F489408
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1066 | 455 | 2132 | 145 |
Family's Representative Sequence
| Representative Sequence | 3300037471|Ga0395905_0198495|Ga0395905_0198495_324_767 |
| Length | 137 |
| Sequence | METLKPATTVWTRDAVPVERRDLWTALKRGFRCRCPRCGEGKLFRAFLKVDGHCPVCDLDFSHHRADDLPAYLVIVVVGHIVVPLALWIETNYSPPVWLQLSILLLQPIKGAVVGFQWAMRMHGFDENAPDDLPPIR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 2 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 8 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 77 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 81 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 82 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 86 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 87 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 90 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 91 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 92 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 98 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 99 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 100 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 101 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 133 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 134 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 201 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 202 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 203 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 210 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 211 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 212 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 214 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 215 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 216 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 217 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 218 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 219 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 220 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 221 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 223 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 224 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 225 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 226 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 227 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 228 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 229 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 230 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 231 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 232 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 233 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 234 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 235 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 236 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 237 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 238 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 239 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 240 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 241 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 242 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 243 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 244 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 245 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 246 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 247 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 248 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 249 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 250 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 251 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 252 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 253 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 254 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 255 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 257 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 259 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 260 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 261 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 262 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 263 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 264 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 265 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 266 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 267 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 268 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 269 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 270 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 271 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 272 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 273 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 274 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 275 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 276 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 277 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 278 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 279 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 356 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 357 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 358 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 359 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 360 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 361 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 364 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 365 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 366 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 367 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 368 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 369 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 370 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 371 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 372 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 373 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 374 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 375 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 376 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 391 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 392 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 393 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 394 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 395 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 396 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 397 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 398 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 404 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 410 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 411 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 412 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 413 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 414 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 415 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 416 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 417 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 418 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 419 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 420 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 421 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 422 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 423 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 424 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 425 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 426 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 427 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 428 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 429 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 430 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 431 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 432 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 433 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 434 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 435 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 436 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 437 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 438 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 439 | 2791355199 | |||
| 440 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 441 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 442 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 443 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 444 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 445 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 446 | 2904699407 | |||
| 447 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 448 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 449 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 450 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 451 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 452 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 453 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 454 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 455 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.74 |
| Metatranscriptomes | 0.28 |
| Isolates | 1.97 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.26 |
| Nodule | 1.88 |
| Rhizoplane | 8.72 |
| Rhizosphere | 75.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395905_0198495 | 3300037471 | Bacteria | 1881 |
| 2 | CNAas_1008573 | 3300000532 | Bacteria | 671 |
| 3 | CNAas_1011860 | 3300000532 | Bacteria | 593 |
| 4 | JGI24737J22298_10181753 | 3300001990 | Bacteria | 621 |
| 5 | JGI24034J26672_10095210 | 3300002239 | Bacteria | 556 |
| 6 | JGI24742J22300_10014608 | 3300002244 | Bacteria | 1319 |
| 7 | JGI25406J46586_10002914 | 3300003203 | Bacteria | 8066 |
| 8 | JGI25404J52841_10009700 | 3300003659 | Bacteria | 2062 |
| 9 | JGI25404J52841_10011183 | 3300003659 | Bacteria | 1933 |
| 10 | JGI25404J52841_10019955 | 3300003659 | Bacteria | 1452 |
| 11 | JGI25404J52841_10022525 | 3300003659 | Bacteria | 1361 |
| 12 | JGI25404J52841_10027405 | 3300003659 | Bacteria | 1225 |
| 13 | JGI25404J52841_10038178 | 3300003659 | Bacteria | 1019 |
| 14 | JGI25404J52841_10068562 | 3300003659 | Bacteria | 742 |
| 15 | Ga0055539_1005103 | 3300003752 | Bacteria | 1717 |
| 16 | Ga0070658_10535292 | 3300005327 | Bacteria | 1013 |
| 17 | Ga0070658_10654213 | 3300005327 | Bacteria | 912 |
| 18 | Ga0070658_10751728 | 3300005327 | Bacteria | 847 |
| 19 | Ga0070658_11014032 | 3300005327 | Bacteria | 722 |
| 20 | Ga0070676_10092030 | 3300005328 | Bacteria | 1859 |
| 21 | Ga0070683_100056257 | 3300005329 | Bacteria | 3653 |
| 22 | Ga0070683_100497299 | 3300005329 | Bacteria | 1165 |
| 23 | Ga0070683_101524254 | 3300005329 | Bacteria | 643 |
| 24 | Ga0070670_100292139 | 3300005331 | Bacteria | 1425 |
| 25 | Ga0070670_100485429 | 3300005331 | Bacteria | 1097 |
| 26 | Ga0070670_100751096 | 3300005331 | Bacteria | 879 |
| 27 | Ga0070670_100914655 | 3300005331 | Bacteria | 796 |
| 28 | Ga0070670_101986963 | 3300005331 | Bacteria | 536 |
| 29 | Ga0068869_100110081 | 3300005334 | Bacteria | 2094 |
| 30 | Ga0068869_100469046 | 3300005334 | Bacteria | 1046 |
| 31 | Ga0070666_10153346 | 3300005335 | Bacteria | 1608 |
| 32 | Ga0070680_100093870 | 3300005336 | Bacteria | 2486 |
| 33 | Ga0070680_100102187 | 3300005336 | Bacteria | 2380 |
| 34 | Ga0070680_100166453 | 3300005336 | Bacteria | 1854 |
| 35 | Ga0070680_100324123 | 3300005336 | Bacteria | 1308 |
| 36 | Ga0070680_100565829 | 3300005336 | Bacteria | 975 |
| 37 | Ga0070680_100822473 | 3300005336 | Bacteria | 800 |
| 38 | Ga0070680_101145347 | 3300005336 | Bacteria | 672 |
| 39 | Ga0070682_100179736 | 3300005337 | Bacteria | 1477 |
| 40 | Ga0070682_100513659 | 3300005337 | Bacteria | 931 |
| 41 | Ga0068868_101009242 | 3300005338 | Bacteria | 762 |
| 42 | Ga0068868_101467993 | 3300005338 | Bacteria | 638 |
| 43 | Ga0070660_100037295 | 3300005339 | Bacteria | 3685 |
| 44 | Ga0070660_100123482 | 3300005339 | Bacteria | 2067 |
| 45 | Ga0070689_100565065 | 3300005340 | Bacteria | 981 |
| 46 | Ga0070687_101319858 | 3300005343 | Bacteria | 536 |
| 47 | Ga0070661_100087661 | 3300005344 | Bacteria | 2303 |
| 48 | Ga0070661_100161593 | 3300005344 | Bacteria | 1697 |
| 49 | Ga0070661_101180869 | 3300005344 | Bacteria | 639 |
| 50 | Ga0070668_100012717 | 3300005347 | Bacteria | 6265 |
| 51 | Ga0070668_100019325 | 3300005347 | Bacteria | 5127 |
| 52 | Ga0070668_100048293 | 3300005347 | Bacteria | 3273 |
| 53 | Ga0070668_100677829 | 3300005347 | Bacteria | 908 |
| 54 | Ga0070668_100724821 | 3300005347 | Bacteria | 878 |
| 55 | Ga0070668_100782668 | 3300005347 | Bacteria | 846 |
| 56 | Ga0070669_100259764 | 3300005353 | Bacteria | 1385 |
| 57 | Ga0070675_100452240 | 3300005354 | Bacteria | 1152 |
| 58 | Ga0070675_101025269 | 3300005354 | Bacteria | 758 |
| 59 | Ga0070675_101456174 | 3300005354 | Bacteria | 632 |
| 60 | Ga0070671_100295162 | 3300005355 | Bacteria | 1380 |
| 61 | Ga0070671_100404794 | 3300005355 | Bacteria | 1167 |
| 62 | Ga0070671_100735591 | 3300005355 | Bacteria | 857 |
| 63 | Ga0070671_101103290 | 3300005355 | Bacteria | 697 |
| 64 | Ga0070674_100082336 | 3300005356 | Bacteria | 2302 |
| 65 | Ga0070674_100230978 | 3300005356 | Bacteria | 1444 |
