236657 | 3300009101 | Bacteria | 1242 |
| 333 | Ga0105243_10050842 | 3300009148 | Bacteria | 3276 |
| 334 | Ga0105241_10004555 | 3300009174 | Bacteria | 10257 |
| 335 | Ga0105241_10008310 | 3300009174 | Bacteria | 7641 |
| 336 | Ga0105241_10017510 | 3300009174 | Bacteria | 5267 |
| 337 | Ga0105241_10185594 | 3300009174 | Bacteria | 1728 |
| 338 | Ga0105241_10414027 | 3300009174 | Bacteria | 1185 |
| 339 | Ga0105241_10587269 | 3300009174 | Unclassified | 1005 |
| 340 | Ga0105241_10824946 | 3300009174 | Unclassified | 856 |
| 341 | Ga0105242_11043623 | 3300009176 | Unclassified | 828 |
| 342 | Ga0105248_10081116 | 3300009177 | Bacteria | 3647 |
| 343 | Ga0105248_10136897 | 3300009177 | Bacteria | 2763 |
| 344 | Ga0105248_10305204 | 3300009177 | Bacteria | 1792 |
| 345 | Ga0105248_11699379 | 3300009177 | Unclassified | 715 |
| 346 | Ga0105237_10144235 | 3300009545 | Bacteria | 2375 |
| 347 | Ga0105237_11148862 | 3300009545 | Unclassified | 783 |
| 348 | Ga0105238_10006041 | 3300009551 | Bacteria | 12007 |
| 349 | Ga0105238_10016999 | 3300009551 | Bacteria | 7385 |
| 350 | Ga0105238_10063599 | 3300009551 | Bacteria | 3690 |
| 351 | Ga0105238_10190750 | 3300009551 | Bacteria | 2025 |
| 352 | Ga0105238_10238257 | 3300009551 | Bacteria | 1797 |
| 353 | Ga0099796_10040799 | 3300010159 | Unclassified | 1569 |
| 354 | Ga0099796_10043294 | 3300010159 | Bacteria | 1533 |
| 355 | Ga0105239_10014037 | 3300010375 | Bacteria | 8892 |
| 356 | Ga0105239_10075736 | 3300010375 | Bacteria | 3700 |
| 357 | Ga0105239_10203699 | 3300010375 | Bacteria | 2217 |
| 358 | Ga0105239_10300144 | 3300010375 | Bacteria | 1809 |
| 359 | Ga0105239_11638313 | 3300010375 | Unclassified | 744 |
| 360 | Ga0105246_10013145 | 3300011119 | Bacteria | 5182 |
| 361 | Ga0105246_10576540 | 3300011119 | Unclassified | 968 |
| 362 | Ga0157373_10008141 | 3300013100 | Bacteria | 7796 |
| 363 | Ga0157373_10127212 | 3300013100 | Bacteria | 1792 |
| 364 | Ga0157373_10136551 | 3300013100 | Unclassified | 1724 |
| 365 | Ga0157373_10323684 | 3300013100 | Bacteria | 1097 |
| 366 | Ga0157373_10434130 | 3300013100 | Bacteria | 944 |
| 367 | Ga0157371_10164825 | 3300013102 | Bacteria | 1583 |
| 368 | Ga0157371_10267475 | 3300013102 | Bacteria | 1233 |
| 369 | Ga0157371_10442934 | 3300013102 | Unclassified | 954 |
| 370 | Ga0157371_11173220 | 3300013102 | Bacteria | 591 |
| 371 | Ga0157370_10020143 | 3300013104 | Bacteria | 6667 |
| 372 | Ga0157370_10315432 | 3300013104 | Bacteria | 1443 |
| 373 | Ga0157370_11164084 | 3300013104 | Bacteria | 696 |
| 374 | Ga0157369_10020040 | 3300013105 | Bacteria | 7480 |
| 375 | Ga0157369_10082844 | 3300013105 | Bacteria | 3432 |
| 376 | Ga0157369_10162270 | 3300013105 | Bacteria | 2359 |
| 377 | Ga0157369_10286471 | 3300013105 | Bacteria | 1715 |
| 378 | Ga0157369_10389207 | 3300013105 | Bacteria | 1447 |
| 379 | Ga0157369_10451522 | 3300013105 | Bacteria | 1331 |
| 380 | Ga0157369_10545999 | 3300013105 | Unclassified | 1198 |
| 381 | Ga0157369_12234097 | 3300013105 | Unclassified | 555 |
| 382 | Ga0157374_10000881 | 3300013296 | Bacteria | 26194 |
| 383 | Ga0157374_10023522 | 3300013296 | Bacteria | 5512 |
| 384 | Ga0157374_10056035 | 3300013296 | Bacteria | 3680 |
| 385 | Ga0157374_10132191 | 3300013296 | Bacteria | 2416 |
| 386 | Ga0157374_10363263 | 3300013296 | Bacteria | 1440 |
| 387 | Ga0157374_10623516 | 3300013296 | Unclassified | 1089 |
| 388 | Ga0157374_11244455 | 3300013296 | Bacteria | 766 |
| 389 | Ga0157374_11330216 | 3300013296 | Bacteria | 741 |
| 390 | Ga0157378_10000030 | 3300013297 | Bacteria | 124811 |
| 391 | Ga0163162_10015539 | 3300013306 | Bacteria | 7438 |
| 392 | Ga0163162_10224506 | 3300013306 | Unclassified | 2008 |
| 393 | Ga0163162_10689287 | 3300013306 | Bacteria | 1144 |
| 394 | Ga0157372_10000576 | 3300013307 | Bacteria | 40151 |
| 395 | Ga0157372_10001714 | 3300013307 | Bacteria | 23796 |
| 396 | Ga0157372_10007600 | 3300013307 | Bacteria | 11524 |
| 397 | Ga0157372_10018023 | 3300013307 | Bacteria | 7589 |
| 398 | Ga0157372_10019657 | 3300013307 | Bacteria | 7278 |
| 399 | Ga0157372_10031691 | 3300013307 | Bacteria | 5789 |
| 400 | Ga0157372_10040611 | 3300013307 | Bacteria | 5139 |
| 401 | Ga0157372_10229211 | 3300013307 | Bacteria | 2153 |
| 402 | Ga0157372_10319807 | 3300013307 | Bacteria | 1807 |
| 403 | Ga0157372_10356902 | 3300013307 | Bacteria | 1703 |
| 404 | Ga0157372_10429893 | 3300013307 | Unclassified | 1539 |
| 405 | Ga0157372_10817672 | 3300013307 | Unclassified | 1082 |
| 406 | Ga0157372_13263363 | 3300013307 | Unclassified | 517 |
| 407 | Ga0157375_11374238 | 3300013308 | Bacteria | 831 |
| 408 | Ga0163163_10021735 | 3300014325 | Bacteria | 6060 |
| 409 | Ga0163163_10146463 | 3300014325 | Bacteria | 2405 |
| 410 | Ga0163163_10392764 | 3300014325 | Bacteria | 1445 |
| 411 | Ga0163163_10805906 | 3300014325 | Bacteria | 1002 |
| 412 | Ga0182008_10021984 | 3300014497 | Bacteria | 3269 |
| 413 | Ga0157379_10078092 | 3300014968 | Bacteria | 2964 |
| 414 | Ga0157379_11238277 | 3300014968 | Unclassified | 719 |
| 415 | Ga0157376_10112949 | 3300014969 | Bacteria | 2395 |
| 416 | Ga0157376_10379918 | 3300014969 | Bacteria | 1360 |
| 417 | Ga0157376_10871276 | 3300014969 | Bacteria | 917 |
| 418 | Ga0157376_11222815 | 3300014969 | Unclassified | 780 |
| 419 | Ga0157376_11504722 | 3300014969 | Unclassified | 706 |
| 420 | Ga0182006_1033395 | 3300015261 | Bacteria | 2064 |
| 421 | Ga0182007_10003047 | 3300015262 | Bacteria | 8080 |
| 422 | Ga0182005_1009721 | 3300015265 | Bacteria | 2786 |
| 423 | Ga0213872_10028523 | 3300021361 | Bacteria | 2559 |
| 424 | Ga0213872_10072584 | 3300021361 | Unclassified | 1550 |
| 425 | Ga0213872_10085000 | 3300021361 | Unclassified | 1419 |
| 426 | Ga0213874_10019603 | 3300021377 | Bacteria | 1843 |
| 427 | Ga0213876_10005622 | 3300021384 | Bacteria | 6881 |
| 428 | Ga0213875_10053355 | 3300021388 | Bacteria | 1893 |
| 429 | Ga0213871_10002734 | 3300021441 | Bacteria | 3291 |
| 430 | Ga0207656_10013934 | 3300025321 | Bacteria | 3084 |
| 431 | Ga0207656_10021529 | 3300025321 | Bacteria | 2577 |
| 432 | Ga0207692_10006378 | 3300025898 | Bacteria | 4782 |
| 433 | Ga0207692_10044734 | 3300025898 | Bacteria | 2211 |
| 434 | Ga0207692_10103082 | 3300025898 | Bacteria | 1570 |
| 435 | Ga0207692_10103202 | 3300025898 | Bacteria | 1569 |
| 436 | Ga0207692_10142385 | 3300025898 | Bacteria | 1365 |
| 437 | Ga0207692_10238359 | 3300025898 | Bacteria | 1085 |
| 438 | Ga0207710_10005580 | 3300025900 | Bacteria | 5413 |
| 439 | Ga0207647_10044739 | 3300025904 | Unclassified | 2765 |
| 440 | Ga0207685_10007324 | 3300025905 | Bacteria | 3069 |
| 441 | Ga0207685_10026595 | 3300025905 | Bacteria | 2014 |
| 442 | Ga0207685_10035468 | 3300025905 | Bacteria | 1821 |
| 443 | Ga0207685_10068198 | 3300025905 | Unclassified | 1432 |
| 444 | Ga0207685_10249888 | 3300025905 | Unclassified | 857 |
| 445 | Ga0207699_10001362 | 3300025906 | Bacteria | 11623 |
| 446 | Ga0207699_10024434 | 3300025906 | Bacteria | 3305 |
| 447 | Ga0207699_10066158 | 3300025906 | Bacteria | 2193 |
| 448 | Ga0207699_10081850 | 3300025906 | Unclassified | 2004 |
| 449 | Ga0207699_10131673 | 3300025906 | Bacteria | 1632 |
| 450 | Ga0207699_10184463 | 3300025906 | Unclassified | 1404 |
| 451 | Ga0207699_10602782 | 3300025906 | Bacteria | 800 |
| 452 | Ga0207699_10877485 | 3300025906 | Unclassified | 661 |
| 453 | Ga0207645_10279493 | 3300025907 | Bacteria | 1108 |
| 454 | Ga0207705_10176487 | 3300025909 | Bacteria | 1611 |
| 455 | Ga0207705_10664370 | 3300025909 | Unclassified | 810 |
| 456 | Ga0207684_10000642 | 3300025910 | Bacteria | 41399 |
| 457 | Ga0207684_10011628 | 3300025910 | Bacteria | 7687 |
| 458 | Ga0207684_10048277 | 3300025910 | Bacteria | 3610 |
| 459 | Ga0207684_10091823 | 3300025910 | Bacteria | 2588 |
| 460 | Ga0207654_10003178 | 3300025911 | Bacteria | 8297 |
| 461 | Ga0207654_10004021 | 3300025911 | Bacteria | 7401 |
| 462 | Ga0207654_10089674 | 3300025911 | Bacteria | 1871 |
| 463 | Ga0207654_10179546 | 3300025911 | Bacteria | 1380 |
| 464 | Ga0207654_10368000 | 3300025911 | Unclassified | 993 |
| 465 | Ga0207707_10120564 | 3300025912 | Bacteria | 2293 |
| 466 | Ga0207707_10186536 | 3300025912 | Bacteria | 1810 |
| 467 | Ga0207707_10203104 | 3300025912 | Unclassified | 1728 |
| 468 | Ga0207707_10420770 | 3300025912 | Unclassified | 1145 |
| 469 | Ga0207695_10008149 | 3300025913 | Bacteria | 13175 |
| 470 | Ga0207695_10014420 | 3300025913 | Bacteria | 9364 |
| 471 | Ga0207695_10020213 | 3300025913 | Bacteria | 7633 |
| 472 | Ga0207695_10029610 | 3300025913 | Bacteria | 6043 |
| 473 | Ga0207695_10036245 | 3300025913 | Bacteria | 5334 |
| 474 | Ga0207695_10090156 | 3300025913 | Bacteria | 3082 |
| 475 | Ga0207695_10125324 | 3300025913 | Bacteria | 2531 |
| 476 | Ga0207695_10171345 | 3300025913 | Bacteria | 2096 |
| 477 | Ga0207695_10380552 | 3300025913 | Bacteria | 1297 |
| 478 | Ga0207695_10570765 | 3300025913 | Bacteria | 1013 |
| 479 | Ga0207695_11688536 | 3300025913 | Unclassified | 514 |
| 480 | Ga0207671_10009016 | 3300025914 | Bacteria | 8391 |
| 481 | Ga0207693_10000084 | 3300025915 | Bacteria | 84105 |
| 482 | Ga0207693_10003411 | 3300025915 | Bacteria | 13562 |
| 483 | Ga0207693_10004079 | 3300025915 | Bacteria | 12409 |
| 484 | Ga0207693_10004685 | 3300025915 | Bacteria | 11519 |
| 485 | Ga0207693_10009120 | 3300025915 | Bacteria | 8099 |
| 486 | Ga0207693_10016835 | 3300025915 | Bacteria | 5835 |
| 487 | Ga0207693_10021197 | 3300025915 | Bacteria | 5166 |
| 488 | Ga0207693_10028599 | 3300025915 | Bacteria | 4405 |
| 489 | Ga0207693_10066652 | 3300025915 | Bacteria | 2819 |
| 490 | Ga0207693_10118820 | 3300025915 | Bacteria | 2076 |
| 491 | Ga0207693_10605389 | 3300025915 | Unclassified | 853 |
| 492 | Ga0207663_10001613 | 3300025916 | Bacteria | 10612 |
| 493 | Ga0207663_10004197 | 3300025916 | Bacteria | 7140 |
| 494 | Ga0207663_10013450 | 3300025916 | Bacteria | 4450 |
| 495 | Ga0207663_10045290 | 3300025916 | Bacteria | 2705 |
| 496 | Ga0207663_10050257 | 3300025916 | Bacteria | 2590 |
| 497 | Ga0207663_10108995 | 3300025916 | Unclassified | 1876 |
| 498 | Ga0207663_10388910 | 3300025916 | Unclassified | 1064 |
| 499 | Ga0207663_10503218 | 3300025916 | Unclassified | 941 |
| 500 | Ga0207663_11529943 | 3300025916 | Unclassified | 537 |
| 501 | Ga0207660_10296504 | 3300025917 | Bacteria | 1287 |
| 502 | Ga0207660_10540738 | 3300025917 | Unclassified | 947 |