| 66 | Ga0070673_100867830 | 3300005364 | Bacteria | 836 |
| 67 | Ga0070688_100968853 | 3300005365 | Bacteria | 674 |
| 68 | Ga0070659_100053186 | 3300005366 | Bacteria | 3186 |
| 69 | Ga0070659_100064801 | 3300005366 | Bacteria | 2893 |
| 70 | Ga0070659_100082245 | 3300005366 | Bacteria | 2573 |
| 71 | Ga0070667_100204545 | 3300005367 | Bacteria | 1753 |
| 72 | Ga0070709_10000143 | 3300005434 | Bacteria | 47770 |
| 73 | Ga0070709_10091382 | 3300005434 | Bacteria | 2009 |
| 74 | Ga0070709_10244805 | 3300005434 | Bacteria | 1289 |
| 75 | Ga0070709_10280025 | 3300005434 | Bacteria | 1211 |
| 76 | Ga0070714_100106966 | 3300005435 | Bacteria | 2472 |
| 77 | Ga0070714_100190761 | 3300005435 | Bacteria | 1870 |
| 78 | Ga0070714_100219183 | 3300005435 | Bacteria | 1748 |
| 79 | Ga0070713_100055014 | 3300005436 | Bacteria | 3305 |
| 80 | Ga0070713_100265572 | 3300005436 | Bacteria | 1570 |
| 81 | Ga0070713_100876024 | 3300005436 | Bacteria | 863 |
| 82 | Ga0070713_101593956 | 3300005436 | Bacteria | 634 |
| 83 | Ga0070710_10000126 | 3300005437 | Bacteria | 35287 |
| 84 | Ga0070710_10046166 | 3300005437 | Bacteria | 2425 |
| 85 | Ga0070701_10660962 | 3300005438 | Bacteria | 699 |
| 86 | Ga0070711_100000463 | 3300005439 | Bacteria | 21241 |
| 87 | Ga0070711_100644148 | 3300005439 | Bacteria | 888 |
| 88 | Ga0070711_101033908 | 3300005439 | Bacteria | 706 |
| 89 | Ga0070705_100351914 | 3300005440 | Bacteria | 1074 |
| 90 | Ga0070700_100180839 | 3300005441 | Bacteria | 1467 |
| 91 | Ga0070663_100022805 | 3300005455 | Bacteria | 4188 |
| 92 | Ga0070663_100064259 | 3300005455 | Bacteria | 2652 |
| 93 | Ga0070663_100594835 | 3300005455 | Bacteria | 930 |
| 94 | Ga0070678_100025097 | 3300005456 | Bacteria | 4004 |
| 95 | Ga0070678_100307297 | 3300005456 | Bacteria | 1350 |
| 96 | Ga0070678_100415125 | 3300005456 | Bacteria | 1172 |
| 97 | Ga0070678_100460254 | 3300005456 | Bacteria | 1116 |
| 98 | Ga0070678_100760775 | 3300005456 | Bacteria | 877 |
| 99 | Ga0070678_101785449 | 3300005456 | Bacteria | 580 |
| 100 | Ga0070662_100064919 | 3300005457 | Bacteria | 2674 |
| 101 | Ga0070662_100275192 | 3300005457 | Bacteria | 1361 |
| 102 | Ga0070662_100506371 | 3300005457 | Bacteria | 1007 |
| 103 | Ga0070681_10044250 | 3300005458 | Bacteria | 4455 |
| 104 | Ga0070681_10212397 | 3300005458 | Bacteria | 1851 |
| 105 | Ga0070681_10931728 | 3300005458 | Bacteria | 787 |
| 106 | Ga0068867_100286433 | 3300005459 | Bacteria | 1353 |
| 107 | Ga0068867_100583325 | 3300005459 | Bacteria | 973 |
| 108 | Ga0068867_101361880 | 3300005459 | Bacteria | 657 |
| 109 | Ga0070685_10395224 | 3300005466 | Bacteria | 956 |
| 110 | Ga0070685_11511271 | 3300005466 | Bacteria | 518 |
| 111 | Ga0070698_101170920 | 3300005471 | Bacteria | 718 |
| 112 | Ga0070699_101030680 | 3300005518 | Bacteria | 755 |
| 113 | Ga0070679_100058733 | 3300005530 | Bacteria | 3833 |
| 114 | Ga0070679_100100749 | 3300005530 | Bacteria | 2874 |
| 115 | Ga0070679_101167199 | 3300005530 | Bacteria | 715 |
| 116 | Ga0070679_101186594 | 3300005530 | Bacteria | 708 |
| 117 | Ga0070684_100150760 | 3300005535 | Bacteria | 2106 |
| 118 | Ga0070684_100254351 | 3300005535 | Bacteria | 1606 |
| 119 | Ga0070684_102268720 | 3300005535 | Bacteria | 512 |
| 120 | Ga0070697_100543921 | 3300005536 | Bacteria | 1018 |
| 121 | Ga0070697_100881427 | 3300005536 | Bacteria | 793 |
| 122 | Ga0068853_100015603 | 3300005539 | Bacteria | 6241 |
| 123 | Ga0068853_100155656 | 3300005539 | Bacteria | 2059 |
| 124 | Ga0068853_100194126 | 3300005539 | Bacteria | 1845 |
| 125 | Ga0068853_100423657 | 3300005539 | Bacteria | 1248 |
| 126 | Ga0068853_100544713 | 3300005539 | Bacteria | 1099 |
| 127 | Ga0068853_101267347 | 3300005539 | Bacteria | 712 |
| 128 | Ga0070672_100289320 | 3300005543 | Bacteria | 1387 |
| 129 | Ga0070672_100389058 | 3300005543 | Bacteria | 1194 |
| 130 | Ga0070695_100995485 | 3300005545 | Bacteria | 682 |
| 131 | Ga0070696_100257698 | 3300005546 | Bacteria | 1321 |
| 132 | Ga0070693_100538829 | 3300005547 | Bacteria | 834 |
| 133 | Ga0070693_100591744 | 3300005547 | Bacteria | 800 |
| 134 | Ga0070665_100023461 | 3300005548 | Bacteria | 6212 |
| 135 | Ga0070665_100034539 | 3300005548 | Bacteria | 5085 |
| 136 | Ga0070665_100056491 | 3300005548 | Bacteria | 3935 |
| 137 | Ga0070665_100104701 | 3300005548 | Bacteria | 2831 |
| 138 | Ga0070665_100228565 | 3300005548 | Bacteria | 1860 |
| 139 | Ga0070665_100320401 | 3300005548 | Bacteria | 1554 |
| 140 | Ga0070665_100344844 | 3300005548 | Bacteria | 1494 |
| 141 | Ga0070665_100713635 | 3300005548 | Bacteria | 1016 |
| 142 | Ga0070665_100794010 | 3300005548 | Bacteria | 960 |
| 143 | Ga0070704_100187016 | 3300005549 | Bacteria | 1662 |
| 144 | Ga0070704_100319955 | 3300005549 | Bacteria | 1299 |
| 145 | Ga0068855_100048315 | 3300005563 | Bacteria | 5023 |
| 146 | Ga0068855_100056614 | 3300005563 | Bacteria | 4600 |
| 147 | Ga0068855_100065375 | 3300005563 | Bacteria | 4240 |
| 148 | Ga0068855_100231300 | 3300005563 | Bacteria | 2070 |
| 149 | Ga0068855_100794017 | 3300005563 | Bacteria | 1007 |
| 150 | Ga0070664_100599483 | 3300005564 | Bacteria | 1021 |
| 151 | Ga0070664_100907533 | 3300005564 | Bacteria | 826 |
| 152 | Ga0070664_100932861 | 3300005564 | Bacteria | 814 |
| 153 | Ga0068857_100386097 | 3300005577 | Bacteria | 1301 |
| 154 | Ga0068857_101435290 | 3300005577 | Bacteria | 672 |
| 155 | Ga0068854_100132358 | 3300005578 | Bacteria | 1905 |
| 156 | Ga0068854_100612229 | 3300005578 | Bacteria | 931 |
| 157 | Ga0068856_100000427 | 3300005614 | Bacteria | 46259 |
| 158 | Ga0068856_100122370 | 3300005614 | Bacteria | 2604 |
| 159 | Ga0068856_100156423 | 3300005614 | Bacteria | 2289 |
| 160 | Ga0068856_100507765 | 3300005614 | Bacteria | 1227 |
| 161 | Ga0068856_102105598 | 3300005614 | Bacteria | 574 |
| 162 | Ga0070702_100563841 | 3300005615 | Bacteria | 848 |
| 163 | Ga0070702_101409144 | 3300005615 | Bacteria | 570 |
| 164 | Ga0070702_101657630 | 3300005615 | Bacteria | 530 |
| 165 | Ga0068852_100060980 | 3300005616 | Bacteria | 3276 |
| 166 | Ga0068852_100209157 | 3300005616 | Bacteria | 1850 |
| 167 | Ga0068852_100231666 | 3300005616 | Bacteria | 1761 |
| 168 | Ga0068852_100237706 | 3300005616 | Bacteria | 1739 |
| 169 | Ga0068859_100088802 | 3300005617 | Bacteria | 3140 |
| 170 | Ga0068859_100218683 | 3300005617 | Bacteria | 1992 |
| 171 | Ga0068859_100246254 | 3300005617 | Bacteria | 1877 |
| 172 | Ga0068864_100034773 | 3300005618 | Bacteria | 4287 |
| 173 | Ga0068864_100078375 | 3300005618 | Bacteria | 2891 |
| 174 | Ga0068864_100146361 | 3300005618 | Bacteria | 2136 |
| 175 | Ga0068866_10096442 | 3300005718 | Bacteria | 1622 |
| 176 | Ga0068861_100169895 | 3300005719 | Bacteria | 1806 |
| 177 | Ga0068861_100222058 | 3300005719 | Bacteria | 1597 |
| 178 | Ga0068861_100267518 | 3300005719 | Bacteria | 1466 |
| 179 | Ga0068861_100732969 | 3300005719 | Bacteria | 921 |
| 180 | Ga0068851_10161264 | 3300005834 | Bacteria | 1232 |
| 181 | Ga0068851_10590584 | 3300005834 | Bacteria | 675 |
| 182 | Ga0068870_10306939 | 3300005840 | Bacteria | 1004 |
| 183 | Ga0068863_100448276 | 3300005841 | Bacteria | 1266 |
| 184 | Ga0068863_101241014 | 3300005841 | Bacteria | 752 |
| 185 | Ga0068858_100104527 | 3300005842 | Bacteria | 2642 |
| 186 | Ga0068858_100479126 | 3300005842 | Bacteria | 1201 |
| 187 | Ga0068858_100826228 | 3300005842 | Bacteria | 904 |
| 188 | Ga0068858_100933894 | 3300005842 | Bacteria | 849 |
| 189 | Ga0068860_100039809 | 3300005843 | Bacteria | 4495 |
| 190 | Ga0068860_100238512 | 3300005843 | Bacteria | 1768 |
| 191 | Ga0068860_100389723 | 3300005843 | Bacteria | 1376 |
| 192 | Ga0068860_100978554 | 3300005843 | Bacteria | 863 |
| 193 | Ga0068862_100117428 | 3300005844 | Bacteria | 2341 |
| 194 | Ga0068862_100122280 | 3300005844 | Bacteria | 2295 |
| 195 | Ga0068862_100533383 | 3300005844 | Bacteria | 1119 |
| 196 | Ga0068862_100656072 | 3300005844 | Bacteria | 1012 |
| 197 | Ga0068862_101536656 | 3300005844 | Bacteria | 672 |
| 198 | Ga0081455_10009802 | 3300005937 | Bacteria | 9811 |
| 199 | Ga0081455_10035912 | 3300005937 | Bacteria | 4420 |
| 200 | Ga0081455_10068093 | 3300005937 | Bacteria | 2965 |
| 201 | Ga0081455_10846876 | 3300005937 | Bacteria | 571 |
| 202 | Ga0081538_10057136 | 3300005981 | Bacteria | 2278 |
| 203 | Ga0081540_1000916 | 3300005983 | Bacteria | 26580 |
| 204 | Ga0081540_1001429 | 3300005983 | Bacteria | 20644 |
| 205 | Ga0081540_1001739 | 3300005983 | Bacteria | 18329 |
| 206 | Ga0081540_1004038 | 3300005983 | Bacteria | 11365 |
| 207 | Ga0081540_1006441 | 3300005983 | Bacteria | 8545 |
| 208 | Ga0081540_1007634 | 3300005983 | Bacteria | 7676 |
| 209 | Ga0081540_1013100 | 3300005983 | Bacteria | 5415 |
| 210 | Ga0081540_1016574 | 3300005983 | Bacteria | 4603 |
| 211 | Ga0081540_1017602 | 3300005983 | Bacteria | 4416 |
| 212 | Ga0081540_1021438 | 3300005983 | Bacteria | 3846 |
| 213 | Ga0081540_1052437 | 3300005983 | Bacteria | 2008 |
| 214 | Ga0081540_1062891 | 3300005983 | Bacteria | 1760 |
| 215 | Ga0081540_1078529 | 3300005983 | Bacteria | 1496 |
| 216 | Ga0081540_1096268 | 3300005983 | Bacteria | 1288 |
| 217 | Ga0081540_1143362 | 3300005983 | Bacteria | 955 |
| 218 | Ga0081540_1263752 | 3300005983 | Bacteria | 598 |
| 219 | Ga0081539_10000231 | 3300005985 | Bacteria | 131197 |
| 220 | Ga0081539_10020178 | 3300005985 | Bacteria | 4520 |
| 221 | Ga0081539_10128908 | 3300005985 | Bacteria | 1245 |
| 222 | Ga0070717_10026354 | 3300006028 | Bacteria | 4636 |
| 223 | Ga0070717_10598941 | 3300006028 | Bacteria | 1000 |
| 224 | Ga0070717_10843871 | 3300006028 | Bacteria | 834 |
| 225 | Ga0070717_11316189 | 3300006028 | Bacteria | 657 |
| 226 | Ga0075365_10071063 | 3300006038 | Bacteria | 2342 |
| 227 | Ga0075365_10156648 | 3300006038 | Bacteria | 1585 |
| 228 | Ga0075365_10157775 | 3300006038 | Bacteria | 1580 |
| 229 | Ga0075365_10160253 | 3300006038 | Bacteria | 1567 |
| 230 | Ga0075365_10191316 | 3300006038 | Bacteria | 1432 |
| 231 | Ga0075365_10852766 | 3300006038 | Bacteria | 643 |
| 232 | Ga0075365_10859929 | 3300006038 | Bacteria | 640 |
| 233 | Ga0075368_10094462 | 3300006042 | Bacteria | 1225 |
| 234 | Ga0075368_10107625 | 3300006042 | Bacteria | 1148 |
| 235 | Ga0075368_10201380 | 3300006042 | Bacteria | 842 |
| 236 | Ga0075363_100002264 | 3300006048 | Bacteria | 7796 |
| 237 | Ga0075363_100086237 | 3300006048 | Bacteria | 1723 |
| 238 | Ga0075363_100209882 | 3300006048 | Bacteria | 1114 |
| 239 | Ga0075363_100688632 | 3300006048 | Bacteria | 617 |
| 240 | Ga0075364_10067002 | 3300006051 | Bacteria | 2359 |
| 241 | Ga0075364_10103567 | 3300006051 | Bacteria | 1895 |
| 242 | Ga0075364_10417588 | 3300006051 | Bacteria | 916 |
| 243 | Ga0070716_100004225 | 3300006173 | Bacteria | 6838 |
| 244 | Ga0070716_100285528 | 3300006173 | Bacteria | 1141 |
| 245 | Ga0070712_100138198 | 3300006175 | Bacteria | 1856 |
| 246 | Ga0070712_100243493 | 3300006175 | Bacteria | 1433 |
| 247 | Ga0070712_100399642 | 3300006175 | Bacteria | 1135 |
| 248 | Ga0075367_10014174 | 3300006178 | Bacteria | 4309 |
| 249 | Ga0075367_10193433 | 3300006178 | Bacteria | 1270 |
| 250 | Ga0075367_10205611 | 3300006178 | Bacteria | 1230 |
| 251 | Ga0075367_10241716 | 3300006178 | Bacteria | 1131 |
| 252 | Ga0075369_10014506 | 3300006186 | Bacteria | 3148 |
| 253 | Ga0075369_10153085 | 3300006186 | Bacteria | 1055 |
| 254 | Ga0075366_10229302 | 3300006195 | Bacteria | 1131 |
| 255 | Ga0075366_10397977 | 3300006195 | Bacteria | 848 |
| 256 | Ga0097621_100481468 | 3300006237 | Bacteria | 1122 |
| 257 | Ga0097621_101046603 | 3300006237 | Bacteria | 765 |
| 258 | Ga0075370_10014665 | 3300006353 | Bacteria | 4184 |
| 259 | Ga0075370_10094128 | 3300006353 | Bacteria | 1730 |
| 260 | Ga0075370_10112537 | 3300006353 | Bacteria | 1581 |
| 261 | Ga0068871_100277335 | 3300006358 | Bacteria | 1466 |
| 262 | Ga0068871_100515253 | 3300006358 | Bacteria | 1079 |
| 263 | Ga0068871_100589021 | 3300006358 | Bacteria | 1010 |
| 264 | Ga0068871_101487307 | 3300006358 | Bacteria | 640 |
| 265 | Ga0075428_100954375 | 3300006844 | Bacteria | 908 |
| 266 | Ga0075428_102558670 | 3300006844 | Bacteria | 522 |
| 267 | Ga0075433_10482408 | 3300006852 | Bacteria | 1092 |
| 268 | Ga0075434_100036482 | 3300006871 | Bacteria | 4863 |
| 269 | Ga0075434_100168254 | 3300006871 | Bacteria | 2212 |
| 270 | Ga0075434_100264985 | 3300006871 | Bacteria | 1737 |
| 271 | Ga0075429_100664731 | 3300006880 | Bacteria | 913 |
| 272 | Ga0068865_100129407 | 3300006881 | Bacteria | 1889 |
| 273 | Ga0068865_100401667 | 3300006881 | Bacteria | 1122 |
| 274 | Ga0068865_100929633 | 3300006881 | Bacteria | 758 |
| 275 | Ga0097620_100088808 | 3300006931 | Bacteria | 3140 |
| 276 | Ga0097620_100218675 | 3300006931 | Bacteria | 1992 |
| 277 | Ga0097620_100246244 | 3300006931 | Bacteria | 1877 |
| 278 | Ga0099824_1006719 | 3300006942 | Bacteria | 15641 |
| 279 | Ga0099822_1001392 | 3300006943 | Bacteria | 27954 |
| 280 | Ga0075435_100249144 | 3300007076 | Bacteria | 1512 |
| 281 | Ga0075435_100547895 | 3300007076 | Bacteria | 1001 |
| 282 | Ga0099794_10041335 | 3300007265 | Bacteria | 2196 |
| 283 | Ga0099794_10199515 | 3300007265 | Bacteria | 1024 |
| 284 | Ga0099794_10212188 | 3300007265 | Bacteria | 993 |
| 285 | Ga0105251_10121295 | 3300009011 | Bacteria | 1187 |
| 286 | Ga0105250_10054913 | 3300009092 | Bacteria | 1598 |
| 287 | Ga0105240_10153061 | 3300009093 | Bacteria | 2745 |
| 288 | Ga0105240_10260454 | 3300009093 | Bacteria | 2001 |
| 289 | Ga0111539_10960135 | 3300009094 | Bacteria | 994 |
| 290 | Ga0111539_11392682 | 3300009094 | Bacteria | 813 |
| 291 | Ga0105245_10109800 | 3300009098 | Bacteria | 2564 |
| 292 | Ga0105245_10486099 | 3300009098 | Bacteria | 1249 |
| 293 | Ga0105245_11662856 | 3300009098 | Bacteria | 690 |
| 294 | Ga0105247_10120706 | 3300009101 | Bacteria | 1698 |
| 295 | Ga0105247_10166203 | 3300009101 | Bacteria | 1464 |
| 296 | Ga0105247_10513644 | 3300009101 | Bacteria | 875 |
| 297 | Ga0105247_10600905 | 3300009101 | Bacteria | 816 |
| 298 | Ga0114129_12412544 | 3300009147 | Bacteria | 630 |
| 299 | Ga0105243_10469697 | 3300009148 | Bacteria | 1185 |
| 300 | Ga0105243_10564963 | 3300009148 | Bacteria | 1089 |
| 301 | Ga0105241_10636537 | 3300009174 | Bacteria | 967 |
| 302 | Ga0105242_10862240 | 3300009176 | Bacteria | 902 |
| 303 | Ga0105242_10936342 | 3300009176 | Bacteria | 869 |
| 304 | Ga0105248_10153172 | 3300009177 | Bacteria | 2601 |
| 305 | Ga0105248_10376827 | 3300009177 | Bacteria | 1597 |
| 306 | Ga0105248_11238695 | 3300009177 | Bacteria | 844 |
| 307 | Ga0105237_10026637 | 3300009545 | Bacteria | 5908 |
| 308 | Ga0105237_10036735 | 3300009545 | Bacteria | 4956 |
| 309 | Ga0105237_10127734 | 3300009545 | Bacteria | 2536 |
| 310 | Ga0105237_10198680 | 3300009545 | Bacteria | 2005 |
| 311 | Ga0105237_10387809 | 3300009545 | Bacteria | 1402 |
| 312 | Ga0105238_10009508 | 3300009551 | Bacteria | 9729 |
| 313 | Ga0105238_10073725 | 3300009551 | Bacteria | 3407 |
| 314 | Ga0105238_10460573 | 3300009551 | Bacteria | 1269 |
| 315 | Ga0105238_10571990 | 3300009551 | Bacteria | 1136 |
| 316 | Ga0105238_10680673 | 3300009551 | Bacteria | 1040 |
| 317 | Ga0105238_11467620 | 3300009551 | Bacteria | 710 |
| 318 | Ga0105249_10021352 | 3300009553 | Bacteria | 5797 |
| 319 | Ga0105249_10318665 | 3300009553 | Bacteria | 1565 |
| 320 | Ga0105249_10431874 | 3300009553 | Bacteria | 1353 |
| 321 | Ga0105249_12075099 | 3300009553 | Bacteria | 641 |
| 322 | Ga0099796_10059578 | 3300010159 | Bacteria | 1349 |
| 323 | Ga0105239_10091118 | 3300010375 | Bacteria | 3364 |
| 324 | Ga0105239_10257165 | 3300010375 | Bacteria | 1962 |
| 325 | Ga0105239_10546566 | 3300010375 | Bacteria | 1319 |
| 326 | Ga0105239_10608557 | 3300010375 | Bacteria | 1247 |
| 327 | Ga0105239_11023836 | 3300010375 | Bacteria | 950 |
| 328 | Ga0105239_11238901 | 3300010375 | Bacteria | 860 |
| 329 | Ga0105239_12162129 | 3300010375 | Bacteria | 647 |
| 330 | Ga0105246_10173385 | 3300011119 | Bacteria | 1654 |
| 331 | Ga0105246_10179878 | 3300011119 | Bacteria | 1627 |
| 332 | Ga0105246_10258415 | 3300011119 | Bacteria | 1386 |
| 333 | Ga0105246_10347559 | 3300011119 | Bacteria | 1214 |
| 334 | Ga0105246_10535679 | 3300011119 | Bacteria | 1001 |
| 335 | Ga0157370_10169682 | 3300013104 | Bacteria | 2029 |
| 336 | Ga0157370_10602529 | 3300013104 | Bacteria | 1006 |
| 337 | Ga0157370_10952307 | 3300013104 | Bacteria | 778 |
| 338 | Ga0157369_10006177 | 3300013105 | Bacteria | 13901 |
| 339 | Ga0157369_10252068 | 3300013105 | Bacteria | 1842 |
| 340 | Ga0157369_10761890 | 3300013105 | Bacteria | 995 |
| 341 | Ga0157369_10951797 | 3300013105 | Bacteria | 880 |
| 342 | Ga0157369_11260805 | 3300013105 | Bacteria | 754 |
| 343 | Ga0157374_10017157 | 3300013296 | Bacteria | 6373 |
| 344 | Ga0157374_10223801 | 3300013296 | Bacteria | 1847 |
| 345 | Ga0157374_10871080 | 3300013296 | Bacteria | 918 |
| 346 | Ga0157374_11374465 | 3300013296 | Bacteria | 729 |
| 347 | Ga0157378_10009614 | 3300013297 | Bacteria | 8418 |
| 348 | Ga0157378_10558617 | 3300013297 | Bacteria | 1151 |
| 349 | Ga0157378_11092476 | 3300013297 | Bacteria | 834 |
| 350 | Ga0157378_11779650 | 3300013297 | Bacteria | 664 |
| 351 | Ga0163162_10043529 | 3300013306 | Bacteria | 4496 |
| 352 | Ga0163162_10145032 | 3300013306 | Bacteria | 2489 |
| 353 | Ga0163162_10212666 | 3300013306 | Bacteria | 2064 |
| 354 | Ga0163162_10448645 | 3300013306 | Bacteria | 1422 |
| 355 | Ga0163162_10513695 | 3300013306 | Bacteria | 1328 |
| 356 | Ga0163162_10841669 | 3300013306 | Bacteria | 1033 |
| 357 | Ga0163162_11403987 | 3300013306 | Bacteria | 794 |
| 358 | Ga0163162_11430050 | 3300013306 | Bacteria | 787 |
| 359 | Ga0163162_11579615 | 3300013306 | Bacteria | 748 |
| 360 | Ga0163162_11738738 | 3300013306 | Bacteria | 712 |
| 361 | Ga0163162_11901254 | 3300013306 | Bacteria | 681 |
| 362 | Ga0157372_10575187 | 3300013307 | Bacteria | 1313 |
| 363 | Ga0157375_10127707 | 3300013308 | Bacteria | 2659 |
| 364 | Ga0157375_10724973 | 3300013308 | Bacteria | 1147 |
| 365 | Ga0157375_10966367 | 3300013308 | Bacteria | 993 |
| 366 | Ga0157375_11869152 | 3300013308 | Bacteria | 712 |
| 367 | Ga0163163_10020151 | 3300014325 | Bacteria | 6277 |
| 368 | Ga0163163_10056573 | 3300014325 | Bacteria | 3877 |
| 369 | Ga0163163_10132991 | 3300014325 | Bacteria | 2527 |
| 370 | Ga0163163_10237128 | 3300014325 | Bacteria | 1873 |
| 371 | Ga0163163_10240206 | 3300014325 | Bacteria | 1861 |
| 372 | Ga0157380_10448674 | 3300014326 | Bacteria | 1238 |
| 373 | Ga0157380_10971818 | 3300014326 | Bacteria | 881 |
| 374 | Ga0157377_10050237 | 3300014745 | Bacteria | 2347 |
| 375 | Ga0157377_10115590 | 3300014745 | Bacteria | 1619 |
| 376 | Ga0157377_10417613 | 3300014745 | Bacteria | 918 |
| 377 | Ga0157377_10565370 | 3300014745 | Bacteria | 806 |
| 378 | Ga0157379_10028544 | 3300014968 | Bacteria | 4962 |
| 379 | Ga0157379_10554796 | 3300014968 | Bacteria | 1069 |
| 380 | Ga0157379_10749570 | 3300014968 | Bacteria | 919 |
| 381 | Ga0157376_10158981 | 3300014969 | Bacteria | 2046 |
| 382 | Ga0157376_11461163 | 3300014969 | Bacteria | 716 |
| 383 | Ga0157376_11871866 | 3300014969 | Bacteria | 637 |
| 384 | Ga0163161_10122245 | 3300017792 | Bacteria | 1957 |
| 385 | Ga0163161_10132697 | 3300017792 | Bacteria | 1880 |
| 386 | Ga0163161_11465018 | 3300017792 | Bacteria | 598 |
| 387 | Ga0206354_11068395 | 3300020081 | Bacteria | 733 |
| 388 | Ga0213874_10043018 | 3300021377 | Bacteria | 1359 |
| 389 | Ga0213876_10041398 | 3300021384 | Bacteria | 2434 |
| 390 | Ga0209677_101475 | 3300025253 | Bacteria | 10119 |
| 391 | Ga0209758_1003786 | 3300025297 | Bacteria | 13331 |
| 392 | Ga0209758_1018611 | 3300025297 | Bacteria | 3393 |
| 393 | Ga0207697_10040482 | 3300025315 | Bacteria | 1913 |
| 394 | Ga0207656_10473463 | 3300025321 | Bacteria | 634 |
| 395 | Ga0207692_10000587 | 3300025898 | Bacteria | 12889 |
| 396 | Ga0207710_10112142 | 3300025900 | Bacteria | 1296 |
| 397 | Ga0207688_10040207 | 3300025901 | Bacteria | 2598 |
| 398 | Ga0207688_10289893 | 3300025901 | Bacteria | 999 |
| 399 | Ga0207688_10308206 | 3300025901 | Bacteria | 969 |
| 400 | Ga0207680_10044161 | 3300025903 | Bacteria | 2619 |
| 401 | Ga0207647_10037524 | 3300025904 | Bacteria | 3071 |
| 402 | Ga0207699_10000213 | 3300025906 | Bacteria | 34254 |
| 403 | Ga0207699_10032169 | 3300025906 | Bacteria | 2954 |
| 404 | Ga0207699_10134284 | 3300025906 | Bacteria | 1618 |
| 405 | Ga0207699_10156838 | 3300025906 | Bacteria | 1512 |
| 406 | Ga0207699_11030070 | 3300025906 | Bacteria | 609 |
| 407 | Ga0207645_10125547 | 3300025907 | Bacteria | 1668 |
| 408 | Ga0207645_10194837 | 3300025907 | Bacteria | 1332 |
| 409 | Ga0207643_10256744 | 3300025908 | Bacteria | 1078 |
| 410 | Ga0207705_10064991 | 3300025909 | Bacteria | 2637 |
| 411 | Ga0207705_10180623 | 3300025909 | Bacteria | 1592 |
| 412 | Ga0207705_10561074 | 3300025909 | Bacteria | 888 |
| 413 | Ga0207705_10574011 | 3300025909 | Bacteria | 877 |
| 414 | Ga0207705_10747964 | 3300025909 | Bacteria | 759 |
| 415 | Ga0207684_10664686 | 3300025910 | Bacteria | 887 |
| 416 | Ga0207654_10090073 | 3300025911 | Bacteria | 1868 |
| 417 | Ga0207654_10164611 | 3300025911 | Bacteria | 1435 |
| 418 | Ga0207707_10056027 | 3300025912 | Bacteria | 3429 |
| 419 | Ga0207707_10098953 | 3300025912 | Bacteria | 2549 |
| 420 | Ga0207707_10601046 | 3300025912 | Bacteria | 931 |
| 421 | Ga0207707_10644558 | 3300025912 | Bacteria | 893 |
| 422 | Ga0207695_10043878 | 3300025913 | Bacteria | 4760 |
| 423 | Ga0207671_10062855 | 3300025914 | Bacteria | 2758 |
| 424 | Ga0207671_10085997 | 3300025914 | Bacteria | 2363 |
| 425 | Ga0207671_10189261 | 3300025914 | Bacteria | 1604 |
| 426 | Ga0207671_10212903 | 3300025914 | Bacteria | 1512 |
| 427 | Ga0207671_10852750 | 3300025914 | Bacteria | 721 |
| 428 | Ga0207693_10031210 | 3300025915 | Bacteria | 4209 |
| 429 | Ga0207663_10000304 | 3300025916 | Bacteria | 21354 |
| 430 | Ga0207663_10538326 | 3300025916 | Bacteria | 912 |
| 431 | Ga0207663_10833366 | 3300025916 | Bacteria | 736 |
| 432 | Ga0207660_10003538 | 3300025917 | Bacteria | 10179 |
| 433 | Ga0207660_10255032 | 3300025917 | Bacteria | 1385 |
| 434 | Ga0207660_10502645 | 3300025917 | Bacteria | 984 |
| 435 | Ga0207662_10342968 | 3300025918 | Bacteria | 1001 |
| 436 | Ga0207662_10735351 | 3300025918 | Bacteria | 693 |
| 437 | Ga0207657_10011777 | 3300025919 | Bacteria | 8662 |
| 438 | Ga0207657_10526992 | 3300025919 | Bacteria | 924 |
| 439 | Ga0207649_10082861 | 3300025920 | Bacteria | 2080 |
| 440 | Ga0207649_10136967 | 3300025920 | Bacteria | 1670 |
| 441 | Ga0207649_10321871 | 3300025920 | Bacteria | 1136 |
| 442 | Ga0207649_10348851 | 3300025920 | Bacteria | 1095 |
| 443 | Ga0207652_10010392 | 3300025921 | Bacteria | 7494 |
| 444 | Ga0207652_10057070 | 3300025921 | Bacteria | 3362 |
| 445 | Ga0207652_10094892 | 3300025921 | Bacteria | 2627 |
| 446 | Ga0207652_10390846 | 3300025921 | Bacteria | 1255 |
| 447 | Ga0207652_10564527 | 3300025921 | Bacteria | 1022 |
| 448 | Ga0207646_10525460 | 3300025922 | Bacteria | 1065 |
| 449 | Ga0207681_10625309 | 3300025923 | Bacteria | 891 |
| 450 | Ga0207681_10685890 | 3300025923 | Bacteria | 851 |
| 451 | Ga0207694_10039712 | 3300025924 | Bacteria | 3622 |
| 452 | Ga0207694_10305118 | 3300025924 | Bacteria | 1311 |
| 453 | Ga0207694_10662210 | 3300025924 | Bacteria | 880 |
| 454 | Ga0207650_10237550 | 3300025925 | Bacteria | 1472 |
| 455 | Ga0207650_10400086 | 3300025925 | Bacteria | 1137 |
| 456 | Ga0207659_10355750 | 3300025926 | Bacteria | 1216 |
| 457 | Ga0207687_10463769 | 3300025927 | Bacteria | 1052 |
| 458 | Ga0207700_10125547 | 3300025928 | Bacteria | 2087 |
| 459 | Ga0207700_10222486 | 3300025928 | Bacteria | 1601 |
| 460 | Ga0207700_10371938 | 3300025928 | Bacteria | 1248 |
| 461 | Ga0207700_10410299 | 3300025928 | Bacteria | 1188 |
| 462 | Ga0207664_10004162 | 3300025929 | Bacteria | 9767 |
| 463 | Ga0207664_10094827 | 3300025929 | Bacteria | 2454 |
| 464 | Ga0207664_10215707 | 3300025929 | Bacteria | 1662 |
| 465 | Ga0207664_10943810 | 3300025929 | Bacteria | 774 |
| 466 | Ga0207644_10234898 | 3300025931 | Bacteria | 1458 |
| 467 | Ga0207690_10164038 | 3300025932 | Bacteria | 1659 |
| 468 | Ga0207690_10232259 | 3300025932 | Bacteria | 1417 |
| 469 | Ga0207706_10428902 | 3300025933 | Bacteria | 1145 |
| 470 | Ga0207706_10509559 | 3300025933 | Bacteria | 1038 |
| 471 | Ga0207686_10282396 | 3300025934 | Bacteria | 1226 |
| 472 | Ga0207686_10538272 | 3300025934 | Bacteria | 911 |
| 473 | Ga0207709_10139003 | 3300025935 | Bacteria | 1667 |
| 474 | Ga0207670_10800443 | 3300025936 | Bacteria | 785 |
| 475 | Ga0207669_10079874 | 3300025937 | Bacteria | 2090 |
| 476 | Ga0207669_10612231 | 3300025937 | Bacteria | 886 |
| 477 | Ga0207704_10182026 | 3300025938 | Bacteria | 1519 |
| 478 | Ga0207704_11036772 | 3300025938 | Bacteria | 695 |
| 479 | Ga0207665_10003342 | 3300025939 | Bacteria | 10748 |
| 480 | Ga0207665_10060764 | 3300025939 | Bacteria | 2560 |
| 481 | Ga0207665_10174456 | 3300025939 | Bacteria | 1554 |
| 482 | Ga0207691_10167731 | 3300025940 | Bacteria | 1924 |
| 483 | Ga0207691_10321591 | 3300025940 | Bacteria | 1326 |
| 484 | Ga0207711_10639202 | 3300025941 | Bacteria | 993 |
| 485 | Ga0207689_10046690 | 3300025942 | Bacteria | 3579 |
| 486 | Ga0207689_10062008 | 3300025942 | Bacteria | 3075 |
| 487 | Ga0207689_10303097 | 3300025942 | Bacteria | 1324 |
| 488 | Ga0207661_10034196 | 3300025944 | Bacteria | 3951 |
| 489 | Ga0207661_10053586 | 3300025944 | Bacteria | 3228 |
| 490 | Ga0207661_11301716 | 3300025944 | Bacteria | 668 |
| 491 | Ga0207679_10126987 | 3300025945 | Bacteria | 2040 |
| 492 | Ga0207679_10472119 | 3300025945 | Bacteria | 1116 |
| 493 | Ga0207679_10522478 | 3300025945 | Bacteria | 1062 |
| 494 | Ga0207667_10013254 | 3300025949 | Bacteria | 9449 |
| 495 | Ga0207667_10046644 | 3300025949 | Bacteria | 4588 |
| 496 | Ga0207667_10321334 | 3300025949 | Bacteria | 1581 |
| 497 | Ga0207667_10566787 | 3300025949 | Bacteria | 1147 |
| 498 | Ga0207667_10715606 | 3300025949 | Bacteria | 1003 |
| 499 | Ga0207667_10762672 | 3300025949 | Bacteria | 966 |
| 500 | Ga0207651_10727552 | 3300025960 | Bacteria | 876 |
| 501 | Ga0207651_10787306 | 3300025960 | Bacteria | 842 |
| 502 | Ga0207712_10044384 | 3300025961 | Bacteria | 3072 |
| 503 | Ga0207712_10147293 | 3300025961 | Bacteria | 1814 |
| 504 | Ga0207712_10526397 | 3300025961 | Bacteria | 1014 |
| 505 | Ga0207668_10006173 | 3300025972 | Bacteria | 7070 |
| 506 | Ga0207668_10052999 | 3300025972 | Bacteria | 2809 |
| 507 | Ga0207668_10072120 | 3300025972 | Bacteria | 2469 |
| 508 | Ga0207668_10309654 | 3300025972 | Bacteria | 1306 |
| 509 | Ga0207668_10329667 | 3300025972 | Bacteria | 1269 |
| 510 | Ga0207668_10444532 | 3300025972 | Bacteria | 1105 |
| 511 | Ga0207668_10598156 | 3300025972 | Bacteria | 960 |
| 512 | Ga0207668_10670224 | 3300025972 | Bacteria | 909 |
| 513 | Ga0207640_10392586 | 3300025981 | Bacteria | 1128 |
| 514 | Ga0207640_10493661 | 3300025981 | Bacteria | 1018 |
| 515 | Ga0207640_10748937 | 3300025981 | Bacteria | 842 |
| 516 | Ga0207658_10704644 | 3300025986 | Bacteria | 912 |
| 517 | Ga0207658_10894756 | 3300025986 | Bacteria | 808 |
| 518 | Ga0207677_10323632 | 3300026023 | Bacteria | 1282 |
| 519 | Ga0207677_11077078 | 3300026023 | Bacteria | 732 |
| 520 | Ga0207703_10074611 | 3300026035 | Bacteria | 2809 |
| 521 | Ga0207703_10181813 | 3300026035 | Bacteria | 1856 |