| 503 | Ga0207657_10002596 | 3300025919 | Bacteria | 19553 |
| 504 | Ga0207657_10444749 | 3300025919 | Bacteria | 1017 |
| 505 | Ga0207649_10064156 | 3300025920 | Bacteria | 2321 |
| 506 | Ga0207652_10078946 | 3300025921 | Bacteria | 2875 |
| 507 | Ga0207652_10209251 | 3300025921 | Unclassified | 1756 |
| 508 | Ga0207652_10363136 | 3300025921 | Bacteria | 1307 |
| 509 | Ga0207646_10001331 | 3300025922 | Bacteria | 30697 |
| 510 | Ga0207646_10055286 | 3300025922 | Bacteria | 3549 |
| 511 | Ga0207646_10082750 | 3300025922 | Bacteria | 2871 |
| 512 | Ga0207646_10103335 | 3300025922 | Bacteria | 2555 |
| 513 | Ga0207646_10203351 | 3300025922 | Bacteria | 1789 |
| 514 | Ga0207646_10225067 | 3300025922 | Bacteria | 1695 |
| 515 | Ga0207646_10435216 | 3300025922 | Bacteria | 1183 |
| 516 | Ga0207646_11004761 | 3300025922 | Unclassified | 737 |
| 517 | Ga0207646_11061673 | 3300025922 | Unclassified | 714 |
| 518 | Ga0207681_10183688 | 3300025923 | Bacteria | 1595 |
| 519 | Ga0207694_10009060 | 3300025924 | Bacteria | 7510 |
| 520 | Ga0207694_10151219 | 3300025924 | Bacteria | 1870 |
| 521 | Ga0207694_10196088 | 3300025924 | Bacteria | 1642 |
| 522 | Ga0207694_10332036 | 3300025924 | Bacteria | 1256 |
| 523 | Ga0207694_11120767 | 3300025924 | Unclassified | 666 |
| 524 | Ga0207650_10014559 | 3300025925 | Bacteria | 5464 |
| 525 | Ga0207650_10074894 | 3300025925 | Bacteria | 2553 |
| 526 | Ga0207650_10230359 | 3300025925 | Unclassified | 1494 |
| 527 | Ga0207650_10461366 | 3300025925 | Unclassified | 1058 |
| 528 | Ga0207659_10094513 | 3300025926 | Bacteria | 2240 |
| 529 | Ga0207659_11101396 | 3300025926 | Unclassified | 683 |
| 530 | Ga0207687_10059373 | 3300025927 | Bacteria | 2694 |
| 531 | Ga0207687_10131282 | 3300025927 | Unclassified | 1888 |
| 532 | Ga0207700_10000293 | 3300025928 | Bacteria | 29699 |
| 533 | Ga0207700_10012079 | 3300025928 | Bacteria | 5548 |
| 534 | Ga0207700_10042787 | 3300025928 | Bacteria | 3323 |
| 535 | Ga0207700_10044006 | 3300025928 | Bacteria | 3284 |
| 536 | Ga0207700_10047878 | 3300025928 | Unclassified | 3172 |
| 537 | Ga0207700_10069480 | 3300025928 | Bacteria | 2703 |
| 538 | Ga0207700_10084458 | 3300025928 | Bacteria | 2489 |
| 539 | Ga0207700_10092181 | 3300025928 | Bacteria | 2395 |
| 540 | Ga0207700_10102024 | 3300025928 | Bacteria | 2290 |
| 541 | Ga0207700_10156228 | 3300025928 | Bacteria | 1890 |
| 542 | Ga0207700_10249297 | 3300025928 | Bacteria | 1516 |
| 543 | Ga0207700_10308189 | 3300025928 | Bacteria | 1369 |
| 544 | Ga0207700_10316855 | 3300025928 | Bacteria | 1351 |
| 545 | Ga0207700_10574749 | 3300025928 | Unclassified | 1002 |
| 546 | Ga0207700_10864980 | 3300025928 | Unclassified | 809 |
| 547 | Ga0207700_11504446 | 3300025928 | Unclassified | 597 |
| 548 | Ga0207700_11662893 | 3300025928 | Unclassified | 564 |
| 549 | Ga0207664_10013366 | 3300025929 | Bacteria | 5889 |
| 550 | Ga0207664_10032843 | 3300025929 | Bacteria | 3982 |
| 551 | Ga0207664_10035600 | 3300025929 | Bacteria | 3842 |
| 552 | Ga0207664_10147146 | 3300025929 | Bacteria | 1998 |
| 553 | Ga0207664_10301212 | 3300025929 | Bacteria | 1410 |
| 554 | Ga0207664_10314730 | 3300025929 | Unclassified | 1380 |
| 555 | Ga0207664_10335761 | 3300025929 | Bacteria | 1335 |
| 556 | Ga0207664_10585939 | 3300025929 | Unclassified | 1001 |
| 557 | Ga0207664_10587940 | 3300025929 | Unclassified | 1000 |
| 558 | Ga0207664_11384106 | 3300025929 | Unclassified | 624 |
| 559 | Ga0207644_10200193 | 3300025931 | Bacteria | 1575 |
| 560 | Ga0207644_11405168 | 3300025931 | Unclassified | 586 |
| 561 | Ga0207706_10064191 | 3300025933 | Bacteria | 3233 |
| 562 | Ga0207706_11453764 | 3300025933 | Unclassified | 561 |
| 563 | Ga0207686_10995702 | 3300025934 | Unclassified | 680 |
| 564 | Ga0207670_10056188 | 3300025936 | Unclassified | 2664 |
| 565 | Ga0207669_11557201 | 3300025937 | Unclassified | 564 |
| 566 | Ga0207665_10001047 | 3300025939 | Bacteria | 18599 |
| 567 | Ga0207665_10001060 | 3300025939 | Bacteria | 18503 |
| 568 | Ga0207665_10008698 | 3300025939 | Bacteria | 6680 |
| 569 | Ga0207665_10013254 | 3300025939 | Bacteria | 5420 |
| 570 | Ga0207665_10013876 | 3300025939 | Bacteria | 5299 |
| 571 | Ga0207665_10031738 | 3300025939 | Bacteria | 3496 |
| 572 | Ga0207665_10044585 | 3300025939 | Bacteria | 2967 |
| 573 | Ga0207665_10076642 | 3300025939 | Bacteria | 2293 |
| 574 | Ga0207665_10079395 | 3300025939 | Bacteria | 2255 |
| 575 | Ga0207665_10198518 | 3300025939 | Bacteria | 1461 |
| 576 | Ga0207665_10270025 | 3300025939 | Bacteria | 1263 |
| 577 | Ga0207665_10729506 | 3300025939 | Unclassified | 780 |
| 578 | Ga0207691_10574452 | 3300025940 | Bacteria | 955 |
| 579 | Ga0207691_10580187 | 3300025940 | Unclassified | 950 |
| 580 | Ga0207711_10007922 | 3300025941 | Bacteria | 8886 |
| 581 | Ga0207711_10087071 | 3300025941 | Bacteria | 2740 |
| 582 | Ga0207711_10360384 | 3300025941 | Bacteria | 1347 |
| 583 | Ga0207689_10083876 | 3300025942 | Bacteria | 2620 |
| 584 | Ga0207661_10152439 | 3300025944 | Unclassified | 1999 |
| 585 | Ga0207661_10307916 | 3300025944 | Unclassified | 1421 |
| 586 | Ga0207679_10181150 | 3300025945 | Bacteria | 1743 |
| 587 | Ga0207679_10238997 | 3300025945 | Unclassified | 1538 |
| 588 | Ga0207679_10439172 | 3300025945 | Bacteria | 1155 |
| 589 | Ga0207679_10540662 | 3300025945 | Unclassified | 1044 |
| 590 | Ga0207667_10013776 | 3300025949 | Bacteria | 9240 |
| 591 | Ga0207667_10055953 | 3300025949 | Bacteria | 4146 |
| 592 | Ga0207667_10163648 | 3300025949 | Bacteria | 2287 |
| 593 | Ga0207667_10401622 | 3300025949 | Bacteria | 1395 |
| 594 | Ga0207651_10027098 | 3300025960 | Bacteria | 3594 |
| 595 | Ga0207651_10034949 | 3300025960 | Bacteria | 3262 |
| 596 | Ga0207640_10002147 | 3300025981 | Bacteria | 10603 |
| 597 | Ga0207640_10170513 | 3300025981 | Bacteria | 1621 |
| 598 | Ga0207658_10103993 | 3300025986 | Bacteria | 2230 |
| 599 | Ga0207658_10716841 | 3300025986 | Bacteria | 905 |
| 600 | Ga0207677_10001194 | 3300026023 | Bacteria | 14078 |
| 601 | Ga0207677_10002578 | 3300026023 | Bacteria | 9523 |
| 602 | Ga0207703_10002718 | 3300026035 | Bacteria | 15154 |
| 603 | Ga0207703_11273438 | 3300026035 | Bacteria | 707 |
| 604 | Ga0207703_11378968 | 3300026035 | Bacteria | 678 |
| 605 | Ga0207639_10114943 | 3300026041 | Bacteria | 2200 |
| 606 | Ga0207639_11232867 | 3300026041 | Bacteria | 702 |
| 607 | Ga0207702_10000764 | 3300026078 | Bacteria | 34175 |
| 608 | Ga0207702_10001551 | 3300026078 | Bacteria | 22731 |
| 609 | Ga0207702_10027156 | 3300026078 | Bacteria | 4753 |
| 610 | Ga0207702_10073909 | 3300026078 | Bacteria | 2940 |
| 611 | Ga0207702_10080814 | 3300026078 | Bacteria | 2821 |
| 612 | Ga0207702_10240822 | 3300026078 | Bacteria | 1695 |
| 613 | Ga0207702_10264003 | 3300026078 | Bacteria | 1622 |
| 614 | Ga0207702_10266245 | 3300026078 | Bacteria | 1615 |
| 615 | Ga0207702_10325787 | 3300026078 | Bacteria | 1464 |
| 616 | Ga0207702_10547207 | 3300026078 | Unclassified | 1132 |
| 617 | Ga0207641_10128289 | 3300026088 | Bacteria | 2274 |
| 618 | Ga0207641_10132001 | 3300026088 | Bacteria | 2244 |
| 619 | Ga0207641_10180534 | 3300026088 | Unclassified | 1933 |
| 620 | Ga0207641_10245754 | 3300026088 | Bacteria | 1669 |
| 621 | Ga0207676_10001298 | 3300026095 | Bacteria | 18583 |
| 622 | Ga0207676_10225648 | 3300026095 | Bacteria | 1671 |
| 623 | Ga0207676_11592726 | 3300026095 | Unclassified | 651 |
| 624 | Ga0207676_11911856 | 3300026095 | Unclassified | 592 |
| 625 | Ga0207674_10000281 | 3300026116 | Bacteria | 64232 |
| 626 | Ga0207674_10003756 | 3300026116 | Bacteria | 18524 |
| 627 | Ga0207674_10032182 | 3300026116 | Bacteria | 5502 |
| 628 | Ga0207674_10393609 | 3300026116 | Bacteria | 1339 |
| 629 | Ga0207674_10797843 | 3300026116 | Unclassified | 911 |
| 630 | Ga0207683_10845972 | 3300026121 | Bacteria | 849 |
| 631 | Ga0207698_12239765 | 3300026142 | Unclassified | 559 |
| 632 | Ga0268266_10139119 | 3300028379 | Bacteria | 2178 |
| 633 | Ga0268266_10462046 | 3300028379 | Bacteria | 1208 |
| 634 | Ga0268265_10026847 | 3300028380 | Bacteria | 4101 |
| 635 | Ga0268264_10270805 | 3300028381 | Bacteria | 1586 |
| 636 | Ga0268264_10478644 | 3300028381 | Bacteria | 1211 |
| 637 | Ga0265337_1000542 | 3300028556 | Bacteria | 20142 |
| 638 | Ga0265337_1002344 | 3300028556 | Bacteria | 8773 |
| 639 | Ga0265337_1004508 | 3300028556 | Bacteria | 5764 |
| 640 | Ga0265337_1007731 | 3300028556 | Bacteria | 3988 |
| 641 | Ga0265337_1017646 | 3300028556 | Bacteria | 2285 |
| 642 | Ga0265337_1021906 | 3300028556 | Bacteria | 1986 |
| 643 | Ga0265337_1043296 | 3300028556 | Bacteria | 1287 |
| 644 | Ga0265337_1061535 | 3300028556 | Bacteria | 1040 |
| 645 | Ga0265337_1160717 | 3300028556 | Unclassified | 609 |
| 646 | Ga0265326_10060961 | 3300028558 | Unclassified | 1067 |
| 647 | Ga0265326_10115618 | 3300028558 | Unclassified | 762 |
| 648 | Ga0265326_10129695 | 3300028558 | Unclassified | 718 |
| 649 | Ga0265319_1000082 | 3300028563 | Bacteria | 74926 |
| 650 | Ga0265319_1000383 | 3300028563 | Bacteria | 32025 |
| 651 | Ga0265319_1005048 | 3300028563 | Bacteria | 6415 |
| 652 | Ga0265319_1024476 | 3300028563 | Bacteria | 2173 |
| 653 | Ga0265319_1032006 | 3300028563 | Unclassified | 1827 |
| 654 | Ga0265334_10002529 | 3300028573 | Bacteria | 8546 |
| 655 | Ga0265334_10005317 | 3300028573 | Bacteria | 5627 |
| 656 | Ga0265334_10024695 | 3300028573 | Bacteria | 2436 |
| 657 | Ga0265334_10043209 | 3300028573 | Bacteria | 1754 |
| 658 | Ga0265334_10045812 | 3300028573 | Bacteria | 1693 |
| 659 | Ga0265334_10071229 | 3300028573 | Bacteria | 1294 |
| 660 | Ga0265334_10240661 | 3300028573 | Unclassified | 624 |
| 661 | Ga0265318_10000611 | 3300028577 | Bacteria | 24727 |
| 662 | Ga0265318_10001111 | 3300028577 | Bacteria | 16883 |
| 663 | Ga0265318_10002270 | 3300028577 | Bacteria | 10338 |
| 664 | Ga0265318_10015696 | 3300028577 | Bacteria | 3143 |
| 665 | Ga0265318_10074196 | 3300028577 | Bacteria | 1260 |
| 666 | Ga0265318_10119213 | 3300028577 | Bacteria | 970 |
| 667 | Ga0265323_10000293 | 3300028653 | Bacteria | 28866 |
| 668 | Ga0265323_10001094 | 3300028653 | Bacteria | 14023 |
| 669 | Ga0265323_10007601 | 3300028653 | Bacteria | 4496 |
| 670 | Ga0265322_10000028 | 3300028654 | Bacteria | 85065 |
| 671 | Ga0265322_10000169 | 3300028654 | Bacteria | 30040 |
| 672 | Ga0265322_10000329 | 3300028654 | Bacteria | 19970 |
| 673 | Ga0265322_10006814 | 3300028654 | Bacteria | 3353 |
| 674 | Ga0265322_10034070 | 3300028654 | Bacteria | 1452 |
| 675 | Ga0265322_10105281 | 3300028654 | Bacteria | 802 |
| 676 | Ga0265336_10000152 | 3300028666 | Bacteria | 49208 |
| 677 | Ga0265336_10057325 | 3300028666 | Bacteria | 1170 |
| 678 | Ga0265338_10000295 | 3300028800 | Bacteria | 89990 |
| 679 | Ga0265338_10000468 | 3300028800 | Bacteria | 72027 |
| 680 | Ga0265338_10001464 | 3300028800 | Bacteria | 38231 |
| 681 | Ga0265338_10003449 | 3300028800 | Bacteria | 22276 |
| 682 | Ga0265338_10004220 | 3300028800 | Bacteria | 19557 |
| 683 | Ga0265338_10009337 | 3300028800 | Bacteria | 11719 |
| 684 | Ga0265338_10015175 | 3300028800 | Bacteria | 8492 |
| 685 | Ga0265338_10016370 | 3300028800 | Bacteria | 8074 |
| 686 | Ga0265338_10017637 | 3300028800 | Bacteria | 7681 |
| 687 | Ga0265338_10022106 | 3300028800 | Bacteria | 6605 |
| 688 | Ga0265338_10027649 | 3300028800 | Bacteria | 5684 |
| 689 | Ga0265338_10031867 | 3300028800 | Bacteria | 5158 |
| 690 | Ga0265338_10068523 | 3300028800 | Bacteria | 3056 |
| 691 | Ga0265338_10075087 | 3300028800 | Bacteria | 2871 |
| 692 | Ga0265338_10120361 | 3300028800 | Bacteria | 2094 |
| 693 | Ga0265338_10129432 | 3300028800 | Bacteria | 1996 |
| 694 | Ga0265338_10220234 | 3300028800 | Unclassified | 1418 |
| 695 | Ga0265338_10245876 | 3300028800 | Unclassified | 1322 |
| 696 | Ga0265338_10319714 | 3300028800 | Unclassified | 1124 |
| 697 | Ga0265338_10473809 | 3300028800 | Unclassified | 884 |
| 698 | Ga0265338_10543990 | 3300028800 | Unclassified | 813 |
| 699 | Ga0265338_10591021 | 3300028800 | Unclassified | 774 |
| 700 | Ga0265338_10727345 | 3300028800 | Bacteria | 683 |
| 701 | Ga0265338_10795672 | 3300028800 | Unclassified | 648 |
| 702 | Ga0265338_10805672 | 3300028800 | Unclassified | 643 |
| 703 | Ga0265338_11161840 | 3300028800 | Unclassified | 519 |
| 704 | Ga0265324_10000484 | 3300029957 | Bacteria | 27886 |
| 705 | Ga0265324_10001659 | 3300029957 | Bacteria | 12315 |
| 706 | Ga0265324_10002703 | 3300029957 | Bacteria | 8850 |
| 707 | Ga0265324_10002940 | 3300029957 | Bacteria | 8344 |
| 708 | Ga0265324_10009253 | 3300029957 | Bacteria | 3855 |
| 709 | Ga0265324_10011687 | 3300029957 | Unclassified | 3341 |
| 710 | Ga0265324_10036441 | 3300029957 | Bacteria | 1710 |
| 711 | Ga0265324_10038878 | 3300029957 | Bacteria | 1650 |
| 712 | Ga0265324_10076732 | 3300029957 | Unclassified | 1137 |
| 713 | Ga0265324_10145941 | 3300029957 | Bacteria | 803 |
| 714 | Ga0265324_10257280 | 3300029957 | Unclassified | 593 |
| 715 | Ga0265760_10028670 | 3300031090 | Bacteria | 1634 |
| 716 | Ga0265760_10153259 | 3300031090 | Bacteria | 757 |
| 717 | Ga0265330_10001419 | 3300031235 | Bacteria | 14021 |
| 718 | Ga0265330_10023290 | 3300031235 | Bacteria | 2813 |
| 719 | Ga0265330_10070411 | 3300031235 | Bacteria | 1513 |
| 720 | Ga0265330_10160517 | 3300031235 | Bacteria | 955 |
| 721 | Ga0265332_10024493 | 3300031238 | Bacteria | 2655 |
| 722 | Ga0265332_10050583 | 3300031238 | Bacteria | 1786 |
| 723 | Ga0265332_10127060 | 3300031238 | Unclassified | 1070 |
| 724 | Ga0265332_10335527 | 3300031238 | Unclassified | 624 |
| 725 | Ga0265328_10000745 | 3300031239 | Bacteria | 15095 |
| 726 | Ga0265328_10139598 | 3300031239 | Unclassified | 909 |
| 727 | Ga0265320_10000497 | 3300031240 | Bacteria | 30621 |
| 728 | Ga0265320_10003678 | 3300031240 | Bacteria | 10242 |
| 729 | Ga0265320_10011997 | 3300031240 | Bacteria | 5068 |
| 730 | Ga0265320_10080605 | 3300031240 | Bacteria | 1520 |
| 731 | Ga0265320_10084941 | 3300031240 | Bacteria | 1473 |
| 732 | Ga0265320_10185875 | 3300031240 | Unclassified | 930 |
| 733 | Ga0265320_10219421 | 3300031240 | Unclassified | 847 |
| 734 | Ga0265320_10229723 | 3300031240 | Bacteria | 825 |
| 735 | Ga0265320_10367674 | 3300031240 | Unclassified | 635 |
| 736 | Ga0265325_10001557 | 3300031241 | Bacteria | 15984 |
| 737 | Ga0265325_10004103 | 3300031241 | Bacteria | 9278 |
| 738 | Ga0265325_10005940 | 3300031241 | Bacteria | 7478 |
| 739 | Ga0265325_10027823 | 3300031241 | Bacteria | 3053 |
| 740 | Ga0265325_10194129 | 3300031241 | Bacteria | 939 |
| 741 | Ga0265329_10001143 | 3300031242 | Bacteria | 13047 |
| 742 | Ga0265329_10025571 | 3300031242 | Bacteria | 1952 |
| 743 | Ga0265329_10047227 | 3300031242 | Bacteria | 1374 |
| 744 | Ga0265340_10004591 | 3300031247 | Bacteria | 7688 |
| 745 | Ga0265340_10007530 | 3300031247 | Bacteria | 5910 |
| 746 | Ga0265340_10019971 | 3300031247 | Bacteria | 3446 |
| 747 | Ga0265340_10025222 | 3300031247 | Bacteria | 3013 |
| 748 | Ga0265340_10052609 | 3300031247 | Unclassified | 1969 |
| 749 | Ga0265340_10118413 | 3300031247 | Unclassified | 1220 |
| 750 | Ga0265339_10003636 | 3300031249 | Bacteria | 10757 |
| 751 | Ga0265339_10004406 | 3300031249 | Bacteria | 9607 |
| 752 | Ga0265339_10066402 | 3300031249 | Bacteria | 1931 |
| 753 | Ga0265339_10209138 | 3300031249 | Unclassified | 959 |
| 754 | Ga0265339_10554626 | 3300031249 | Unclassified | 528 |
| 755 | Ga0265331_10001038 | 3300031250 | Bacteria | 21666 |
| 756 | Ga0265331_10328197 | 3300031250 | Unclassified | 685 |
| 757 | Ga0265331_10416425 | 3300031250 | Unclassified | 603 |
| 758 | Ga0265331_10518106 | 3300031250 | Unclassified | 537 |
| 759 | Ga0265327_10002648 | 3300031251 | Bacteria | 18430 |
| 760 | Ga0265327_10008343 | 3300031251 | Bacteria | 7739 |
| 761 | Ga0265327_10320443 | 3300031251 | Unclassified | 680 |
| 762 | Ga0265316_10003484 | 3300031344 | Bacteria | 15898 |
| 763 | Ga0265316_10004394 | 3300031344 | Bacteria | 14042 |
| 764 | Ga0265316_10006331 | 3300031344 | Bacteria | 11325 |
| 765 | Ga0265316_10028996 | 3300031344 | Bacteria | 4557 |
| 766 | Ga0265316_10066512 | 3300031344 | Bacteria | 2789 |
| 767 | Ga0265316_10078133 | 3300031344 | Bacteria | 2541 |
| 768 | Ga0265316_10079353 | 3300031344 | Bacteria | 2519 |
| 769 | Ga0265316_10130069 | 3300031344 | Bacteria | 1897 |
| 770 | Ga0265316_10142749 | 3300031344 | Bacteria | 1797 |
| 771 | Ga0265316_10160516 | 3300031344 | Bacteria | 1681 |
| 772 | Ga0265316_10200146 | 3300031344 | Unclassified | 1481 |
| 773 | Ga0265316_10607919 | 3300031344 | Bacteria | 775 |
| 774 | Ga0265316_10632945 | 3300031344 | Bacteria | 757 |
| 775 | Ga0265316_10686117 | 3300031344 | Bacteria | 723 |
| 776 | Ga0265316_11124707 | 3300031344 | Unclassified | 544 |
| 777 | Ga0265313_10000945 | 3300031595 | Bacteria | 28829 |
| 778 | Ga0265313_10003307 | 3300031595 | Bacteria | 13198 |
| 779 | Ga0265313_10013437 | 3300031595 | Bacteria | 4914 |
| 780 | Ga0265313_10015127 | 3300031595 | Bacteria | 4515 |
| 781 | Ga0265313_10061673 | 3300031595 | Bacteria | 1754 |
| 782 | Ga0265313_10069853 | 3300031595 | Unclassified | 1620 |
| 783 | Ga0265314_10001204 | 3300031711 | Bacteria | 29721 |
| 784 | Ga0265314_10058439 | 3300031711 | Bacteria | 2642 |
| 785 | Ga0265314_10072895 | 3300031711 | Bacteria | 2292 |
| 786 | Ga0265314_10078044 | 3300031711 | Bacteria | 2194 |
| 787 | Ga0265314_10121129 | 3300031711 | Unclassified | 1646 |
| 788 | Ga0265314_10252900 | 3300031711 | Unclassified | 1011 |
| 789 | Ga0265342_10000219 | 3300031712 | Bacteria | 64778 |
| 790 | Ga0265342_10006314 | 3300031712 | Bacteria | 8839 |
| 791 | Ga0265342_10009671 | 3300031712 | Bacteria | 6762 |
| 792 | Ga0265342_10018239 | 3300031712 | Bacteria | 4551 |
| 793 | Ga0265342_10032556 | 3300031712 | Bacteria | 3215 |
| 794 | Ga0265342_10042317 | 3300031712 | Bacteria | 2753 |
| 795 | Ga0265342_10159956 | 3300031712 | Unclassified | 1245 |
| 796 | Ga0307409_100051117 | 3300031995 | Bacteria | 3161 |
| 797 | Ga0307409_101270328 | 3300031995 | Bacteria | 761 |
| 798 | Ga0307416_100807059 | 3300032002 | Bacteria | 1034 |
| 799 | Ga0307416_101567512 | 3300032002 | Unclassified | 764 |
| 800 | Ga0373926_0035045 | 3300035083 | Unclassified | 1779 |
| 801 | Ga0373926_0175219 | 3300035083 | Bacteria | 822 |
| 802 | Ga0373934_0033468 | 3300035086 | Bacteria | 2017 |
| 803 | Ga0373944_0132193 | 3300035089 | Bacteria | 868 |
| 804 | Ga0373944_0395479 | 3300035089 | Unclassified | 532 |
| 805 | Ga0373923_0084353 | 3300035111 | Bacteria | 1382 |
| 806 | Ga0373923_0120032 | 3300035111 | Unclassified | 1174 |
| 807 | Ga0373936_0002702 | 3300035113 | Bacteria | 6621 |
| 808 | Ga0373936_0082477 | 3300035113 | Bacteria | 1340 |
| 809 | Ga0373936_0320152 | 3300035113 | Unclassified | 702 |
| 810 | Ga0373939_0417639 | 3300035114 | Bacteria | 559 |
| 811 | Ga0373953_0284072 | 3300035117 | Unclassified | 721 |
| 812 | Ga0373954_0062318 | 3300035118 | Bacteria | 1762 |
| 813 | Ga0373954_0118256 | 3300035118 | Bacteria | 1285 |
| 814 | Ga0373956_0289372 | 3300035119 | Unclassified | 780 |
| 815 | Ga0373956_0419727 | 3300035119 | Unclassified | 638 |
| 816 | Ga0373957_0060953 | 3300035120 | Bacteria | 1461 |
| 817 | Ga0373957_0170364 | 3300035120 | Unclassified | 900 |
| 818 | Ga0373960_0006213 | 3300035121 | Bacteria | 2795 |
| 819 | Ga0373943_0008803 | 3300035170 | Bacteria | 4524 |
| 820 | Ga0373943_0067290 | 3300035170 | Bacteria | 1806 |
| 821 | Ga0373943_0182752 | 3300035170 | Bacteria | 1153 |
| 822 | Ga0373943_0296381 | 3300035170 | Bacteria | 917 |
| 823 | Ga0373943_0300417 | 3300035170 | Bacteria | 911 |
| 824 | Ga0373946_0019548 | 3300035171 | Unclassified | 2611 |
| 825 | Ga0373946_0116268 | 3300035171 | Bacteria | 1216 |
| 826 | Ga0373955_0053675 | 3300035172 | Bacteria | 2201 |
| 827 | Ga0373955_0264788 | 3300035172 | Bacteria | 1032 |
| 828 | Ga0373962_0095696 | 3300035242 | Unclassified | 920 |
| 829 | Ga0373931_0486795 | 3300035691 | Unclassified | 794 |
| 830 | Ga0373935_0006293 | 3300035692 | Bacteria | 7073 |
| 831 | Ga0373935_0037578 | 3300035692 | Unclassified | 3031 |
| 832 | Ga0373935_0147226 | 3300035692 | Unclassified | 1595 |
| 833 | Ga0373935_0236664 | 3300035692 | Bacteria | 1273 |
| 834 | Ga0373935_1015824 | 3300035692 | Bacteria | 616 |
| 835 | Ga0373927_0020828 | 3300035695 | Bacteria | 4298 |
| 836 | Ga0373927_0049204 | 3300035695 | Bacteria | 2726 |
| 837 | Ga0373927_0078242 | 3300035695 | Bacteria | 2142 |
| 838 | Ga0373927_0475768 | 3300035695 | Unclassified | 825 |
| 839 | Ga0373927_1132874 | 3300035695 | Unclassified | 516 |
| 840 | Ga0373933_0000058 | 3300035724 | Bacteria | 66002 |
| 841 | Ga0373933_0026651 | 3300035724 | Bacteria | 3321 |
| 842 | Ga0373933_0264794 | 3300035724 | Unclassified | 1109 |
| 843 | Ga0373947_0018181 | 3300035725 | Bacteria | 4045 |