| 522 | Ga0207703_10266695 | 3300026035 | Bacteria | 1550 |
| 523 | Ga0207703_10356795 | 3300026035 | Bacteria | 1347 |
| 524 | Ga0207703_10384341 | 3300026035 | Bacteria | 1299 |
| 525 | Ga0207703_10512505 | 3300026035 | Bacteria | 1127 |
| 526 | Ga0207703_10617983 | 3300026035 | Bacteria | 1026 |
| 527 | Ga0207639_10014213 | 3300026041 | Bacteria | 5591 |
| 528 | Ga0207639_10049278 | 3300026041 | Bacteria | 3193 |
| 529 | Ga0207639_10123103 | 3300026041 | Bacteria | 2134 |
| 530 | Ga0207639_10229703 | 3300026041 | Bacteria | 1607 |
| 531 | Ga0207639_10309613 | 3300026041 | Bacteria | 1399 |
| 532 | Ga0207639_10360046 | 3300026041 | Bacteria | 1302 |
| 533 | Ga0207639_10471443 | 3300026041 | Bacteria | 1143 |
| 534 | Ga0207639_11139230 | 3300026041 | Bacteria | 732 |
| 535 | Ga0207678_10024919 | 3300026067 | Bacteria | 5223 |
| 536 | Ga0207678_10056612 | 3300026067 | Bacteria | 3375 |
| 537 | Ga0207678_10333411 | 3300026067 | Bacteria | 1306 |
| 538 | Ga0207678_10506288 | 3300026067 | Bacteria | 1053 |
| 539 | Ga0207708_10066372 | 3300026075 | Bacteria | 2759 |
| 540 | Ga0207708_10868245 | 3300026075 | Bacteria | 780 |
| 541 | Ga0207702_10002818 | 3300026078 | Bacteria | 16258 |
| 542 | Ga0207702_10085484 | 3300026078 | Bacteria | 2749 |
| 543 | Ga0207641_10214822 | 3300026088 | Bacteria | 1780 |
| 544 | Ga0207641_10592874 | 3300026088 | Bacteria | 1084 |
| 545 | Ga0207641_10856278 | 3300026088 | Bacteria | 901 |
| 546 | Ga0207648_10522821 | 3300026089 | Bacteria | 1087 |
| 547 | Ga0207648_10541905 | 3300026089 | Bacteria | 1068 |
| 548 | Ga0207648_10788658 | 3300026089 | Bacteria | 884 |
| 549 | Ga0207648_11369053 | 3300026089 | Bacteria | 665 |
| 550 | Ga0207676_10119945 | 3300026095 | Bacteria | 2216 |
| 551 | Ga0207676_10215002 | 3300026095 | Bacteria | 1708 |
| 552 | Ga0207676_10521472 | 3300026095 | Bacteria | 1131 |
| 553 | Ga0207676_10592123 | 3300026095 | Bacteria | 1064 |
| 554 | Ga0207674_10092290 | 3300026116 | Bacteria | 3018 |
| 555 | Ga0207674_10311722 | 3300026116 | Bacteria | 1523 |
| 556 | Ga0207675_100102647 | 3300026118 | Bacteria | 2695 |
| 557 | Ga0207675_100334934 | 3300026118 | Bacteria | 1480 |
| 558 | Ga0207675_100491540 | 3300026118 | Bacteria | 1221 |
| 559 | Ga0207675_100954021 | 3300026118 | Bacteria | 875 |
| 560 | Ga0207675_102110906 | 3300026118 | Bacteria | 580 |
| 561 | Ga0207683_10035270 | 3300026121 | Bacteria | 4349 |
| 562 | Ga0207683_10069997 | 3300026121 | Bacteria | 3099 |
| 563 | Ga0207683_10238787 | 3300026121 | Bacteria | 1658 |
| 564 | Ga0207683_10306453 | 3300026121 | Bacteria | 1453 |
| 565 | Ga0207683_10494754 | 3300026121 | Bacteria | 1129 |
| 566 | Ga0207683_10629424 | 3300026121 | Bacteria | 994 |
| 567 | Ga0207683_10955186 | 3300026121 | Bacteria | 796 |
| 568 | Ga0207683_11827649 | 3300026121 | Bacteria | 557 |
| 569 | Ga0207698_10066227 | 3300026142 | Bacteria | 2842 |
| 570 | Ga0207698_10146670 | 3300026142 | Bacteria | 2042 |
| 571 | Ga0207698_10249335 | 3300026142 | Bacteria | 1623 |
| 572 | Ga0207698_12207185 | 3300026142 | Bacteria | 563 |
| 573 | Ga0209589_1000023 | 3300027357 | Bacteria | 177856 |
| 574 | Ga0209489_100032 | 3300027361 | Bacteria | 177856 |
| 575 | Ga0209700_100040 | 3300027363 | Bacteria | 177856 |
| 576 | Ga0209179_1010194 | 3300027512 | Bacteria | 1632 |
| 577 | Ga0209588_1013209 | 3300027671 | Bacteria | 2517 |
| 578 | Ga0209813_10045419 | 3300027866 | Bacteria | 1353 |
| 579 | Ga0209813_10063519 | 3300027866 | Bacteria | 1184 |
| 580 | Ga0268266_10004462 | 3300028379 | Bacteria | 13381 |
| 581 | Ga0268266_10014083 | 3300028379 | Bacteria | 6884 |
| 582 | Ga0268266_10237848 | 3300028379 | Bacteria | 1679 |
| 583 | Ga0268266_10307922 | 3300028379 | Bacteria | 1479 |
| 584 | Ga0268266_10682882 | 3300028379 | Bacteria | 989 |
| 585 | Ga0268266_10961409 | 3300028379 | Bacteria | 826 |
| 586 | Ga0268265_10229471 | 3300028380 | Bacteria | 1630 |
| 587 | Ga0268265_10456757 | 3300028380 | Bacteria | 1194 |
| 588 | Ga0268265_11016967 | 3300028380 | Bacteria | 819 |
| 589 | Ga0268264_10322468 | 3300028381 | Bacteria | 1461 |
| 590 | Ga0268264_10336108 | 3300028381 | Bacteria | 1433 |
| 591 | Ga0268264_10370329 | 3300028381 | Bacteria | 1369 |
| 592 | Ga0268264_10387080 | 3300028381 | Bacteria | 1340 |
| 593 | Ga0268264_11630566 | 3300028381 | Bacteria | 656 |
| 594 | Ga0307517_10000369 | 3300028786 | Bacteria | 77795 |
| 595 | Ga0307515_10065881 | 3300028794 | Bacteria | 5030 |
| 596 | Ga0307515_10190456 | 3300028794 | Bacteria | 1963 |
| 597 | Ga0307515_10498837 | 3300028794 | Bacteria | 828 |
| 598 | Ga0307511_10199720 | 3300030521 | Bacteria | 1041 |
| 599 | Ga0265763_1003947 | 3300030763 | Bacteria | 1198 |
| 600 | Ga0265330_10050130 | 3300031235 | Bacteria | 1831 |
| 601 | Ga0265329_10048148 | 3300031242 | Bacteria | 1360 |
| 602 | Ga0265340_10336056 | 3300031247 | Bacteria | 668 |
| 603 | Ga0265339_10029554 | 3300031249 | Bacteria | 3109 |
| 604 | Ga0265316_10357304 | 3300031344 | Bacteria | 1057 |
| 605 | Ga0307513_10099517 | 3300031456 | Bacteria | 2935 |
| 606 | Ga0307509_10094849 | 3300031507 | Bacteria | 3041 |
| 607 | Ga0307508_10000010 | 3300031616 | Bacteria | 255747 |
| 608 | Ga0307508_10177854 | 3300031616 | Bacteria | 1731 |
| 609 | Ga0307508_10382799 | 3300031616 | Bacteria | 998 |
| 610 | Ga0307508_10869620 | 3300031616 | Bacteria | 525 |
| 611 | Ga0265314_10003900 | 3300031711 | Bacteria | 14176 |
| 612 | Ga0307516_10621641 | 3300031730 | Bacteria | 735 |
| 613 | Ga0307405_10384095 | 3300031731 | Bacteria | 1094 |
| 614 | Ga0307413_10207496 | 3300031824 | Bacteria | 1420 |
| 615 | Ga0307410_10214900 | 3300031852 | Bacteria | 1476 |
| 616 | Ga0307410_10273750 | 3300031852 | Bacteria | 1322 |
| 617 | Ga0307406_10385022 | 3300031901 | Bacteria | 1107 |
| 618 | Ga0307406_10681189 | 3300031901 | Bacteria | 856 |
| 619 | Ga0307406_10685922 | 3300031901 | Bacteria | 854 |
| 620 | Ga0307407_10759737 | 3300031903 | Bacteria | 735 |
| 621 | Ga0307412_10373319 | 3300031911 | Bacteria | 1152 |
| 622 | Ga0307409_100090639 | 3300031995 | Bacteria | 2503 |
| 623 | Ga0307416_100260662 | 3300032002 | Bacteria | 1694 |
| 624 | Ga0307416_101351443 | 3300032002 | Bacteria | 818 |
| 625 | Ga0307414_10267972 | 3300032004 | Bacteria | 1429 |
| 626 | Ga0307411_10345048 | 3300032005 | Bacteria | 1211 |
| 627 | Ga0307411_11052309 | 3300032005 | Bacteria | 731 |
| 628 | Ga0307415_100072259 | 3300032126 | Bacteria | 2429 |
| 629 | Ga0307415_100148779 | 3300032126 | Bacteria | 1799 |
| 630 | Ga0307510_10007185 | 3300033180 | Bacteria | 13262 |
| 631 | Ga0307510_10045483 | 3300033180 | Bacteria | 4737 |
| 632 | Ga0316214_1022723 | 3300033545 | Bacteria | 881 |
| 633 | Ga0373959_0154131 | 3300034820 | Bacteria | 583 |
| 634 | Ga0373926_0013254 | 3300035083 | Bacteria | 2795 |
| 635 | Ga0373940_0099315 | 3300035088 | Bacteria | 882 |
| 636 | Ga0373944_0048009 | 3300035089 | Bacteria | 1339 |
| 637 | Ga0373923_0014328 | 3300035111 | Bacteria | 2977 |
| 638 | Ga0373923_0162978 | 3300035111 | Bacteria | 1018 |
| 639 | Ga0373936_0009767 | 3300035113 | Bacteria | 3621 |
| 640 | Ga0373936_0429905 | 3300035113 | Bacteria | 609 |
| 641 | Ga0373945_0031608 | 3300035116 | Bacteria | 1871 |
| 642 | Ga0373953_0063091 | 3300035117 | Bacteria | 1518 |
| 643 | Ga0373953_0185978 | 3300035117 | Bacteria | 897 |
| 644 | Ga0373954_0080108 | 3300035118 | Bacteria | 1560 |
| 645 | Ga0373954_0286292 | 3300035118 | Bacteria | 812 |
| 646 | Ga0373956_0407757 | 3300035119 | Bacteria | 648 |
| 647 | Ga0373943_0707038 | 3300035170 | Bacteria | 597 |
| 648 | Ga0373946_0008582 | 3300035171 | Bacteria | 3751 |
| 649 | Ga0373955_0006653 | 3300035172 | Bacteria | 5272 |
| 650 | Ga0373955_1052922 | 3300035172 | Bacteria | 501 |
| 651 | Ga0373924_0038427 | 3300035410 | Bacteria | 1952 |
| 652 | Ga0373924_0176762 | 3300035410 | Bacteria | 939 |
| 653 | Ga0373924_0319214 | 3300035410 | Bacteria | 691 |
| 654 | Ga0373931_0012857 | 3300035691 | Bacteria | 4065 |
| 655 | Ga0373931_1287738 | 3300035691 | Bacteria | 502 |
| 656 | Ga0373935_0371438 | 3300035692 | Bacteria | 1023 |
| 657 | Ga0373935_0535805 | 3300035692 | Bacteria | 852 |
| 658 | Ga0373927_0017113 | 3300035695 | Bacteria | 4776 |
| 659 | Ga0373927_0042999 | 3300035695 | Bacteria | 2927 |
| 660 | Ga0373927_0155359 | 3300035695 | Bacteria | 1498 |
| 661 | Ga0373927_0487544 | 3300035695 | Bacteria | 815 |
| 662 | Ga0373927_0835763 | 3300035695 | Bacteria | 608 |
| 663 | Ga0373933_0118882 | 3300035724 | Bacteria | 1654 |
| 664 | Ga0373933_0331337 | 3300035724 | Bacteria | 987 |
| 665 | Ga0373933_0558077 | 3300035724 | Bacteria | 751 |
| 666 | Ga0373947_0003273 | 3300035725 | Bacteria | 9604 |
| 667 | Ga0373947_0817888 | 3300035725 | Bacteria | 636 |
| 668 | Ga0373937_0025703 | 3300036401 | Bacteria | 5318 |
| 669 | Ga0372808_025885 | 3300036459 | Bacteria | 842 |
| 670 | Ga0373925_0033662 | 3300037068 | Bacteria | 3775 |
| 671 | Ga0373925_0181838 | 3300037068 | Bacteria | 1665 |
| 672 | Ga0395899_0269481 | 3300037312 | Bacteria | 1162 |
| 673 | Ga0395900_0233613 | 3300037418 | Bacteria | 1848 |
| 674 | Ga0395898_0651972 | 3300037466 | Bacteria | 995 |
| 675 | Ga0395905_0432620 | 3300037471 | Bacteria | 1213 |
| 676 | Ga0395901_0230698 | 3300038443 | Bacteria | 1932 |
| 677 | Ga0395901_0650263 | 3300038443 | Bacteria | 1058 |
| 678 | Ga0436365_1450483 | 3300039437 | Bacteria | 2294 |
| 679 | Ga0436360_0868147 | 3300039438 | Bacteria | 1924 |
| 680 | Ga0436363_0568357 | 3300039450 | Bacteria | 2597 |
| 681 | Ga0436363_0671415 | 3300039450 | Bacteria | 764 |
| 682 | Ga0436363_0784172 | 3300039450 | Bacteria | 1484 |
| 683 | Ga0436363_1485995 | 3300039450 | Bacteria | 3097 |
| 684 | Ga0436362_0917119 | 3300039453 | Bacteria | 597 |
| 685 | Ga0451791_0544621 | 3300041451 | Bacteria | 938 |
| 686 | Ga0451793_0675627 | 3300041452 | Bacteria | 534 |
| 687 | Ga0451800_0695612 | 3300041459 | Bacteria | 879 |
| 688 | Ga0451800_1652685 | 3300041459 | Bacteria | 883 |
| 689 | Ga0451802_0959116 | 3300041460 | Bacteria | 531 |
| 690 | Ga0451835_1010143 | 3300041492 | Bacteria | 740 |
| 691 | Ga0451837_0761693 | 3300041494 | Bacteria | 697 |
| 692 | Ga0451839_0367782 | 3300041496 | Bacteria | 606 |
| 693 | Ga0451855_1343022 | 3300041511 | Bacteria | 1090 |
| 694 | Ga0450904_020118 | 3300042139 | Bacteria | 676 |
| 695 | Ga0439459_0055943 | 3300042438 | Bacteria | 879 |
| 696 | Ga0466970_0572651 | 3300044765 | Bacteria | 654 |
| 697 | Ga0466957_0439831 | 3300044842 | Bacteria | 897 |
| 698 | Ga0466967_0105415 | 3300045976 | Bacteria | 2583 |
| 699 | Ga0495617_045104 | 3300046452 | Bacteria | 1470 |
| 700 | Ga0495592_0064177 | 3300046454 | Bacteria | 2692 |
| 701 | Ga0495592_0182927 | 3300046454 | Bacteria | 1426 |
| 702 | Ga0495603_0035061 | 3300046455 | Bacteria | 3015 |
| 703 | Ga0495603_0291720 | 3300046455 | Bacteria | 937 |
| 704 | Ga0495590_0104124 | 3300046457 | Bacteria | 1010 |
| 705 | Ga0495591_064537 | 3300046458 | Bacteria | 965 |
| 706 | Ga0495629_0080062 | 3300046459 | Bacteria | 2281 |
| 707 | Ga0495629_0111304 | 3300046459 | Bacteria | 1909 |
| 708 | Ga0495629_0160859 | 3300046459 | Bacteria | 1560 |
| 709 | Ga0495638_0121782 | 3300046460 | Bacteria | 1540 |
| 710 | Ga0495638_0174056 | 3300046460 | Bacteria | 1233 |
| 711 | Ga0495651_0075593 | 3300046462 | Bacteria | 2553 |
| 712 | Ga0495653_0444544 | 3300046463 | Bacteria | 816 |
| 713 | Ga0495650_0129986 | 3300046471 | Bacteria | 919 |
| 714 | Ga0495650_0157760 | 3300046471 | Bacteria | 811 |
| 715 | Ga0495580_0007113 | 3300046472 | Bacteria | 9013 |
| 716 | Ga0495582_0027504 | 3300046473 | Bacteria | 3118 |
| 717 | Ga0495582_0177918 | 3300046473 | Bacteria | 1212 |
| 718 | Ga0495582_0204163 | 3300046473 | Bacteria | 1129 |
| 719 | Ga0495605_0118651 | 3300046474 | Bacteria | 1201 |
| 720 | Ga0495605_0123054 | 3300046474 | Bacteria | 1175 |
| 721 | Ga0495605_0257859 | 3300046474 | Bacteria | 745 |
| 722 | Ga0495639_0021589 | 3300046475 | Bacteria | 2819 |
| 723 | Ga0495639_0037553 | 3300046475 | Bacteria | 2172 |
| 724 | Ga0495662_0047199 | 3300046476 | Bacteria | 2079 |
| 725 | Ga0495662_0106213 | 3300046476 | Bacteria | 1375 |
| 726 | Ga0495664_0004051 | 3300046477 | Bacteria | 7988 |
| 727 | Ga0495664_0113015 | 3300046477 | Bacteria | 1640 |
| 728 | Ga0495664_0229315 | 3300046477 | Bacteria | 1124 |
| 729 | Ga0495584_0642366 | 3300046491 | Bacteria | 541 |
| 730 | Ga0495585_0155620 | 3300046492 | Bacteria | 1189 |
| 731 | Ga0495585_0212482 | 3300046492 | Bacteria | 980 |
| 732 | Ga0495594_0109099 | 3300046499 | Bacteria | 1560 |
| 733 | Ga0495607_0166995 | 3300046501 | Bacteria | 1114 |
| 734 | Ga0495583_0077729 | 3300046506 | Bacteria | 1447 |
| 735 | Ga0495606_0161738 | 3300046507 | Bacteria | 1306 |
| 736 | Ga0495606_0258888 | 3300046507 | Bacteria | 961 |
| 737 | Ga0495608_0333429 | 3300046511 | Bacteria | 935 |
| 738 | Ga0495616_0114780 | 3300046513 | Bacteria | 1248 |
| 739 | Ga0495616_0274151 | 3300046513 | Bacteria | 718 |
| 740 | Ga0495618_0088495 | 3300046514 | Bacteria | 1980 |
| 741 | Ga0495620_0035717 | 3300046515 | Bacteria | 2231 |
| 742 | Ga0495628_0210238 | 3300046516 | Bacteria | 1464 |
| 743 | Ga0495628_0229379 | 3300046516 | Bacteria | 1392 |
| 744 | Ga0495630_0006245 | 3300046517 | Bacteria | 8455 |
| 745 | Ga0495630_0096605 | 3300046517 | Bacteria | 2234 |
| 746 | Ga0495630_0833993 | 3300046517 | Bacteria | 703 |
| 747 | Ga0495631_0102182 | 3300046518 | Bacteria | 1233 |
| 748 | Ga0495632_0136221 | 3300046519 | Bacteria | 1141 |
| 749 | Ga0495632_0377592 | 3300046519 | Bacteria | 621 |
| 750 | Ga0495632_0408256 | 3300046519 | Bacteria | 592 |
| 751 | Ga0495637_0096047 | 3300046520 | Bacteria | 1163 |