| 844 | Ga0373947_0018296 | 3300035725 | Bacteria | 4032 |
| 845 | Ga0373947_0083697 | 3300035725 | Bacteria | 1979 |
| 846 | Ga0373947_0260051 | 3300035725 | Unclassified | 1150 |
| 847 | Ga0373947_0278910 | 3300035725 | Unclassified | 1111 |
| 848 | Ga0373947_0401192 | 3300035725 | Unclassified | 925 |
| 849 | Ga0373947_0697419 | 3300035725 | Unclassified | 693 |
| 850 | Ga0373937_0000008 | 3300036401 | Bacteria | 170075 |
| 851 | Ga0373937_0157358 | 3300036401 | Bacteria | 2130 |
| 852 | Ga0373937_0227229 | 3300036401 | Bacteria | 1757 |
| 853 | Ga0373937_0309923 | 3300036401 | Bacteria | 1493 |
| 854 | Ga0373937_1022690 | 3300036401 | Bacteria | 775 |
| 855 | Ga0373937_1090025 | 3300036401 | Unclassified | 747 |
| 856 | Ga0373937_1323030 | 3300036401 | Unclassified | 668 |
| 857 | Ga0373937_1547096 | 3300036401 | Unclassified | 611 |
| 858 | Ga0373925_0005774 | 3300037068 | Bacteria | 9198 |
| 859 | Ga0373925_0013923 | 3300037068 | Bacteria | 5822 |
| 860 | Ga0373925_0017898 | 3300037068 | Bacteria | 5143 |
| 861 | Ga0373925_0033781 | 3300037068 | Bacteria | 3769 |
| 862 | Ga0373925_0057398 | 3300037068 | Bacteria | 2917 |
| 863 | Ga0373925_0097392 | 3300037068 | Bacteria | 2256 |
| 864 | Ga0373925_0208372 | 3300037068 | Bacteria | 1557 |
| 865 | Ga0373925_0278103 | 3300037068 | Bacteria | 1348 |
| 866 | Ga0373925_0284902 | 3300037068 | Bacteria | 1331 |
| 867 | Ga0395900_0186273 | 3300037418 | Bacteria | 2107 |
| 868 | Ga0395900_0308367 | 3300037418 | Bacteria | 1567 |
| 869 | Ga0395900_1565074 | 3300037418 | Unclassified | 571 |
| 870 | Ga0395898_0101342 | 3300037466 | Bacteria | 2765 |
| 871 | Ga0395905_0058193 | 3300037471 | Bacteria | 3615 |
| 872 | Ga0395905_0161058 | 3300037471 | Bacteria | 2109 |
| 873 | Ga0436364_0503746 | 3300037853 | Bacteria | 1923 |
| 874 | Ga0436364_0713119 | 3300037853 | Unclassified | 741 |
| 875 | Ga0395901_0022807 | 3300038443 | Bacteria | 6418 |
| 876 | Ga0395901_1022276 | 3300038443 | Bacteria | 801 |
| 877 | Ga0395901_1118825 | 3300038443 | Bacteria | 757 |
| 878 | Ga0395901_1130743 | 3300038443 | Bacteria | 752 |
| 879 | Ga0436365_0596749 | 3300039437 | Bacteria | 23938 |
| 880 | Ga0436365_0660570 | 3300039437 | Unclassified | 761 |
| 881 | Ga0436360_0274844 | 3300039438 | Bacteria | 1104 |
| 882 | Ga0436360_0428817 | 3300039438 | Bacteria | 5415 |
| 883 | Ga0436360_0480910 | 3300039438 | Bacteria | 4594 |
| 884 | Ga0436360_1072958 | 3300039438 | Bacteria | 620 |
| 885 | Ga0436361_0085950 | 3300039447 | Unclassified | 791 |
| 886 | Ga0436361_0234159 | 3300039447 | Bacteria | 1346 |
| 887 | Ga0436361_0311977 | 3300039447 | Unclassified | 1341 |
| 888 | Ga0436361_0365009 | 3300039447 | Unclassified | 4351 |
| 889 | Ga0436361_1107455 | 3300039447 | Bacteria | 4012 |
| 890 | Ga0436363_0061087 | 3300039450 | Unclassified | 716 |
| 891 | Ga0436363_1378733 | 3300039450 | Bacteria | 6972 |
| 892 | Ga0436362_1173817 | 3300039453 | Unclassified | 2427 |
| 893 | Ga0451839_1135551 | 3300041496 | Unclassified | 804 |
| 894 | Ga0451577_0000241 | 3300042876 | Bacteria | 108191 |
| 895 | Ga0451577_0042149 | 3300042876 | Bacteria | 4094 |
| 896 | Ga0451577_0916874 | 3300042876 | Unclassified | 789 |
| 897 | Ga0466972_0560089 | 3300044658 | Unclassified | 539 |
| 898 | Ga0453683_0013032 | 3300044673 | Bacteria | 5435 |
| 899 | Ga0453683_0218397 | 3300044673 | Bacteria | 1212 |
| 900 | Ga0466963_0280566 | 3300044694 | Bacteria | 1171 |
| 901 | Ga0466963_0335600 | 3300044694 | Unclassified | 1064 |
| 902 | Ga0466964_0024093 | 3300044706 | Bacteria | 2370 |
| 903 | Ga0466964_0093278 | 3300044706 | Bacteria | 1314 |
| 904 | Ga0453684_0000366 | 3300044712 | Bacteria | 186117 |
| 905 | Ga0453684_0389644 | 3300044712 | Bacteria | 1563 |
| 906 | Ga0466957_0165502 | 3300044842 | Bacteria | 1438 |
| 907 | Ga0466959_0338365 | 3300045049 | Unclassified | 1027 |
| 908 | Ga0451576_0013105 | 3300045051 | Bacteria | 9283 |
| 909 | Ga0451576_0118234 | 3300045051 | Bacteria | 2759 |
| 910 | Ga0451576_0353266 | 3300045051 | Bacteria | 1539 |
| 911 | Ga0451576_0555111 | 3300045051 | Bacteria | 1207 |
| 912 | Ga0451576_1300128 | 3300045051 | Unclassified | 758 |
| 913 | Ga0466967_0648168 | 3300045976 | Unclassified | 1044 |
| 914 | Ga0466967_0757018 | 3300045976 | Unclassified | 963 |
| 915 | Ga0495592_0567087 | 3300046454 | Unclassified | 696 |
| 916 | Ga0495603_0202664 | 3300046455 | Unclassified | 1147 |
| 917 | Ga0495590_0039548 | 3300046457 | Bacteria | 1645 |
| 918 | Ga0495590_0179517 | 3300046457 | Unclassified | 774 |
| 919 | Ga0495629_0007545 | 3300046459 | Bacteria | 8016 |
| 920 | Ga0495641_0066599 | 3300046461 | Unclassified | 1620 |
| 921 | Ga0495651_0131206 | 3300046462 | Bacteria | 1829 |
| 922 | Ga0495651_0134892 | 3300046462 | Bacteria | 1797 |
| 923 | Ga0495651_0326210 | 3300046462 | Bacteria | 1022 |
| 924 | Ga0495653_0515485 | 3300046463 | Unclassified | 744 |
| 925 | Ga0495653_0765050 | 3300046463 | Unclassified | 583 |
| 926 | Ga0495580_0000038 | 3300046472 | Bacteria | 71800 |
| 927 | Ga0495580_0000970 | 3300046472 | Bacteria | 25166 |
| 928 | Ga0495580_0001331 | 3300046472 | Bacteria | 21781 |
| 929 | Ga0495580_0008880 | 3300046472 | Bacteria | 7952 |
| 930 | Ga0495580_0010292 | 3300046472 | Bacteria | 7295 |
| 931 | Ga0495580_0010572 | 3300046472 | Bacteria | 7182 |
| 932 | Ga0495580_0011519 | 3300046472 | Bacteria | 6842 |
| 933 | Ga0495580_0102909 | 3300046472 | Bacteria | 1985 |
| 934 | Ga0495580_0287432 | 3300046472 | Bacteria | 1121 |
| 935 | Ga0495580_0325001 | 3300046472 | Bacteria | 1045 |
| 936 | Ga0495580_0439075 | 3300046472 | Unclassified | 876 |
| 937 | Ga0495580_0497555 | 3300046472 | Unclassified | 814 |
| 938 | Ga0495580_0548071 | 3300046472 | Unclassified | 768 |
| 939 | Ga0495580_1073933 | 3300046472 | Unclassified | 510 |
| 940 | Ga0495582_0004582 | 3300046473 | Bacteria | 7764 |
| 941 | Ga0495582_0005852 | 3300046473 | Bacteria | 6852 |
| 942 | Ga0495582_0120781 | 3300046473 | Bacteria | 1476 |
| 943 | Ga0495582_0442767 | 3300046473 | Bacteria | 750 |
| 944 | Ga0495639_0058131 | 3300046475 | Bacteria | 1768 |
| 945 | Ga0495639_0062297 | 3300046475 | Bacteria | 1711 |
| 946 | Ga0495639_0152189 | 3300046475 | Bacteria | 1116 |
| 947 | Ga0495639_0219026 | 3300046475 | Unclassified | 935 |
| 948 | Ga0495662_0218410 | 3300046476 | Bacteria | 939 |
| 949 | Ga0495664_0316845 | 3300046477 | Bacteria | 941 |
| 950 | Ga0495584_0531891 | 3300046491 | Unclassified | 599 |
| 951 | Ga0495594_0150539 | 3300046499 | Bacteria | 1321 |
| 952 | Ga0495608_0101658 | 3300046511 | Bacteria | 1853 |
| 953 | Ga0495608_0219676 | 3300046511 | Bacteria | 1193 |
| 954 | Ga0495608_0257223 | 3300046511 | Bacteria | 1088 |
| 955 | Ga0495628_0141981 | 3300046516 | Bacteria | 1833 |
| 956 | Ga0495630_0006895 | 3300046517 | Bacteria | 8100 |
| 957 | Ga0495630_0024679 | 3300046517 | Bacteria | 4443 |
| 958 | Ga0495630_0073287 | 3300046517 | Bacteria | 2579 |
| 959 | Ga0495630_0230567 | 3300046517 | Bacteria | 1415 |
| 960 | Ga0495630_0263812 | 3300046517 | Unclassified | 1316 |
| 961 | Ga0495630_0372776 | 3300046517 | Bacteria | 1093 |
| 962 | Ga0495630_0450136 | 3300046517 | Bacteria | 987 |
| 963 | Ga0495630_0718286 | 3300046517 | Unclassified | 764 |
| 964 | Ga0495666_0082377 | 3300046526 | Bacteria | 1521 |
| 965 | Ga0495652_0107767 | 3300046529 | Bacteria | 2247 |
| 966 | Ga0495652_0162000 | 3300046529 | Bacteria | 1736 |
| 967 | Ga0495652_0771646 | 3300046529 | Unclassified | 642 |
| 968 | Ga0495665_0007054 | 3300046531 | Bacteria | 6064 |
| 969 | Ga0495665_0014261 | 3300046531 | Bacteria | 4287 |
| 970 | Ga0495665_0353200 | 3300046531 | Unclassified | 748 |
| 971 | Ga0495665_0665389 | 3300046531 | Unclassified | 518 |
| 972 | Ga0495640_0487871 | 3300046533 | Bacteria | 750 |
| 973 | Ga0495586_0018720 | 3300046535 | Bacteria | 3687 |
| 974 | Ga0495586_0443122 | 3300046535 | Unclassified | 748 |
| 975 | Ga0495586_0567564 | 3300046535 | Unclassified | 655 |
| 976 | Ga0495587_0000423 | 3300046536 | Bacteria | 29685 |
| 977 | Ga0495587_0080020 | 3300046536 | Bacteria | 1894 |
| 978 | Ga0495645_0364981 | 3300046543 | Unclassified | 927 |
| 979 | Ga0495645_0813237 | 3300046543 | Bacteria | 560 |
| 980 | Ga0495667_0425893 | 3300046559 | Unclassified | 835 |
| 981 | Ga0495635_0692717 | 3300046663 | Bacteria | 661 |
| 982 | Ga0495588_0248786 | 3300046674 | Unclassified | 937 |
| 983 | Ga0495657_0459608 | 3300046675 | Unclassified | 745 |
| 984 | Ga0495657_0480019 | 3300046675 | Unclassified | 726 |
| 985 | Ga0495599_0467508 | 3300046678 | Unclassified | 745 |
| 986 | Ga0495623_0009865 | 3300046679 | Bacteria | 6187 |
| 987 | Ga0495658_0004737 | 3300046683 | Bacteria | 6681 |
| 988 | Ga0495658_0004768 | 3300046683 | Bacteria | 6654 |
| 989 | Ga0495658_0045434 | 3300046683 | Bacteria | 2465 |
| 990 | Ga0495669_0238759 | 3300046684 | Bacteria | 872 |
| 991 | Ga0495613_0043783 | 3300046689 | Bacteria | 3312 |
| 992 | Ga0495613_0224412 | 3300046689 | Bacteria | 1318 |
| 993 | Ga0495624_0138659 | 3300046690 | Unclassified | 1490 |
| 994 | Ga0495624_0234871 | 3300046690 | Bacteria | 1110 |
| 995 | Ga0495624_0339443 | 3300046690 | Unclassified | 904 |
| 996 | Ga0495674_0150475 | 3300047319 | Bacteria | 1952 |
| 997 | Ga0495674_0271250 | 3300047319 | Bacteria | 1392 |
| 998 | Ga0495674_0298263 | 3300047319 | Unclassified | 1317 |
| 999 | Ga0495674_0389798 | 3300047319 | Unclassified | 1126 |
| 1000 | Ga0495674_0798719 | 3300047319 | Bacteria | 734 |
| 1001 | Ga0495676_0903476 | 3300047321 | Unclassified | 566 |
| 1002 | Ga0495675_0030452 | 3300047444 | Bacteria | 3443 |
| 1003 | Ga0495684_0001583 | 3300047471 | Bacteria | 18237 |
| 1004 | Ga0495684_0355036 | 3300047471 | Unclassified | 1040 |
| 1005 | Ga0495684_0466043 | 3300047471 | Bacteria | 875 |
| 1006 | Ga0495684_1090627 | 3300047471 | Unclassified | 501 |
| 1007 | Ga0495593_0254453 | 3300047673 | Unclassified | 879 |
| 1008 | Ga0495602_0000026 | 3300048088 | Bacteria | 148063 |
| 1009 | Ga0495602_0032590 | 3300048088 | Bacteria | 4904 |
| 1010 | Ga0495602_0382004 | 3300048088 | Bacteria | 1009 |
| 1011 | Ga0495614_0230448 | 3300048089 | Unclassified | 844 |
| 1012 | Ga0496100_1497606 | 3300048903 | Unclassified | 533 |
| 1013 | Ga0496101_0784020 | 3300048904 | Unclassified | 752 |
| 1014 | Ga0496101_0955241 | 3300048904 | Unclassified | 674 |
| 1015 | Ga0496102_0060962 | 3300048905 | Bacteria | 3451 |
| 1016 | Ga0496103_0076041 | 3300048906 | Bacteria | 2106 |
| 1017 | Ga0496104_0161978 | 3300048907 | Bacteria | 2146 |
| 1018 | Ga0496104_0401849 | 3300048907 | Bacteria | 1282 |
| 1019 | Ga0496105_0695435 | 3300048908 | Unclassified | 781 |
| 1020 | Ga0496106_0422834 | 3300048909 | Bacteria | 1071 |
| 1021 | Ga0496106_1001351 | 3300048909 | Unclassified | 657 |
| 1022 | Ga0496107_0139292 | 3300048910 | Bacteria | 1793 |
| 1023 | Ga0496107_0614913 | 3300048910 | Unclassified | 802 |
| 1024 | Ga0496108_0044623 | 3300048911 | Bacteria | 3700 |
| 1025 | Ga0496108_0716807 | 3300048911 | Unclassified | 867 |
| 1026 | Ga0496110_0026275 | 3300048913 | Bacteria | 4979 |
| 1027 | Ga0496111_0044118 | 3300048914 | Bacteria | 3205 |
| 1028 | Ga0496112_0015301 | 3300048915 | Bacteria | 7154 |
| 1029 | Ga0496112_0090422 | 3300048915 | Bacteria | 3030 |
| 1030 | Ga0496112_0123505 | 3300048915 | Bacteria | 2560 |
| 1031 | Ga0496112_0714532 | 3300048915 | Bacteria | 929 |
| 1032 | Ga0496113_0158785 | 3300048916 | Bacteria | 1787 |
| 1033 | Ga0496113_0605264 | 3300048916 | Unclassified | 877 |
| 1034 | Ga0496114_0680576 | 3300048917 | Bacteria | 903 |
| 1035 | Ga0496115_0003221 | 3300048918 | Bacteria | 11716 |
| 1036 | Ga0496119_0444387 | 3300048922 | Unclassified | 612 |
| 1037 | Ga0501033_0038382 | 3300049570 | Bacteria | 3581 |
| 1038 | Ga0501034_0221363 | 3300049571 | Bacteria | 1845 |
| 1039 | Ga0501080_0063443 | 3300049742 | Bacteria | 3439 |
| 1040 | nmdc:mga03683_33616_c1 | 3300050489 | Bacteria | 2071 |
| 1041 | nmdc:mga0yw44_231182_c1 | 3300050492 | Bacteria | 1227 |
| 1042 | nmdc:mga0yw44_782260_c1 | 3300050492 | Bacteria | 648 |
| 1043 | nmdc:mga0k408_23503_c2 | 3300050493 | Bacteria | 665 |
| 1044 | nmdc:mga06z11_210394_c1 | 3300050494 | Unclassified | 1133 |
| 1045 | nmdc:mga06z11_31825_c1 | 3300050494 | Bacteria | 2567 |
| 1046 | nmdc:mga0n895_1767718_c1 | 3300050512 | Unclassified | 580 |
| 1047 | nmdc:mga0n895_2241_c1 | 3300050512 | Bacteria | 14970 |
| 1048 | nmdc:mga0n895_249_c1 | 3300050512 | Bacteria | 34575 |
| 1049 | nmdc:mga0n895_5529_c1 | 3300050512 | Bacteria | 10581 |
| 1050 | nmdc:mga0rr50_110_c2 | 3300050513 | Bacteria | 25403 |
| 1051 | nmdc:mga0rr50_18748_c1 | 3300050513 | Bacteria | 4656 |
| 1052 | nmdc:mga0rr50_446054_c1 | 3300050513 | Unclassified | 1097 |
| 1053 | nmdc:mga0rr50_461694_c1 | 3300050513 | Unclassified | 1077 |
| 1054 | nmdc:mga0rr50_599394_c1 | 3300050513 | Unclassified | 939 |
| 1055 | nmdc:mga0rr50_9343_c1 | 3300050513 | Bacteria | 6160 |
| 1056 | nmdc:mga08x19_2015_c1 | 3300050514 | Bacteria | 12441 |
| 1057 | nmdc:mga08x19_2054_c1 | 3300050514 | Bacteria | 12346 |
| 1058 | nmdc:mga08x19_290469_c1 | 3300050514 | Bacteria | 1134 |
| 1059 | nmdc:mga08x19_663989_c1 | 3300050514 | Unclassified | 739 |
| 1060 | nmdc:mga08x19_916339_c1 | 3300050514 | Unclassified | 622 |
| 1061 | nmdc:mga08x19_93400_c1 | 3300050514 | Bacteria | 1988 |
| 1062 | nmdc:mga0a205_131_c1 | 3300050515 | Bacteria | 46472 |
| 1063 | nmdc:mga0a205_32965_c1 | 3300050515 | Bacteria | 4968 |
| 1064 | Ga0495601_0086974 | 3300053077 | Bacteria | 2009 |
| 1065 | Ga0495601_0825665 | 3300053077 | Unclassified | 588 |
| 1066 | Ga0495619_0453961 | 3300053085 | Unclassified | 883 |
| 1067 | Ga0587080_121393 | 3300059503 | Unclassified | 580 |
| 1068 | Ga0587071_150359 | 3300060344 | Bacteria | 578 |
| 1069 | Ga0373925_0588096 | |||
| 1070 | rootH2_10231894 | |||
| 1071 | Ga0065712_10094197 | |||
| 1072 | Ga0070658_10058248 | |||
| 1073 | Ga0070658_10184645 | |||
| 1074 | Ga0070683_100035026 | |||
| 1075 | Ga0070683_100144800 | |||
| 1076 | Ga0070683_100191643 | |||
| 1077 | Ga0070683_100261347 | |||
| 1078 | Ga0070690_100037280 | |||
| 1079 | Ga0070670_100001671 | |||
| 1080 | Ga0070670_100041646 | |||
| 1081 | Ga0070670_100196186 | |||
| 1082 | Ga0070670_101105421 | |||
| 1083 | Ga0068869_100014829 | |||
| 1084 | Ga0068869_100037074 | |||
| 1085 | Ga0068869_101908937 | |||
| 1086 | Ga0070680_100173118 | |||
| 1087 | Ga0070680_100281584 | |||
| 1088 | Ga0070682_100056200 | |||
| 1089 | Ga0070682_101484000 | |||
| 1090 | Ga0068868_100001978 | |||
| 1091 | Ga0068868_100002128 | |||
| 1092 | Ga0068868_100718929 | |||
| 1093 | Ga0070660_100082778 | |||
| 1094 | Ga0070660_100208428 | |||
| 1095 | Ga0070691_10077617 | |||
| 1096 | Ga0070691_10083245 | |||
| 1097 | Ga0070687_100044499 | |||
| 1098 | Ga0070687_100564906 | |||
| 1099 | Ga0070661_100036253 | |||
| 1100 | Ga0070661_100059537 | |||
| 1101 | Ga0070661_100242259 | |||
| 1102 | Ga0070661_100272411 | |||
| 1103 | Ga0070661_100703833 | |||
| 1104 | Ga0070692_10444766 | |||
| 1105 | Ga0070675_100071694 | |||
| 1106 | Ga0070671_100022623 | |||
| 1107 | Ga0070671_100819163 | |||
| 1108 | Ga0070671_101533250 | |||
| 1109 | Ga0070674_100552448 | |||
| 1110 | Ga0070674_100571412 | |||
| 1111 | Ga0070673_100063620 | |||
| 1112 | Ga0070673_100400791 | |||
| 1113 | Ga0070688_100366973 | |||
| 1114 | Ga0070688_100751141 | |||
| 1115 | Ga0070659_100035299 | |||
| 1116 | Ga0070667_100081826 | |||
| 1117 | Ga0070667_100422190 | |||
| 1118 | Ga0070709_10000124 | |||
| 1119 | Ga0070709_10004385 | |||
| 1120 | Ga0070709_10007336 | |||
| 1121 | Ga0070709_10079571 | |||
| 1122 | Ga0070709_10137306 | |||
| 1123 | Ga0070709_10147119 | |||
| 1124 | Ga0070709_10158379 | |||
| 1125 | Ga0070709_10542832 | |||
| 1126 | Ga0070709_10656022 | |||
| 1127 | Ga0070709_11022584 | |||
| 1128 | Ga0070714_100001513 | |||
| 1129 | Ga0070714_100004992 | |||
| 1130 | Ga0070714_100013058 | |||
| 1131 | Ga0070714_100203159 | |||
| 1132 | Ga0070714_100245595 | |||
| 1133 | Ga0070714_100265531 | |||
| 1134 | Ga0070714_100786083 | |||
| 1135 | Ga0070714_101144947 | |||
| 1136 | Ga0070714_101168549 | |||
| 1137 | Ga0070714_101190810 | |||
| 1138 | Ga0070714_101238479 | |||
| 1139 | Ga0070714_101556120 | |||
| 1140 | Ga0070713_100007817 | |||
| 1141 | Ga0070713_100021351 | |||
| 1142 | Ga0070713_100023074 | |||
| 1143 | Ga0070713_100029951 | |||
| 1144 | Ga0070713_100035750 | |||
| 1145 | Ga0070713_100049791 | |||
| 1146 | Ga0070713_100056043 | |||
| 1147 | Ga0070713_100086252 | |||
| 1148 | Ga0070713_100136892 | |||
| 1149 | Ga0070713_100163140 | |||
| 1150 | Ga0070713_100304627 | |||
| 1151 | Ga0070713_100536428 | |||
| 1152 | Ga0070713_100699443 | |||
| 1153 | Ga0070713_100701554 | |||
| 1154 | Ga0070713_101109195 | |||
| 1155 | Ga0070713_101195463 | |||
| 1156 | Ga0070713_101207446 | |||
| 1157 | Ga0070713_101210468 | |||
| 1158 | Ga0070713_101305794 | |||
| 1159 | Ga0070713_102021067 | |||
| 1160 | Ga0070710_10004411 | |||
| 1161 | Ga0070710_10007525 | |||
| 1162 | Ga0070710_10014242 | |||
| 1163 | Ga0070710_10072591 | |||
| 1164 | Ga0070710_10104544 | |||
| 1165 | Ga0070710_10104858 | |||
| 1166 | Ga0070710_10388130 | |||
| 1167 | Ga0070711_100000177 | |||
| 1168 | Ga0070711_100000967 | |||
| 1169 | Ga0070711_100023772 | |||
| 1170 | Ga0070711_100025207 | |||
| 1171 | Ga0070711_100032311 | |||
| 1172 | Ga0070711_100060428 | |||
| 1173 | Ga0070711_100104453 | |||
| 1174 | Ga0070711_100137982 | |||
| 1175 | Ga0070711_100849622 | |||
| 1176 | Ga0070708_100000233 | |||
| 1177 | Ga0070708_100020645 | |||
| 1178 | Ga0070708_100064714 | |||
| 1179 | Ga0070708_100078071 | |||
| 1180 | Ga0070708_100079102 | |||
| 1181 | Ga0070708_100094858 | |||
| 1182 | Ga0070708_100121776 | |||
| 1183 | Ga0070708_100193488 | |||
| 1184 | Ga0070708_100391958 | |||
| 1185 | Ga0070708_100469889 | |||
| 1186 | Ga0070663_100917911 | |||
| 1187 | Ga0070678_100765393 | |||
| 1188 | Ga0070662_100081746 | |||
| 1189 | Ga0070681_10016810 | |||
| 1190 | Ga0070681_10040101 | |||
| 1191 | Ga0070681_10054948 | |||
| 1192 | Ga0070681_10096949 | |||
| 1193 | Ga0070681_10505964 | |||
| 1194 | Ga0070681_10706662 | |||
| 1195 | Ga0070681_10740468 | |||
| 1196 | Ga0068867_100003355 | |||
| 1197 | Ga0070685_10102500 | |||
| 1198 | Ga0070706_100004545 | |||
| 1199 | Ga0070706_100005808 | |||
| 1200 | Ga0070706_100007343 | |||
| 1201 | Ga0070706_100102770 | |||
| 1202 | Ga0070706_100328296 | |||
| 1203 | Ga0070707_100001178 | |||
| 1204 | Ga0070707_100027882 | |||
| 1205 | Ga0070707_100046302 | |||
| 1206 | Ga0070707_100078728 | |||
| 1207 | Ga0070707_100148882 | |||
| 1208 | Ga0070707_100294927 | |||
| 1209 | Ga0070707_100385093 | |||
| 1210 | Ga0070707_100439675 | |||
| 1211 | Ga0070707_100467235 | |||
| 1212 | Ga0070707_100700380 | |||
| 1213 | Ga0070707_101413022 | |||
| 1214 | Ga0070707_101570759 | |||
| 1215 | Ga0070707_101602776 | |||
| 1216 | Ga0070698_100008031 | |||
| 1217 | Ga0070698_100029536 | |||
| 1218 | Ga0070698_100600432 | |||
| 1219 | Ga0070698_100882603 | |||
| 1220 | Ga0070699_100000726 | |||
| 1221 | Ga0070699_100021953 | |||
| 1222 | Ga0070699_100111175 | |||
| 1223 | Ga0070699_100276125 | |||
| 1224 | Ga0070699_100352041 | |||
| 1225 | Ga0070699_100361281 | |||
| 1226 | Ga0070679_100123029 | |||
| 1227 | Ga0070679_100147917 | |||
| 1228 | Ga0070679_100765905 | |||
| 1229 | Ga0070679_101176456 | |||
| 1230 | Ga0070684_100566819 | |||
| 1231 | Ga0070684_100628489 | |||
| 1232 | Ga0070697_100000178 | |||
| 1233 | Ga0070697_100000417 | |||
| 1234 | Ga0070697_100000825 | |||
| 1235 | Ga0070697_100022312 | |||
| 1236 | Ga0070697_100061198 | |||
| 1237 | Ga0070697_100134084 | |||
| 1238 | Ga0070697_100160430 | |||
| 1239 | Ga0070697_100651459 | |||
| 1240 | Ga0070697_101406072 | |||
| 1241 | Ga0070672_100123688 | |||
| 1242 | Ga0070672_100546010 | |||
| 1243 | Ga0070672_100896142 | |||
| 1244 | Ga0070686_100595862 | |||
| 1245 | Ga0070695_100259560 | |||
| 1246 | Ga0070696_101031749 | |||
| 1247 | Ga0070693_100029120 | |||
| 1248 | Ga0070693_100144831 | |||
| 1249 | Ga0070693_100147914 | |||
| 1250 | Ga0070665_100269864 | |||
| 1251 | Ga0070665_100361783 | |||
| 1252 | Ga0068855_100009907 | |||
| 1253 | Ga0068855_100068957 | |||
| 1254 | Ga0068855_100148046 | |||
| 1255 | Ga0068855_100297555 | |||
| 1256 | Ga0068855_101683435 | |||
| 1257 | Ga0070664_100004208 | |||
| 1258 | Ga0070664_100017530 | |||
| 1259 | Ga0070664_100034600 | |||
| 1260 | Ga0070664_100451052 | |||
| 1261 | Ga0068857_100000121 | |||
| 1262 | Ga0068857_100010837 | |||
| 1263 | Ga0068857_100013517 | |||
| 1264 | Ga0068857_100614748 | |||
| 1265 | Ga0068857_101097631 | |||
| 1266 | Ga0068854_100005151 | |||
| 1267 | Ga0068856_100000735 | |||
| 1268 | Ga0068856_100003101 | |||
| 1269 | Ga0068856_100009396 | |||
| 1270 | Ga0068856_100013903 | |||