| 752 | Ga0495648_0209796 | 3300046524 | Bacteria | 968 |
| 753 | Ga0495648_0261096 | 3300046524 | Bacteria | 831 |
| 754 | Ga0495666_0148222 | 3300046526 | Bacteria | 1092 |
| 755 | Ga0495666_0505550 | 3300046526 | Bacteria | 540 |
| 756 | Ga0495666_0575748 | 3300046526 | Bacteria | 502 |
| 757 | Ga0495642_0309219 | 3300046528 | Bacteria | 693 |
| 758 | Ga0495652_0402101 | 3300046529 | Bacteria | 969 |
| 759 | Ga0495640_0053476 | 3300046533 | Bacteria | 2768 |
| 760 | Ga0495640_0249826 | 3300046533 | Bacteria | 1111 |
| 761 | Ga0495586_0220394 | 3300046535 | Bacteria | 1078 |
| 762 | Ga0495587_0190063 | 3300046536 | Bacteria | 1163 |
| 763 | Ga0495587_0329079 | 3300046536 | Bacteria | 853 |
| 764 | Ga0495598_0050273 | 3300046537 | Bacteria | 1252 |
| 765 | Ga0495598_0174654 | 3300046537 | Bacteria | 763 |
| 766 | Ga0495609_0044599 | 3300046538 | Bacteria | 1988 |
| 767 | Ga0495621_0170572 | 3300046539 | Bacteria | 864 |
| 768 | Ga0495645_0023446 | 3300046543 | Bacteria | 4469 |
| 769 | Ga0495645_0204776 | 3300046543 | Bacteria | 1336 |
| 770 | Ga0495645_0268304 | 3300046543 | Bacteria | 1127 |
| 771 | Ga0495645_0306564 | 3300046543 | Bacteria | 1035 |
| 772 | Ga0495667_0016699 | 3300046559 | Bacteria | 4956 |
| 773 | Ga0495656_0094736 | 3300046615 | Bacteria | 1371 |
| 774 | Ga0495656_0141813 | 3300046615 | Bacteria | 1153 |
| 775 | Ga0495668_0355102 | 3300046616 | Bacteria | 804 |
| 776 | Ga0495668_0525251 | 3300046616 | Bacteria | 653 |
| 777 | Ga0495634_0005414 | 3300046642 | Bacteria | 9831 |
| 778 | Ga0495634_0047319 | 3300046642 | Bacteria | 2899 |
| 779 | Ga0495634_0695017 | 3300046642 | Bacteria | 585 |
| 780 | Ga0495625_0103563 | 3300046660 | Bacteria | 1952 |
| 781 | Ga0495625_0150642 | 3300046660 | Bacteria | 1564 |
| 782 | Ga0495625_0151747 | 3300046660 | Bacteria | 1557 |
| 783 | Ga0495625_0369321 | 3300046660 | Bacteria | 903 |
| 784 | Ga0495625_0781764 | 3300046660 | Bacteria | 557 |
| 785 | Ga0495635_0095062 | 3300046663 | Bacteria | 2037 |
| 786 | Ga0495635_0666119 | 3300046663 | Bacteria | 676 |
| 787 | Ga0495659_0074994 | 3300046664 | Bacteria | 1273 |
| 788 | Ga0495657_0286095 | 3300046675 | Bacteria | 985 |
| 789 | Ga0495599_0091460 | 3300046678 | Bacteria | 1898 |
| 790 | Ga0495599_0335592 | 3300046678 | Bacteria | 908 |
| 791 | Ga0495623_0696833 | 3300046679 | Bacteria | 520 |
| 792 | Ga0495646_0083582 | 3300046680 | Bacteria | 1855 |
| 793 | Ga0495647_0016692 | 3300046681 | Bacteria | 2589 |
| 794 | Ga0495658_0005198 | 3300046683 | Bacteria | 6401 |
| 795 | Ga0495658_0078457 | 3300046683 | Bacteria | 1933 |
| 796 | Ga0495669_0130308 | 3300046684 | Bacteria | 1183 |
| 797 | Ga0495669_0148919 | 3300046684 | Bacteria | 1107 |
| 798 | Ga0495669_0251678 | 3300046684 | Bacteria | 848 |
| 799 | Ga0495669_0280605 | 3300046684 | Bacteria | 801 |
| 800 | Ga0495613_0071090 | 3300046689 | Bacteria | 2537 |
| 801 | Ga0495624_0485612 | 3300046690 | Bacteria | 739 |
| 802 | Ga0495670_0320223 | 3300046691 | Bacteria | 832 |
| 803 | Ga0495670_0356664 | 3300046691 | Bacteria | 787 |
| 804 | Ga0495600_0349977 | 3300046809 | Bacteria | 925 |
| 805 | Ga0495600_0384134 | 3300046809 | Bacteria | 876 |
| 806 | Ga0495581_0018727 | 3300047315 | Bacteria | 4020 |
| 807 | Ga0495581_0161209 | 3300047315 | Bacteria | 1311 |
| 808 | Ga0495581_0251886 | 3300047315 | Bacteria | 1033 |
| 809 | Ga0495581_0264045 | 3300047315 | Bacteria | 1007 |
| 810 | Ga0495581_0328773 | 3300047315 | Bacteria | 893 |
| 811 | Ga0495581_0464878 | 3300047315 | Bacteria | 736 |
| 812 | Ga0495604_0064711 | 3300047317 | Bacteria | 2785 |
| 813 | Ga0495674_0009113 | 3300047319 | Bacteria | 9428 |
| 814 | Ga0495674_0623877 | 3300047319 | Bacteria | 852 |
| 815 | Ga0495674_0705550 | 3300047319 | Bacteria | 791 |
| 816 | Ga0495672_0049429 | 3300047320 | Bacteria | 2488 |
| 817 | Ga0495672_0114268 | 3300047320 | Bacteria | 1445 |
| 818 | Ga0495672_0192590 | 3300047320 | Bacteria | 1024 |
| 819 | Ga0495676_0035019 | 3300047321 | Bacteria | 4205 |
| 820 | Ga0495676_0462322 | 3300047321 | Bacteria | 836 |
| 821 | Ga0495676_0514920 | 3300047321 | Bacteria | 784 |
| 822 | Ga0495683_0160402 | 3300047323 | Bacteria | 1040 |
| 823 | Ga0495675_0135746 | 3300047444 | Bacteria | 1527 |
| 824 | Ga0495677_0067245 | 3300047445 | Bacteria | 1333 |
| 825 | Ga0495677_0118314 | 3300047445 | Bacteria | 1009 |
| 826 | Ga0495681_0175160 | 3300047470 | Bacteria | 885 |
| 827 | Ga0495686_0097878 | 3300047472 | Bacteria | 1773 |
| 828 | Ga0495686_0367911 | 3300047472 | Bacteria | 778 |
| 829 | Ga0495686_0481510 | 3300047472 | Bacteria | 656 |
| 830 | Ga0495593_0106071 | 3300047673 | Bacteria | 1437 |
| 831 | Ga0495593_0590213 | 3300047673 | Bacteria | 558 |
| 832 | Ga0495602_0147114 | 3300048088 | Bacteria | 1857 |
| 833 | Ga0495602_0277663 | 3300048088 | Bacteria | 1236 |
| 834 | Ga0495602_0631168 | 3300048088 | Bacteria | 734 |
| 835 | Ga0495614_0211824 | 3300048089 | Bacteria | 879 |
| 836 | Ga0495615_0326478 | 3300048090 | Bacteria | 502 |
| 837 | Ga0496100_0030053 | 3300048903 | Bacteria | 3366 |
| 838 | Ga0496100_0230575 | 3300048903 | Bacteria | 1362 |
| 839 | Ga0496100_0266579 | 3300048903 | Bacteria | 1272 |
| 840 | Ga0496100_0421724 | 3300048903 | Bacteria | 1019 |
| 841 | Ga0496100_0433148 | 3300048903 | Bacteria | 1006 |
| 842 | Ga0496101_0272806 | 3300048904 | Bacteria | 1321 |
| 843 | Ga0496101_0307438 | 3300048904 | Bacteria | 1242 |
| 844 | Ga0496101_0351646 | 3300048904 | Bacteria | 1158 |
| 845 | Ga0496102_0017316 | 3300048905 | Bacteria | 6310 |
| 846 | Ga0496102_0052522 | 3300048905 | Bacteria | 3714 |
| 847 | Ga0496102_0088277 | 3300048905 | Bacteria | 2866 |
| 848 | Ga0496102_0148842 | 3300048905 | Bacteria | 2198 |
| 849 | Ga0496102_0179443 | 3300048905 | Bacteria | 1995 |
| 850 | Ga0496102_0330375 | 3300048905 | Bacteria | 1436 |
| 851 | Ga0496102_0334140 | 3300048905 | Bacteria | 1427 |
| 852 | Ga0496102_0463974 | 3300048905 | Bacteria | 1187 |
| 853 | Ga0496102_0973526 | 3300048905 | Bacteria | 769 |
| 854 | Ga0496102_0975761 | 3300048905 | Bacteria | 768 |
| 855 | Ga0496103_0043903 | 3300048906 | Bacteria | 2753 |
| 856 | Ga0496103_0094923 | 3300048906 | Bacteria | 1884 |
| 857 | Ga0496103_0249249 | 3300048906 | Bacteria | 1143 |
| 858 | Ga0496103_0332596 | 3300048906 | Bacteria | 977 |
| 859 | Ga0496103_0521318 | 3300048906 | Bacteria | 760 |
| 860 | Ga0496104_0011106 | 3300048907 | Bacteria | 8058 |
| 861 | Ga0496104_0028694 | 3300048907 | Bacteria | 5158 |
| 862 | Ga0496104_0041875 | 3300048907 | Bacteria | 4295 |
| 863 | Ga0496104_0367872 | 3300048907 | Bacteria | 1350 |
| 864 | Ga0496105_0069731 | 3300048908 | Bacteria | 2905 |
| 865 | Ga0496105_0094951 | 3300048908 | Bacteria | 2463 |
| 866 | Ga0496105_0288925 | 3300048908 | Bacteria | 1320 |
| 867 | Ga0496105_0472771 | 3300048908 | Bacteria | 987 |
| 868 | Ga0496105_0967159 | 3300048908 | Bacteria | 638 |
| 869 | Ga0496105_1077251 | 3300048908 | Bacteria | 598 |
| 870 | Ga0496106_0000796 | 3300048909 | Bacteria | 22789 |
| 871 | Ga0496106_0039046 | 3300048909 | Bacteria | 3555 |
| 872 | Ga0496106_0355013 | 3300048909 | Bacteria | 1178 |
| 873 | Ga0496106_0688928 | 3300048909 | Bacteria | 815 |
| 874 | Ga0496106_0731644 | 3300048909 | Bacteria | 787 |
| 875 | Ga0496107_0001290 | 3300048910 | Bacteria | 15326 |
| 876 | Ga0496107_0014938 | 3300048910 | Bacteria | 5438 |
| 877 | Ga0496107_0435271 | 3300048910 | Bacteria | 975 |
| 878 | Ga0496107_1239308 | 3300048910 | Bacteria | 535 |
| 879 | Ga0496108_0002231 | 3300048911 | Bacteria | 15526 |
| 880 | Ga0496108_0028557 | 3300048911 | Bacteria | 4616 |
| 881 | Ga0496108_0123386 | 3300048911 | Bacteria | 2223 |
| 882 | Ga0496108_0246693 | 3300048911 | Bacteria | 1553 |
| 883 | Ga0496108_0432079 | 3300048911 | Bacteria | 1150 |
| 884 | Ga0496109_0000399 | 3300048912 | Bacteria | 39304 |
| 885 | Ga0496109_0034945 | 3300048912 | Bacteria | 4531 |
| 886 | Ga0496109_0070531 | 3300048912 | Bacteria | 3207 |
| 887 | Ga0496109_0076040 | 3300048912 | Bacteria | 3088 |
| 888 | Ga0496109_0866003 | 3300048912 | Bacteria | 841 |
| 889 | Ga0496109_1014516 | 3300048912 | Bacteria | 767 |
| 890 | Ga0496110_0021658 | 3300048913 | Bacteria | 5446 |
| 891 | Ga0496110_0049839 | 3300048913 | Bacteria | 3675 |
| 892 | Ga0496110_0090401 | 3300048913 | Bacteria | 2737 |
| 893 | Ga0496110_0573115 | 3300048913 | Bacteria | 1025 |
| 894 | Ga0496110_0817931 | 3300048913 | Bacteria | 836 |
| 895 | Ga0496110_1454524 | 3300048913 | Bacteria | 595 |
| 896 | Ga0496111_0035884 | 3300048914 | Bacteria | 3545 |
| 897 | Ga0496111_0038257 | 3300048914 | Bacteria | 3437 |
| 898 | Ga0496111_0054689 | 3300048914 | Bacteria | 2886 |
| 899 | Ga0496111_0075789 | 3300048914 | Bacteria | 2451 |
| 900 | Ga0496111_0455996 | 3300048914 | Bacteria | 943 |
| 901 | Ga0496112_0005242 | 3300048915 | Bacteria | 11163 |
| 902 | Ga0496112_0006435 | 3300048915 | Bacteria | 10313 |
| 903 | Ga0496112_0113335 | 3300048915 | Bacteria | 2682 |
| 904 | Ga0496112_0113796 | 3300048915 | Bacteria | 2676 |
| 905 | Ga0496112_0177089 | 3300048915 | Bacteria | 2097 |
| 906 | Ga0496112_0241189 | 3300048915 | Bacteria | 1760 |
| 907 | Ga0496112_0366439 | 3300048915 | Bacteria | 1382 |
| 908 | Ga0496113_0093717 | 3300048916 | Bacteria | 2319 |
| 909 | Ga0496113_0150221 | 3300048916 | Bacteria | 1837 |
| 910 | Ga0496114_0045894 | 3300048917 | Bacteria | 3630 |
| 911 | Ga0496114_0097042 | 3300048917 | Bacteria | 2510 |
| 912 | Ga0496114_0190755 | 3300048917 | Bacteria | 1793 |
| 913 | Ga0496114_0339750 | 3300048917 | Bacteria | 1328 |
| 914 | Ga0496114_0615795 | 3300048917 | Bacteria | 957 |
| 915 | Ga0496114_0715270 | 3300048917 | Bacteria | 877 |
| 916 | Ga0496115_0002110 | 3300048918 | Bacteria | 14231 |
| 917 | Ga0496115_0084102 | 3300048918 | Bacteria | 2594 |
| 918 | Ga0496115_0104092 | 3300048918 | Bacteria | 2329 |
| 919 | Ga0496115_0106326 | 3300048918 | Bacteria | 2304 |
| 920 | Ga0496115_0108995 | 3300048918 | Bacteria | 2274 |
| 921 | Ga0496115_0473009 | 3300048918 | Bacteria | 1010 |
| 922 | Ga0496115_0518619 | 3300048918 | Bacteria | 956 |
| 923 | Ga0496115_1169145 | 3300048918 | Bacteria | 580 |
| 924 | Ga0496115_1259450 | 3300048918 | Bacteria | 553 |
| 925 | Ga0496118_0106777 | 3300048921 | Bacteria | 1872 |
| 926 | Ga0496118_0211719 | 3300048921 | Bacteria | 1137 |
| 927 | Ga0496118_0322575 | 3300048921 | Bacteria | 837 |
| 928 | Ga0496119_0082328 | 3300048922 | Bacteria | 1851 |
| 929 | Ga0496119_0278867 | 3300048922 | Bacteria | 832 |
| 930 | Ga0496121_0095634 | 3300048924 | Bacteria | 2308 |
| 931 | Ga0496121_0290721 | 3300048924 | Bacteria | 1113 |
| 932 | Ga0496121_0475393 | 3300048924 | Bacteria | 799 |
| 933 | Ga0496121_0539301 | 3300048924 | Bacteria | 732 |
| 934 | Ga0496122_0115599 | 3300048925 | Bacteria | 1747 |
| 935 | Ga0496124_0154878 | 3300048927 | Bacteria | 1793 |
| 936 | Ga0496124_0296501 | 3300048927 | Bacteria | 1170 |
| 937 | Ga0496125_0074135 | 3300048928 | Bacteria | 2641 |
| 938 | Ga0496125_0113691 | 3300048928 | Bacteria | 1952 |
| 939 | Ga0496125_0401385 | 3300048928 | Bacteria | 801 |
| 940 | Ga0496125_0469501 | 3300048928 | Bacteria | 716 |
| 941 | Ga0496126_0016102 | 3300048929 | Bacteria | 7492 |
| 942 | Ga0496126_0040697 | 3300048929 | Bacteria | 4307 |
| 943 | Ga0496126_0070021 | 3300048929 | Bacteria | 3127 |
| 944 | Ga0496126_0094148 | 3300048929 | Bacteria | 2629 |
| 945 | Ga0496126_0170002 | 3300048929 | Bacteria | 1857 |
| 946 | Ga0496126_0190672 | 3300048929 | Bacteria | 1736 |
| 947 | Ga0496126_0197846 | 3300048929 | Bacteria | 1699 |
| 948 | Ga0496126_0396295 | 3300048929 | Bacteria | 1121 |
| 949 | Ga0496126_0398855 | 3300048929 | Bacteria | 1116 |
| 950 | Ga0496126_0687308 | 3300048929 | Bacteria | 797 |
| 951 | Ga0496126_0803606 | 3300048929 | Bacteria | 721 |
| 952 | Ga0496126_0875247 | 3300048929 | Bacteria | 683 |
| 953 | Ga0495678_201291 | 3300049459 | Bacteria | 614 |
| 954 | Ga0495682_0072313 | 3300049460 | Bacteria | 1241 |
| 955 | Ga0495682_0268113 | 3300049460 | Bacteria | 603 |
| 956 | Ga0501031_0636432 | 3300049568 | Bacteria | 686 |
| 957 | Ga0501041_0163322 | 3300049577 | Bacteria | 1393 |
| 958 | Ga0501042_0047355 | 3300049578 | Bacteria | 3066 |
| 959 | Ga0501047_0073783 | 3300049581 | Bacteria | 3285 |
| 960 | Ga0501047_0085598 | 3300049581 | Bacteria | 3029 |
| 961 | Ga0501067_0158543 | 3300049583 | Bacteria | 1260 |
| 962 | Ga0501067_0339273 | 3300049583 | Bacteria | 837 |
| 963 | Ga0501070_0006242 | 3300049586 | Bacteria | 10144 |
| 964 | Ga0501073_0023935 | 3300049589 | Bacteria | 4385 |
| 965 | Ga0501074_0015583 | 3300049590 | Bacteria | 5525 |
| 966 | Ga0501075_0189922 | 3300049591 | Bacteria | 1567 |
| 967 | Ga0501076_0060190 | 3300049592 | Bacteria | 3021 |
| 968 | Ga0501079_0215758 | 3300049741 | Bacteria | 1499 |
| 969 | Ga0501080_0004826 | 3300049742 | Bacteria | 12024 |
| 970 | Ga0501080_0190322 | 3300049742 | Bacteria | 1886 |
| 971 | nmdc:mga03683_476131_c1 | 3300050489 | Bacteria | 603 |
| 972 | nmdc:mga03n38_2026_c1 | 3300050490 | Bacteria | 6103 |
| 973 | nmdc:mga03n38_246621_c1 | 3300050490 | Bacteria | 942 |
| 974 | nmdc:mga03n38_49200_c1 | 3300050490 | Bacteria | 1873 |
| 975 | nmdc:mga03n38_82677_c1 | 3300050490 | Bacteria | 1512 |
| 976 | nmdc:mga00v17_159102_c1 | 3300050491 | Bacteria | 1453 |
| 977 | nmdc:mga00v17_19757_c1 | 3300050491 | Bacteria | 3851 |
| 978 | nmdc:mga00v17_218561_c1 | 3300050491 | Bacteria | 1234 |
| 979 | nmdc:mga00v17_670137_c1 | 3300050491 | Bacteria | 666 |
| 980 | nmdc:mga0yw44_105030_c1 | 3300050492 | Bacteria | 1804 |
| 981 | nmdc:mga0yw44_11629_c1 | 3300050492 | Bacteria | 4555 |
| 982 | nmdc:mga0yw44_190343_c1 | 3300050492 | Bacteria | 1353 |
| 983 | nmdc:mga0yw44_554060_c1 | 3300050492 | Bacteria | 781 |