| 1271 | Ga0068856_100328411 | |||
| 1272 | Ga0068856_100599568 | |||
| 1273 | Ga0068856_100651215 | |||
| 1274 | Ga0068856_101289878 | |||
| 1275 | Ga0070702_100202836 | |||
| 1276 | Ga0068852_100182018 | |||
| 1277 | Ga0068852_101977655 | |||
| 1278 | Ga0068859_100000415 | |||
| 1279 | Ga0068859_101027065 | |||
| 1280 | Ga0068864_100001353 | |||
| 1281 | Ga0068864_100062163 | |||
| 1282 | Ga0068864_101448515 | |||
| 1283 | Ga0068864_102599655 | |||
| 1284 | Ga0068861_100577529 | |||
| 1285 | Ga0068851_10010311 | |||
| 1286 | Ga0068851_10010643 | |||
| 1287 | Ga0068851_10101494 | |||
| 1288 | Ga0068863_100125245 | |||
| 1289 | Ga0068863_100365545 | |||
| 1290 | Ga0068863_100802156 | |||
| 1291 | Ga0068863_101650809 | |||
| 1292 | Ga0068858_100001756 | |||
| 1293 | Ga0068860_100147508 | |||
| 1294 | Ga0068860_100281833 | |||
| 1295 | Ga0068860_100835963 | |||
| 1296 | Ga0068862_100036840 | |||
| 1297 | Ga0070717_10002031 | |||
| 1298 | Ga0070717_10002353 | |||
| 1299 | Ga0070717_10004967 | |||
| 1300 | Ga0070717_10017838 | |||
| 1301 | Ga0070717_10047477 | |||
| 1302 | Ga0070717_10052640 | |||
| 1303 | Ga0070717_10104206 | |||
| 1304 | Ga0070717_10133449 | |||
| 1305 | Ga0070717_10177361 | |||
| 1306 | Ga0070717_10369156 | |||
| 1307 | Ga0070717_10373231 | |||
| 1308 | Ga0070717_10441313 | |||
| 1309 | Ga0070717_10533583 | |||
| 1310 | Ga0070717_10621710 | |||
| 1311 | Ga0070717_11326124 | |||
| 1312 | Ga0075365_10113081 | |||
| 1313 | Ga0075365_10842243 | |||
| 1314 | Ga0075368_10015612 | |||
| 1315 | Ga0075368_10049797 | |||
| 1316 | Ga0075364_10035156 | |||
| 1317 | Ga0075364_10056817 | |||
| 1318 | Ga0070715_10005113 | |||
| 1319 | Ga0070715_10007964 | |||
| 1320 | Ga0070715_10066248 | |||
| 1321 | Ga0070715_10111290 | |||
| 1322 | Ga0070716_100001161 | |||
| 1323 | Ga0070716_100001202 | |||
| 1324 | Ga0070716_100006315 | |||
| 1325 | Ga0070716_100008072 | |||
| 1326 | Ga0070716_100008298 | |||
| 1327 | Ga0070716_100009175 | |||
| 1328 | Ga0070716_100227038 | |||
| 1329 | Ga0070716_100621268 | |||
| 1330 | Ga0070716_100670863 | |||
| 1331 | Ga0070716_100688384 | |||
| 1332 | Ga0070712_100000563 | |||
| 1333 | Ga0070712_100002311 | |||
| 1334 | Ga0070712_100002744 | |||
| 1335 | Ga0070712_100008454 | |||
| 1336 | Ga0070712_100009284 | |||
| 1337 | Ga0070712_100018486 | |||
| 1338 | Ga0070712_100041353 | |||
| 1339 | Ga0070712_100075627 | |||
| 1340 | Ga0070712_100167270 | |||
| 1341 | Ga0070712_100175616 | |||
| 1342 | Ga0070712_100406335 | |||
| 1343 | Ga0070712_100662894 | |||
| 1344 | Ga0070712_101894810 | |||
| 1345 | Ga0075362_10022193 | |||
| 1346 | Ga0075362_10415068 | |||
| 1347 | Ga0075367_10006965 | |||
| 1348 | Ga0075366_10027836 | |||
| 1349 | Ga0075366_10110587 | |||
| 1350 | Ga0097621_100012384 | |||
| 1351 | Ga0097621_100205019 | |||
| 1352 | Ga0097621_100743607 | |||
| 1353 | Ga0097621_101686531 | |||
| 1354 | Ga0075370_10003793 | |||
| 1355 | Ga0068871_100000258 | |||
| 1356 | Ga0068871_100038342 | |||
| 1357 | Ga0068871_100045931 | |||
| 1358 | Ga0068871_100730359 | |||
| 1359 | Ga0068871_101110719 | |||
| 1360 | Ga0068871_101876141 | |||
| 1361 | Ga0075433_10001437 | |||
| 1362 | Ga0075433_10026265 | |||
| 1363 | Ga0075433_10161078 | |||
| 1364 | Ga0075434_100000558 | |||
| 1365 | Ga0075434_100002002 | |||
| 1366 | Ga0075434_100013048 | |||
| 1367 | Ga0075434_100409948 | |||
| 1368 | Ga0075436_100002093 | |||
| 1369 | Ga0075436_100004685 | |||
| 1370 | Ga0075436_100215758 | |||
| 1371 | Ga0075436_100333048 | |||
| 1372 | Ga0097620_100000415 | |||
| 1373 | Ga0097620_101027003 | |||
| 1374 | Ga0075435_100001773 | |||
| 1375 | Ga0075435_100004419 | |||
| 1376 | Ga0075435_100015210 | |||
| 1377 | Ga0075435_100235759 | |||
| 1378 | Ga0099794_10172448 | |||
| 1379 | Ga0099794_10215001 | |||
| 1380 | Ga0099795_10052652 | |||
| 1381 | Ga0099795_10445561 | |||
| 1382 | Ga0099795_10639228 | |||
| 1383 | Ga0105240_10003977 | |||
| 1384 | Ga0105240_10007614 | |||
| 1385 | Ga0105240_10039816 | |||
| 1386 | Ga0105240_10054248 | |||
| 1387 | Ga0105240_10086289 | |||
| 1388 | Ga0105240_10092117 | |||
| 1389 | Ga0105240_10122519 | |||
| 1390 | Ga0105240_10183442 | |||
| 1391 | Ga0105240_10354365 | |||
| 1392 | Ga0105240_10726039 | |||
| 1393 | Ga0105240_10970798 | |||
| 1394 | Ga0111539_10688636 | |||
| 1395 | Ga0111539_10857201 | |||
| 1396 | Ga0105245_10015031 | |||
| 1397 | Ga0105245_10215226 | |||
| 1398 | Ga0105245_11018774 | |||
| 1399 | Ga0105247_10004638 | |||
| 1400 | Ga0105247_10236657 | |||
| 1401 | Ga0105243_10050842 | |||
| 1402 | Ga0105241_10004555 | |||
| 1403 | Ga0105241_10008310 | |||
| 1404 | Ga0105241_10017510 | |||
| 1405 | Ga0105241_10185594 | |||
| 1406 | Ga0105241_10414027 | |||
| 1407 | Ga0105241_10587269 | |||
| 1408 | Ga0105241_10824946 | |||
| 1409 | Ga0105242_11043623 | |||
| 1410 | Ga0105248_10081116 | |||
| 1411 | Ga0105248_10136897 | |||
| 1412 | Ga0105248_10305204 | |||
| 1413 | Ga0105248_11699379 | |||
| 1414 | Ga0105237_10144235 | |||
| 1415 | Ga0105237_11148862 | |||
| 1416 | Ga0105238_10006041 | |||
| 1417 | Ga0105238_10016999 | |||
| 1418 | Ga0105238_10063599 | |||
| 1419 | Ga0105238_10190750 | |||
| 1420 | Ga0105238_10238257 | |||
| 1421 | Ga0099796_10040799 | |||
| 1422 | Ga0099796_10043294 | |||
| 1423 | Ga0105239_10014037 | |||
| 1424 | Ga0105239_10075736 | |||
| 1425 | Ga0105239_10203699 | |||
| 1426 | Ga0105239_10300144 | |||
| 1427 | Ga0105239_11638313 | |||
| 1428 | Ga0105246_10013145 | |||
| 1429 | Ga0105246_10576540 | |||
| 1430 | Ga0157373_10008141 | |||
| 1431 | Ga0157373_10127212 | |||
| 1432 | Ga0157373_10136551 | |||
| 1433 | Ga0157373_10323684 | |||
| 1434 | Ga0157373_10434130 | |||
| 1435 | Ga0157371_10164825 | |||
| 1436 | Ga0157371_10267475 | |||
| 1437 | Ga0157371_10442934 | |||
| 1438 | Ga0157371_11173220 | |||
| 1439 | Ga0157370_10020143 | |||
| 1440 | Ga0157370_10315432 | |||
| 1441 | Ga0157370_11164084 | |||
| 1442 | Ga0157369_10020040 | |||
| 1443 | Ga0157369_10082844 | |||
| 1444 | Ga0157369_10162270 | |||
| 1445 | Ga0157369_10286471 | |||
| 1446 | Ga0157369_10389207 | |||
| 1447 | Ga0157369_10451522 | |||
| 1448 | Ga0157369_10545999 | |||
| 1449 | Ga0157369_12234097 | |||
| 1450 | Ga0157374_10000881 | |||
| 1451 | Ga0157374_10023522 | |||
| 1452 | Ga0157374_10056035 | |||
| 1453 | Ga0157374_10132191 | |||
| 1454 | Ga0157374_10363263 | |||
| 1455 | Ga0157374_10623516 | |||
| 1456 | Ga0157374_11244455 | |||
| 1457 | Ga0157374_11330216 | |||
| 1458 | Ga0157378_10000030 | |||
| 1459 | Ga0163162_10015539 | |||
| 1460 | Ga0163162_10224506 | |||
| 1461 | Ga0163162_10689287 | |||
| 1462 | Ga0157372_10000576 | |||
| 1463 | Ga0157372_10001714 | |||
| 1464 | Ga0157372_10007600 | |||
| 1465 | Ga0157372_10018023 | |||
| 1466 | Ga0157372_10019657 | |||
| 1467 | Ga0157372_10031691 | |||
| 1468 | Ga0157372_10040611 | |||
| 1469 | Ga0157372_10229211 | |||
| 1470 | Ga0157372_10319807 | |||
| 1471 | Ga0157372_10356902 | |||
| 1472 | Ga0157372_10429893 | |||
| 1473 | Ga0157372_10817672 | |||
| 1474 | Ga0157372_13263363 | |||
| 1475 | Ga0157375_11374238 | |||
| 1476 | Ga0163163_10021735 | |||
| 1477 | Ga0163163_10146463 | |||
| 1478 | Ga0163163_10392764 | |||
| 1479 | Ga0163163_10805906 | |||
| 1480 | Ga0182008_10021984 | |||
| 1481 | Ga0157379_10078092 | |||
| 1482 | Ga0157379_11238277 | |||
| 1483 | Ga0157376_10112949 | |||
| 1484 | Ga0157376_10379918 | |||
| 1485 | Ga0157376_10871276 | |||
| 1486 | Ga0157376_11222815 | |||
| 1487 | Ga0157376_11504722 | |||
| 1488 | Ga0182006_1033395 | |||
| 1489 | Ga0182007_10003047 | |||
| 1490 | Ga0182005_1009721 | |||
| 1491 | Ga0213872_10028523 | |||
| 1492 | Ga0213872_10072584 | |||
| 1493 | Ga0213872_10085000 | |||
| 1494 | Ga0213874_10019603 | |||
| 1495 | Ga0213876_10005622 | |||
| 1496 | Ga0213875_10053355 | |||
| 1497 | Ga0213871_10002734 | |||
| 1498 | Ga0207656_10013934 | |||
| 1499 | Ga0207656_10021529 | |||
| 1500 | Ga0207692_10006378 | |||
| 1501 | Ga0207692_10044734 | |||
| 1502 | Ga0207692_10103082 | |||
| 1503 | Ga0207692_10103202 | |||
| 1504 | Ga0207692_10142385 | |||
| 1505 | Ga0207692_10238359 | |||
| 1506 | Ga0207710_10005580 | |||
| 1507 | Ga0207647_10044739 | |||
| 1508 | Ga0207685_10007324 | |||
| 1509 | Ga0207685_10026595 | |||
| 1510 | Ga0207685_10035468 | |||
| 1511 | Ga0207685_10068198 | |||
| 1512 | Ga0207685_10249888 | |||
| 1513 | Ga0207699_10001362 | |||
| 1514 | Ga0207699_10024434 | |||
| 1515 | Ga0207699_10066158 | |||
| 1516 | Ga0207699_10081850 | |||
| 1517 | Ga0207699_10131673 | |||
| 1518 | Ga0207699_10184463 | |||
| 1519 | Ga0207699_10602782 | |||
| 1520 | Ga0207699_10877485 | |||
| 1521 | Ga0207645_10279493 | |||
| 1522 | Ga0207705_10176487 | |||
| 1523 | Ga0207705_10664370 | |||
| 1524 | Ga0207684_10000642 | |||
| 1525 | Ga0207684_10011628 | |||
| 1526 | Ga0207684_10048277 | |||
| 1527 | Ga0207684_10091823 | |||
| 1528 | Ga0207654_10003178 | |||
| 1529 | Ga0207654_10004021 | |||
| 1530 | Ga0207654_10089674 | |||
| 1531 | Ga0207654_10179546 | |||
| 1532 | Ga0207654_10368000 | |||
| 1533 | Ga0207707_10120564 | |||
| 1534 | Ga0207707_10186536 | |||
| 1535 | Ga0207707_10203104 | |||
| 1536 | Ga0207707_10420770 | |||
| 1537 | Ga0207695_10008149 | |||
| 1538 | Ga0207695_10014420 | |||
| 1539 | Ga0207695_10020213 | |||
| 1540 | Ga0207695_10029610 | |||
| 1541 | Ga0207695_10036245 | |||
| 1542 | Ga0207695_10090156 | |||
| 1543 | Ga0207695_10125324 | |||
| 1544 | Ga0207695_10171345 | |||
| 1545 | Ga0207695_10380552 | |||
| 1546 | Ga0207695_10570765 | |||
| 1547 | Ga0207695_11688536 | |||
| 1548 | Ga0207671_10009016 | |||
| 1549 | Ga0207693_10000084 | |||
| 1550 | Ga0207693_10003411 | |||
| 1551 | Ga0207693_10004079 | |||
| 1552 | Ga0207693_10004685 | |||
| 1553 | Ga0207693_10009120 | |||
| 1554 | Ga0207693_10016835 | |||
| 1555 | Ga0207693_10021197 | |||
| 1556 | Ga0207693_10028599 | |||
| 1557 | Ga0207693_10066652 | |||
| 1558 | Ga0207693_10118820 | |||
| 1559 | Ga0207693_10605389 | |||
| 1560 | Ga0207663_10001613 | |||
| 1561 | Ga0207663_10004197 | |||
| 1562 | Ga0207663_10013450 | |||
| 1563 | Ga0207663_10045290 | |||
| 1564 | Ga0207663_10050257 | |||
| 1565 | Ga0207663_10108995 | |||
| 1566 | Ga0207663_10388910 | |||
| 1567 | Ga0207663_10503218 | |||
| 1568 | Ga0207663_11529943 | |||
| 1569 | Ga0207660_10296504 | |||
| 1570 | Ga0207660_10540738 | |||
| 1571 | Ga0207657_10002596 | |||
| 1572 | Ga0207657_10444749 | |||
| 1573 | Ga0207649_10064156 | |||