| 984 | nmdc:mga0yw44_86642_c1 | 3300050492 | Bacteria | 1973 |
| 985 | nmdc:mga0k408_274866_c1 | 3300050493 | Bacteria | 1005 |
| 986 | nmdc:mga0k408_303614_c1 | 3300050493 | Bacteria | 953 |
| 987 | nmdc:mga0k408_392651_c1 | 3300050493 | Bacteria | 826 |
| 988 | nmdc:mga06z11_452609_c1 | 3300050494 | Bacteria | 776 |
| 989 | nmdc:mga04h51_192147_c1 | 3300050495 | Bacteria | 799 |
| 990 | nmdc:mga04h51_53354_c1 | 3300050495 | Bacteria | 1364 |
| 991 | nmdc:mga07m45_30559_c1 | 3300050496 | Bacteria | 2984 |
| 992 | nmdc:mga07m45_379708_c1 | 3300050496 | Bacteria | 821 |
| 993 | nmdc:mga07m45_49950_c1 | 3300050496 | Bacteria | 2356 |
| 994 | nmdc:mga09592_305767_c1 | 3300050508 | Bacteria | 1378 |
| 995 | nmdc:mga08y16_484874_c1 | 3300050511 | Bacteria | 1258 |
| 996 | nmdc:mga08y16_912480_c1 | 3300050511 | Bacteria | 864 |
| 997 | nmdc:mga0n895_1072292_c1 | 3300050512 | Bacteria | 784 |
| 998 | nmdc:mga0n895_149626_c1 | 3300050512 | Bacteria | 2364 |
| 999 | nmdc:mga0rr50_123032_c1 | 3300050513 | Bacteria | 2067 |
| 1000 | nmdc:mga0rr50_399001_c1 | 3300050513 | Bacteria | 1161 |
| 1001 | nmdc:mga08x19_871806_c1 | 3300050514 | Bacteria | 639 |
| 1002 | nmdc:mga0sz30_14133_c1 | 3300050516 | Bacteria | 3137 |
| 1003 | nmdc:mga0sz30_143211_c1 | 3300050516 | Bacteria | 1056 |
| 1004 | nmdc:mga0sz30_235547_c1 | 3300050516 | Bacteria | 815 |
| 1005 | Ga0495601_0062733 | 3300053077 | Bacteria | 2361 |
| 1006 | Ga0495601_0208358 | 3300053077 | Bacteria | 1277 |
| 1007 | Ga0495612_0024243 | 3300053078 | Bacteria | 2436 |
| 1008 | Ga0495612_0030931 | 3300053078 | Bacteria | 2157 |
| 1009 | Ga0495612_0398723 | 3300053078 | Bacteria | 625 |
| 1010 | Ga0495655_0117557 | 3300053083 | Bacteria | 806 |
| 1011 | Ga0495655_0249590 | 3300053083 | Bacteria | 596 |
| 1012 | Ga0495595_0010652 | 3300053084 | Bacteria | 3828 |
| 1013 | Ga0495619_0025683 | 3300053085 | Bacteria | 3785 |
| 1014 | Ga0495619_0933813 | 3300053085 | Bacteria | 582 |
| 1015 | Ga0500643_084096 | 3300053087 | Bacteria | 872 |
| 1016 | Ga0500581_141583 | 3300053089 | Bacteria | 1139 |
| 1017 | Ga0500646_0053203 | 3300053090 | Bacteria | 1173 |
| 1018 | Ga0500641_0012748 | 3300053096 | Bacteria | 3077 |
| 1019 | Ga0500641_0142583 | 3300053096 | Bacteria | 1035 |
| 1020 | Ga0500554_003298 | 3300053102 | Bacteria | 3288 |
| 1021 | Ga0500555_138893 | 3300053103 | Bacteria | 599 |
| 1022 | Ga0500556_0130236 | 3300053104 | Bacteria | 986 |
| 1023 | Ga0500562_014099 | 3300053108 | Bacteria | 2045 |
| 1024 | Ga0500594_0035967 | 3300053118 | Bacteria | 1331 |
| 1025 | Ga0500595_000159 | 3300053119 | Bacteria | 44312 |
| 1026 | Ga0500595_057239 | 3300053119 | Bacteria | 1188 |
| 1027 | Ga0500608_178779 | 3300053122 | Bacteria | 901 |
| 1028 | Ga0500559_0000870 | 3300053136 | Bacteria | 19374 |
| 1029 | Ga0500559_0545637 | 3300053136 | Bacteria | 529 |
| 1030 | Ga0500573_0225943 | 3300053140 | Bacteria | 979 |
| 1031 | Ga0500577_0053566 | 3300053142 | Bacteria | 1525 |
| 1032 | Ga0500589_192740 | 3300053147 | Bacteria | 790 |
| 1033 | Ga0500590_077349 | 3300053148 | Bacteria | 1642 |
| 1034 | Ga0500604_0073547 | 3300053151 | Bacteria | 1094 |
| 1035 | Ga0500627_0138149 | 3300053158 | Bacteria | 1101 |
| 1036 | Ga0500627_0338246 | 3300053158 | Bacteria | 651 |
| 1037 | Ga0500638_007983 | 3300053162 | Bacteria | 4477 |
| 1038 | Ga0500638_124805 | 3300053162 | Bacteria | 1174 |
| 1039 | Ga0500637_0000106 | 3300053178 | Bacteria | 29937 |
| 1040 | Ga0500611_082403 | 3300053727 | Bacteria | 805 |
| 1041 | Ga0500645_021806 | 3300053730 | Bacteria | 1974 |
| 1042 | Ga0500661_001729 | 3300055283 | Bacteria | 4109 |
| 1043 | Ga0501082_0209533 | 3300060353 | Bacteria | 1696 |
| 1044 | 2509153252 | 2508501128 | Bacteria | 8613869 |
| 1045 | 2513673587 | 2513237098 | Bacteria | 9902361 |
| 1046 | 2513691645 | 2513237101 | Bacteria | 7952346 |
| 1047 | 2524467673 | 2524023210 | Bacteria | 9029266 |
| 1048 | 2524537147 | 2524023228 | Bacteria | 10118060 |
| 1049 | 2723845935 | 2721755755 | Bacteria | 8322773 |
| 1050 | 2793079743 | |||
| 1051 | 2874609409 | 2874604998 | Bacteria | 7834745 |
| 1052 | 2876813204 | 2876808645 | Bacteria | 8824342 |
| 1053 | 2879110368 | 2879110137 | Bacteria | 8907982 |
| 1054 | 2885387584 | 2885383462 | Bacteria | 9473874 |
| 1055 | 2889040793 | 2889033259 | Bacteria | 9099371 |
| 1056 | 2903777481 | 2903768456 | Bacteria | 9749579 |
| 1057 | 2904704327 | |||
| 1058 | 2922367887 | 2922361189 | Bacteria | 7436256 |
| 1059 | 2922392222 | 2922386360 | Bacteria | 7017218 |
| 1060 | 8006941792 | 8006933436 | Bacteria | 10410654 |
| 1061 | 8006968720 | 8006964411 | Bacteria | 8966052 |
| 1062 | 8006981540 | 8006973647 | Bacteria | 10679141 |
| 1063 | 8006990539 | 8006984368 | Bacteria | 9651211 |
| 1064 | 8006996293 | 8006994254 | Bacteria | 8309700 |
| 1065 | 8056680667 | 8056673599 | Bacteria | 7871253 |
| 1066 | 8056684075 | 8056681323 | Bacteria | 8472857 |
| 1067 | Ga0395905_0198495 | |||
| 1068 | CNAas_1008573 | |||
| 1069 | CNAas_1011860 | |||
| 1070 | JGI24737J22298_10181753 | |||
| 1071 | JGI24034J26672_10095210 | |||
| 1072 | JGI24742J22300_10014608 | |||
| 1073 | JGI25406J46586_10002914 | |||
| 1074 | JGI25404J52841_10009700 | |||
| 1075 | JGI25404J52841_10011183 | |||
| 1076 | JGI25404J52841_10019955 | |||
| 1077 | JGI25404J52841_10022525 | |||
| 1078 | JGI25404J52841_10027405 | |||
| 1079 | JGI25404J52841_10038178 | |||
| 1080 | JGI25404J52841_10068562 | |||
| 1081 | Ga0055539_1005103 | |||
| 1082 | Ga0070658_10535292 | |||
| 1083 | Ga0070658_10654213 | |||
| 1084 | Ga0070658_10751728 | |||
| 1085 | Ga0070658_11014032 | |||
| 1086 | Ga0070676_10092030 | |||
| 1087 | Ga0070683_100056257 | |||
| 1088 | Ga0070683_100497299 | |||
| 1089 | Ga0070683_101524254 | |||
| 1090 | Ga0070670_100292139 | |||
| 1091 | Ga0070670_100485429 | |||
| 1092 | Ga0070670_100751096 | |||
| 1093 | Ga0070670_100914655 | |||
| 1094 | Ga0070670_101986963 | |||
| 1095 | Ga0068869_100110081 | |||
| 1096 | Ga0068869_100469046 | |||
| 1097 | Ga0070666_10153346 | |||
| 1098 | Ga0070680_100093870 | |||
| 1099 | Ga0070680_100102187 | |||
| 1100 | Ga0070680_100166453 | |||
| 1101 | Ga0070680_100324123 | |||
| 1102 | Ga0070680_100565829 | |||
| 1103 | Ga0070680_100822473 | |||
| 1104 | Ga0070680_101145347 | |||
| 1105 | Ga0070682_100179736 | |||
| 1106 | Ga0070682_100513659 | |||
| 1107 | Ga0068868_101009242 | |||
| 1108 | Ga0068868_101467993 | |||
| 1109 | Ga0070660_100037295 | |||
| 1110 | Ga0070660_100123482 | |||
| 1111 | Ga0070689_100565065 | |||
| 1112 | Ga0070687_101319858 | |||
| 1113 | Ga0070661_100087661 | |||
| 1114 | Ga0070661_100161593 | |||
| 1115 | Ga0070661_101180869 | |||
| 1116 | Ga0070668_100012717 | |||
| 1117 | Ga0070668_100019325 | |||
| 1118 | Ga0070668_100048293 | |||
| 1119 | Ga0070668_100677829 | |||
| 1120 | Ga0070668_100724821 | |||
| 1121 | Ga0070668_100782668 | |||
| 1122 | Ga0070669_100259764 | |||
| 1123 | Ga0070675_100452240 | |||
| 1124 | Ga0070675_101025269 | |||
| 1125 | Ga0070675_101456174 | |||
| 1126 | Ga0070671_100295162 | |||
| 1127 | Ga0070671_100404794 | |||
| 1128 | Ga0070671_100735591 | |||
| 1129 | Ga0070671_101103290 | |||
| 1130 | Ga0070674_100082336 | |||
| 1131 | Ga0070674_100230978 | |||
| 1132 | Ga0070673_100867830 | |||
| 1133 | Ga0070688_100968853 | |||
| 1134 | Ga0070659_100053186 | |||
| 1135 | Ga0070659_100064801 | |||
| 1136 | Ga0070659_100082245 | |||
| 1137 | Ga0070667_100204545 | |||
| 1138 | Ga0070709_10000143 | |||
| 1139 | Ga0070709_10091382 | |||
| 1140 | Ga0070709_10244805 | |||
| 1141 | Ga0070709_10280025 | |||
| 1142 | Ga0070714_100106966 | |||
| 1143 | Ga0070714_100190761 | |||
| 1144 | Ga0070714_100219183 | |||
| 1145 | Ga0070713_100055014 | |||
| 1146 | Ga0070713_100265572 | |||
| 1147 | Ga0070713_100876024 | |||
| 1148 | Ga0070713_101593956 | |||
| 1149 | Ga0070710_10000126 | |||
| 1150 | Ga0070710_10046166 | |||
| 1151 | Ga0070701_10660962 | |||
| 1152 | Ga0070711_100000463 | |||
| 1153 | Ga0070711_100644148 | |||
| 1154 | Ga0070711_101033908 | |||
| 1155 | Ga0070705_100351914 | |||
| 1156 | Ga0070700_100180839 | |||
| 1157 | Ga0070663_100022805 | |||
| 1158 | Ga0070663_100064259 | |||
| 1159 | Ga0070663_100594835 | |||
| 1160 | Ga0070678_100025097 | |||
| 1161 | Ga0070678_100307297 | |||
| 1162 | Ga0070678_100415125 | |||
| 1163 | Ga0070678_100460254 | |||
| 1164 | Ga0070678_100760775 | |||
| 1165 | Ga0070678_101785449 | |||
| 1166 | Ga0070662_100064919 | |||
| 1167 | Ga0070662_100275192 | |||
| 1168 | Ga0070662_100506371 | |||
| 1169 | Ga0070681_10044250 | |||
| 1170 | Ga0070681_10212397 | |||
| 1171 | Ga0070681_10931728 | |||
| 1172 | Ga0068867_100286433 | |||
| 1173 | Ga0068867_100583325 | |||
| 1174 | Ga0068867_101361880 | |||
| 1175 | Ga0070685_10395224 | |||
| 1176 | Ga0070685_11511271 | |||
| 1177 | Ga0070698_101170920 | |||
| 1178 | Ga0070699_101030680 | |||
| 1179 | Ga0070679_100058733 | |||
| 1180 | Ga0070679_100100749 | |||
| 1181 | Ga0070679_101167199 | |||
| 1182 | Ga0070679_101186594 | |||
| 1183 | Ga0070684_100150760 | |||
| 1184 | Ga0070684_100254351 | |||
| 1185 | Ga0070684_102268720 | |||
| 1186 | Ga0070697_100543921 | |||
| 1187 | Ga0070697_100881427 | |||
| 1188 | Ga0068853_100015603 | |||
| 1189 | Ga0068853_100155656 | |||
| 1190 | Ga0068853_100194126 | |||
| 1191 | Ga0068853_100423657 | |||
| 1192 | Ga0068853_100544713 | |||
| 1193 | Ga0068853_101267347 | |||
| 1194 | Ga0070672_100289320 | |||
| 1195 | Ga0070672_100389058 | |||
| 1196 | Ga0070695_100995485 | |||
| 1197 | Ga0070696_100257698 | |||
| 1198 | Ga0070693_100538829 | |||
| 1199 | Ga0070693_100591744 | |||
| 1200 | Ga0070665_100023461 | |||
| 1201 | Ga0070665_100034539 | |||
| 1202 | Ga0070665_100056491 | |||
| 1203 | Ga0070665_100104701 | |||
| 1204 | Ga0070665_100228565 | |||
| 1205 | Ga0070665_100320401 | |||
| 1206 | Ga0070665_100344844 | |||
| 1207 | Ga0070665_100713635 | |||
| 1208 | Ga0070665_100794010 | |||
| 1209 | Ga0070704_100187016 | |||
| 1210 | Ga0070704_100319955 | |||
| 1211 | Ga0068855_100048315 | |||
| 1212 | Ga0068855_100056614 | |||
| 1213 | Ga0068855_100065375 | |||
| 1214 | Ga0068855_100231300 | |||
| 1215 | Ga0068855_100794017 | |||
| 1216 | Ga0070664_100599483 | |||
| 1217 | Ga0070664_100907533 | |||
| 1218 | Ga0070664_100932861 | |||
| 1219 | Ga0068857_100386097 | |||
| 1220 | Ga0068857_101435290 | |||
| 1221 | Ga0068854_100132358 | |||
| 1222 | Ga0068854_100612229 | |||
| 1223 | Ga0068856_100000427 | |||
| 1224 | Ga0068856_100122370 | |||
| 1225 | Ga0068856_100156423 | |||
| 1226 | Ga0068856_100507765 | |||
| 1227 | Ga0068856_102105598 | |||
| 1228 | Ga0070702_100563841 | |||
| 1229 | Ga0070702_101409144 | |||
| 1230 | Ga0070702_101657630 | |||
| 1231 | Ga0068852_100060980 | |||
| 1232 | Ga0068852_100209157 | |||
| 1233 | Ga0068852_100231666 | |||
| 1234 | Ga0068852_100237706 | |||
| 1235 | Ga0068859_100088802 | |||
| 1236 | Ga0068859_100218683 | |||
| 1237 | Ga0068859_100246254 | |||
| 1238 | Ga0068864_100034773 | |||
| 1239 | Ga0068864_100078375 | |||
| 1240 | Ga0068864_100146361 | |||
| 1241 | Ga0068866_10096442 | |||
| 1242 | Ga0068861_100169895 | |||
| 1243 | Ga0068861_100222058 | |||
| 1244 | Ga0068861_100267518 | |||
| 1245 | Ga0068861_100732969 | |||
| 1246 | Ga0068851_10161264 | |||
| 1247 | Ga0068851_10590584 | |||
| 1248 | Ga0068870_10306939 | |||
| 1249 | Ga0068863_100448276 | |||
| 1250 | Ga0068863_101241014 | |||
| 1251 | Ga0068858_100104527 | |||
| 1252 | Ga0068858_100479126 | |||
| 1253 | Ga0068858_100826228 | |||
| 1254 | Ga0068858_100933894 | |||
| 1255 | Ga0068860_100039809 | |||
| 1256 | Ga0068860_100238512 | |||
| 1257 | Ga0068860_100389723 | |||
| 1258 | Ga0068860_100978554 | |||
| 1259 | Ga0068862_100117428 | |||
| 1260 | Ga0068862_100122280 | |||
| 1261 | Ga0068862_100533383 | |||
| 1262 | Ga0068862_100656072 | |||
| 1263 | Ga0068862_101536656 | |||
| 1264 | Ga0081455_10009802 | |||
| 1265 | Ga0081455_10035912 | |||
| 1266 | Ga0081455_10068093 | |||
| 1267 | Ga0081455_10846876 | |||
| 1268 | Ga0081538_10057136 | |||
| 1269 | Ga0081540_1000916 | |||
| 1270 | Ga0081540_1001429 | |||
| 1271 | Ga0081540_1001739 | |||
| 1272 | Ga0081540_1004038 | |||
| 1273 | Ga0081540_1006441 | |||
| 1274 | Ga0081540_1007634 | |||
| 1275 | Ga0081540_1013100 | |||
| 1276 | Ga0081540_1016574 | |||
| 1277 | Ga0081540_1017602 | |||
| 1278 | Ga0081540_1021438 | |||
| 1279 | Ga0081540_1052437 | |||
| 1280 | Ga0081540_1062891 | |||
| 1281 | Ga0081540_1078529 | |||
| 1282 | Ga0081540_1096268 | |||
| 1283 | Ga0081540_1143362 | |||
| 1284 | Ga0081540_1263752 | |||
| 1285 | Ga0081539_10000231 | |||
| 1286 | Ga0081539_10020178 | |||
| 1287 | Ga0081539_10128908 | |||
| 1288 | Ga0070717_10026354 | |||
| 1289 | Ga0070717_10598941 | |||
| 1290 | Ga0070717_10843871 | |||
| 1291 | Ga0070717_11316189 | |||
| 1292 | Ga0075365_10071063 | |||
| 1293 | Ga0075365_10156648 | |||
| 1294 | Ga0075365_10157775 | |||
| 1295 | Ga0075365_10160253 | |||
| 1296 | Ga0075365_10191316 | |||
| 1297 | Ga0075365_10852766 | |||
| 1298 | Ga0075365_10859929 | |||
| 1299 | Ga0075368_10094462 | |||
| 1300 | Ga0075368_10107625 | |||
| 1301 | Ga0075368_10201380 | |||
| 1302 | Ga0075363_100002264 | |||
| 1303 | Ga0075363_100086237 | |||
| 1304 | Ga0075363_100209882 | |||
| 1305 | Ga0075363_100688632 | |||
| 1306 | Ga0075364_10067002 | |||
| 1307 | Ga0075364_10103567 | |||
| 1308 | Ga0075364_10417588 | |||
| 1309 | Ga0070716_100004225 | |||
| 1310 | Ga0070716_100285528 | |||
| 1311 | Ga0070712_100138198 | |||
| 1312 | Ga0070712_100243493 | |||
| 1313 | Ga0070712_100399642 | |||
| 1314 | Ga0075367_10014174 | |||
| 1315 | Ga0075367_10193433 | |||
| 1316 | Ga0075367_10205611 | |||
| 1317 | Ga0075367_10241716 | |||
| 1318 | Ga0075369_10014506 | |||