| 1574 | Ga0207652_10078946 | |||
| 1575 | Ga0207652_10209251 | |||
| 1576 | Ga0207652_10363136 | |||
| 1577 | Ga0207646_10001331 | |||
| 1578 | Ga0207646_10055286 | |||
| 1579 | Ga0207646_10082750 | |||
| 1580 | Ga0207646_10103335 | |||
| 1581 | Ga0207646_10203351 | |||
| 1582 | Ga0207646_10225067 | |||
| 1583 | Ga0207646_10435216 | |||
| 1584 | Ga0207646_11004761 | |||
| 1585 | Ga0207646_11061673 | |||
| 1586 | Ga0207681_10183688 | |||
| 1587 | Ga0207694_10009060 | |||
| 1588 | Ga0207694_10151219 | |||
| 1589 | Ga0207694_10196088 | |||
| 1590 | Ga0207694_10332036 | |||
| 1591 | Ga0207694_11120767 | |||
| 1592 | Ga0207650_10014559 | |||
| 1593 | Ga0207650_10074894 | |||
| 1594 | Ga0207650_10230359 | |||
| 1595 | Ga0207650_10461366 | |||
| 1596 | Ga0207659_10094513 | |||
| 1597 | Ga0207659_11101396 | |||
| 1598 | Ga0207687_10059373 | |||
| 1599 | Ga0207687_10131282 | |||
| 1600 | Ga0207700_10000293 | |||
| 1601 | Ga0207700_10012079 | |||
| 1602 | Ga0207700_10042787 | |||
| 1603 | Ga0207700_10044006 | |||
| 1604 | Ga0207700_10047878 | |||
| 1605 | Ga0207700_10069480 | |||
| 1606 | Ga0207700_10084458 | |||
| 1607 | Ga0207700_10092181 | |||
| 1608 | Ga0207700_10102024 | |||
| 1609 | Ga0207700_10156228 | |||
| 1610 | Ga0207700_10249297 | |||
| 1611 | Ga0207700_10308189 | |||
| 1612 | Ga0207700_10316855 | |||
| 1613 | Ga0207700_10574749 | |||
| 1614 | Ga0207700_10864980 | |||
| 1615 | Ga0207700_11504446 | |||
| 1616 | Ga0207700_11662893 | |||
| 1617 | Ga0207664_10013366 | |||
| 1618 | Ga0207664_10032843 | |||
| 1619 | Ga0207664_10035600 | |||
| 1620 | Ga0207664_10147146 | |||
| 1621 | Ga0207664_10301212 | |||
| 1622 | Ga0207664_10314730 | |||
| 1623 | Ga0207664_10335761 | |||
| 1624 | Ga0207664_10585939 | |||
| 1625 | Ga0207664_10587940 | |||
| 1626 | Ga0207664_11384106 | |||
| 1627 | Ga0207644_10200193 | |||
| 1628 | Ga0207644_11405168 | |||
| 1629 | Ga0207706_10064191 | |||
| 1630 | Ga0207706_11453764 | |||
| 1631 | Ga0207686_10995702 | |||
| 1632 | Ga0207670_10056188 | |||
| 1633 | Ga0207669_11557201 | |||
| 1634 | Ga0207665_10001047 | |||
| 1635 | Ga0207665_10001060 | |||
| 1636 | Ga0207665_10008698 | |||
| 1637 | Ga0207665_10013254 | |||
| 1638 | Ga0207665_10013876 | |||
| 1639 | Ga0207665_10031738 | |||
| 1640 | Ga0207665_10044585 | |||
| 1641 | Ga0207665_10076642 | |||
| 1642 | Ga0207665_10079395 | |||
| 1643 | Ga0207665_10198518 | |||
| 1644 | Ga0207665_10270025 | |||
| 1645 | Ga0207665_10729506 | |||
| 1646 | Ga0207691_10574452 | |||
| 1647 | Ga0207691_10580187 | |||
| 1648 | Ga0207711_10007922 | |||
| 1649 | Ga0207711_10087071 | |||
| 1650 | Ga0207711_10360384 | |||
| 1651 | Ga0207689_10083876 | |||
| 1652 | Ga0207661_10152439 | |||
| 1653 | Ga0207661_10307916 | |||
| 1654 | Ga0207679_10181150 | |||
| 1655 | Ga0207679_10238997 | |||
| 1656 | Ga0207679_10439172 | |||
| 1657 | Ga0207679_10540662 | |||
| 1658 | Ga0207667_10013776 | |||
| 1659 | Ga0207667_10055953 | |||
| 1660 | Ga0207667_10163648 | |||
| 1661 | Ga0207667_10401622 | |||
| 1662 | Ga0207651_10027098 | |||
| 1663 | Ga0207651_10034949 | |||
| 1664 | Ga0207640_10002147 | |||
| 1665 | Ga0207640_10170513 | |||
| 1666 | Ga0207658_10103993 | |||
| 1667 | Ga0207658_10716841 | |||
| 1668 | Ga0207677_10001194 | |||
| 1669 | Ga0207677_10002578 | |||
| 1670 | Ga0207703_10002718 | |||
| 1671 | Ga0207703_11273438 | |||
| 1672 | Ga0207703_11378968 | |||
| 1673 | Ga0207639_10114943 | |||
| 1674 | Ga0207639_11232867 | |||
| 1675 | Ga0207702_10000764 | |||
| 1676 | Ga0207702_10001551 | |||
| 1677 | Ga0207702_10027156 | |||
| 1678 | Ga0207702_10073909 | |||
| 1679 | Ga0207702_10080814 | |||
| 1680 | Ga0207702_10240822 | |||
| 1681 | Ga0207702_10264003 | |||
| 1682 | Ga0207702_10266245 | |||
| 1683 | Ga0207702_10325787 | |||
| 1684 | Ga0207702_10547207 | |||
| 1685 | Ga0207641_10128289 | |||
| 1686 | Ga0207641_10132001 | |||
| 1687 | Ga0207641_10180534 | |||
| 1688 | Ga0207641_10245754 | |||
| 1689 | Ga0207676_10001298 | |||
| 1690 | Ga0207676_10225648 | |||
| 1691 | Ga0207676_11592726 | |||
| 1692 | Ga0207676_11911856 | |||
| 1693 | Ga0207674_10000281 | |||
| 1694 | Ga0207674_10003756 | |||
| 1695 | Ga0207674_10032182 | |||
| 1696 | Ga0207674_10393609 | |||
| 1697 | Ga0207674_10797843 | |||
| 1698 | Ga0207683_10845972 | |||
| 1699 | Ga0207698_12239765 | |||
| 1700 | Ga0268266_10139119 | |||
| 1701 | Ga0268266_10462046 | |||
| 1702 | Ga0268265_10026847 | |||
| 1703 | Ga0268264_10270805 | |||
| 1704 | Ga0268264_10478644 | |||
| 1705 | Ga0265337_1000542 | |||
| 1706 | Ga0265337_1002344 | |||
| 1707 | Ga0265337_1004508 | |||
| 1708 | Ga0265337_1007731 | |||
| 1709 | Ga0265337_1017646 | |||
| 1710 | Ga0265337_1021906 | |||
| 1711 | Ga0265337_1043296 | |||
| 1712 | Ga0265337_1061535 | |||
| 1713 | Ga0265337_1160717 | |||
| 1714 | Ga0265326_10060961 | |||
| 1715 | Ga0265326_10115618 | |||
| 1716 | Ga0265326_10129695 | |||
| 1717 | Ga0265319_1000082 | |||
| 1718 | Ga0265319_1000383 | |||
| 1719 | Ga0265319_1005048 | |||
| 1720 | Ga0265319_1024476 | |||
| 1721 | Ga0265319_1032006 | |||
| 1722 | Ga0265334_10002529 | |||
| 1723 | Ga0265334_10005317 | |||
| 1724 | Ga0265334_10024695 | |||
| 1725 | Ga0265334_10043209 | |||
| 1726 | Ga0265334_10045812 | |||
| 1727 | Ga0265334_10071229 | |||
| 1728 | Ga0265334_10240661 | |||
| 1729 | Ga0265318_10000611 | |||
| 1730 | Ga0265318_10001111 | |||
| 1731 | Ga0265318_10002270 | |||
| 1732 | Ga0265318_10015696 | |||
| 1733 | Ga0265318_10074196 | |||
| 1734 | Ga0265318_10119213 | |||
| 1735 | Ga0265323_10000293 | |||
| 1736 | Ga0265323_10001094 | |||
| 1737 | Ga0265323_10007601 | |||
| 1738 | Ga0265322_10000028 | |||
| 1739 | Ga0265322_10000169 | |||
| 1740 | Ga0265322_10000329 | |||
| 1741 | Ga0265322_10006814 | |||
| 1742 | Ga0265322_10034070 | |||
| 1743 | Ga0265322_10105281 | |||
| 1744 | Ga0265336_10000152 | |||
| 1745 | Ga0265336_10057325 | |||
| 1746 | Ga0265338_10000295 | |||
| 1747 | Ga0265338_10000468 | |||
| 1748 | Ga0265338_10001464 | |||
| 1749 | Ga0265338_10003449 | |||
| 1750 | Ga0265338_10004220 | |||
| 1751 | Ga0265338_10009337 | |||
| 1752 | Ga0265338_10015175 | |||
| 1753 | Ga0265338_10016370 | |||
| 1754 | Ga0265338_10017637 | |||
| 1755 | Ga0265338_10022106 | |||
| 1756 | Ga0265338_10027649 | |||
| 1757 | Ga0265338_10031867 | |||
| 1758 | Ga0265338_10068523 | |||
| 1759 | Ga0265338_10075087 | |||
| 1760 | Ga0265338_10120361 | |||
| 1761 | Ga0265338_10129432 | |||
| 1762 | Ga0265338_10220234 | |||
| 1763 | Ga0265338_10245876 | |||
| 1764 | Ga0265338_10319714 | |||
| 1765 | Ga0265338_10473809 | |||
| 1766 | Ga0265338_10543990 | |||
| 1767 | Ga0265338_10591021 | |||
| 1768 | Ga0265338_10727345 | |||
| 1769 | Ga0265338_10795672 | |||
| 1770 | Ga0265338_10805672 | |||
| 1771 | Ga0265338_11161840 | |||
| 1772 | Ga0265324_10000484 | |||
| 1773 | Ga0265324_10001659 | |||
| 1774 | Ga0265324_10002703 | |||
| 1775 | Ga0265324_10002940 | |||
| 1776 | Ga0265324_10009253 | |||
| 1777 | Ga0265324_10011687 | |||
| 1778 | Ga0265324_10036441 | |||
| 1779 | Ga0265324_10038878 | |||
| 1780 | Ga0265324_10076732 | |||
| 1781 | Ga0265324_10145941 | |||
| 1782 | Ga0265324_10257280 | |||
| 1783 | Ga0265760_10028670 | |||
| 1784 | Ga0265760_10153259 | |||
| 1785 | Ga0265330_10001419 | |||
| 1786 | Ga0265330_10023290 | |||
| 1787 | Ga0265330_10070411 | |||
| 1788 | Ga0265330_10160517 | |||
| 1789 | Ga0265332_10024493 | |||
| 1790 | Ga0265332_10050583 | |||
| 1791 | Ga0265332_10127060 | |||
| 1792 | Ga0265332_10335527 | |||
| 1793 | Ga0265328_10000745 | |||
| 1794 | Ga0265328_10139598 | |||
| 1795 | Ga0265320_10000497 | |||
| 1796 | Ga0265320_10003678 | |||
| 1797 | Ga0265320_10011997 | |||
| 1798 | Ga0265320_10080605 | |||
| 1799 | Ga0265320_10084941 | |||
| 1800 | Ga0265320_10185875 | |||
| 1801 | Ga0265320_10219421 | |||
| 1802 | Ga0265320_10229723 | |||
| 1803 | Ga0265320_10367674 | |||
| 1804 | Ga0265325_10001557 | |||
| 1805 | Ga0265325_10004103 | |||
| 1806 | Ga0265325_10005940 | |||
| 1807 | Ga0265325_10027823 | |||
| 1808 | Ga0265325_10194129 | |||
| 1809 | Ga0265329_10001143 | |||
| 1810 | Ga0265329_10025571 | |||
| 1811 | Ga0265329_10047227 | |||
| 1812 | Ga0265340_10004591 | |||
| 1813 | Ga0265340_10007530 | |||
| 1814 | Ga0265340_10019971 | |||
| 1815 | Ga0265340_10025222 | |||
| 1816 | Ga0265340_10052609 | |||
| 1817 | Ga0265340_10118413 | |||
| 1818 | Ga0265339_10003636 | |||
| 1819 | Ga0265339_10004406 | |||
| 1820 | Ga0265339_10066402 | |||
| 1821 | Ga0265339_10209138 | |||
| 1822 | Ga0265339_10554626 | |||
| 1823 | Ga0265331_10001038 | |||
| 1824 | Ga0265331_10328197 | |||
| 1825 | Ga0265331_10416425 | |||
| 1826 | Ga0265331_10518106 | |||
| 1827 | Ga0265327_10002648 | |||
| 1828 | Ga0265327_10008343 | |||
| 1829 | Ga0265327_10320443 | |||
| 1830 | Ga0265316_10003484 | |||
| 1831 | Ga0265316_10004394 | |||
| 1832 | Ga0265316_10006331 | |||
| 1833 | Ga0265316_10028996 | |||
| 1834 | Ga0265316_10066512 | |||
| 1835 | Ga0265316_10078133 | |||
| 1836 | Ga0265316_10079353 | |||
| 1837 | Ga0265316_10130069 | |||
| 1838 | Ga0265316_10142749 | |||
| 1839 | Ga0265316_10160516 | |||
| 1840 | Ga0265316_10200146 | |||
| 1841 | Ga0265316_10607919 | |||
| 1842 | Ga0265316_10632945 | |||
| 1843 | Ga0265316_10686117 | |||
| 1844 | Ga0265316_11124707 | |||
| 1845 | Ga0265313_10000945 | |||
| 1846 | Ga0265313_10003307 | |||
| 1847 | Ga0265313_10013437 | |||
| 1848 | Ga0265313_10015127 | |||
| 1849 | Ga0265313_10061673 | |||
| 1850 | Ga0265313_10069853 | |||
| 1851 | Ga0265314_10001204 | |||
| 1852 | Ga0265314_10058439 | |||
| 1853 | Ga0265314_10072895 | |||
| 1854 | Ga0265314_10078044 | |||
| 1855 | Ga0265314_10121129 | |||
| 1856 | Ga0265314_10252900 | |||
| 1857 | Ga0265342_10000219 | |||
| 1858 | Ga0265342_10006314 | |||
| 1859 | Ga0265342_10009671 | |||
| 1860 | Ga0265342_10018239 | |||
| 1861 | Ga0265342_10032556 | |||
| 1862 | Ga0265342_10042317 | |||
| 1863 | Ga0265342_10159956 | |||
| 1864 | Ga0307409_100051117 | |||
| 1865 | Ga0307409_101270328 | |||
| 1866 | Ga0307416_100807059 | |||
| 1867 | Ga0307416_101567512 | |||
| 1868 | Ga0373926_0035045 | |||
| 1869 | Ga0373926_0175219 | |||
| 1870 | Ga0373934_0033468 | |||
| 1871 | Ga0373944_0132193 | |||
| 1872 | Ga0373944_0395479 | |||
| 1873 | Ga0373923_0084353 | |||
| 1874 | Ga0373923_0120032 | |||
| 1875 | Ga0373936_0002702 | |||
| 1876 | Ga0373936_0082477 | |||
| 1877 | Ga0373936_0320152 | |||
| 1878 | Ga0373939_0417639 | |||
| 1879 | Ga0373953_0284072 | |||
| 1880 | Ga0373954_0062318 | |||
| 1881 | Ga0373954_0118256 | |||
| 1882 | Ga0373956_0289372 | |||
| 1883 | Ga0373956_0419727 | |||
| 1884 | Ga0373957_0060953 | |||
| 1885 | Ga0373957_0170364 | |||
| 1886 | Ga0373960_0006213 | |||
| 1887 | Ga0373943_0008803 | |||
| 1888 | Ga0373943_0067290 | |||
| 1889 | Ga0373943_0182752 | |||
| 1890 | Ga0373943_0296381 | |||
| 1891 | Ga0373943_0300417 | |||
| 1892 | Ga0373946_0019548 | |||
| 1893 | Ga0373946_0116268 | |||
| 1894 | Ga0373955_0053675 | |||
| 1895 | Ga0373955_0264788 | |||
| 1896 | Ga0373962_0095696 | |||
| 1897 | Ga0373931_0486795 | |||
| 1898 | Ga0373935_0006293 | |||
| 1899 | Ga0373935_0037578 | |||
| 1900 | Ga0373935_0147226 | |||
| 1901 | Ga0373935_0236664 | |||
| 1902 | Ga0373935_1015824 | |||
| 1903 | Ga0373927_0020828 | |||
| 1904 | Ga0373927_0049204 | |||
| 1905 | Ga0373927_0078242 | |||
| 1906 | Ga0373927_0475768 | |||
| 1907 | Ga0373927_1132874 | |||
| 1908 | Ga0373933_0000058 | |||
| 1909 | Ga0373933_0026651 | |||
| 1910 | Ga0373933_0264794 | |||
| 1911 | Ga0373947_0018181 | |||
| 1912 | Ga0373947_0018296 | |||
| 1913 | Ga0373947_0083697 | |||
| 1914 | Ga0373947_0260051 | |||
| 1915 | Ga0373947_0278910 | |||
| 1916 | Ga0373947_0401192 | |||
| 1917 | Ga0373947_0697419 | |||
| 1918 | Ga0373937_0000008 | |||
| 1919 | Ga0373937_0157358 | |||
| 1920 | Ga0373937_0227229 | |||
| 1921 | Ga0373937_0309923 | |||
| 1922 | Ga0373937_1022690 | |||
| 1923 | Ga0373937_1090025 | |||
| 1924 | Ga0373937_1323030 | |||
| 1925 | Ga0373937_1547096 | |||
| 1926 | Ga0373925_0005774 | |||
| 1927 | Ga0373925_0013923 | |||
| 1928 | Ga0373925_0017898 | |||
| 1929 | Ga0373925_0033781 | |||
| 1930 | Ga0373925_0057398 | |||
| 1931 | Ga0373925_0097392 | |||
| 1932 | Ga0373925_0208372 | |||
| 1933 | Ga0373925_0278103 | |||
| 1934 | Ga0373925_0284902 | |||
| 1935 | Ga0395900_0186273 | |||
| 1936 | Ga0395900_0308367 | |||
| 1937 | Ga0395900_1565074 | |||
| 1938 | Ga0395898_0101342 | |||
| 1939 | Ga0395905_0058193 | |||
| 1940 | Ga0395905_0161058 | |||
| 1941 | Ga0436364_0503746 | |||
| 1942 | Ga0436364_0713119 | |||
| 1943 | Ga0395901_0022807 | |||
| 1944 | Ga0395901_1022276 | |||
| 1945 | Ga0395901_1118825 | |||
| 1946 | Ga0395901_1130743 | |||
| 1947 | Ga0436365_0596749 | |||
| 1948 | Ga0436365_0660570 | |||
| 1949 | Ga0436360_0274844 | |||
| 1950 | Ga0436360_0428817 | |||
| 1951 | Ga0436360_0480910 | |||
| 1952 | Ga0436360_1072958 | |||
| 1953 | Ga0436361_0085950 | |||
| 1954 | Ga0436361_0234159 | |||
| 1955 | Ga0436361_0311977 | |||
| 1956 | Ga0436361_0365009 | |||
| 1957 | Ga0436361_1107455 | |||
| 1958 | Ga0436363_0061087 | |||
| 1959 | Ga0436363_1378733 | |||
| 1960 | Ga0436362_1173817 | |||
| 1961 | Ga0451839_1135551 | |||
| 1962 | Ga0451577_0000241 | |||
| 1963 | Ga0451577_0042149 | |||
| 1964 | Ga0451577_0916874 | |||
| 1965 | Ga0466972_0560089 | |||
| 1966 | Ga0453683_0013032 | |||
| 1967 | Ga0453683_0218397 | |||
| 1968 | Ga0466963_0280566 | |||
| 1969 | Ga0466963_0335600 | |||
| 1970 | Ga0466964_0024093 | |||
| 1971 | Ga0466964_0093278 | |||
| 1972 | Ga0453684_0000366 | |||
| 1973 | Ga0453684_0389644 | |||
| 1974 | Ga0466957_0165502 | |||
| 1975 | Ga0466959_0338365 | |||
| 1976 | Ga0451576_0013105 | |||
| 1977 | Ga0451576_0118234 | |||
| 1978 | Ga0451576_0353266 | |||
| 1979 | Ga0451576_0555111 | |||
| 1980 | Ga0451576_1300128 | |||
| 1981 | Ga0466967_0648168 | |||
| 1982 | Ga0466967_0757018 | |||
| 1983 | Ga0495592_0567087 | |||
| 1984 | Ga0495603_0202664 | |||
| 1985 | Ga0495590_0039548 | |||
| 1986 | Ga0495590_0179517 | |||
| 1987 | Ga0495629_0007545 | |||
| 1988 | Ga0495641_0066599 | |||
| 1989 | Ga0495651_0131206 | |||
| 1990 | Ga0495651_0134892 | |||
| 1991 | Ga0495651_0326210 | |||
| 1992 | Ga0495653_0515485 | |||
| 1993 | Ga0495653_0765050 | |||
| 1994 | Ga0495580_0000038 | |||
| 1995 | Ga0495580_0000970 | |||
| 1996 | Ga0495580_0001331 | |||
| 1997 | Ga0495580_0008880 | |||
| 1998 | Ga0495580_0010292 | |||
| 1999 | Ga0495580_0010572 | |||
| 2000 | Ga0495580_0011519 | |||
| 2001 | Ga0495580_0102909 | |||
| 2002 | Ga0495580_0287432 | |||
| 2003 | Ga0495580_0325001 | |||
| 2004 | Ga0495580_0439075 | |||
| 2005 | Ga0495580_0497555 | |||
| 2006 | Ga0495580_0548071 | |||
| 2007 | Ga0495580_1073933 | |||
| 2008 | Ga0495582_0004582 | |||
| 2009 | Ga0495582_0005852 | |||
| 2010 | Ga0495582_0120781 | |||
| 2011 | Ga0495582_0442767 | |||
| 2012 | Ga0495639_0058131 | |||
| 2013 | Ga0495639_0062297 | |||
| 2014 | Ga0495639_0152189 | |||
| 2015 | Ga0495639_0219026 | |||
| 2016 | Ga0495662_0218410 | |||
| 2017 | Ga0495664_0316845 | |||
| 2018 | Ga0495584_0531891 | |||
| 2019 | Ga0495594_0150539 | |||
| 2020 | Ga0495608_0101658 | |||
| 2021 | Ga0495608_0219676 | |||
| 2022 | Ga0495608_0257223 | |||
| 2023 | Ga0495628_0141981 | |||
| 2024 | Ga0495630_0006895 | |||
| 2025 | Ga0495630_0024679 | |||
| 2026 | Ga0495630_0073287 | |||
| 2027 | Ga0495630_0230567 | |||
| 2028 | Ga0495630_0263812 | |||
| 2029 | Ga0495630_0372776 | |||
| 2030 | Ga0495630_0450136 | |||
| 2031 | Ga0495630_0718286 | |||
| 2032 | Ga0495666_0082377 | |||
| 2033 | Ga0495652_0107767 | |||
| 2034 | Ga0495652_0162000 | |||
| 2035 | Ga0495652_0771646 | |||
| 2036 | Ga0495665_0007054 | |||
| 2037 | Ga0495665_0014261 | |||
| 2038 | Ga0495665_0353200 | |||
| 2039 | Ga0495665_0665389 | |||
| 2040 | Ga0495640_0487871 | |||
| 2041 | Ga0495586_0018720 | |||
| 2042 | Ga0495586_0443122 | |||
| 2043 | Ga0495586_0567564 | |||
| 2044 | Ga0495587_0000423 | |||
| 2045 | Ga0495587_0080020 | |||
| 2046 | Ga0495645_0364981 | |||
| 2047 | Ga0495645_0813237 | |||
| 2048 | Ga0495667_0425893 | |||
| 2049 | Ga0495635_0692717 | |||
| 2050 | Ga0495588_0248786 | |||
| 2051 | Ga0495657_0459608 | |||
| 2052 | Ga0495657_0480019 | |||
| 2053 | Ga0495599_0467508 | |||
| 2054 | Ga0495623_0009865 | |||
| 2055 | Ga0495658_0004737 | |||
| 2056 | Ga0495658_0004768 | |||
| 2057 | Ga0495658_0045434 | |||
| 2058 | Ga0495669_0238759 | |||
| 2059 | Ga0495613_0043783 | |||
| 2060 | Ga0495613_0224412 | |||
| 2061 | Ga0495624_0138659 | |||
| 2062 | Ga0495624_0234871 | |||
| 2063 | Ga0495624_0339443 | |||
| 2064 | Ga0495674_0150475 | |||
| 2065 | Ga0495674_0271250 | |||
| 2066 | Ga0495674_0298263 | |||
| 2067 | Ga0495674_0389798 | |||
| 2068 | Ga0495674_0798719 | |||
| 2069 | Ga0495676_0903476 | |||
| 2070 | Ga0495675_0030452 | |||
| 2071 | Ga0495684_0001583 | |||
| 2072 | Ga0495684_0355036 | |||
| 2073 | Ga0495684_0466043 | |||
| 2074 | Ga0495684_1090627 | |||
| 2075 | Ga0495593_0254453 | |||
| 2076 | Ga0495602_0000026 | |||
| 2077 | Ga0495602_0032590 | |||
| 2078 | Ga0495602_0382004 | |||
| 2079 | Ga0495614_0230448 | |||
| 2080 | Ga0496100_1497606 | |||
| 2081 | Ga0496101_0784020 | |||
| 2082 | Ga0496101_0955241 | |||
| 2083 | Ga0496102_0060962 | |||
| 2084 | Ga0496103_0076041 | |||
| 2085 | Ga0496104_0161978 | |||
| 2086 | Ga0496104_0401849 | |||
| 2087 | Ga0496105_0695435 | |||
| 2088 | Ga0496106_0422834 | |||
| 2089 | Ga0496106_1001351 | |||
| 2090 | Ga0496107_0139292 | |||
| 2091 | Ga0496107_0614913 | |||
| 2092 | Ga0496108_0044623 | |||
| 2093 | Ga0496108_0716807 | |||
| 2094 | Ga0496110_0026275 | |||
| 2095 | Ga0496111_0044118 | |||
| 2096 | Ga0496112_0015301 | |||
| 2097 | Ga0496112_0090422 | |||
| 2098 | Ga0496112_0123505 | |||
| 2099 | Ga0496112_0714532 | |||
| 2100 | Ga0496113_0158785 | |||
| 2101 | Ga0496113_0605264 | |||
| 2102 | Ga0496114_0680576 | |||
| 2103 | Ga0496115_0003221 | |||
| 2104 | Ga0496119_0444387 | |||
| 2105 | Ga0501033_0038382 | |||
| 2106 | Ga0501034_0221363 | |||
| 2107 | Ga0501080_0063443 | |||
| 2108 | nmdc:mga03683_33616_c1 | |||
| 2109 | nmdc:mga0yw44_231182_c1 | |||
| 2110 | nmdc:mga0yw44_782260_c1 | |||
| 2111 | nmdc:mga0k408_23503_c2 | |||
| 2112 | nmdc:mga06z11_210394_c1 | |||
| 2113 | nmdc:mga06z11_31825_c1 | |||
| 2114 | nmdc:mga0n895_1767718_c1 | |||
| 2115 | nmdc:mga0n895_2241_c1 | |||
| 2116 | nmdc:mga0n895_249_c1 | |||
| 2117 | nmdc:mga0n895_5529_c1 | |||
| 2118 | nmdc:mga0rr50_110_c2 | |||
| 2119 | nmdc:mga0rr50_18748_c1 | |||
| 2120 | nmdc:mga0rr50_446054_c1 | |||
| 2121 | nmdc:mga0rr50_461694_c1 | |||
| 2122 | nmdc:mga0rr50_599394_c1 | |||
| 2123 | nmdc:mga0rr50_9343_c1 | |||
| 2124 | nmdc:mga08x19_2015_c1 | |||
| 2125 | nmdc:mga08x19_2054_c1 | |||
| 2126 | nmdc:mga08x19_290469_c1 | |||
| 2127 | nmdc:mga08x19_663989_c1 | |||
| 2128 | nmdc:mga08x19_916339_c1 | |||
| 2129 | nmdc:mga08x19_93400_c1 | |||
| 2130 | nmdc:mga0a205_131_c1 | |||
| 2131 | nmdc:mga0a205_32965_c1 | |||
| 2132 | Ga0495601_0086974 | |||
| 2133 | Ga0495601_0825665 | |||
| 2134 | Ga0495619_0453961 | |||
| 2135 | Ga0587080_121393 | |||
| 2136 | Ga0587071_150359 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1mjh-assembly1.cif.gz_A | structure-based assignment of the biochemical function of hypothetical protein mj0577: a test case of structural genomics | 0.8399 | 1 | 138 |
| 3ab7-assembly3.cif.gz_B | crystal structure of the hypothetical tandem-type universal stress protein ttha0350 from thermus thermophilus hb8 | 0.8389 | 4 | 134 |
| 1mjh-assembly1.cif.gz_A | structure-based assignment of the biochemical function of hypothetical protein mj0577: a test case of structural genomics | 0.8348 | 1 | 138 |
| 3loq-assembly2.cif.gz_B | the crystal structure of a universal stress protein from archaeoglobus fulgidus dsm 4304 | 0.8278 | 3 | 136 |
| 3loq-assembly1.cif.gz_A | the crystal structure of a universal stress protein from archaeoglobus fulgidus dsm 4304 | 0.8273 | 3 | 136 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1mjhA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8399 | 1 | 138 | 3.40.50.620 |
| 1mjhA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8348 | 1 | 138 | 3.40.50.620 |
| 2pfsA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.823 | 2 | 137 | 3.40.50.620 |
| 3loqB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8206 | 3 | 134 | 3.40.50.620 |
| 3qtbA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.818 | 4 | 136 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q7V4S6-F1-model_v4 | UspA domain-containing protein | 1.002 | 1 | 95 |
|
| AF-A0A2V8ZVF2-F1-model_v4 | Universal stress protein | 0.9532 | 1 | 138 |
|
| AF-A0A1Q7V4S6-F1-model_v4 | UspA domain-containing protein | 0.9423 | 1 | 95 |
|
| AF-A0A2V9UPT1-F1-model_v4 | Universal stress protein | 0.9409 | 1 | 138 |
|
| AF-A0A2V9UPT1-F1-model_v4 | Universal stress protein | 0.9342 | 1 | 138 |
|