| 1319 | Ga0075369_10153085 | |||
| 1320 | Ga0075366_10229302 | |||
| 1321 | Ga0075366_10397977 | |||
| 1322 | Ga0097621_100481468 | |||
| 1323 | Ga0097621_101046603 | |||
| 1324 | Ga0075370_10014665 | |||
| 1325 | Ga0075370_10094128 | |||
| 1326 | Ga0075370_10112537 | |||
| 1327 | Ga0068871_100277335 | |||
| 1328 | Ga0068871_100515253 | |||
| 1329 | Ga0068871_100589021 | |||
| 1330 | Ga0068871_101487307 | |||
| 1331 | Ga0075428_100954375 | |||
| 1332 | Ga0075428_102558670 | |||
| 1333 | Ga0075433_10482408 | |||
| 1334 | Ga0075434_100036482 | |||
| 1335 | Ga0075434_100168254 | |||
| 1336 | Ga0075434_100264985 | |||
| 1337 | Ga0075429_100664731 | |||
| 1338 | Ga0068865_100129407 | |||
| 1339 | Ga0068865_100401667 | |||
| 1340 | Ga0068865_100929633 | |||
| 1341 | Ga0097620_100088808 | |||
| 1342 | Ga0097620_100218675 | |||
| 1343 | Ga0097620_100246244 | |||
| 1344 | Ga0099824_1006719 | |||
| 1345 | Ga0099822_1001392 | |||
| 1346 | Ga0075435_100249144 | |||
| 1347 | Ga0075435_100547895 | |||
| 1348 | Ga0099794_10041335 | |||
| 1349 | Ga0099794_10199515 | |||
| 1350 | Ga0099794_10212188 | |||
| 1351 | Ga0105251_10121295 | |||
| 1352 | Ga0105250_10054913 | |||
| 1353 | Ga0105240_10153061 | |||
| 1354 | Ga0105240_10260454 | |||
| 1355 | Ga0111539_10960135 | |||
| 1356 | Ga0111539_11392682 | |||
| 1357 | Ga0105245_10109800 | |||
| 1358 | Ga0105245_10486099 | |||
| 1359 | Ga0105245_11662856 | |||
| 1360 | Ga0105247_10120706 | |||
| 1361 | Ga0105247_10166203 | |||
| 1362 | Ga0105247_10513644 | |||
| 1363 | Ga0105247_10600905 | |||
| 1364 | Ga0114129_12412544 | |||
| 1365 | Ga0105243_10469697 | |||
| 1366 | Ga0105243_10564963 | |||
| 1367 | Ga0105241_10636537 | |||
| 1368 | Ga0105242_10862240 | |||
| 1369 | Ga0105242_10936342 | |||
| 1370 | Ga0105248_10153172 | |||
| 1371 | Ga0105248_10376827 | |||
| 1372 | Ga0105248_11238695 | |||
| 1373 | Ga0105237_10026637 | |||
| 1374 | Ga0105237_10036735 | |||
| 1375 | Ga0105237_10127734 | |||
| 1376 | Ga0105237_10198680 | |||
| 1377 | Ga0105237_10387809 | |||
| 1378 | Ga0105238_10009508 | |||
| 1379 | Ga0105238_10073725 | |||
| 1380 | Ga0105238_10460573 | |||
| 1381 | Ga0105238_10571990 | |||
| 1382 | Ga0105238_10680673 | |||
| 1383 | Ga0105238_11467620 | |||
| 1384 | Ga0105249_10021352 | |||
| 1385 | Ga0105249_10318665 | |||
| 1386 | Ga0105249_10431874 | |||
| 1387 | Ga0105249_12075099 | |||
| 1388 | Ga0099796_10059578 | |||
| 1389 | Ga0105239_10091118 | |||
| 1390 | Ga0105239_10257165 | |||
| 1391 | Ga0105239_10546566 | |||
| 1392 | Ga0105239_10608557 | |||
| 1393 | Ga0105239_11023836 | |||
| 1394 | Ga0105239_11238901 | |||
| 1395 | Ga0105239_12162129 | |||
| 1396 | Ga0105246_10173385 | |||
| 1397 | Ga0105246_10179878 | |||
| 1398 | Ga0105246_10258415 | |||
| 1399 | Ga0105246_10347559 | |||
| 1400 | Ga0105246_10535679 | |||
| 1401 | Ga0157370_10169682 | |||
| 1402 | Ga0157370_10602529 | |||
| 1403 | Ga0157370_10952307 | |||
| 1404 | Ga0157369_10006177 | |||
| 1405 | Ga0157369_10252068 | |||
| 1406 | Ga0157369_10761890 | |||
| 1407 | Ga0157369_10951797 | |||
| 1408 | Ga0157369_11260805 | |||
| 1409 | Ga0157374_10017157 | |||
| 1410 | Ga0157374_10223801 | |||
| 1411 | Ga0157374_10871080 | |||
| 1412 | Ga0157374_11374465 | |||
| 1413 | Ga0157378_10009614 | |||
| 1414 | Ga0157378_10558617 | |||
| 1415 | Ga0157378_11092476 | |||
| 1416 | Ga0157378_11779650 | |||
| 1417 | Ga0163162_10043529 | |||
| 1418 | Ga0163162_10145032 | |||
| 1419 | Ga0163162_10212666 | |||
| 1420 | Ga0163162_10448645 | |||
| 1421 | Ga0163162_10513695 | |||
| 1422 | Ga0163162_10841669 | |||
| 1423 | Ga0163162_11403987 | |||
| 1424 | Ga0163162_11430050 | |||
| 1425 | Ga0163162_11579615 | |||
| 1426 | Ga0163162_11738738 | |||
| 1427 | Ga0163162_11901254 | |||
| 1428 | Ga0157372_10575187 | |||
| 1429 | Ga0157375_10127707 | |||
| 1430 | Ga0157375_10724973 | |||
| 1431 | Ga0157375_10966367 | |||
| 1432 | Ga0157375_11869152 | |||
| 1433 | Ga0163163_10020151 | |||
| 1434 | Ga0163163_10056573 | |||
| 1435 | Ga0163163_10132991 | |||
| 1436 | Ga0163163_10237128 | |||
| 1437 | Ga0163163_10240206 | |||
| 1438 | Ga0157380_10448674 | |||
| 1439 | Ga0157380_10971818 | |||
| 1440 | Ga0157377_10050237 | |||
| 1441 | Ga0157377_10115590 | |||
| 1442 | Ga0157377_10417613 | |||
| 1443 | Ga0157377_10565370 | |||
| 1444 | Ga0157379_10028544 | |||
| 1445 | Ga0157379_10554796 | |||
| 1446 | Ga0157379_10749570 | |||
| 1447 | Ga0157376_10158981 | |||
| 1448 | Ga0157376_11461163 | |||
| 1449 | Ga0157376_11871866 | |||
| 1450 | Ga0163161_10122245 | |||
| 1451 | Ga0163161_10132697 | |||
| 1452 | Ga0163161_11465018 | |||
| 1453 | Ga0206354_11068395 | |||
| 1454 | Ga0213874_10043018 | |||
| 1455 | Ga0213876_10041398 | |||
| 1456 | Ga0209677_101475 | |||
| 1457 | Ga0209758_1003786 | |||
| 1458 | Ga0209758_1018611 | |||
| 1459 | Ga0207697_10040482 | |||
| 1460 | Ga0207656_10473463 | |||
| 1461 | Ga0207692_10000587 | |||
| 1462 | Ga0207710_10112142 | |||
| 1463 | Ga0207688_10040207 | |||
| 1464 | Ga0207688_10289893 | |||
| 1465 | Ga0207688_10308206 | |||
| 1466 | Ga0207680_10044161 | |||
| 1467 | Ga0207647_10037524 | |||
| 1468 | Ga0207699_10000213 | |||
| 1469 | Ga0207699_10032169 | |||
| 1470 | Ga0207699_10134284 | |||
| 1471 | Ga0207699_10156838 | |||
| 1472 | Ga0207699_11030070 | |||
| 1473 | Ga0207645_10125547 | |||
| 1474 | Ga0207645_10194837 | |||
| 1475 | Ga0207643_10256744 | |||
| 1476 | Ga0207705_10064991 | |||
| 1477 | Ga0207705_10180623 | |||
| 1478 | Ga0207705_10561074 | |||
| 1479 | Ga0207705_10574011 | |||
| 1480 | Ga0207705_10747964 | |||
| 1481 | Ga0207684_10664686 | |||
| 1482 | Ga0207654_10090073 | |||
| 1483 | Ga0207654_10164611 | |||
| 1484 | Ga0207707_10056027 | |||
| 1485 | Ga0207707_10098953 | |||
| 1486 | Ga0207707_10601046 | |||
| 1487 | Ga0207707_10644558 | |||
| 1488 | Ga0207695_10043878 | |||
| 1489 | Ga0207671_10062855 | |||
| 1490 | Ga0207671_10085997 | |||
| 1491 | Ga0207671_10189261 | |||
| 1492 | Ga0207671_10212903 | |||
| 1493 | Ga0207671_10852750 | |||
| 1494 | Ga0207693_10031210 | |||
| 1495 | Ga0207663_10000304 | |||
| 1496 | Ga0207663_10538326 | |||
| 1497 | Ga0207663_10833366 | |||
| 1498 | Ga0207660_10003538 | |||
| 1499 | Ga0207660_10255032 | |||
| 1500 | Ga0207660_10502645 | |||
| 1501 | Ga0207662_10342968 | |||
| 1502 | Ga0207662_10735351 | |||
| 1503 | Ga0207657_10011777 | |||
| 1504 | Ga0207657_10526992 | |||
| 1505 | Ga0207649_10082861 | |||
| 1506 | Ga0207649_10136967 | |||
| 1507 | Ga0207649_10321871 | |||
| 1508 | Ga0207649_10348851 | |||
| 1509 | Ga0207652_10010392 | |||
| 1510 | Ga0207652_10057070 | |||
| 1511 | Ga0207652_10094892 | |||
| 1512 | Ga0207652_10390846 | |||
| 1513 | Ga0207652_10564527 | |||
| 1514 | Ga0207646_10525460 | |||
| 1515 | Ga0207681_10625309 | |||
| 1516 | Ga0207681_10685890 | |||
| 1517 | Ga0207694_10039712 | |||
| 1518 | Ga0207694_10305118 | |||
| 1519 | Ga0207694_10662210 | |||
| 1520 | Ga0207650_10237550 | |||
| 1521 | Ga0207650_10400086 | |||
| 1522 | Ga0207659_10355750 | |||
| 1523 | Ga0207687_10463769 | |||
| 1524 | Ga0207700_10125547 | |||
| 1525 | Ga0207700_10222486 | |||
| 1526 | Ga0207700_10371938 | |||
| 1527 | Ga0207700_10410299 | |||
| 1528 | Ga0207664_10004162 | |||
| 1529 | Ga0207664_10094827 | |||
| 1530 | Ga0207664_10215707 | |||
| 1531 | Ga0207664_10943810 | |||
| 1532 | Ga0207644_10234898 | |||
| 1533 | Ga0207690_10164038 | |||
| 1534 | Ga0207690_10232259 | |||
| 1535 | Ga0207706_10428902 | |||
| 1536 | Ga0207706_10509559 | |||
| 1537 | Ga0207686_10282396 | |||
| 1538 | Ga0207686_10538272 | |||
| 1539 | Ga0207709_10139003 | |||
| 1540 | Ga0207670_10800443 | |||
| 1541 | Ga0207669_10079874 | |||
| 1542 | Ga0207669_10612231 | |||
| 1543 | Ga0207704_10182026 | |||
| 1544 | Ga0207704_11036772 | |||
| 1545 | Ga0207665_10003342 | |||
| 1546 | Ga0207665_10060764 | |||
| 1547 | Ga0207665_10174456 | |||
| 1548 | Ga0207691_10167731 | |||
| 1549 | Ga0207691_10321591 | |||
| 1550 | Ga0207711_10639202 | |||
| 1551 | Ga0207689_10046690 | |||
| 1552 | Ga0207689_10062008 | |||
| 1553 | Ga0207689_10303097 | |||
| 1554 | Ga0207661_10034196 | |||
| 1555 | Ga0207661_10053586 | |||
| 1556 | Ga0207661_11301716 | |||
| 1557 | Ga0207679_10126987 | |||
| 1558 | Ga0207679_10472119 | |||
| 1559 | Ga0207679_10522478 | |||
| 1560 | Ga0207667_10013254 | |||
| 1561 | Ga0207667_10046644 | |||
| 1562 | Ga0207667_10321334 | |||
| 1563 | Ga0207667_10566787 | |||
| 1564 | Ga0207667_10715606 | |||
| 1565 | Ga0207667_10762672 | |||
| 1566 | Ga0207651_10727552 | |||
| 1567 | Ga0207651_10787306 | |||
| 1568 | Ga0207712_10044384 | |||
| 1569 | Ga0207712_10147293 | |||
| 1570 | Ga0207712_10526397 | |||
| 1571 | Ga0207668_10006173 | |||
| 1572 | Ga0207668_10052999 | |||
| 1573 | Ga0207668_10072120 | |||
| 1574 | Ga0207668_10309654 | |||
| 1575 | Ga0207668_10329667 | |||
| 1576 | Ga0207668_10444532 | |||
| 1577 | Ga0207668_10598156 | |||
| 1578 | Ga0207668_10670224 | |||
| 1579 | Ga0207640_10392586 | |||
| 1580 | Ga0207640_10493661 | |||
| 1581 | Ga0207640_10748937 | |||
| 1582 | Ga0207658_10704644 | |||
| 1583 | Ga0207658_10894756 | |||
| 1584 | Ga0207677_10323632 | |||
| 1585 | Ga0207677_11077078 | |||
| 1586 | Ga0207703_10074611 | |||
| 1587 | Ga0207703_10181813 | |||
| 1588 | Ga0207703_10266695 | |||
| 1589 | Ga0207703_10356795 | |||
| 1590 | Ga0207703_10384341 | |||
| 1591 | Ga0207703_10512505 | |||
| 1592 | Ga0207703_10617983 | |||
| 1593 | Ga0207639_10014213 | |||
| 1594 | Ga0207639_10049278 | |||
| 1595 | Ga0207639_10123103 | |||
| 1596 | Ga0207639_10229703 | |||
| 1597 | Ga0207639_10309613 | |||
| 1598 | Ga0207639_10360046 | |||
| 1599 | Ga0207639_10471443 | |||
| 1600 | Ga0207639_11139230 | |||
| 1601 | Ga0207678_10024919 | |||
| 1602 | Ga0207678_10056612 | |||
| 1603 | Ga0207678_10333411 | |||
| 1604 | Ga0207678_10506288 | |||
| 1605 | Ga0207708_10066372 | |||
| 1606 | Ga0207708_10868245 | |||
| 1607 | Ga0207702_10002818 | |||
| 1608 | Ga0207702_10085484 | |||
| 1609 | Ga0207641_10214822 | |||
| 1610 | Ga0207641_10592874 | |||
| 1611 | Ga0207641_10856278 | |||
| 1612 | Ga0207648_10522821 | |||
| 1613 | Ga0207648_10541905 | |||
| 1614 | Ga0207648_10788658 | |||
| 1615 | Ga0207648_11369053 | |||
| 1616 | Ga0207676_10119945 | |||
| 1617 | Ga0207676_10215002 | |||
| 1618 | Ga0207676_10521472 | |||
| 1619 | Ga0207676_10592123 | |||
| 1620 | Ga0207674_10092290 | |||
| 1621 | Ga0207674_10311722 | |||
| 1622 | Ga0207675_100102647 | |||
| 1623 | Ga0207675_100334934 | |||
| 1624 | Ga0207675_100491540 | |||
| 1625 | Ga0207675_100954021 | |||
| 1626 | Ga0207675_102110906 | |||
| 1627 | Ga0207683_10035270 | |||
| 1628 | Ga0207683_10069997 | |||
| 1629 | Ga0207683_10238787 | |||
| 1630 | Ga0207683_10306453 | |||
| 1631 | Ga0207683_10494754 | |||
| 1632 | Ga0207683_10629424 | |||
| 1633 | Ga0207683_10955186 | |||
| 1634 | Ga0207683_11827649 | |||
| 1635 | Ga0207698_10066227 | |||
| 1636 | Ga0207698_10146670 | |||
| 1637 | Ga0207698_10249335 | |||
| 1638 | Ga0207698_12207185 | |||
| 1639 | Ga0209589_1000023 | |||
| 1640 | Ga0209489_100032 | |||
| 1641 | Ga0209700_100040 | |||
| 1642 | Ga0209179_1010194 | |||
| 1643 | Ga0209588_1013209 | |||
| 1644 | Ga0209813_10045419 | |||
| 1645 | Ga0209813_10063519 | |||
| 1646 | Ga0268266_10004462 | |||
| 1647 | Ga0268266_10014083 | |||
| 1648 | Ga0268266_10237848 | |||
| 1649 | Ga0268266_10307922 | |||
| 1650 | Ga0268266_10682882 | |||
| 1651 | Ga0268266_10961409 | |||
| 1652 | Ga0268265_10229471 | |||
| 1653 | Ga0268265_10456757 | |||
| 1654 | Ga0268265_11016967 | |||
| 1655 | Ga0268264_10322468 | |||
| 1656 | Ga0268264_10336108 | |||
| 1657 | Ga0268264_10370329 | |||
| 1658 | Ga0268264_10387080 | |||
| 1659 | Ga0268264_11630566 | |||
| 1660 | Ga0307517_10000369 | |||
| 1661 | Ga0307515_10065881 | |||
| 1662 | Ga0307515_10190456 | |||
| 1663 | Ga0307515_10498837 | |||
| 1664 | Ga0307511_10199720 | |||
| 1665 | Ga0265763_1003947 | |||
| 1666 | Ga0265330_10050130 | |||
| 1667 | Ga0265329_10048148 | |||
| 1668 | Ga0265340_10336056 | |||
| 1669 | Ga0265339_10029554 | |||
| 1670 | Ga0265316_10357304 | |||
| 1671 | Ga0307513_10099517 | |||
| 1672 | Ga0307509_10094849 | |||
| 1673 | Ga0307508_10000010 | |||
| 1674 | Ga0307508_10177854 | |||
| 1675 | Ga0307508_10382799 | |||
| 1676 | Ga0307508_10869620 | |||
| 1677 | Ga0265314_10003900 | |||
| 1678 | Ga0307516_10621641 | |||
| 1679 | Ga0307405_10384095 | |||
| 1680 | Ga0307413_10207496 | |||
| 1681 | Ga0307410_10214900 | |||
| 1682 | Ga0307410_10273750 | |||
| 1683 | Ga0307406_10385022 | |||
| 1684 | Ga0307406_10681189 | |||
| 1685 | Ga0307406_10685922 | |||
| 1686 | Ga0307407_10759737 | |||
| 1687 | Ga0307412_10373319 | |||
| 1688 | Ga0307409_100090639 | |||
| 1689 | Ga0307416_100260662 | |||
| 1690 | Ga0307416_101351443 | |||
| 1691 | Ga0307414_10267972 | |||
| 1692 | Ga0307411_10345048 | |||
| 1693 | Ga0307411_11052309 | |||
| 1694 | Ga0307415_100072259 | |||
| 1695 | Ga0307415_100148779 | |||
| 1696 | Ga0307510_10007185 | |||
| 1697 | Ga0307510_10045483 | |||
| 1698 | Ga0316214_1022723 | |||
| 1699 | Ga0373959_0154131 | |||
| 1700 | Ga0373926_0013254 | |||
| 1701 | Ga0373940_0099315 | |||
| 1702 | Ga0373944_0048009 | |||
| 1703 | Ga0373923_0014328 | |||
| 1704 | Ga0373923_0162978 | |||
| 1705 | Ga0373936_0009767 | |||
| 1706 | Ga0373936_0429905 | |||
| 1707 | Ga0373945_0031608 | |||
| 1708 | Ga0373953_0063091 | |||
| 1709 | Ga0373953_0185978 | |||
| 1710 | Ga0373954_0080108 | |||
| 1711 | Ga0373954_0286292 | |||
| 1712 | Ga0373956_0407757 | |||
| 1713 | Ga0373943_0707038 | |||
| 1714 | Ga0373946_0008582 | |||
| 1715 | Ga0373955_0006653 | |||
| 1716 | Ga0373955_1052922 | |||
| 1717 | Ga0373924_0038427 | |||
| 1718 | Ga0373924_0176762 | |||
| 1719 | Ga0373924_0319214 | |||
| 1720 | Ga0373931_0012857 | |||
| 1721 | Ga0373931_1287738 | |||
| 1722 | Ga0373935_0371438 | |||
| 1723 | Ga0373935_0535805 | |||
| 1724 | Ga0373927_0017113 | |||
| 1725 | Ga0373927_0042999 | |||
| 1726 | Ga0373927_0155359 | |||
| 1727 | Ga0373927_0487544 | |||
| 1728 | Ga0373927_0835763 | |||
| 1729 | Ga0373933_0118882 | |||
| 1730 | Ga0373933_0331337 | |||
| 1731 | Ga0373933_0558077 | |||
| 1732 | Ga0373947_0003273 | |||
| 1733 | Ga0373947_0817888 | |||
| 1734 | Ga0373937_0025703 | |||
| 1735 | Ga0372808_025885 | |||
| 1736 | Ga0373925_0033662 | |||
| 1737 | Ga0373925_0181838 | |||
| 1738 | Ga0395899_0269481 | |||
| 1739 | Ga0395900_0233613 | |||
| 1740 | Ga0395898_0651972 | |||
| 1741 | Ga0395905_0432620 | |||
| 1742 | Ga0395901_0230698 | |||
| 1743 | Ga0395901_0650263 | |||
| 1744 | Ga0436365_1450483 | |||
| 1745 | Ga0436360_0868147 | |||
| 1746 | Ga0436363_0568357 | |||
| 1747 | Ga0436363_0671415 | |||
| 1748 | Ga0436363_0784172 | |||
| 1749 | Ga0436363_1485995 | |||
| 1750 | Ga0436362_0917119 | |||
| 1751 | Ga0451791_0544621 | |||
| 1752 | Ga0451793_0675627 | |||
| 1753 | Ga0451800_0695612 | |||
| 1754 | Ga0451800_1652685 | |||
| 1755 | Ga0451802_0959116 | |||
| 1756 | Ga0451835_1010143 | |||
| 1757 | Ga0451837_0761693 | |||
| 1758 | Ga0451839_0367782 | |||
| 1759 | Ga0451855_1343022 | |||
| 1760 | Ga0450904_020118 | |||
| 1761 | Ga0439459_0055943 | |||
| 1762 | Ga0466970_0572651 | |||
| 1763 | Ga0466957_0439831 | |||
| 1764 | Ga0466967_0105415 | |||
| 1765 | Ga0495617_045104 | |||
| 1766 | Ga0495592_0064177 | |||
| 1767 | Ga0495592_0182927 | |||
| 1768 | Ga0495603_0035061 | |||
| 1769 | Ga0495603_0291720 | |||
| 1770 | Ga0495590_0104124 | |||
| 1771 | Ga0495591_064537 | |||
| 1772 | Ga0495629_0080062 | |||
| 1773 | Ga0495629_0111304 | |||
| 1774 | Ga0495629_0160859 | |||
| 1775 | Ga0495638_0121782 | |||
| 1776 | Ga0495638_0174056 | |||
| 1777 | Ga0495651_0075593 | |||
| 1778 | Ga0495653_0444544 | |||
| 1779 | Ga0495650_0129986 | |||
| 1780 | Ga0495650_0157760 | |||
| 1781 | Ga0495580_0007113 | |||
| 1782 | Ga0495582_0027504 | |||
| 1783 | Ga0495582_0177918 | |||
| 1784 | Ga0495582_0204163 | |||
| 1785 | Ga0495605_0118651 | |||
| 1786 | Ga0495605_0123054 | |||
| 1787 | Ga0495605_0257859 | |||
| 1788 | Ga0495639_0021589 | |||
| 1789 | Ga0495639_0037553 | |||
| 1790 | Ga0495662_0047199 | |||
| 1791 | Ga0495662_0106213 | |||
| 1792 | Ga0495664_0004051 | |||
| 1793 | Ga0495664_0113015 | |||
| 1794 | Ga0495664_0229315 | |||
| 1795 | Ga0495584_0642366 | |||
| 1796 | Ga0495585_0155620 | |||
| 1797 | Ga0495585_0212482 | |||
| 1798 | Ga0495594_0109099 | |||
| 1799 | Ga0495607_0166995 | |||
| 1800 | Ga0495583_0077729 | |||
| 1801 | Ga0495606_0161738 | |||
| 1802 | Ga0495606_0258888 | |||
| 1803 | Ga0495608_0333429 | |||
| 1804 | Ga0495616_0114780 | |||
| 1805 | Ga0495616_0274151 | |||
| 1806 | Ga0495618_0088495 | |||
| 1807 | Ga0495620_0035717 | |||
| 1808 | Ga0495628_0210238 | |||
| 1809 | Ga0495628_0229379 | |||
| 1810 | Ga0495630_0006245 | |||
| 1811 | Ga0495630_0096605 | |||
| 1812 | Ga0495630_0833993 | |||
| 1813 | Ga0495631_0102182 | |||
| 1814 | Ga0495632_0136221 | |||
| 1815 | Ga0495632_0377592 | |||
| 1816 | Ga0495632_0408256 | |||
| 1817 | Ga0495637_0096047 | |||
| 1818 | Ga0495648_0209796 | |||
| 1819 | Ga0495648_0261096 | |||
| 1820 | Ga0495666_0148222 | |||
| 1821 | Ga0495666_0505550 | |||
| 1822 | Ga0495666_0575748 | |||
| 1823 | Ga0495642_0309219 | |||
| 1824 | Ga0495652_0402101 | |||
| 1825 | Ga0495640_0053476 | |||
| 1826 | Ga0495640_0249826 | |||
| 1827 | Ga0495586_0220394 | |||
| 1828 | Ga0495587_0190063 | |||
| 1829 | Ga0495587_0329079 | |||
| 1830 | Ga0495598_0050273 | |||
| 1831 | Ga0495598_0174654 | |||
| 1832 | Ga0495609_0044599 | |||
| 1833 | Ga0495621_0170572 | |||
| 1834 | Ga0495645_0023446 | |||
| 1835 | Ga0495645_0204776 | |||
| 1836 | Ga0495645_0268304 | |||
| 1837 | Ga0495645_0306564 | |||
| 1838 | Ga0495667_0016699 | |||
| 1839 | Ga0495656_0094736 | |||
| 1840 | Ga0495656_0141813 | |||
| 1841 | Ga0495668_0355102 | |||
| 1842 | Ga0495668_0525251 | |||
| 1843 | Ga0495634_0005414 | |||
| 1844 | Ga0495634_0047319 | |||
| 1845 | Ga0495634_0695017 | |||
| 1846 | Ga0495625_0103563 | |||
| 1847 | Ga0495625_0150642 | |||
| 1848 | Ga0495625_0151747 | |||
| 1849 | Ga0495625_0369321 | |||
| 1850 | Ga0495625_0781764 | |||
| 1851 | Ga0495635_0095062 | |||
| 1852 | Ga0495635_0666119 | |||
| 1853 | Ga0495659_0074994 | |||
| 1854 | Ga0495657_0286095 | |||
| 1855 | Ga0495599_0091460 | |||
| 1856 | Ga0495599_0335592 | |||
| 1857 | Ga0495623_0696833 | |||
| 1858 | Ga0495646_0083582 | |||
| 1859 | Ga0495647_0016692 | |||
| 1860 | Ga0495658_0005198 | |||
| 1861 | Ga0495658_0078457 | |||
| 1862 | Ga0495669_0130308 | |||
| 1863 | Ga0495669_0148919 | |||
| 1864 | Ga0495669_0251678 | |||
| 1865 | Ga0495669_0280605 | |||
| 1866 | Ga0495613_0071090 | |||
| 1867 | Ga0495624_0485612 | |||
| 1868 | Ga0495670_0320223 | |||
| 1869 | Ga0495670_0356664 | |||
| 1870 | Ga0495600_0349977 | |||
| 1871 | Ga0495600_0384134 | |||
| 1872 | Ga0495581_0018727 | |||
| 1873 | Ga0495581_0161209 | |||
| 1874 | Ga0495581_0251886 | |||
| 1875 | Ga0495581_0264045 | |||
| 1876 | Ga0495581_0328773 | |||
| 1877 | Ga0495581_0464878 | |||
| 1878 | Ga0495604_0064711 | |||
| 1879 | Ga0495674_0009113 | |||
| 1880 | Ga0495674_0623877 | |||
| 1881 | Ga0495674_0705550 | |||
| 1882 | Ga0495672_0049429 | |||
| 1883 | Ga0495672_0114268 | |||
| 1884 | Ga0495672_0192590 | |||
| 1885 | Ga0495676_0035019 | |||
| 1886 | Ga0495676_0462322 | |||
| 1887 | Ga0495676_0514920 | |||
| 1888 | Ga0495683_0160402 | |||
| 1889 | Ga0495675_0135746 | |||
| 1890 | Ga0495677_0067245 | |||
| 1891 | Ga0495677_0118314 | |||
| 1892 | Ga0495681_0175160 | |||
| 1893 | Ga0495686_0097878 | |||
| 1894 | Ga0495686_0367911 | |||
| 1895 | Ga0495686_0481510 | |||
| 1896 | Ga0495593_0106071 | |||
| 1897 | Ga0495593_0590213 | |||
| 1898 | Ga0495602_0147114 | |||
| 1899 | Ga0495602_0277663 | |||
| 1900 | Ga0495602_0631168 | |||
| 1901 | Ga0495614_0211824 | |||
| 1902 | Ga0495615_0326478 | |||
| 1903 | Ga0496100_0030053 | |||
| 1904 | Ga0496100_0230575 | |||
| 1905 | Ga0496100_0266579 | |||
| 1906 | Ga0496100_0421724 | |||
| 1907 | Ga0496100_0433148 | |||
| 1908 | Ga0496101_0272806 | |||
| 1909 | Ga0496101_0307438 | |||
| 1910 | Ga0496101_0351646 | |||
| 1911 | Ga0496102_0017316 | |||
| 1912 | Ga0496102_0052522 | |||
| 1913 | Ga0496102_0088277 | |||
| 1914 | Ga0496102_0148842 | |||
| 1915 | Ga0496102_0179443 | |||
| 1916 | Ga0496102_0330375 | |||
| 1917 | Ga0496102_0334140 | |||
| 1918 | Ga0496102_0463974 | |||
| 1919 | Ga0496102_0973526 | |||
| 1920 | Ga0496102_0975761 | |||
| 1921 | Ga0496103_0043903 | |||
| 1922 | Ga0496103_0094923 | |||
| 1923 | Ga0496103_0249249 | |||
| 1924 | Ga0496103_0332596 | |||
| 1925 | Ga0496103_0521318 | |||
| 1926 | Ga0496104_0011106 | |||
| 1927 | Ga0496104_0028694 | |||
| 1928 | Ga0496104_0041875 | |||
| 1929 | Ga0496104_0367872 | |||
| 1930 | Ga0496105_0069731 | |||
| 1931 | Ga0496105_0094951 | |||
| 1932 | Ga0496105_0288925 | |||
| 1933 | Ga0496105_0472771 | |||
| 1934 | Ga0496105_0967159 | |||
| 1935 | Ga0496105_1077251 | |||
| 1936 | Ga0496106_0000796 | |||
| 1937 | Ga0496106_0039046 | |||
| 1938 | Ga0496106_0355013 | |||
| 1939 | Ga0496106_0688928 | |||
| 1940 | Ga0496106_0731644 | |||
| 1941 | Ga0496107_0001290 | |||
| 1942 | Ga0496107_0014938 | |||
| 1943 | Ga0496107_0435271 | |||
| 1944 | Ga0496107_1239308 | |||
| 1945 | Ga0496108_0002231 | |||
| 1946 | Ga0496108_0028557 | |||
| 1947 | Ga0496108_0123386 | |||
| 1948 | Ga0496108_0246693 | |||
| 1949 | Ga0496108_0432079 | |||
| 1950 | Ga0496109_0000399 | |||
| 1951 | Ga0496109_0034945 | |||
| 1952 | Ga0496109_0070531 | |||
| 1953 | Ga0496109_0076040 | |||
| 1954 | Ga0496109_0866003 | |||
| 1955 | Ga0496109_1014516 | |||
| 1956 | Ga0496110_0021658 | |||
| 1957 | Ga0496110_0049839 | |||
| 1958 | Ga0496110_0090401 | |||
| 1959 | Ga0496110_0573115 | |||
| 1960 | Ga0496110_0817931 | |||
| 1961 | Ga0496110_1454524 | |||
| 1962 | Ga0496111_0035884 | |||
| 1963 | Ga0496111_0038257 | |||
| 1964 | Ga0496111_0054689 | |||
| 1965 | Ga0496111_0075789 | |||
| 1966 | Ga0496111_0455996 | |||
| 1967 | Ga0496112_0005242 | |||
| 1968 | Ga0496112_0006435 | |||
| 1969 | Ga0496112_0113335 | |||
| 1970 | Ga0496112_0113796 | |||
| 1971 | Ga0496112_0177089 | |||
| 1972 | Ga0496112_0241189 | |||
| 1973 | Ga0496112_0366439 | |||
| 1974 | Ga0496113_0093717 | |||
| 1975 | Ga0496113_0150221 | |||
| 1976 | Ga0496114_0045894 | |||
| 1977 | Ga0496114_0097042 | |||
| 1978 | Ga0496114_0190755 | |||
| 1979 | Ga0496114_0339750 | |||
| 1980 | Ga0496114_0615795 | |||
| 1981 | Ga0496114_0715270 | |||
| 1982 | Ga0496115_0002110 | |||
| 1983 | Ga0496115_0084102 | |||
| 1984 | Ga0496115_0104092 | |||
| 1985 | Ga0496115_0106326 | |||
| 1986 | Ga0496115_0108995 | |||
| 1987 | Ga0496115_0473009 | |||
| 1988 | Ga0496115_0518619 | |||
| 1989 | Ga0496115_1169145 | |||
| 1990 | Ga0496115_1259450 | |||
| 1991 | Ga0496118_0106777 | |||
| 1992 | Ga0496118_0211719 | |||
| 1993 | Ga0496118_0322575 | |||
| 1994 | Ga0496119_0082328 | |||
| 1995 | Ga0496119_0278867 | |||
| 1996 | Ga0496121_0095634 | |||
| 1997 | Ga0496121_0290721 | |||
| 1998 | Ga0496121_0475393 | |||
| 1999 | Ga0496121_0539301 | |||
| 2000 | Ga0496122_0115599 | |||
| 2001 | Ga0496124_0154878 | |||
| 2002 | Ga0496124_0296501 | |||
| 2003 | Ga0496125_0074135 | |||
| 2004 | Ga0496125_0113691 | |||
| 2005 | Ga0496125_0401385 | |||
| 2006 | Ga0496125_0469501 | |||
| 2007 | Ga0496126_0016102 | |||
| 2008 | Ga0496126_0040697 | |||
| 2009 | Ga0496126_0070021 | |||
| 2010 | Ga0496126_0094148 | |||
| 2011 | Ga0496126_0170002 | |||
| 2012 | Ga0496126_0190672 | |||
| 2013 | Ga0496126_0197846 | |||
| 2014 | Ga0496126_0396295 | |||
| 2015 | Ga0496126_0398855 | |||
| 2016 | Ga0496126_0687308 | |||
| 2017 | Ga0496126_0803606 | |||
| 2018 | Ga0496126_0875247 | |||
| 2019 | Ga0495678_201291 | |||
| 2020 | Ga0495682_0072313 | |||
| 2021 | Ga0495682_0268113 | |||
| 2022 | Ga0501031_0636432 | |||
| 2023 | Ga0501041_0163322 | |||
| 2024 | Ga0501042_0047355 | |||
| 2025 | Ga0501047_0073783 | |||
| 2026 | Ga0501047_0085598 | |||
| 2027 | Ga0501067_0158543 | |||
| 2028 | Ga0501067_0339273 | |||
| 2029 | Ga0501070_0006242 | |||
| 2030 | Ga0501073_0023935 | |||
| 2031 | Ga0501074_0015583 | |||
| 2032 | Ga0501075_0189922 | |||
| 2033 | Ga0501076_0060190 | |||
| 2034 | Ga0501079_0215758 | |||
| 2035 | Ga0501080_0004826 | |||
| 2036 | Ga0501080_0190322 | |||
| 2037 | nmdc:mga03683_476131_c1 | |||
| 2038 | nmdc:mga03n38_2026_c1 | |||
| 2039 | nmdc:mga03n38_246621_c1 | |||
| 2040 | nmdc:mga03n38_49200_c1 | |||
| 2041 | nmdc:mga03n38_82677_c1 | |||
| 2042 | nmdc:mga00v17_159102_c1 | |||
| 2043 | nmdc:mga00v17_19757_c1 | |||
| 2044 | nmdc:mga00v17_218561_c1 | |||
| 2045 | nmdc:mga00v17_670137_c1 | |||
| 2046 | nmdc:mga0yw44_105030_c1 | |||
| 2047 | nmdc:mga0yw44_11629_c1 | |||
| 2048 | nmdc:mga0yw44_190343_c1 | |||
| 2049 | nmdc:mga0yw44_554060_c1 | |||
| 2050 | nmdc:mga0yw44_86642_c1 | |||
| 2051 | nmdc:mga0k408_274866_c1 | |||
| 2052 | nmdc:mga0k408_303614_c1 | |||
| 2053 | nmdc:mga0k408_392651_c1 | |||
| 2054 | nmdc:mga06z11_452609_c1 | |||
| 2055 | nmdc:mga04h51_192147_c1 | |||
| 2056 | nmdc:mga04h51_53354_c1 | |||
| 2057 | nmdc:mga07m45_30559_c1 | |||
| 2058 | nmdc:mga07m45_379708_c1 | |||
| 2059 | nmdc:mga07m45_49950_c1 | |||
| 2060 | nmdc:mga09592_305767_c1 | |||
| 2061 | nmdc:mga08y16_484874_c1 | |||
| 2062 | nmdc:mga08y16_912480_c1 | |||
| 2063 | nmdc:mga0n895_1072292_c1 | |||
| 2064 | nmdc:mga0n895_149626_c1 | |||
| 2065 | nmdc:mga0rr50_123032_c1 | |||
| 2066 | nmdc:mga0rr50_399001_c1 | |||
| 2067 | nmdc:mga08x19_871806_c1 | |||
| 2068 | nmdc:mga0sz30_14133_c1 | |||
| 2069 | nmdc:mga0sz30_143211_c1 | |||
| 2070 | nmdc:mga0sz30_235547_c1 | |||
| 2071 | Ga0495601_0062733 | |||
| 2072 | Ga0495601_0208358 | |||
| 2073 | Ga0495612_0024243 | |||
| 2074 | Ga0495612_0030931 | |||
| 2075 | Ga0495612_0398723 | |||
| 2076 | Ga0495655_0117557 | |||
| 2077 | Ga0495655_0249590 | |||
| 2078 | Ga0495595_0010652 | |||
| 2079 | Ga0495619_0025683 | |||
| 2080 | Ga0495619_0933813 | |||
| 2081 | Ga0500643_084096 | |||
| 2082 | Ga0500581_141583 | |||
| 2083 | Ga0500646_0053203 | |||
| 2084 | Ga0500641_0012748 | |||
| 2085 | Ga0500641_0142583 | |||
| 2086 | Ga0500554_003298 | |||
| 2087 | Ga0500555_138893 | |||
| 2088 | Ga0500556_0130236 | |||
| 2089 | Ga0500562_014099 | |||
| 2090 | Ga0500594_0035967 | |||
| 2091 | Ga0500595_000159 | |||
| 2092 | Ga0500595_057239 | |||
| 2093 | Ga0500608_178779 | |||
| 2094 | Ga0500559_0000870 | |||
| 2095 | Ga0500559_0545637 | |||
| 2096 | Ga0500573_0225943 | |||
| 2097 | Ga0500577_0053566 | |||
| 2098 | Ga0500589_192740 | |||
| 2099 | Ga0500590_077349 | |||
| 2100 | Ga0500604_0073547 | |||
| 2101 | Ga0500627_0138149 | |||
| 2102 | Ga0500627_0338246 | |||
| 2103 | Ga0500638_007983 | |||
| 2104 | Ga0500638_124805 | |||
| 2105 | Ga0500637_0000106 | |||
| 2106 | Ga0500611_082403 | |||
| 2107 | Ga0500645_021806 | |||
| 2108 | Ga0500661_001729 | |||
| 2109 | Ga0501082_0209533 | |||
| 2110 | 2509153252 | |||
| 2111 | 2513673587 | |||
| 2112 | 2513691645 | |||
| 2113 | 2524467673 | |||
| 2114 | 2524537147 | |||
| 2115 | 2723845935 | |||
| 2116 | 2793079743 | |||
| 2117 | 2874609409 | |||
| 2118 | 2876813204 | |||
| 2119 | 2879110368 | |||
| 2120 | 2885387584 | |||
| 2121 | 2889040793 | |||
| 2122 | 2903777481 | |||
| 2123 | 2904704327 | |||
| 2124 | 2922367887 | |||
| 2125 | 2922392222 | |||
| 2126 | 8006941792 | |||
| 2127 | 8006968720 | |||
| 2128 | 8006981540 | |||
| 2129 | 8006990539 | |||
| 2130 | 8006996293 | |||
| 2131 | 8056680667 | |||
| 2132 | 8056684075 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy