F489385

General Info

Members Datasets Scaffolds Average Seq Length
1065 349 1065 212

Family's Representative Sequence

Representative Sequence 3300049589|Ga0501073_0055066|Ga0501073_0055066_1364_2122
Length 252
Sequence VHSVPAESAKAGNAEAPADVLAGTLRVNEVFFSIQGESTWAGEPCVFVRLTGCPLRCTYCDTEYAFREGETRTIASVVQQVESFGCRVVEVTGGEPLAQKRCLDLVRVLCERGCTVLIETSGAVDIGPVDSRAIRIVDLKTPGSGEMERNLWSNMQQLRPRDEVKFVVTSREDYDWAKQQMTRLDLAGMVQRGQLRAVLMSAAWEQRKGLEIAGCAGLHPRTLAEWILADRLPVRMQSQLHKIIWDPQTRGV

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
193 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
194 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
195 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
196 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
201 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
204 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
205 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
206 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
207 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
208 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
210 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
211 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
212 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
213 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
214 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
215 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
216 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
217 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
219 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
220 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
221 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
222 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
223 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
224 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
225 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
226 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
227 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
228 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
229 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
230 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
231 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
232 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
233 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
234 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
235 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
236 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
237 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
238 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
239 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
240 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
241 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
242 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
243 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
244 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
245 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
246 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
247 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
248 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
249 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
250 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
251 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
252 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
253 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
254 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
255 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
256 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
257 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
258 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
259 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
260 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
261 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
262 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
263 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
264 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
265 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
266 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
267 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
268 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
269 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
270 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
271 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
272 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
273 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
274 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
275 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
276 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
277 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
278 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
279 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
280 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
281 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
282 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
283 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
284 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
296 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
297 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
298 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
299 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
300 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
301 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
302 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
303 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
304 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
305 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
306 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
307 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
308 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
309 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
310 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
311 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
312 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
313 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
314 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
315 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
316 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
317 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
318 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
319 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
320 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
321 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
322 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
323 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
324 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
325 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
326 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
327 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
328 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
329 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
330 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
331 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
332 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
333 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
334 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
335 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
336 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
337 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
338 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
339 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
340 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
341 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
342 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
343 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
344 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
345 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
346 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
347 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
348 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
349 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.09
Nodule 0
Rhizoplane 1.6
Rhizosphere 97.84
Stem 0
Stem Tuber 0
Unclassified 0.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10021274 3300002459 Bacteria 1344
2 Ga0065704_10015486 3300005289 Bacteria 1781
3 Ga0065704_10140576 3300005289 Unclassified 1521
4 Ga0065712_10087465 3300005290 Unclassified 2576
5 Ga0065712_10128456 3300005290 Bacteria 1578
6 Ga0065712_10187895 3300005290 Unclassified 1161
7 Ga0065712_10276063 3300005290 Bacteria 905
8 Ga0065715_10022852 3300005293 Bacteria 1819
9 Ga0065715_10142070 3300005293 Bacteria 1839
10 Ga0065707_10137543 3300005295 Bacteria 1819
11 Ga0065707_10338296 3300005295 Bacteria 938
12 Ga0070676_10007566 3300005328 Bacteria 5833
13 Ga0070676_10151114 3300005328 Bacteria 1486
14 Ga0070676_10427478 3300005328 Bacteria 927
15 Ga0070683_100013326 3300005329 Bacteria 7167
16 Ga0070683_100169018 3300005329 Bacteria 2075
17 Ga0070683_100529077 3300005329 Bacteria 1127
18 Ga0070690_100000336 3300005330 Bacteria 24075
19 Ga0070690_100004162 3300005330 Bacteria 8002
20 Ga0070690_100035498 3300005330 Bacteria 3129
21 Ga0070690_100050976 3300005330 Bacteria 2641
22 Ga0070670_100002699 3300005331 Bacteria 14659
23 Ga0070670_100035231 3300005331 Bacteria 4309
24 Ga0070670_100119293 3300005331 Unclassified 2275
25 Ga0070670_100627597 3300005331 Bacteria 963
26 Ga0070670_100640967 3300005331 Bacteria 953
27 Ga0070677_10005848 3300005333 Bacteria 4073
28 Ga0070677_10143361 3300005333 Bacteria 1104
29 Ga0068869_100032669 3300005334 Bacteria 3669
30 Ga0068869_100283775 3300005334 Bacteria 1332
31 Ga0070666_10007593 3300005335 Bacteria 6690
32 Ga0070666_10008555 3300005335 Bacteria 6358
33 Ga0070666_10232264 3300005335 Bacteria 1303
34 Ga0070680_100167068 3300005336 Bacteria 1850
35 Ga0070680_100235862 3300005336 Bacteria 1545
36 Ga0068868_100061553 3300005338 Bacteria 2974
37 Ga0068868_100076743 3300005338 Bacteria 2672
38 Ga0068868_100130709 3300005338 Bacteria 2054
39 Ga0068868_100200115 3300005338 Bacteria 1665
40 Ga0068868_100300052 3300005338 Bacteria 1364
41 Ga0068868_100392814 3300005338 Bacteria 1196
42 Ga0070660_100012311 3300005339 Bacteria 6105
43 Ga0070660_100104112 3300005339 Bacteria 2251
44 Ga0070689_100000066 3300005340 Bacteria 62639
45 Ga0070689_100089945 3300005340 Bacteria 2418
46 Ga0070689_100095286 3300005340 Unclassified 2351
47 Ga0070689_100137192 3300005340 Bacteria 1965
48 Ga0070689_100176621 3300005340 Bacteria 1733
49 Ga0070689_100324812 3300005340 Bacteria 1286
50 Ga0070689_100460076 3300005340 Bacteria 1084
51 Ga0070689_100630372 3300005340 Unclassified 931
52 Ga0070687_100232773 3300005343 Bacteria 1135
53 Ga0070661_100018875 3300005344 Bacteria 4909
54 Ga0070692_10001597 3300005345 Bacteria 8322
55 Ga0070692_10035483 3300005345 Bacteria 2525
56 Ga0070668_100275499 3300005347 Unclassified 1404
57 Ga0070668_100338028 3300005347 Unclassified 1271
58 Ga0070669_100001454 3300005353 Bacteria 17172
59 Ga0070669_100012223 3300005353 Bacteria 6094
60 Ga0070669_100016030 3300005353 Bacteria 5348
61 Ga0070669_100081558 3300005353 Bacteria 2410
62 Ga0070669_100105804 3300005353 Bacteria 2129
63 Ga0070669_100112110 3300005353 Bacteria 2071
64 Ga0070669_100341127 3300005353 Bacteria 1214
65 Ga0070675_100000147 3300005354 Bacteria 42295
66 Ga0070675_100003888 3300005354 Bacteria 11318
67 Ga0070675_100008321 3300005354 Bacteria 8046
68 Ga0070675_100048236 3300005354 Bacteria 3491
69 Ga0070675_100051067 3300005354 Bacteria 3397
70 Ga0070675_100247922 3300005354 Bacteria 1558
71 Ga0070675_100356514 3300005354 Bacteria 1298
72 Ga0070675_100390088 3300005354 Bacteria 1241
73 Ga0070675_100668551 3300005354 Unclassified 945
74 Ga0070671_100007961 3300005355 Bacteria 8477
75 Ga0070671_100032528 3300005355 Bacteria 4312
76 Ga0070671_100164771 3300005355 Bacteria 1874
77 Ga0070674_100002716 3300005356 Bacteria 9792
78 Ga0070674_100064531 3300005356 Bacteria 2566
79 Ga0070674_100814911 3300005356 Bacteria 807
80 Ga0070673_100000103 3300005364 Bacteria 38215
81 Ga0070673_100003965 3300005364 Bacteria 9304
82 Ga0070673_100009418 3300005364 Bacteria 6554
83 Ga0070673_100713120 3300005364 Bacteria 922
84 Ga0070688_100001477 3300005365 Bacteria 11687
85 Ga0070688_100003218 3300005365 Bacteria 8369
86 Ga0070688_100023138 3300005365 Bacteria 3651
87 Ga0070688_100055066 3300005365 Bacteria 2494
88 Ga0070688_100065786 3300005365 Bacteria 2305
89 Ga0070688_100105296 3300005365 Bacteria 1867
90 Ga0070688_100416269 3300005365 Bacteria 998
91 Ga0070688_100623179 3300005365 Bacteria 828
92 Ga0070659_100349461 3300005366 Unclassified 1240
93 Ga0070659_100375231 3300005366 Bacteria 1197
94 Ga0070667_100083176 3300005367 Bacteria 2742
95 Ga0070667_100325363 3300005367 Bacteria 1388
96 Ga0070703_10031065 3300005406 Bacteria 1613
97 Ga0070703_10040636 3300005406 Bacteria 1447
98 Ga0070703_10232710 3300005406 Bacteria 739
99 Ga0070709_10132027 3300005434 Bacteria 1706
100 Ga0070714_100253206 3300005435 Unclassified 1629
101 Ga0070710_10027928 3300005437 Bacteria 3014
102 Ga0070701_10000020 3300005438 Bacteria 41399
103 Ga0070701_10051314 3300005438 Bacteria 2140
104 Ga0070701_10138561 3300005438 Bacteria 1389
105 Ga0070701_10155126 3300005438 Bacteria 1322
106 Ga0070701_10286350 3300005438 Bacteria 1008
107 Ga0070701_10524117 3300005438 Bacteria 773
108 Ga0070711_100439564 3300005439 Unclassified 1066
109 Ga0070711_100465652 3300005439 Bacteria 1037
110 Ga0070705_100038491 3300005440 Bacteria 2706
111 Ga0070705_100042809 3300005440 Bacteria 2591
112 Ga0070705_100069953 3300005440 Bacteria 2118
113 Ga0070705_100186311 3300005440 Bacteria 1410
114 Ga0070705_100401137 3300005440 Unclassified 1015
115 Ga0070700_100000818 3300005441 Bacteria 15281
116 Ga0070700_100004171 3300005441 Bacteria 7535
117 Ga0070700_100004954 3300005441 Bacteria 7006
118 Ga0070700_100143607 3300005441 Bacteria 1625
119 Ga0070700_100694100 3300005441 Bacteria 808
120 Ga0070700_100776910 3300005441 Bacteria 769
121 Ga0070694_100047946 3300005444 Bacteria 2872
122 Ga0070694_100054370 3300005444 Bacteria 2712
123 Ga0070694_100106143 3300005444 Bacteria 1994
124 Ga0070694_100116412 3300005444 Unclassified 1912
125 Ga0070694_100397414 3300005444 Bacteria 1078
126 Ga0070708_100022317 3300005445 Bacteria 5367
127 Ga0070708_100101619 3300005445 Bacteria 2633
128 Ga0070708_100260591 3300005445 Bacteria 1630
129 Ga0070708_100422162 3300005445 Unclassified 1258
130 Ga0070708_100905832 3300005445 Bacteria 828
131 Ga0070663_100009569 3300005455 Bacteria 6006
132 Ga0070663_100032089 3300005455 Bacteria 3617
133 Ga0070678_100002436 3300005456 Bacteria 10191
134 Ga0070678_100016979 3300005456 Bacteria 4673
135 Ga0070678_100032871 3300005456 Bacteria 3595
136 Ga0070678_100055019 3300005456 Bacteria 2903
137 Ga0070678_100071199 3300005456 Bacteria 2602
138 Ga0070678_100137887 3300005456 Bacteria 1948
139 Ga0070678_101014404 3300005456 Bacteria 763
140 Ga0070662_100027204 3300005457 Bacteria 3967
141 Ga0070662_100100568 3300005457 Bacteria 2188
142 Ga0070662_100276377 3300005457 Bacteria 1358
143 Ga0070662_100989909 3300005457 Unclassified 719
144 Ga0070681_10014199 3300005458 Bacteria 7925
145 Ga0070681_10073223 3300005458 Bacteria 3388
146 Ga0070681_10129868 3300005458 Bacteria 2451
147 Ga0068867_100001096 3300005459 Bacteria 18486
148 Ga0068867_100002876 3300005459 Bacteria 12113
149 Ga0068867_100027704 3300005459 Bacteria 4075
150 Ga0068867_100093506 3300005459 Bacteria 2285
151 Ga0068867_100094484 3300005459 Bacteria 2274
152 Ga0068867_100345586 3300005459 Bacteria 1240
153 Ga0068867_100383805 3300005459 Bacteria 1181
154 Ga0068867_101115018 3300005459 Unclassified 721
155 Ga0070685_10000069 3300005466 Bacteria 60941
156 Ga0070685_10019371 3300005466 Bacteria 3670
157 Ga0070685_10031005 3300005466 Bacteria 2983
158 Ga0070685_10062750 3300005466 Bacteria 2180
159 Ga0070685_10139038 3300005466 Bacteria 1527
160 Ga0070685_10165941 3300005466 Bacteria 1411
161 Ga0070685_10167642 3300005466 Bacteria 1405
162 Ga0070706_100096995 3300005467 Bacteria 2738
163 Ga0070706_100144241 3300005467 Bacteria 2223
164 Ga0070706_100631082 3300005467 Bacteria 995
165 Ga0070707_100000021 3300005468 Bacteria 130642
166 Ga0070707_100038006 3300005468 Bacteria 4597
167 Ga0070707_100041900 3300005468 Bacteria 4383
168 Ga0070707_100069599 3300005468 Bacteria 3388
169 Ga0070707_100669326 3300005468 Unclassified 1001
170 Ga0070698_100029698 3300005471 Bacteria 5675
171 Ga0070698_100196500 3300005471 Bacteria 1954
172 Ga0070698_100289952 3300005471 Unclassified 1568
173 Ga0070699_100001737 3300005518 Bacteria 19888
174 Ga0070699_100002012 3300005518 Bacteria 18361
175 Ga0070699_100037057 3300005518 Bacteria 4219
176 Ga0070699_100053591 3300005518 Bacteria 3491
177 Ga0070699_100218236 3300005518 Bacteria 1699
178 Ga0070699_100335870 3300005518 Unclassified 1359
179 Ga0070679_100171169 3300005530 Bacteria 2144
180 Ga0070684_100768542 3300005535 Bacteria 900
181 Ga0070697_100048178 3300005536 Bacteria 3455
182 Ga0070697_100061083 3300005536 Bacteria 3073
183 Ga0070697_100139549 3300005536 Bacteria 2037
184 Ga0070697_100178419 3300005536 Bacteria 1800
185 Ga0070697_100538973 3300005536 Bacteria 1023
186 Ga0068853_100459082 3300005539 Bacteria 1199
187 Ga0070672_100002045 3300005543 Bacteria 12704
188 Ga0070672_100011300 3300005543 Bacteria 6227
189 Ga0070672_100045389 3300005543 Bacteria 3398
190 Ga0070672_100093050 3300005543 Bacteria 2435
191 Ga0070672_100136771 3300005543 Bacteria 2018
192 Ga0070672_100151381 3300005543 Bacteria 1919
193 Ga0070672_100227374 3300005543 Bacteria 1566
194 Ga0070686_100000100 3300005544 Bacteria 59351
195 Ga0070686_100002508 3300005544 Bacteria 10110
196 Ga0070686_100022866 3300005544 Bacteria 3729
197 Ga0070686_100040570 3300005544 Bacteria 2905
198 Ga0070686_100118755 3300005544 Bacteria 1813
199 Ga0070695_100005877 3300005545 Bacteria 7240
200 Ga0070695_100050017 3300005545 Bacteria 2677
201 Ga0070695_100063731 3300005545 Bacteria 2396
202 Ga0070695_100189390 3300005545 Bacteria 1463
203 Ga0070695_100575094 3300005545 Bacteria 881
204 Ga0070695_100799634 3300005545 Bacteria 755
205 Ga0070696_100002986 3300005546 Bacteria 11235
206 Ga0070696_100003911 3300005546 Bacteria 9952
207 Ga0070696_100011890 3300005546 Bacteria 5834
208 Ga0070696_100073659 3300005546 Bacteria 2407
209 Ga0070696_100101272 3300005546 Bacteria 2064
210 Ga0070696_100190801 3300005546 Unclassified 1525
211 Ga0070696_100250978 3300005546 Bacteria 1338
212 Ga0070696_100259553 3300005546 Bacteria 1317
213 Ga0070693_100169167 3300005547 Bacteria 1398
214 Ga0070665_100340116 3300005548 Unclassified 1505
215 Ga0070665_100422305 3300005548 Bacteria 1342
216 Ga0070665_100470014 3300005548 Bacteria 1268
217 Ga0070704_100003197 3300005549 Bacteria 9366
218 Ga0070704_100008135 3300005549 Bacteria 6271
219 Ga0070704_100009518 3300005549 Bacteria 5877
220 Ga0070704_100012684 3300005549 Bacteria 5214
221 Ga0070704_100040734 3300005549 Bacteria 3200
222 Ga0070704_100139194 3300005549 Bacteria 1892
223 Ga0070704_100175606 3300005549 Unclassified 1708
224 Ga0070704_100187522 3300005549 Bacteria 1660
225 Ga0070704_100631817 3300005549 Bacteria 944
226 Ga0070704_100708027 3300005549 Unclassified 893
227 Ga0068855_100098552 3300005563 Bacteria 3367
228 Ga0068855_100112064 3300005563 Bacteria 3131
229 Ga0070664_100000584 3300005564 Bacteria 27791
230 Ga0070664_100013313 3300005564 Bacteria 6698
231 Ga0070664_100029223 3300005564 Bacteria 4594
232 Ga0070664_100091172 3300005564 Bacteria 2638
233 Ga0070664_100107093 3300005564 Bacteria 2437
234 Ga0070664_100447347 3300005564 Bacteria 1186
235 Ga0070664_100590851 3300005564 Unclassified 1029
236 Ga0068857_100020770 3300005577 Bacteria 5778
237 Ga0068854_100174919 3300005578 Bacteria 1673
238 Ga0070702_100023978 3300005615 Bacteria 3249
239 Ga0070702_100116927 3300005615 Bacteria 1663
240 Ga0070702_100432589 3300005615 Bacteria 950
241 Ga0068852_101377789 3300005616 Unclassified 727
242 Ga0068859_100004613 3300005617 Bacteria 14046
243 Ga0068859_100051697 3300005617 Bacteria 4131
244 Ga0068859_100095636 3300005617 Bacteria 3023
245 Ga0068859_100174261 3300005617 Bacteria 2233
246 Ga0068859_100343076 3300005617 Bacteria 1588
247 Ga0068859_100481130 3300005617 Bacteria 1337
248 Ga0068864_100008151 3300005618 Bacteria 8641
249 Ga0068864_100029037 3300005618 Bacteria 4679
250 Ga0068864_100038432 3300005618 Bacteria 4087
251 Ga0068864_100111730 3300005618 Bacteria 2435
252 Ga0068864_100177764 3300005618 Bacteria 1944
253 Ga0068864_100471794 3300005618 Bacteria 1203
254 Ga0068866_10002332 3300005718 Bacteria 7869
255 Ga0068866_10202778 3300005718 Bacteria 1186
256 Ga0068861_100005416 3300005719 Bacteria 8639
257 Ga0068861_100045160 3300005719 Bacteria 3316
258 Ga0068861_100053791 3300005719 Bacteria 3065
259 Ga0068861_100253404 3300005719 Bacteria 1503
260 Ga0068861_100454974 3300005719 Unclassified 1148
261 Ga0068861_100685254 3300005719 Bacteria 951
262 Ga0068870_10001025 3300005840 Bacteria 11049
263 Ga0068870_10006146 3300005840 Bacteria 5280
264 Ga0068863_100002234 3300005841 Bacteria 19218
265 Ga0068863_100165117 3300005841 Bacteria 2123
266 Ga0068863_100168822 3300005841 Bacteria 2098
267 Ga0068858_100001888 3300005842 Bacteria 21404
268 Ga0068858_100030600 3300005842 Bacteria 4999
269 Ga0068858_100038117 3300005842 Bacteria 4458
270 Ga0068858_100126799 3300005842 Bacteria 2391
271 Ga0068858_100292889 3300005842 Bacteria 1552
272 Ga0068858_100833859 3300005842 Bacteria 900
273 Ga0068858_100986190 3300005842 Bacteria 825
274 Ga0068860_100033522 3300005843 Bacteria 4927
275 Ga0068860_100033985 3300005843 Bacteria 4892
276 Ga0068860_100054885 3300005843 Bacteria 3787
277 Ga0068860_100066357 3300005843 Bacteria 3428
278 Ga0068860_100484848 3300005843 Bacteria 1233
279 Ga0068862_100006477 3300005844 Bacteria 9723
280 Ga0068862_100018207 3300005844 Bacteria 5848
281 Ga0068862_100030874 3300005844 Bacteria 4518
282 Ga0068862_100042813 3300005844 Bacteria 3858
283 Ga0068862_100218963 3300005844 Bacteria 1723
284 Ga0081455_10000786 3300005937 Bacteria 40744
285 Ga0081455_10214401 3300005937 Bacteria 1432
286 Ga0081539_10146522 3300005985 Bacteria 1141
287 Ga0070715_10015855 3300006163 Bacteria 2819
288 Ga0070716_100206208 3300006173 Bacteria 1310
289 Ga0070716_100220732 3300006173 Bacteria 1273
290 Ga0070716_100514022 3300006173 Bacteria 886
291 Ga0070716_100639853 3300006173 Unclassified 805
292 Ga0070712_100135942 3300006175 Bacteria 1869
293 Ga0097621_100001601 3300006237 Bacteria 15491
294 Ga0097621_100007328 3300006237 Bacteria 7885
295 Ga0097621_100023648 3300006237 Bacteria 4786
296 Ga0097621_100056007 3300006237 Bacteria 3220
297 Ga0097621_100086311 3300006237 Bacteria 2619
298 Ga0097621_100091837 3300006237 Bacteria 2542
299 Ga0068871_100001107 3300006358 Bacteria 18079
300 Ga0068871_100010328 3300006358 Bacteria 6806
301 Ga0068871_100026278 3300006358 Bacteria 4541
302 Ga0068871_100033300 3300006358 Bacteria 4080
303 Ga0068871_100193809 3300006358 Bacteria 1751
304 Ga0068871_100340182 3300006358 Bacteria 1325
305 Ga0068871_100352776 3300006358 Bacteria 1301
306 Ga0075428_100012493 3300006844 Bacteria 9444
307 Ga0075428_100018081 3300006844 Bacteria 7790
308 Ga0075428_100037061 3300006844 Bacteria 5371
309 Ga0075428_100055313 3300006844 Bacteria 4348
310 Ga0075428_100066734 3300006844 Bacteria 3939
311 Ga0075428_100109374 3300006844 Bacteria 3011
312 Ga0075428_100388623 3300006844 Bacteria 1496
313 Ga0075428_100565104 3300006844 Bacteria 1216
314 Ga0075430_100001196 3300006846 Bacteria 20813
315 Ga0075430_100003466 3300006846 Bacteria 13203
316 Ga0075430_100006133 3300006846 Bacteria 10128
317 Ga0075430_100009586 3300006846 Bacteria 8182
318 Ga0075430_100180315 3300006846 Bacteria 1757
319 Ga0075430_100700891 3300006846 Bacteria 835
320 Ga0075431_100028775 3300006847 Bacteria 5713
321 Ga0075431_100073904 3300006847 Bacteria 3517
322 Ga0075431_100111492 3300006847 Bacteria 2823
323 Ga0075431_100177222 3300006847 Bacteria 2189
324 Ga0075431_100535423 3300006847 Bacteria 1160
325 Ga0075431_101174045 3300006847 Unclassified 731
326 Ga0075433_10000936 3300006852 Bacteria 20611
327 Ga0075433_10001275 3300006852 Bacteria 18416
328 Ga0075433_10013705 3300006852 Bacteria 6602
329 Ga0075433_10067320 3300006852 Bacteria 3143
330 Ga0075433_10110458 3300006852 Bacteria 2439
331 Ga0075433_10129334 3300006852 Bacteria 2243
332 Ga0075433_10338702 3300006852 Bacteria 1329
333 Ga0075433_10381076 3300006852 Bacteria 1245
334 Ga0075433_10492670 3300006852 Bacteria 1079
335 Ga0075433_10540806 3300006852 Bacteria 1024
336 Ga0075434_100000049 3300006871 Bacteria 57417
337 Ga0075434_100011998 3300006871 Bacteria 8199
338 Ga0075434_100021443 3300006871 Bacteria 6278
339 Ga0075434_100025831 3300006871 Bacteria 5749
340 Ga0075434_100046934 3300006871 Bacteria 4286
341 Ga0075434_100047314 3300006871 Bacteria 4268
342 Ga0075434_100132783 3300006871 Unclassified 2509
343 Ga0075434_100187017 3300006871 Bacteria 2091
344 Ga0075434_100634562 3300006871 Bacteria 1087
345 Ga0075429_100001236 3300006880 Bacteria 20721
346 Ga0075429_100018761 3300006880 Bacteria 5990
347 Ga0075429_100044586 3300006880 Bacteria 3857
348 Ga0075429_100161158 3300006880 Bacteria 1964
349 Ga0075429_100213590 3300006880 Bacteria 1690
350 Ga0075429_100215362 3300006880 Bacteria 1683
351 Ga0075429_100425496 3300006880 Bacteria 1163
352 Ga0068865_100086899 3300006881 Bacteria 2258
353 Ga0068865_100266952 3300006881 Bacteria 1357
354 Ga0068865_100339852 3300006881 Bacteria 1213
355 Ga0075436_100000420 3300006914 Bacteria 27162
356 Ga0075436_100019413 3300006914 Bacteria 4658
357 Ga0075436_100019739 3300006914 Bacteria 4621
358 Ga0075436_100025325 3300006914 Bacteria 4082
359 Ga0075436_100037192 3300006914 Bacteria 3360
360 Ga0075436_100322257 3300006914 Unclassified 1110
361 Ga0097620_100004613 3300006931 Bacteria 14046
362 Ga0097620_100051695 3300006931 Bacteria 4131
363 Ga0097620_100095631 3300006931 Bacteria 3023
364 Ga0097620_100174262 3300006931 Bacteria 2233
365 Ga0097620_100343077 3300006931 Bacteria 1588
366 Ga0097620_100481101 3300006931 Bacteria 1337
367 Ga0075435_100000059 3300007076 Bacteria 56189
368 Ga0075435_100004605 3300007076 Bacteria 9499
369 Ga0075435_100005562 3300007076 Bacteria 8819
370 Ga0075435_100013234 3300007076 Bacteria 6131
371 Ga0075435_100057562 3300007076 Bacteria 3145
372 Ga0075435_100154261 3300007076 Bacteria 1932
373 Ga0075435_100233022 3300007076 Bacteria 1564
374 Ga0075435_100287762 3300007076 Unclassified 1404
375 Ga0075435_100318908 3300007076 Bacteria 1330
376 Ga0111539_10000326 3300009094 Bacteria 58218
377 Ga0111539_10004673 3300009094 Bacteria 17895
378 Ga0111539_10004769 3300009094 Bacteria 17699
379 Ga0111539_10007551 3300009094 Bacteria 13899
380 Ga0111539_10010427 3300009094 Bacteria 11694
381 Ga0111539_10017167 3300009094 Bacteria 8959
382 Ga0111539_10042960 3300009094 Bacteria 5423
383 Ga0111539_10054412 3300009094 Bacteria 4762
384 Ga0111539_10057964 3300009094 Bacteria 4597
385 Ga0111539_10078245 3300009094 Bacteria 3891
386 Ga0111539_10123247 3300009094 Bacteria 3038
387 Ga0111539_10621651 3300009094 Bacteria 1258
388 Ga0111539_10646306 3300009094 Bacteria 1232
389 Ga0105245_10267491 3300009098 Unclassified 1666
390 Ga0105247_10003020 3300009101 Bacteria 11147
391 Ga0105247_10010076 3300009101 Bacteria 5726
392 Ga0105247_10270811 3300009101 Bacteria 1168
393 Ga0114129_10002862 3300009147 Bacteria 24132
394 Ga0114129_10004893 3300009147 Bacteria 18907
395 Ga0114129_10006748 3300009147 Bacteria 16297
396 Ga0114129_10008062 3300009147 Bacteria 15009
397 Ga0114129_10018292 3300009147 Bacteria 9981
398 Ga0114129_10027396 3300009147 Bacteria 8068
399 Ga0114129_10031782 3300009147 Bacteria 7463
400 Ga0114129_10038284 3300009147 Bacteria 6766
401 Ga0114129_10049334 3300009147 Bacteria 5914
402 Ga0114129_10056630 3300009147 Bacteria 5490
403 Ga0114129_10063676 3300009147 Bacteria 5148
404 Ga0114129_10082166 3300009147 Bacteria 4477
405 Ga0114129_10094153 3300009147 Bacteria 4149
406 Ga0114129_10126682 3300009147 Bacteria 3510
407 Ga0114129_10204942 3300009147 Bacteria 2669
408 Ga0114129_10252394 3300009147 Bacteria 2367
409 Ga0114129_10706218 3300009147 Bacteria 1295
410 Ga0114129_10753893 3300009147 Bacteria 1246
411 Ga0114129_10787619 3300009147 Bacteria 1214
412 Ga0114129_10951071 3300009147 Bacteria 1085
413 Ga0105243_10000238 3300009148 Bacteria 63019
414 Ga0105243_10025094 3300009148 Bacteria 4552
415 Ga0105243_10872003 3300009148 Unclassified 893
416 Ga0105242_10001243 3300009176 Bacteria 20071
417 Ga0105242_10004726 3300009176 Bacteria 10547
418 Ga0105242_10007339 3300009176 Bacteria 8485
419 Ga0105242_10098152 3300009176 Bacteria 2478
420 Ga0105242_10259609 3300009176 Bacteria 1569
421 Ga0105242_10847090 3300009176 Bacteria 909
422 Ga0105248_10013509 3300009177 Bacteria 8989
423 Ga0105248_10017801 3300009177 Bacteria 7840
424 Ga0105248_10056753 3300009177 Bacteria 4393
425 Ga0105248_10081647 3300009177 Bacteria 3634
426 Ga0105248_10126720 3300009177 Bacteria 2880
427 Ga0105248_10139979 3300009177 Bacteria 2729
428 Ga0105248_10151210 3300009177 Bacteria 2619
429 Ga0105248_10271331 3300009177 Bacteria 1910
430 Ga0105248_10811528 3300009177 Unclassified 1056
431 Ga0105248_11395260 3300009177 Bacteria 793
432 Ga0105238_10686821 3300009551 Bacteria 1035
433 Ga0105249_10051517 3300009553 Bacteria 3755
434 Ga0105249_10269044 3300009553 Bacteria 1697
435 Ga0105249_11078758 3300009553 Bacteria 873
436 Ga0157371_10184330 3300013102 Bacteria 1493
437 Ga0157370_10640920 3300013104 Bacteria 971
438 Ga0157369_10337892 3300013105 Bacteria 1564
439 Ga0157374_10064849 3300013296 Bacteria 3429
440 Ga0157374_10496237 3300013296 Unclassified 1225
441 Ga0157374_10504422 3300013296 Bacteria 1215
442 Ga0157374_10554208 3300013296 Unclassified 1157
443 Ga0157378_10002332 3300013297 Bacteria 16867
444 Ga0157378_10174325 3300013297 Bacteria 2019
445 Ga0157378_10659056 3300013297 Bacteria 1063
446 Ga0163162_10102935 3300013306 Bacteria 2949
447 Ga0163162_10465786 3300013306 Bacteria 1395
448 Ga0163162_11271088 3300013306 Bacteria 836
449 Ga0157375_10022418 3300013308 Bacteria 5813
450 Ga0157375_10050333 3300013308 Bacteria 4086
451 Ga0157375_10089852 3300013308 Bacteria 3129
452 Ga0157375_10115922 3300013308 Bacteria 2782
453 Ga0157375_10212801 3300013308 Bacteria 2091
454 Ga0157375_10535202 3300013308 Bacteria 1334
455 Ga0163163_10401399 3300014325 Bacteria 1429
456 Ga0157380_10002955 3300014326 Bacteria 11565
457 Ga0157380_10003616 3300014326 Bacteria 10632
458 Ga0157380_10010138 3300014326 Bacteria 6772
459 Ga0157380_10029391 3300014326 Bacteria 4201
460 Ga0157380_10104200 3300014326 Bacteria 2369
461 Ga0157380_10106662 3300014326 Bacteria 2345
462 Ga0157380_10197607 3300014326 Bacteria 1781
463 Ga0157380_10265843 3300014326 Bacteria 1561
464 Ga0157380_10319912 3300014326 Bacteria 1438
465 Ga0157380_10486371 3300014326 Bacteria 1195
466 Ga0157380_10791525 3300014326 Bacteria 964
467 Ga0157380_11151838 3300014326 Bacteria 817
468 Ga0157380_11331560 3300014326 Bacteria 766
469 Ga0157377_10018169 3300014745 Bacteria 3652
470 Ga0157377_10018864 3300014745 Bacteria 3593
471 Ga0157377_10047355 3300014745 Bacteria 2408
472 Ga0157377_10095111 3300014745 Bacteria 1766
473 Ga0157377_10248787 3300014745 Bacteria 1151
474 Ga0157379_10009913 3300014968 Bacteria 8299
475 Ga0157379_10017365 3300014968 Bacteria 6340
476 Ga0157379_10067559 3300014968 Bacteria 3195
477 Ga0157376_10048960 3300014969 Bacteria 3499
478 Ga0157376_10160959 3300014969 Bacteria 2035
479 Ga0157376_10431110 3300014969 Bacteria 1281
480 Ga0157376_10455653 3300014969 Bacteria 1249
481 Ga0157376_10650086 3300014969 Unclassified 1055
482 Ga0163161_10031367 3300017792 Bacteria 3787
483 Ga0163161_10161833 3300017792 Bacteria 1707
484 Ga0207697_10000575 3300025315 Bacteria 20854
485 Ga0207682_10001469 3300025893 Bacteria 10886
486 Ga0207682_10011353 3300025893 Bacteria 3478
487 Ga0207682_10030408 3300025893 Bacteria 2163
488 Ga0207682_10033322 3300025893 Bacteria 2073
489 Ga0207682_10129069 3300025893 Bacteria 1127
490 Ga0207692_10035866 3300025898 Bacteria 2413
491 Ga0207692_10060517 3300025898 Bacteria 1959
492 Ga0207642_10017132 3300025899 Bacteria 2748
493 Ga0207642_10110274 3300025899 Bacteria 1400
494 Ga0207710_10003937 3300025900 Bacteria 6552
495 Ga0207710_10047460 3300025900 Unclassified 1920
496 Ga0207710_10365696 3300025900 Bacteria 736
497 Ga0207688_10000078 3300025901 Bacteria 37290
498 Ga0207688_10221170 3300025901 Bacteria 1141
499 Ga0207680_10051609 3300025903 Bacteria 2460
500 Ga0207680_10765267 3300025903 Bacteria 692
501 Ga0207685_10011619 3300025905 Bacteria 2654
502 Ga0207685_10107174 3300025905 Bacteria 1205
503 Ga0207645_10002104 3300025907 Bacteria 15935
504 Ga0207645_10002597 3300025907 Bacteria 14090
505 Ga0207645_10007763 3300025907 Bacteria 7551
506 Ga0207645_10128802 3300025907 Bacteria 1646
507 Ga0207643_10000706 3300025908 Bacteria 20718
508 Ga0207643_10084543 3300025908 Bacteria 1842
509 Ga0207684_10000737 3300025910 Bacteria 38452
510 Ga0207684_10031826 3300025910 Bacteria 4487
511 Ga0207684_10142894 3300025910 Bacteria 2058
512 Ga0207684_10296558 3300025910 Unclassified 1394
513 Ga0207684_10681152 3300025910 Bacteria 875
514 Ga0207654_10091248 3300025911 Unclassified 1857
515 Ga0207707_10002734 3300025912 Bacteria 15763
516 Ga0207707_10070129 3300025912 Bacteria 3054
517 Ga0207693_10013276 3300025915 Bacteria 6645
518 Ga0207663_10870600 3300025916 Bacteria 720
519 Ga0207660_10004716 3300025917 Bacteria 8877
520 Ga0207660_10037729 3300025917 Bacteria 3369
521 Ga0207660_10142675 3300025917 Bacteria 1832
522 Ga0207662_10001063 3300025918 Bacteria 12911
523 Ga0207662_10001208 3300025918 Bacteria 12343
524 Ga0207662_10140373 3300025918 Bacteria 1530
525 Ga0207662_10333653 3300025918 Bacteria 1015
526 Ga0207662_10483314 3300025918 Bacteria 851
527 Ga0207657_10060146 3300025919 Bacteria 3261
528 Ga0207657_10093048 3300025919 Bacteria 2511
529 Ga0207649_10018165 3300025920 Bacteria 3994
530 Ga0207649_10029456 3300025920 Bacteria 3242
531 Ga0207652_10124757 3300025921 Bacteria 2293
532 Ga0207646_10000231 3300025922 Bacteria 76772
533 Ga0207646_10000547 3300025922 Bacteria 49465
534 Ga0207646_10127744 3300025922 Bacteria 2286
535 Ga0207646_10611216 3300025922 Unclassified 978
536 Ga0207681_10023929 3300025923 Bacteria 3913
537 Ga0207681_10064590 3300025923 Bacteria 2528
538 Ga0207681_10095334 3300025923 Bacteria 2134
539 Ga0207681_10162286 3300025923 Bacteria 1686
540 Ga0207681_10194009 3300025923 Bacteria 1556
541 Ga0207694_10130066 3300025924 Bacteria 2017
542 Ga0207650_10007478 3300025925 Bacteria 7445
543 Ga0207650_10070542 3300025925 Bacteria 2626
544 Ga0207650_10114607 3300025925 Unclassified 2091
545 Ga0207650_10150803 3300025925 Bacteria 1834
546 Ga0207650_10261694 3300025925 Bacteria 1403
547 Ga0207650_10601054 3300025925 Bacteria 925
548 Ga0207659_10000075 3300025926 Bacteria 63221
549 Ga0207659_10000939 3300025926 Bacteria 17393
550 Ga0207659_10002741 3300025926 Bacteria 10504
551 Ga0207659_10010800 3300025926 Bacteria 5748
552 Ga0207659_10132383 3300025926 Bacteria 1926
553 Ga0207659_10168017 3300025926 Bacteria 1728
554 Ga0207659_10270178 3300025926 Bacteria 1387
555 Ga0207659_10289572 3300025926 Bacteria 1341
556 Ga0207659_10635974 3300025926 Bacteria 911
557 Ga0207659_10870072 3300025926 Bacteria 775
558 Ga0207687_10057635 3300025927 Bacteria 2730
559 Ga0207700_11125101 3300025928 Bacteria 702
560 Ga0207644_10096143 3300025931 Bacteria 2216
561 Ga0207644_10102458 3300025931 Bacteria 2153
562 Ga0207644_10107568 3300025931 Bacteria 2104
563 Ga0207706_10005586 3300025933 Bacteria 11718
564 Ga0207706_10026033 3300025933 Bacteria 5237
565 Ga0207706_10402085 3300025933 Bacteria 1187
566 Ga0207706_10403920 3300025933 Bacteria 1184
567 Ga0207706_10483263 3300025933 Unclassified 1070
568 Ga0207706_10672387 3300025933 Bacteria 886
569 Ga0207686_10004046 3300025934 Bacteria 7869
570 Ga0207686_10015028 3300025934 Bacteria 4322
571 Ga0207686_10032259 3300025934 Bacteria 3117
572 Ga0207686_10237243 3300025934 Bacteria 1325
573 Ga0207709_10005269 3300025935 Bacteria 7354
574 Ga0207670_10000098 3300025936 Bacteria 60320
575 Ga0207670_10018572 3300025936 Bacteria 4231
576 Ga0207670_10018961 3300025936 Bacteria 4194
577 Ga0207670_10064879 3300025936 Bacteria 2505
578 Ga0207670_10114531 3300025936 Bacteria 1949
579 Ga0207670_10153793 3300025936 Bacteria 1710
580 Ga0207670_10281125 3300025936 Bacteria 1297
581 Ga0207669_10038016 3300025937 Bacteria 2767
582 Ga0207669_10095631 3300025937 Bacteria 1948
583 Ga0207669_10377503 3300025937 Bacteria 1104
584 Ga0207669_10411894 3300025937 Bacteria 1061
585 Ga0207704_10006357 3300025938 Bacteria 5505
586 Ga0207704_10145885 3300025938 Bacteria 1662
587 Ga0207704_10173104 3300025938 Bacteria 1551
588 Ga0207704_10883530 3300025938 Bacteria 751
589 Ga0207665_10129988 3300025939 Bacteria 1786
590 Ga0207665_10135890 3300025939 Bacteria 1749
591 Ga0207665_10294556 3300025939 Bacteria 1211
592 Ga0207691_10000209 3300025940 Bacteria 56763
593 Ga0207691_10008047 3300025940 Bacteria 10134
594 Ga0207691_10016035 3300025940 Bacteria 7118
595 Ga0207691_10030425 3300025940 Bacteria 5044
596 Ga0207691_10064712 3300025940 Bacteria 3312
597 Ga0207691_10200556 3300025940 Bacteria 1737
598 Ga0207691_10374381 3300025940 Bacteria 1216
599 Ga0207691_10569750 3300025940 Bacteria 960
600 Ga0207691_10713245 3300025940 Unclassified 845
601 Ga0207711_10007687 3300025941 Bacteria 9013
602 Ga0207711_10076709 3300025941 Bacteria 2911
603 Ga0207711_10174978 3300025941 Bacteria 1949
604 Ga0207711_10691119 3300025941 Bacteria 951
605 Ga0207711_10825436 3300025941 Unclassified 863
606 Ga0207689_10003806 3300025942 Bacteria 13754
607 Ga0207689_10004341 3300025942 Bacteria 12917
608 Ga0207689_10009073 3300025942 Bacteria 8612
609 Ga0207689_10111980 3300025942 Bacteria 2243
610 Ga0207689_10182618 3300025942 Bacteria 1730
611 Ga0207689_10578185 3300025942 Unclassified 944
612 Ga0207661_10053538 3300025944 Bacteria 3230
613 Ga0207661_10723134 3300025944 Bacteria 916
614 Ga0207679_10002301 3300025945 Bacteria 11774
615 Ga0207679_10003057 3300025945 Bacteria 10362
616 Ga0207679_10004433 3300025945 Bacteria 8744
617 Ga0207679_10024651 3300025945 Bacteria 4126
618 Ga0207679_10285976 3300025945 Bacteria 1416
619 Ga0207667_10175780 3300025949 Bacteria 2200
620 Ga0207651_10000027 3300025960 Bacteria 69165
621 Ga0207651_10001655 3300025960 Bacteria 10222
622 Ga0207651_10139926 3300025960 Bacteria 1868
623 Ga0207651_10233236 3300025960 Unclassified 1495
624 Ga0207651_10580045 3300025960 Unclassified 978
625 Ga0207712_10411109 3300025961 Bacteria 1139
626 Ga0207668_10203382 3300025972 Bacteria 1579
627 Ga0207668_10804354 3300025972 Bacteria 832
628 Ga0207640_10620184 3300025981 Bacteria 918
629 Ga0207640_10896771 3300025981 Bacteria 774
630 Ga0207658_10011910 3300025986 Bacteria 5930
631 Ga0207658_10092466 3300025986 Bacteria 2350
632 Ga0207658_10374305 3300025986 Bacteria 1246
633 Ga0207677_10232312 3300026023 Bacteria 1486
634 Ga0207677_10394383 3300026023 Bacteria 1172
635 Ga0207677_10423021 3300026023 Bacteria 1135
636 Ga0207703_10010388 3300026035 Bacteria 7283
637 Ga0207703_10015685 3300026035 Bacteria 5909
638 Ga0207703_10053921 3300026035 Bacteria 3269
639 Ga0207703_10236358 3300026035 Bacteria 1641
640 Ga0207703_10326843 3300026035 Bacteria 1406
641 Ga0207678_10011052 3300026067 Bacteria 7930
642 Ga0207678_10029975 3300026067 Bacteria 4750
643 Ga0207708_10000853 3300026075 Bacteria 22965
644 Ga0207708_10001575 3300026075 Bacteria 17042
645 Ga0207708_10002902 3300026075 Bacteria 12636
646 Ga0207708_10004792 3300026075 Bacteria 9964
647 Ga0207708_10320605 3300026075 Bacteria 1265
648 Ga0207708_10337523 3300026075 Bacteria 1233
649 Ga0207708_10441513 3300026075 Bacteria 1082
650 Ga0207708_10590216 3300026075 Unclassified 940
651 Ga0207641_10005189 3300026088 Bacteria 11136
652 Ga0207641_10029000 3300026088 Bacteria 4575
653 Ga0207641_10147973 3300026088 Bacteria 2125
654 Ga0207641_10465013 3300026088 Bacteria 1224
655 Ga0207641_10540184 3300026088 Bacteria 1136
656 Ga0207641_10718470 3300026088 Bacteria 985
657 Ga0207641_10781211 3300026088 Bacteria 944
658 Ga0207641_11090744 3300026088 Bacteria 797
659 Ga0207648_10000543 3300026089 Bacteria 42056
660 Ga0207648_10001158 3300026089 Bacteria 29542
661 Ga0207648_10004219 3300026089 Bacteria 14853
662 Ga0207648_10005943 3300026089 Bacteria 12209
663 Ga0207648_10203058 3300026089 Bacteria 1758
664 Ga0207648_10276221 3300026089 Unclassified 1502
665 Ga0207648_10549894 3300026089 Bacteria 1060
666 Ga0207648_10637825 3300026089 Bacteria 984
667 Ga0207676_10009537 3300026095 Bacteria 6910
668 Ga0207676_10020875 3300026095 Bacteria 4799
669 Ga0207676_10070443 3300026095 Bacteria 2804
670 Ga0207676_10316048 3300026095 Bacteria 1432
671 Ga0207676_10648925 3300026095 Bacteria 1018
672 Ga0207674_10029412 3300026116 Bacteria 5784
673 Ga0207674_10426578 3300026116 Bacteria 1281
674 Ga0207675_100004884 3300026118 Bacteria 12928
675 Ga0207675_100025879 3300026118 Bacteria 5459
676 Ga0207675_100126472 3300026118 Bacteria 2421
677 Ga0207675_100992494 3300026118 Bacteria 858
678 Ga0207683_10001107 3300026121 Bacteria 24547
679 Ga0207683_10002196 3300026121 Bacteria 17160
680 Ga0207683_10011362 3300026121 Bacteria 7597
681 Ga0207683_10017195 3300026121 Bacteria 6159
682 Ga0207683_10031021 3300026121 Bacteria 4637
683 Ga0207683_10075220 3300026121 Bacteria 2989
684 Ga0207683_10116045 3300026121 Bacteria 2400
685 Ga0207683_10187113 3300026121 Bacteria 1879
686 Ga0207698_10304153 3300026142 Bacteria 1486
687 Ga0209969_1000120 3300027360 Bacteria 9962
688 Ga0209967_1000144 3300027364 Bacteria 9733
689 Ga0209967_1003541 3300027364 Bacteria 2056
690 Ga0209981_1000003 3300027378 Bacteria 30420
691 Ga0209996_1000058 3300027395 Bacteria 15054
692 Ga0209984_1000444 3300027424 Bacteria 4509
693 Ga0209984_1010133 3300027424 Unclassified 1205
694 Ga0210000_1000024 3300027462 Bacteria 23307
695 Ga0209995_1000087 3300027471 Bacteria 14662
696 Ga0209995_1018580 3300027471 Bacteria 1147
697 Ga0209968_1000019 3300027526 Bacteria 32234
698 Ga0209999_1000055 3300027543 Bacteria 12672
699 Ga0209982_1001564 3300027552 Bacteria 3145
700 Ga0209970_1000013 3300027614 Bacteria 24097
701 Ga0210002_1000024 3300027617 Bacteria 23321
702 Ga0209983_1001530 3300027665 Bacteria 5144
703 Ga0209983_1028790 3300027665 Bacteria 1180
704 Ga0209971_1000232 3300027682 Bacteria 15872
705 Ga0209966_1000331 3300027695 Bacteria 14989
706 Ga0209998_10000094 3300027717 Bacteria 35182
707 Ga0209998_10095011 3300027717 Bacteria 734
708 Ga0209974_10001696 3300027876 Bacteria 7979
709 Ga0209974_10028942 3300027876 Bacteria 1835
710 Ga0209974_10150074 3300027876 Unclassified 841
711 Ga0207428_10000089 3300027907 Bacteria 127333
712 Ga0207428_10000529 3300027907 Bacteria 45592
713 Ga0207428_10005145 3300027907 Bacteria 12252
714 Ga0207428_10006577 3300027907 Bacteria 10711
715 Ga0207428_10009135 3300027907 Bacteria 8908
716 Ga0207428_10036379 3300027907 Bacteria 4015
717 Ga0207428_10041262 3300027907 Bacteria 3737
718 Ga0207428_10087031 3300027907 Bacteria 2431
719 Ga0207428_10096747 3300027907 Bacteria 2286
720 Ga0268266_10261906 3300028379 Bacteria 1603
721 Ga0268266_10356310 3300028379 Bacteria 1376
722 Ga0268266_10773398 3300028379 Unclassified 927
723 Ga0268265_10014428 3300028380 Bacteria 5383
724 Ga0268265_10033808 3300028380 Bacteria 3720
725 Ga0268265_10047123 3300028380 Bacteria 3228
726 Ga0268265_10468822 3300028380 Bacteria 1180
727 Ga0268265_10779926 3300028380 Bacteria 930
728 Ga0268265_10886111 3300028380 Bacteria 875
729 Ga0268264_10042594 3300028381 Bacteria 3759
730 Ga0268264_10058684 3300028381 Bacteria 3223
731 Ga0268264_10073918 3300028381 Bacteria 2894
732 Ga0265332_10114114 3300031238 Bacteria 1137
733 Ga0307408_100013769 3300031548 Bacteria 5368
734 Ga0307408_100173814 3300031548 Unclassified 1722
735 Ga0307408_100278417 3300031548 Bacteria 1392
736 Ga0307405_10586391 3300031731 Bacteria 907
737 Ga0307413_10596162 3300031824 Bacteria 903
738 Ga0307410_10296321 3300031852 Bacteria 1275
739 Ga0307412_10034734 3300031911 Bacteria 3215
740 Ga0307409_100370716 3300031995 Bacteria 1358
741 Ga0307416_100052642 3300032002 Bacteria 3261
742 Ga0307416_100105257 3300032002 Unclassified 2469
743 Ga0307416_100138240 3300032002 Bacteria 2209
744 Ga0307416_100390432 3300032002 Bacteria 1426
745 Ga0307416_100497949 3300032002 Bacteria 1282
746 Ga0307416_100656294 3300032002 Bacteria 1134
747 Ga0307414_10050348 3300032004 Bacteria 2885
748 Ga0307411_10474862 3300032005 Bacteria 1052
749 Ga0307415_100077488 3300032126 Unclassified 2361
750 Ga0307415_100126033 3300032126 Bacteria 1930
751 Ga0307415_100358610 3300032126 Bacteria 1230
752 Ga0373958_0034645 3300034819 Bacteria 1007
753 Ga0373958_0042935 3300034819 Bacteria 930
754 Ga0373926_0030225 3300035083 Unclassified 1907
755 Ga0373926_0084736 3300035083 Bacteria 1175
756 Ga0373940_0106412 3300035088 Bacteria 857
757 Ga0373949_0111813 3300035090 Bacteria 759
758 Ga0373949_0133286 3300035090 Unclassified 706
759 Ga0373952_0012701 3300035092 Bacteria 1661
760 Ga0373923_0236918 3300035111 Bacteria 852
761 Ga0373939_0177465 3300035114 Unclassified 792
762 Ga0373941_0098558 3300035115 Unclassified 1014
763 Ga0373941_0149254 3300035115 Unclassified 856
764 Ga0373945_0023198 3300035116 Bacteria 2143
765 Ga0373960_0009345 3300035121 Bacteria 2373
766 Ga0373943_0223882 3300035170 Unclassified 1049
767 Ga0373931_0009512 3300035691 Bacteria 4647
768 Ga0373927_0525940 3300035695 Bacteria 782
769 Ga0373933_0048168 3300035724 Bacteria 2537
770 Ga0373937_0086289 3300036401 Bacteria 2905
771 Ga0373937_0103302 3300036401 Bacteria 2647
772 Ga0373937_0285603 3300036401 Bacteria 1559
773 Ga0373937_0631625 3300036401 Bacteria 1016
774 Ga0373937_0631680 3300036401 Bacteria 1016
775 Ga0373925_0027581 3300037068 Bacteria 4157
776 Ga0373925_0552846 3300037068 Bacteria 947
777 Ga0400490_10325 3300038726 Bacteria 52681
778 Ga0400491_11348 3300038727 Bacteria 7348
779 Ga0400489_76132 3300039093 Bacteria 1104
780 Ga0439438_058205 3300041405 Bacteria 971
781 Ga0439447_010933 3300041407 Bacteria 2673
782 Ga0439453_0003992 3300041408 Bacteria 2167
783 Ga0439461_0035251 3300041410 Bacteria 1061
784 Ga0451853_1940769 3300041512 Unclassified 1591
785 Ga0451853_2329500 3300041512 Bacteria 1103
786 Ga0439433_0017488 3300041999 Bacteria 1592
787 Ga0439441_003072 3300042001 Bacteria 2420
788 Ga0439448_0035817 3300042005 Bacteria 1591
789 Ga0439432_035110 3300042006 Bacteria 1607
790 Ga0439450_000289 3300042008 Bacteria 6222
791 Ga0439450_019708 3300042008 Bacteria 1432
792 Ga0439450_125750 3300042008 Bacteria 662
793 Ga0439451_016701 3300042009 Bacteria 1478
794 Ga0439452_013979 3300042010 Bacteria 2240
795 Ga0439456_015300 3300042013 Unclassified 1602
796 Ga0439456_056997 3300042013 Bacteria 857
797 Ga0450923_016385 3300042125 Bacteria 1395
798 Ga0450923_065484 3300042125 Archaea 799
799 Ga0450896_002429 3300042133 Bacteria 2402
800 Ga0450896_015549 3300042133 Bacteria 1090
801 Ga0439446_0045893 3300042156 Bacteria 1296
802 Ga0439446_0068646 3300042156 Bacteria 1081
803 Ga0450909_027822 3300042185 Bacteria 854
804 Ga0439434_0003138 3300042435 Bacteria 4858
805 Ga0439434_0110659 3300042435 Bacteria 890
806 Ga0439434_0115256 3300042435 Bacteria 873
807 Ga0439435_0021616 3300042436 Bacteria 1672
808 Ga0439435_0185312 3300042436 Bacteria 681
809 Ga0439460_0076306 3300042461 Unclassified 1045
810 Ga0451577_0000099 3300042876 Bacteria 191842
811 Ga0451577_0010642 3300042876 Bacteria 8765
812 Ga0451577_0035953 3300042876 Bacteria 4462
813 Ga0451577_0039088 3300042876 Bacteria 4264
814 Ga0451577_0091136 3300042876 Bacteria 2721
815 Ga0451577_0179114 3300042876 Bacteria 1911
816 Ga0439440_0063986 3300042993 Unclassified 944
817 Ga0453683_0105451 3300044673 Unclassified 1770
818 Ga0453684_0000350 3300044712 Bacteria 191841
819 Ga0453684_0011762 3300044712 Bacteria 14591
820 Ga0453684_0027518 3300044712 Bacteria 8150
821 Ga0453684_0039023 3300044712 Bacteria 6477
822 Ga0453684_0143678 3300044712 Bacteria 2845
823 Ga0451576_0000471 3300045051 Bacteria 91500
824 Ga0451576_0005198 3300045051 Bacteria 16438
825 Ga0451576_0021687 3300045051 Bacteria 6978
826 Ga0451576_0135313 3300045051 Bacteria 2569
827 Ga0451576_0359059 3300045051 Bacteria 1526
828 Ga0495629_0014650 3300046459 Bacteria 5640
829 Ga0495594_0018424 3300046499 Bacteria 3697
830 Ga0495594_0025661 3300046499 Unclassified 3168
831 Ga0495594_0052839 3300046499 Bacteria 2237
832 Ga0495628_0302254 3300046516 Unclassified 1184
833 Ga0495628_0406239 3300046516 Bacteria 994
834 Ga0495652_0417177 3300046529 Bacteria 947
835 Ga0495640_0332069 3300046533 Unclassified 940
836 Ga0495586_0338789 3300046535 Bacteria 863
837 Ga0495598_0027179 3300046537 Bacteria 1576
838 Ga0495598_0161640 3300046537 Bacteria 788
839 Ga0495621_0000253 3300046539 Bacteria 12748
840 Ga0495633_0155955 3300046558 Bacteria 1054
841 Ga0495659_0017881 3300046664 Bacteria 2356
842 Ga0495599_0363725 3300046678 Bacteria 866
843 Ga0495647_0184952 3300046681 Bacteria 908
844 Ga0495658_0018821 3300046683 Bacteria 3597
845 Ga0495670_0254419 3300046691 Bacteria 937
846 Ga0495581_0010104 3300047315 Bacteria 5461
847 Ga0495636_0066656 3300047318 Bacteria 1531
848 Ga0495672_0000911 3300047320 Bacteria 30934
849 Ga0495676_0198153 3300047321 Bacteria 1397
850 Ga0495614_0080214 3300048089 Bacteria 1413
851 Ga0496101_0398909 3300048904 Bacteria 1083
852 Ga0496104_0076988 3300048907 Bacteria 3178
853 Ga0496104_0208295 3300048907 Bacteria 1867
854 Ga0496105_0886466 3300048908 Bacteria 673
855 Ga0496106_0308293 3300048909 Bacteria 1270
856 Ga0496106_0417224 3300048909 Bacteria 1079
857 Ga0496108_0082559 3300048911 Bacteria 2725
858 Ga0496108_0685324 3300048911 Bacteria 889
859 Ga0496109_0222921 3300048912 Unclassified 1773
860 Ga0496110_0035808 3300048913 Bacteria 4309
861 Ga0496112_0005329 3300048915 Bacteria 11101
862 Ga0496112_0005642 3300048915 Bacteria 10865
863 Ga0496112_0110221 3300048915 Bacteria 2723
864 Ga0496112_0435803 3300048915 Bacteria 1249
865 Ga0496113_0049333 3300048916 Bacteria 3134
866 Ga0496113_0462915 3300048916 Bacteria 1019
867 Ga0496114_0052718 3300048917 Bacteria 3389
868 Ga0501291_000488 3300049514 Bacteria 4616
869 Ga0501293_004272 3300049516 Bacteria 1123
870 Ga0501295_000527 3300049518 Bacteria 3586
871 Ga0501298_000073 3300049521 Bacteria 11007
872 Ga0501298_032825 3300049521 Bacteria 1026
873 Ga0501299_000048 3300049522 Bacteria 13201
874 Ga0501299_023155 3300049522 Unclassified 1150
875 Ga0501300_000939 3300049523 Bacteria 4450
876 Ga0501301_000833 3300049524 Bacteria 1917
877 Ga0501303_001510 3300049526 Bacteria 1739
878 Ga0501031_0021701 3300049568 Bacteria 4186
879 Ga0501031_0342664 3300049568 Unclassified 967
880 Ga0501033_0091133 3300049570 Bacteria 2230
881 Ga0501034_0468185 3300049571 Bacteria 1176
882 Ga0501036_0301083 3300049572 Bacteria 1341
883 Ga0501036_0341214 3300049572 Bacteria 1251
884 Ga0501036_0437191 3300049572 Unclassified 1090
885 Ga0501038_0254514 3300049574 Bacteria 1390
886 Ga0501039_0127983 3300049575 Unclassified 1993
887 Ga0501039_0458174 3300049575 Bacteria 1001
888 Ga0501039_0629334 3300049575 Unclassified 840
889 Ga0501040_0011021 3300049576 Bacteria 5910
890 Ga0501040_0013239 3300049576 Bacteria 5426
891 Ga0501040_0128933 3300049576 Bacteria 1778
892 Ga0501041_0018990 3300049577 Bacteria 4097
893 Ga0501041_0069816 3300049577 Bacteria 2156
894 Ga0501041_0113525 3300049577 Unclassified 1682
895 Ga0501041_0171110 3300049577 Bacteria 1359
896 Ga0501041_0173713 3300049577 Bacteria 1348
897 Ga0501042_0106405 3300049578 Bacteria 2019
898 Ga0501042_0197623 3300049578 Bacteria 1450
899 Ga0501042_0237533 3300049578 Bacteria 1315
900 Ga0501042_0245446 3300049578 Bacteria 1292
901 Ga0501046_0298905 3300049580 Bacteria 1176
902 Ga0501048_0064134 3300049582 Bacteria 2598
903 Ga0501048_0191872 3300049582 Bacteria 1448
904 Ga0501048_0197359 3300049582 Bacteria 1426
905 Ga0501048_0280676 3300049582 Bacteria 1184
906 Ga0501068_0018839 3300049584 Bacteria 4000
907 Ga0501071_0120294 3300049587 Bacteria 1946
908 Ga0501071_0305490 3300049587 Unclassified 1206
909 Ga0501072_0235406 3300049588 Bacteria 1458
910 Ga0501072_0556800 3300049588 Bacteria 905
911 Ga0501073_0002831 3300049589 Bacteria 13000
912 Ga0501073_0055066 3300049589 Bacteria 2784
913 Ga0501074_0201538 3300049590 Bacteria 1418
914 Ga0501075_0035944 3300049591 Bacteria 3696
915 Ga0501075_0291361 3300049591 Unclassified 1243
916 Ga0501075_0413234 3300049591 Bacteria 1029
917 Ga0501076_0018458 3300049592 Bacteria 5318
918 Ga0501076_0107571 3300049592 Bacteria 2252
919 Ga0501076_0232805 3300049592 Bacteria 1506
920 Ga0501076_0242849 3300049592 Bacteria 1473
921 Ga0501076_0458420 3300049592 Unclassified 1050
922 Ga0501076_0464334 3300049592 Unclassified 1042
923 Ga0501076_0776991 3300049592 Bacteria 790
924 Ga0501077_0014054 3300049593 Bacteria 5022
925 Ga0501077_0025415 3300049593 Bacteria 3762
926 Ga0501077_0437545 3300049593 Unclassified 837
927 Ga0501199_000966 3300049650 Bacteria 2575
928 Ga0501202_002220 3300049652 Bacteria 3241
929 Ga0501202_102510 3300049652 Bacteria 699
930 Ga0501208_004521 3300049655 Bacteria 1644
931 Ga0501209_000634 3300049656 Bacteria 4353
932 Ga0501217_010982 3300049661 Bacteria 1996
933 Ga0501217_044275 3300049661 Bacteria 1143
934 Ga0501227_077089 3300049665 Bacteria 871
935 Ga0501233_001024 3300049668 Bacteria 4752
936 Ga0501235_005843 3300049669 Bacteria 2679
937 Ga0501236_025732 3300049670 Bacteria 901
938 Ga0501243_001231 3300049675 Bacteria 3669
939 Ga0501246_000121 3300049676 Bacteria 4745
940 Ga0501249_032973 3300049679 Bacteria 1159
941 Ga0501251_000290 3300049681 Bacteria 4440
942 Ga0501256_005709 3300049685 Bacteria 1104
943 Ga0501257_011113 3300049686 Bacteria 2052
944 Ga0501261_004095 3300049690 Bacteria 1793
945 Ga0501221_002583 3300049704 Bacteria 2986
946 Ga0501225_0020194 3300049705 Bacteria 1841
947 Ga0501229_000424 3300049706 Bacteria 4772
948 Ga0501234_000290 3300049707 Bacteria 7353
949 Ga0501079_0048048 3300049741 Bacteria 3293
950 Ga0501079_0089110 3300049741 Bacteria 2389
951 Ga0501079_0115525 3300049741 Bacteria 2086
952 Ga0501079_0486125 3300049741 Unclassified 970
953 Ga0501080_0062248 3300049742 Bacteria 3473
954 Ga0501080_0085095 3300049742 Bacteria 2938
955 Ga0501080_0872456 3300049742 Bacteria 786
956 Ga0501081_0090955 3300049743 Bacteria 2146
957 Ga0501081_0160934 3300049743 Bacteria 1618
958 Ga0501081_1037128 3300049743 Bacteria 620
959 Ga0501263_026085 3300049760 Bacteria 807
960 Ga0501264_000674 3300049761 Bacteria 4684
961 Ga0501266_001401 3300049763 Bacteria 3079
962 Ga0501278_001930 3300049774 Bacteria 1459
963 Ga0501279_002809 3300049775 Bacteria 2270
964 Ga0501281_00924 3300049777 Bacteria 2474
965 Ga0501283_004328 3300049779 Bacteria 1914
966 Ga0501283_007596 3300049779 Bacteria 1547
967 Ga0501045_0258946 3300049824 Bacteria 1295
968 Ga0501045_0621411 3300049824 Unclassified 799
969 nmdc:mga05p37_1214327_c1 3300050507 Bacteria 778
970 nmdc:mga05p37_127165_c1 3300050507 Bacteria 3129
971 nmdc:mga05p37_156259_c1 3300050507 Bacteria 2787
972 nmdc:mga05p37_176866_c1 3300050507 Bacteria 2599
973 nmdc:mga05p37_193021_c1 3300050507 Bacteria 2471
974 nmdc:mga05p37_2169_c1 3300050507 Bacteria 22888
975 nmdc:mga05p37_30866_c1 3300050507 Bacteria 6541
976 nmdc:mga05p37_35207_c1 3300050507 Bacteria 6138
977 nmdc:mga05p37_376704_c1 3300050507 Bacteria 1664
978 nmdc:mga05p37_411232_c2 3300050507 Bacteria 1182
979 nmdc:mga05p37_53643_c2 3300050507 Bacteria 4487
980 nmdc:mga05p37_6745_c1 3300050507 Bacteria 13538
981 nmdc:mga05p37_74645_c1 3300050507 Bacteria 4174
982 nmdc:mga05p37_74813_c1 3300050507 Bacteria 4169
983 nmdc:mga05p37_75048_c1 3300050507 Bacteria 4162
984 nmdc:mga05p37_760502_c1 3300050507 Unclassified 1066
985 nmdc:mga09592_123314_c1 3300050508 Bacteria 2227
986 nmdc:mga09592_142368_c1 3300050508 Bacteria 2067
987 nmdc:mga09592_160271_c1 3300050508 Bacteria 1943
988 nmdc:mga09592_397043_c1 3300050508 Bacteria 1192
989 nmdc:mga09592_477817_c1 3300050508 Bacteria 1074
990 nmdc:mga09592_4935_c1 3300050508 Bacteria 10818
991 nmdc:mga09592_57742_c1 3300050508 Bacteria 3281
992 nmdc:mga0qj67_116349_c1 3300050509 Bacteria 2160
993 nmdc:mga0qj67_212178_c1 3300050509 Bacteria 1572
994 nmdc:mga0qj67_256855_c1 3300050509 Bacteria 1418
995 nmdc:mga0qj67_8816_c1 3300050509 Bacteria 7485
996 nmdc:mga06r32_1105884_c1 3300050510 Bacteria 741
997 nmdc:mga06r32_1114373_c1 3300050510 Unclassified 738
998 nmdc:mga06r32_1232812_c1 3300050510 Unclassified 693
999 nmdc:mga06r32_185062_c1 3300050510 Bacteria 2069
1000 nmdc:mga06r32_55337_c1 3300050510 Bacteria 3805
1001 nmdc:mga06r32_58087_c1 3300050510 Bacteria 3718
1002 nmdc:mga08y16_1340_c1 3300050511 Bacteria 24552
1003 nmdc:mga08y16_1540_c1 3300050511 Bacteria 23195
1004 nmdc:mga08y16_159603_c1 3300050511 Bacteria 2343
1005 nmdc:mga08y16_2229_c1 3300050511 Bacteria 19859
1006 nmdc:mga08y16_244510_c1 3300050511 Bacteria 1854
1007 nmdc:mga08y16_2595_c1 3300050511 Bacteria 18556
1008 nmdc:mga08y16_45702_c1 3300050511 Bacteria 4587
1009 nmdc:mga08y16_55323_c1 3300050511 Bacteria 4147
1010 nmdc:mga08y16_7280_c1 3300050511 Bacteria 11614
1011 nmdc:mga08y16_75653_c1 3300050511 Bacteria 3510
1012 nmdc:mga0n895_108093_c1 3300050512 Unclassified 2796
1013 nmdc:mga0n895_14984_c1 3300050512 Bacteria 7062
1014 nmdc:mga0n895_1500_c1 3300050512 Bacteria 17509
1015 nmdc:mga0n895_18994_c1 3300050512 Bacteria 6377
1016 nmdc:mga0n895_223446_c1 3300050512 Bacteria 1911
1017 nmdc:mga0n895_291448_c1 3300050512 Bacteria 1655
1018 nmdc:mga0n895_308498_c1 3300050512 Bacteria 1604
1019 nmdc:mga0n895_378447_c1 3300050512 Unclassified 1433
1020 nmdc:mga0n895_408790_c1 3300050512 Bacteria 1373
1021 nmdc:mga0n895_702168_c1 3300050512 Bacteria 1007
1022 nmdc:mga0n895_95_c1 3300050512 Bacteria 52030
1023 nmdc:mga0rr50_102750_c1 3300050513 Bacteria 2249
1024 nmdc:mga0rr50_105623_c1 3300050513 Bacteria 2221
1025 nmdc:mga0rr50_13491_c1 3300050513 Bacteria 5321
1026 nmdc:mga0rr50_17771_c1 3300050513 Bacteria 4759
1027 nmdc:mga0rr50_193363_c1 3300050513 Bacteria 1669
1028 nmdc:mga0rr50_283931_c1 3300050513 Bacteria 1382
1029 nmdc:mga0rr50_28_c1 3300050513 Bacteria 108950
1030 nmdc:mga0rr50_4559_c1 3300050513 Bacteria 8153
1031 nmdc:mga0rr50_46608_c1 3300050513 Bacteria 3192
1032 nmdc:mga0rr50_788376_c1 3300050513 Bacteria 811
1033 nmdc:mga0rr50_864788_c1 3300050513 Bacteria 771
1034 nmdc:mga08x19_11377_c1 3300050514 Bacteria 5356
1035 nmdc:mga08x19_121_c1 3300050514 Bacteria 69968
1036 nmdc:mga08x19_28970_c1 3300050514 Bacteria 3472
1037 nmdc:mga08x19_55142_c1 3300050514 Bacteria 2561
1038 nmdc:mga08x19_58793_c1 3300050514 Bacteria 2488
1039 nmdc:mga08x19_62829_c1 3300050514 Bacteria 2408
1040 nmdc:mga08x19_91733_c1 3300050514 Bacteria 2005
1041 nmdc:mga0a205_1053_c2 3300050515 Bacteria 7492
1042 nmdc:mga0a205_33911_c1 3300050515 Bacteria 4896
1043 nmdc:mga0a205_35961_c1 3300050515 Bacteria 4757
1044 nmdc:mga0a205_384820_c1 3300050515 Bacteria 1268
1045 nmdc:mga0a205_431012_c1 3300050515 Bacteria 1180
1046 nmdc:mga0a205_476_c1 3300050515 Bacteria 31298
1047 nmdc:mga0a205_538846_c1 3300050515 Unclassified 1023
1048 nmdc:mga0a205_53893_c1 3300050515 Bacteria 3882
1049 nmdc:mga0a205_552440_c1 3300050515 Bacteria 1007
1050 nmdc:mga0a205_5677_c1 3300050515 Bacteria 11242
1051 nmdc:mga0a205_6503_c1 3300050515 Bacteria 10566
1052 nmdc:mga0a205_78431_c1 3300050515 Unclassified 3191
1053 Ga0495601_0009411 3300053077 Bacteria 5778
1054 Ga0495601_0147173 3300053077 Bacteria 1537
1055 Ga0495619_0487330 3300053085 Unclassified 848
1056 Ga0500555_005302 3300053103 Bacteria 3657
1057 Ga0501084_0054920 3300054114 Bacteria 3332
1058 Ga0590075_004459 3300059424 Bacteria 3316
1059 Ga0501082_0069283 3300060353 Bacteria 3037
1060 Ga0501082_0381461 3300060353 Bacteria 1230
1061 Ga0501082_0471300 3300060353 Bacteria 1097
1062 Ga0501082_0644367 3300060353 Unclassified 927
1063 Ga0501082_0703868 3300060353 Bacteria 884
1064 Ga0530510_0066955 3300061734 Bacteria 2605
1065 Ga0530510_0288448 3300061734 Bacteria 1227

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050510 nmdc:mga06r32_1232812_c1 nmdc:mga06r32_1232812_c1_58_603 181
2 3300042008 Ga0439450_125750 Ga0439450_125750_43_603 186
3 3300042436 Ga0439435_0185312 Ga0439435_0185312_53_613 186
4 3300028380 Ga0268265_10886111 Ga0268265_108861111 189
5 3300042008 Ga0439450_019708 Ga0439450_019708_838_1407 189
6 3300042156 Ga0439446_0068646 Ga0439446_0068646_49_618 189
7 3300049652 Ga0501202_102510 Ga0501202_102510_14_583 189
8 3300035115 Ga0373941_0149254 Ga0373941_0149254_259_831 190
9 3300049742 Ga0501080_0872456 Ga0501080_0872456_204_776 190
10 3300046683 Ga0495658_0018821 Ga0495658_0018821_14_589 191
11 3300048904 Ga0496101_0398909 Ga0496101_0398909_461_1036 191
12 3300049571 Ga0501034_0468185 Ga0501034_0468185_46_621 191
13 3300049582 Ga0501048_0064134 Ga0501048_0064134_1988_2563 191
14 3300049593 Ga0501077_0437545 Ga0501077_0437545_11_586 191
15 3300049741 Ga0501079_0115525 Ga0501079_0115525_1472_2047 191
16 3300049743 Ga0501081_1037128 Ga0501081_1037128_28_603 191
17 3300050513 nmdc:mga0rr50_788376_c1 nmdc:mga0rr50_788376_c1_212_787 191
18 3300005440 Ga0070705_100186311 Ga0070705_1001863112 193
19 3300025934 Ga0207686_10004046 Ga0207686_100040462 193
20 3300005441 Ga0070700_100776910 Ga0070700_1007769101 197
21 3300014326 Ga0157380_10029391 Ga0157380_100293912 197
22 3300026075 Ga0207708_10441513 Ga0207708_104415132 197
23 3300049760 Ga0501263_026085 Ga0501263_026085_120_713 197
24 3300005546 Ga0070696_100073659 Ga0070696_1000736592 198
25 3300005338 Ga0068868_100200115 Ga0068868_1002001152 200
26 3300005539 Ga0068853_100459082 Ga0068853_1004590822 200
27 3300005842 Ga0068858_100126799 Ga0068858_1001267991 200
28 3300005843 Ga0068860_100484848 Ga0068860_1004848481 200
29 3300009177 Ga0105248_10056753 Ga0105248_100567533 200
30 3300025903 Ga0207680_10765267 Ga0207680_107652671 200
31 3300025941 Ga0207711_10076709 Ga0207711_100767093 200
32 3300025981 Ga0207640_10896771 Ga0207640_108967711 200
33 3300026023 Ga0207677_10232312 Ga0207677_102323122 200
34 3300026035 Ga0207703_10053921 Ga0207703_100539213 200
35 3300042876 Ga0451577_0035953 Ga0451577_0035953_1663_2313 203
36 3300044712 Ga0453684_0143678 Ga0453684_0143678_1227_1877 203
37 3300045051 Ga0451576_0000471 Ga0451576_0000471_56565_57215 203
38 3300042993 Ga0439440_0063986 Ga0439440_0063986_62_676 204
39 3300028379 Ga0268266_10261906 Ga0268266_102619062 206
40 3300035088 Ga0373940_0106412 Ga0373940_0106412_35_655 206
41 3300035691 Ga0373931_0009512 Ga0373931_0009512_2030_2650 206
42 3300047318 Ga0495636_0066656 Ga0495636_0066656_28_648 206
43 3300009094 Ga0111539_10007551 Ga0111539_100075513 207
44 3300027717 Ga0209998_10095011 Ga0209998_100950111 207
45 3300027907 Ga0207428_10009135 Ga0207428_1000913514 207
46 3300038726 Ga0400490_10325 Ga0400490_10325_44823_45500 207
47 3300038727 Ga0400491_11348 Ga0400491_11348_3882_4559 207
48 3300050511 nmdc:mga08y16_2229_c1 nmdc:mga08y16_2229_c1_5417_6058 207
49 3300025933 Ga0207706_10672387 Ga0207706_106723871 208
50 3300042876 Ga0451577_0000099 Ga0451577_0000099_28632_29288 209
51 3300044712 Ga0453684_0000350 Ga0453684_0000350_162555_163211 209
52 3300005289 Ga0065704_10015486 Ga0065704_100154861 211
53 3300005289 Ga0065704_10140576 Ga0065704_101405762 211
54 3300005290 Ga0065712_10187895 Ga0065712_101878951 211
55 3300005293 Ga0065715_10022852 Ga0065715_100228522 211
56 3300005295 Ga0065707_10137543 Ga0065707_101375432 211
57 3300005328 Ga0070676_10007566 Ga0070676_100075662 211
58 3300005329 Ga0070683_100013326 Ga0070683_1000133267 211
59 3300005329 Ga0070683_100169018 Ga0070683_1001690182 211
60 3300005330 Ga0070690_100000336 Ga0070690_10000033617 211
61 3300005330 Ga0070690_100035498 Ga0070690_1000354982 211
62 3300005330 Ga0070690_100050976 Ga0070690_1000509762 211
63 3300005331 Ga0070670_100035231 Ga0070670_1000352315 211
64 3300005335 Ga0070666_10008555 Ga0070666_100085554 211
65 3300005336 Ga0070680_100167068 Ga0070680_1001670682 211
66 3300005338 Ga0068868_100061553 Ga0068868_1000615534 211
67 3300005338 Ga0068868_100130709 Ga0068868_1001307091 211
68 3300005338 Ga0068868_100300052 Ga0068868_1003000522 211
69 3300005339 Ga0070660_100012311 Ga0070660_1000123112 211
70 3300005339 Ga0070660_100104112 Ga0070660_1001041122 211
71 3300005340 Ga0070689_100000066 Ga0070689_10000006619 211
72 3300005340 Ga0070689_100460076 Ga0070689_1004600761 211
73 3300005340 Ga0070689_100630372 Ga0070689_1006303722 211
74 3300005347 Ga0070668_100275499 Ga0070668_1002754992 211
75 3300005353 Ga0070669_100001454 Ga0070669_1000014544 211
76 3300005353 Ga0070669_100341127 Ga0070669_1003411272 211
77 3300005354 Ga0070675_100051067 Ga0070675_1000510675 211
78 3300005355 Ga0070671_100032528 Ga0070671_1000325283 211
79 3300005356 Ga0070674_100002716 Ga0070674_1000027164 211
80 3300005356 Ga0070674_100064531 Ga0070674_1000645313 211
81 3300005364 Ga0070673_100000103 Ga0070673_10000010346 211
82 3300005364 Ga0070673_100003965 Ga0070673_1000039654 211
83 3300005365 Ga0070688_100001477 Ga0070688_1000014777 211
84 3300005365 Ga0070688_100055066 Ga0070688_1000550663 211
85 3300005365 Ga0070688_100105296 Ga0070688_1001052963 211
86 3300005366 Ga0070659_100375231 Ga0070659_1003752311 211
87 3300005435 Ga0070714_100253206 Ga0070714_1002532062 211
88 3300005437 Ga0070710_10027928 Ga0070710_100279283 211
89 3300005438 Ga0070701_10000020 Ga0070701_1000002017 211
90 3300005438 Ga0070701_10138561 Ga0070701_101385612 211
91 3300005440 Ga0070705_100069953 Ga0070705_1000699532 211
92 3300005440 Ga0070705_100401137 Ga0070705_1004011371 211
93 3300005441 Ga0070700_100000818 Ga0070700_10000081810 211
94 3300005444 Ga0070694_100054370 Ga0070694_1000543702 211
95 3300005444 Ga0070694_100106143 Ga0070694_1001061432 211
96 3300005444 Ga0070694_100116412 Ga0070694_1001164122 211
97 3300005445 Ga0070708_100022317 Ga0070708_1000223172 211
98 3300005445 Ga0070708_100101619 Ga0070708_1001016192 211
99 3300005455 Ga0070663_100032089 Ga0070663_1000320892 211
100 3300005456 Ga0070678_100002436 Ga0070678_1000024366 211
101 3300005456 Ga0070678_100032871 Ga0070678_1000328713 211
102 3300005457 Ga0070662_100027204 Ga0070662_1000272045 211
103 3300005457 Ga0070662_100100568 Ga0070662_1001005683 211
104 3300005458 Ga0070681_10073223 Ga0070681_100732232 211
105 3300005458 Ga0070681_10129868 Ga0070681_101298684 211
106 3300005459 Ga0068867_100001096 Ga0068867_10000109610 211
107 3300005459 Ga0068867_100027704 Ga0068867_1000277044 211
108 3300005466 Ga0070685_10000069 Ga0070685_1000006952 211
109 3300005466 Ga0070685_10062750 Ga0070685_100627502 211
110 3300005466 Ga0070685_10165941 Ga0070685_101659412 211
111 3300005466 Ga0070685_10167642 Ga0070685_101676422 211
112 3300005467 Ga0070706_100096995 Ga0070706_1000969952 211
113 3300005467 Ga0070706_100144241 Ga0070706_1001442412 211
114 3300005468 Ga0070707_100000021 Ga0070707_10000002179 211
115 3300005468 Ga0070707_100038006 Ga0070707_1000380063 211
116 3300005468 Ga0070707_100041900 Ga0070707_1000419003 211
117 3300005468 Ga0070707_100669326 Ga0070707_1006693261 211
118 3300005471 Ga0070698_100029698 Ga0070698_1000296982 211
119 3300005471 Ga0070698_100289952 Ga0070698_1002899522 211
120 3300005518 Ga0070699_100001737 Ga0070699_1000017372 211
121 3300005518 Ga0070699_100037057 Ga0070699_1000370574 211
122 3300005518 Ga0070699_100335870 Ga0070699_1003358702 211
123 3300005530 Ga0070679_100171169 Ga0070679_1001711692 211
124 3300005536 Ga0070697_100048178 Ga0070697_1000481782 211
125 3300005536 Ga0070697_100061083 Ga0070697_1000610832 211
126 3300005536 Ga0070697_100178419 Ga0070697_1001784192 211
127 3300005543 Ga0070672_100002045 Ga0070672_1000020453 211
128 3300005543 Ga0070672_100151381 Ga0070672_1001513812 211
129 3300005544 Ga0070686_100000100 Ga0070686_10000010015 211
130 3300005544 Ga0070686_100040570 Ga0070686_1000405702 211
131 3300005545 Ga0070695_100063731 Ga0070695_1000637312 211
132 3300005545 Ga0070695_100799634 Ga0070695_1007996341 211
133 3300005546 Ga0070696_100003911 Ga0070696_1000039113 211
134 3300005546 Ga0070696_100101272 Ga0070696_1001012722 211
135 3300005546 Ga0070696_100250978 Ga0070696_1002509782 211
136 3300005546 Ga0070696_100259553 Ga0070696_1002595532 211
137 3300005548 Ga0070665_100340116 Ga0070665_1003401162 211
138 3300005548 Ga0070665_100422305 Ga0070665_1004223052 211
139 3300005549 Ga0070704_100012684 Ga0070704_1000126842 211
140 3300005549 Ga0070704_100040734 Ga0070704_1000407342 211
141 3300005549 Ga0070704_100139194 Ga0070704_1001391943 211
142 3300005549 Ga0070704_100708027 Ga0070704_1007080271 211
143 3300005563 Ga0068855_100112064 Ga0068855_1001120644 211
144 3300005564 Ga0070664_100000584 Ga0070664_10000058421 211
145 3300005564 Ga0070664_100029223 Ga0070664_1000292236 211
146 3300005564 Ga0070664_100107093 Ga0070664_1001070932 211
147 3300005577 Ga0068857_100020770 Ga0068857_1000207707 211
148 3300005615 Ga0070702_100023978 Ga0070702_1000239783 211
149 3300005615 Ga0070702_100116927 Ga0070702_1001169272 211
150 3300005617 Ga0068859_100004613 Ga0068859_1000046134 211
151 3300005718 Ga0068866_10002332 Ga0068866_100023327 211
152 3300005718 Ga0068866_10202778 Ga0068866_102027781 211
153 3300005719 Ga0068861_100053791 Ga0068861_1000537912 211
154 3300005842 Ga0068858_100833859 Ga0068858_1008338592 211
155 3300005842 Ga0068858_100986190 Ga0068858_1009861901 211
156 3300005843 Ga0068860_100033522 Ga0068860_1000335223 211
157 3300005843 Ga0068860_100033985 Ga0068860_1000339852 211
158 3300005844 Ga0068862_100018207 Ga0068862_1000182073 211
159 3300005937 Ga0081455_10000786 Ga0081455_1000078628 211
160 3300006163 Ga0070715_10015855 Ga0070715_100158553 211
161 3300006173 Ga0070716_100206208 Ga0070716_1002062082 211
162 3300006173 Ga0070716_100220732 Ga0070716_1002207322 211
163 3300006237 Ga0097621_100001601 Ga0097621_10000160115 211
164 3300006237 Ga0097621_100056007 Ga0097621_1000560074 211
165 3300006237 Ga0097621_100086311 Ga0097621_1000863112 211
166 3300006358 Ga0068871_100033300 Ga0068871_1000333003 211
167 3300006358 Ga0068871_100352776 Ga0068871_1003527763 211
168 3300006844 Ga0075428_100037061 Ga0075428_1000370612 211
169 3300006846 Ga0075430_100006133 Ga0075430_1000061333 211
170 3300006846 Ga0075430_100009586 Ga0075430_1000095865 211
171 3300006847 Ga0075431_100073904 Ga0075431_1000739043 211
172 3300006852 Ga0075433_10067320 Ga0075433_100673203 211
173 3300006852 Ga0075433_10129334 Ga0075433_101293342 211
174 3300006852 Ga0075433_10492670 Ga0075433_104926702 211
175 3300006852 Ga0075433_10540806 Ga0075433_105408061 211
176 3300006871 Ga0075434_100025831 Ga0075434_1000258312 211
177 3300006880 Ga0075429_100001236 Ga0075429_10000123619 211
178 3300006880 Ga0075429_100018761 Ga0075429_1000187616 211
179 3300006881 Ga0068865_100266952 Ga0068865_1002669522 211
180 3300006881 Ga0068865_100339852 Ga0068865_1003398523 211
181 3300006914 Ga0075436_100025325 Ga0075436_1000253256 211
182 3300006914 Ga0075436_100037192 Ga0075436_1000371925 211
183 3300006914 Ga0075436_100322257 Ga0075436_1003222572 211
184 3300006931 Ga0097620_100004613 Ga0097620_1000046134 211
185 3300009094 Ga0111539_10010427 Ga0111539_100104275 211
186 3300009147 Ga0114129_10004893 Ga0114129_100048939 211
187 3300009147 Ga0114129_10018292 Ga0114129_100182927 211
188 3300009147 Ga0114129_10094153 Ga0114129_100941532 211
189 3300009147 Ga0114129_10126682 Ga0114129_101266822 211
190 3300009148 Ga0105243_10000238 Ga0105243_1000023828 211
191 3300009176 Ga0105242_10001243 Ga0105242_1000124317 211
192 3300009176 Ga0105242_10007339 Ga0105242_100073395 211
193 3300009177 Ga0105248_10271331 Ga0105248_102713312 211
194 3300009551 Ga0105238_10686821 Ga0105238_106868212 211
195 3300013102 Ga0157371_10184330 Ga0157371_101843301 211
196 3300013105 Ga0157369_10337892 Ga0157369_103378922 211
197 3300013296 Ga0157374_10064849 Ga0157374_100648495 211
198 3300013296 Ga0157374_10504422 Ga0157374_105044222 211
199 3300013297 Ga0157378_10002332 Ga0157378_100023325 211
200 3300013297 Ga0157378_10174325 Ga0157378_101743252 211
201 3300013306 Ga0163162_10102935 Ga0163162_101029354 211
202 3300013308 Ga0157375_10022418 Ga0157375_100224186 211
203 3300013308 Ga0157375_10089852 Ga0157375_100898523 211
204 3300014326 Ga0157380_10002955 Ga0157380_100029556 211
205 3300014326 Ga0157380_10486371 Ga0157380_104863712 211
206 3300014745 Ga0157377_10018864 Ga0157377_100188645 211
207 3300014969 Ga0157376_10048960 Ga0157376_100489601 211
208 3300014969 Ga0157376_10650086 Ga0157376_106500861 211
209 3300017792 Ga0163161_10161833 Ga0163161_101618332 211
210 3300025893 Ga0207682_10011353 Ga0207682_100113534 211
211 3300025898 Ga0207692_10035866 Ga0207692_100358662 211
212 3300025899 Ga0207642_10110274 Ga0207642_101102742 211
213 3300025901 Ga0207688_10221170 Ga0207688_102211701 211
214 3300025903 Ga0207680_10051609 Ga0207680_100516092 211
215 3300025905 Ga0207685_10011619 Ga0207685_100116192 211
216 3300025907 Ga0207645_10007763 Ga0207645_100077638 211
217 3300025910 Ga0207684_10000737 Ga0207684_1000073735 211
218 3300025910 Ga0207684_10031826 Ga0207684_100318264 211
219 3300025910 Ga0207684_10296558 Ga0207684_102965582 211
220 3300025911 Ga0207654_10091248 Ga0207654_100912483 211
221 3300025912 Ga0207707_10070129 Ga0207707_100701293 211
222 3300025917 Ga0207660_10004716 Ga0207660_100047167 211
223 3300025917 Ga0207660_10142675 Ga0207660_101426752 211
224 3300025918 Ga0207662_10001208 Ga0207662_1000120812 211
225 3300025918 Ga0207662_10140373 Ga0207662_101403732 211
226 3300025919 Ga0207657_10060146 Ga0207657_100601462 211
227 3300025919 Ga0207657_10093048 Ga0207657_100930482 211
228 3300025920 Ga0207649_10029456 Ga0207649_100294562 211
229 3300025921 Ga0207652_10124757 Ga0207652_101247572 211
230 3300025922 Ga0207646_10000231 Ga0207646_1000023175 211
231 3300025922 Ga0207646_10000547 Ga0207646_1000054743 211
232 3300025922 Ga0207646_10127744 Ga0207646_101277442 211
233 3300025922 Ga0207646_10611216 Ga0207646_106112161 211
234 3300025923 Ga0207681_10064590 Ga0207681_100645903 211
235 3300025925 Ga0207650_10114607 Ga0207650_101146072 211
236 3300025926 Ga0207659_10168017 Ga0207659_101680172 211
237 3300025926 Ga0207659_10289572 Ga0207659_102895722 211
238 3300025927 Ga0207687_10057635 Ga0207687_100576352 211
239 3300025928 Ga0207700_11125101 Ga0207700_111251011 211
240 3300025931 Ga0207644_10107568 Ga0207644_101075684 211
241 3300025933 Ga0207706_10005586 Ga0207706_1000558611 211
242 3300025933 Ga0207706_10403920 Ga0207706_104039202 211
243 3300025934 Ga0207686_10015028 Ga0207686_100150283 211
244 3300025936 Ga0207670_10000098 Ga0207670_1000009816 211
245 3300025936 Ga0207670_10018961 Ga0207670_100189612 211
246 3300025936 Ga0207670_10064879 Ga0207670_100648792 211
247 3300025937 Ga0207669_10411894 Ga0207669_104118941 211
248 3300025938 Ga0207704_10145885 Ga0207704_101458852 211
249 3300025939 Ga0207665_10129988 Ga0207665_101299882 211
250 3300025939 Ga0207665_10135890 Ga0207665_101358902 211
251 3300025940 Ga0207691_10000209 Ga0207691_100002092 211
252 3300025940 Ga0207691_10016035 Ga0207691_100160355 211
253 3300025941 Ga0207711_10007687 Ga0207711_100076878 211
254 3300025942 Ga0207689_10003806 Ga0207689_1000380611 211
255 3300025942 Ga0207689_10182618 Ga0207689_101826181 211
256 3300025942 Ga0207689_10578185 Ga0207689_105781851 211
257 3300025944 Ga0207661_10053538 Ga0207661_100535382 211
258 3300025945 Ga0207679_10002301 Ga0207679_100023013 211
259 3300025945 Ga0207679_10003057 Ga0207679_100030577 211
260 3300025945 Ga0207679_10285976 Ga0207679_102859762 211
261 3300025949 Ga0207667_10175780 Ga0207667_101757802 211
262 3300025960 Ga0207651_10000027 Ga0207651_1000002775 211
263 3300025960 Ga0207651_10233236 Ga0207651_102332362 211
264 3300025960 Ga0207651_10580045 Ga0207651_105800452 211
265 3300025961 Ga0207712_10411109 Ga0207712_104111092 211
266 3300025972 Ga0207668_10804354 Ga0207668_108043541 211
267 3300025986 Ga0207658_10011910 Ga0207658_100119105 211
268 3300025986 Ga0207658_10092466 Ga0207658_100924664 211
269 3300026023 Ga0207677_10394383 Ga0207677_103943832 211
270 3300026067 Ga0207678_10029975 Ga0207678_100299755 211
271 3300026075 Ga0207708_10001575 Ga0207708_100015754 211
272 3300026075 Ga0207708_10590216 Ga0207708_105902161 211
273 3300026088 Ga0207641_10718470 Ga0207641_107184701 211
274 3300026089 Ga0207648_10000543 Ga0207648_1000054328 211
275 3300026089 Ga0207648_10004219 Ga0207648_1000421916 211
276 3300026116 Ga0207674_10029412 Ga0207674_100294122 211
277 3300026121 Ga0207683_10001107 Ga0207683_100011077 211
278 3300026121 Ga0207683_10017195 Ga0207683_100171955 211
279 3300027360 Ga0209969_1000120 Ga0209969_100012012 211
280 3300027364 Ga0209967_1000144 Ga0209967_10001447 211
281 3300027364 Ga0209967_1003541 Ga0209967_10035412 211
282 3300027378 Ga0209981_1000003 Ga0209981_100000328 211
283 3300027395 Ga0209996_1000058 Ga0209996_10000583 211
284 3300027424 Ga0209984_1000444 Ga0209984_10004444 211
285 3300027424 Ga0209984_1010133 Ga0209984_10101332 211
286 3300027462 Ga0210000_1000024 Ga0210000_100002415 211
287 3300027471 Ga0209995_1000087 Ga0209995_10000873 211
288 3300027471 Ga0209995_1018580 Ga0209995_10185802 211
289 3300027526 Ga0209968_1000019 Ga0209968_100001919 211
290 3300027543 Ga0209999_1000055 Ga0209999_100005511 211
291 3300027552 Ga0209982_1001564 Ga0209982_10015643 211
292 3300027614 Ga0209970_1000013 Ga0209970_100001321 211
293 3300027617 Ga0210002_1000024 Ga0210002_10000249 211
294 3300027665 Ga0209983_1001530 Ga0209983_10015302 211
295 3300027665 Ga0209983_1028790 Ga0209983_10287902 211
296 3300027682 Ga0209971_1000232 Ga0209971_10002324 211
297 3300027695 Ga0209966_1000331 Ga0209966_100033110 211
298 3300027717 Ga0209998_10000094 Ga0209998_1000009422 211
299 3300027876 Ga0209974_10001696 Ga0209974_100016967 211
300 3300027876 Ga0209974_10028942 Ga0209974_100289422 211
301 3300027876 Ga0209974_10150074 Ga0209974_101500741 211
302 3300027907 Ga0207428_10000529 Ga0207428_1000052926 211
303 3300027907 Ga0207428_10006577 Ga0207428_1000657710 211
304 3300028380 Ga0268265_10779926 Ga0268265_107799261 211
305 3300028381 Ga0268264_10073918 Ga0268264_100739183 211
306 3300031548 Ga0307408_100013769 Ga0307408_1000137696 211
307 3300031548 Ga0307408_100173814 Ga0307408_1001738142 211
308 3300031731 Ga0307405_10586391 Ga0307405_105863912 211
309 3300031824 Ga0307413_10596162 Ga0307413_105961622 211
310 3300031911 Ga0307412_10034734 Ga0307412_100347344 211
311 3300031995 Ga0307409_100370716 Ga0307409_1003707161 211
312 3300032004 Ga0307414_10050348 Ga0307414_100503485 211
313 3300032126 Ga0307415_100126033 Ga0307415_1001260333 211
314 3300034819 Ga0373958_0042935 Ga0373958_0042935_252_887 211
315 3300035083 Ga0373926_0030225 Ga0373926_0030225_846_1481 211
316 3300035092 Ga0373952_0012701 Ga0373952_0012701_357_992 211
317 3300035111 Ga0373923_0236918 Ga0373923_0236918_26_661 211
318 3300035115 Ga0373941_0098558 Ga0373941_0098558_166_813 211
319 3300035121 Ga0373960_0009345 Ga0373960_0009345_678_1313 211
320 3300035724 Ga0373933_0048168 Ga0373933_0048168_1529_2164 211
321 3300036401 Ga0373937_0086289 Ga0373937_0086289_450_1085 211
322 3300041405 Ga0439438_058205 Ga0439438_058205_203_838 211
323 3300041407 Ga0439447_010933 Ga0439447_010933_403_1038 211
324 3300041410 Ga0439461_0035251 Ga0439461_0035251_336_971 211
325 3300042001 Ga0439441_003072 Ga0439441_003072_1302_1937 211
326 3300042005 Ga0439448_0035817 Ga0439448_0035817_800_1435 211
327 3300042006 Ga0439432_035110 Ga0439432_035110_288_923 211
328 3300042008 Ga0439450_000289 Ga0439450_000289_5137_5772 211
329 3300042010 Ga0439452_013979 Ga0439452_013979_967_1602 211
330 3300042013 Ga0439456_015300 Ga0439456_015300_149_784 211
331 3300042013 Ga0439456_056997 Ga0439456_056997_126_761 211
332 3300042156 Ga0439446_0045893 Ga0439446_0045893_217_852 211
333 3300042185 Ga0450909_027822 Ga0450909_027822_28_663 211
334 3300042435 Ga0439434_0003138 Ga0439434_0003138_1768_2403 211
335 3300042876 Ga0451577_0010642 Ga0451577_0010642_7486_8130 211
336 3300042876 Ga0451577_0179114 Ga0451577_0179114_981_1616 211
337 3300044712 Ga0453684_0027518 Ga0453684_0027518_3467_4111 211
338 3300045051 Ga0451576_0005198 Ga0451576_0005198_12089_12724 211
339 3300045051 Ga0451576_0021687 Ga0451576_0021687_6234_6869 211
340 3300045051 Ga0451576_0135313 Ga0451576_0135313_1411_2046 211
341 3300045051 Ga0451576_0359059 Ga0451576_0359059_825_1460 211
342 3300046459 Ga0495629_0014650 Ga0495629_0014650_1962_2597 211
343 3300046499 Ga0495594_0018424 Ga0495594_0018424_1566_2201 211
344 3300046499 Ga0495594_0025661 Ga0495594_0025661_931_1566 211
345 3300046499 Ga0495594_0052839 Ga0495594_0052839_445_1080 211
346 3300046516 Ga0495628_0302254 Ga0495628_0302254_416_1051 211
347 3300046533 Ga0495640_0332069 Ga0495640_0332069_106_741 211
348 3300046535 Ga0495586_0338789 Ga0495586_0338789_211_846 211
349 3300047315 Ga0495581_0010104 Ga0495581_0010104_1210_1845 211
350 3300047321 Ga0495676_0198153 Ga0495676_0198153_718_1353 211
351 3300048089 Ga0495614_0080214 Ga0495614_0080214_370_1005 211
352 3300048908 Ga0496105_0886466 Ga0496105_0886466_16_651 211
353 3300048909 Ga0496106_0308293 Ga0496106_0308293_38_673 211
354 3300048911 Ga0496108_0082559 Ga0496108_0082559_174_809 211
355 3300048913 Ga0496110_0035808 Ga0496110_0035808_2645_3280 211
356 3300048915 Ga0496112_0435803 Ga0496112_0435803_130_765 211
357 3300048916 Ga0496113_0462915 Ga0496113_0462915_370_1005 211
358 3300048917 Ga0496114_0052718 Ga0496114_0052718_1458_2093 211
359 3300049514 Ga0501291_000488 Ga0501291_000488_1591_2226 211
360 3300049516 Ga0501293_004272 Ga0501293_004272_447_1082 211
361 3300049518 Ga0501295_000527 Ga0501295_000527_745_1380 211
362 3300049521 Ga0501298_000073 Ga0501298_000073_9715_10350 211
363 3300049522 Ga0501299_000048 Ga0501299_000048_4062_4697 211
364 3300049523 Ga0501300_000939 Ga0501300_000939_2656_3291 211
365 3300049524 Ga0501301_000833 Ga0501301_000833_966_1601 211
366 3300049526 Ga0501303_001510 Ga0501303_001510_199_834 211
367 3300049568 Ga0501031_0021701 Ga0501031_0021701_3387_4022 211
368 3300049568 Ga0501031_0342664 Ga0501031_0342664_114_752 211
369 3300049572 Ga0501036_0341214 Ga0501036_0341214_432_1079 211
370 3300049572 Ga0501036_0437191 Ga0501036_0437191_232_867 211
371 3300049575 Ga0501039_0127983 Ga0501039_0127983_1100_1735 211
372 3300049575 Ga0501039_0458174 Ga0501039_0458174_75_722 211
373 3300049575 Ga0501039_0629334 Ga0501039_0629334_179_814 211
374 3300049576 Ga0501040_0011021 Ga0501040_0011021_4738_5373 211
375 3300049577 Ga0501041_0113525 Ga0501041_0113525_324_959 211
376 3300049577 Ga0501041_0171110 Ga0501041_0171110_643_1278 211
377 3300049577 Ga0501041_0173713 Ga0501041_0173713_318_953 211
378 3300049578 Ga0501042_0197623 Ga0501042_0197623_266_913 211
379 3300049580 Ga0501046_0298905 Ga0501046_0298905_510_1157 211
380 3300049582 Ga0501048_0280676 Ga0501048_0280676_37_684 211
381 3300049584 Ga0501068_0018839 Ga0501068_0018839_1056_1691 211
382 3300049587 Ga0501071_0305490 Ga0501071_0305490_477_1112 211
383 3300049590 Ga0501074_0201538 Ga0501074_0201538_205_840 211
384 3300049591 Ga0501075_0291361 Ga0501075_0291361_442_1077 211
385 3300049592 Ga0501076_0018458 Ga0501076_0018458_2421_3056 211
386 3300049592 Ga0501076_0242849 Ga0501076_0242849_467_1102 211
387 3300049592 Ga0501076_0458420 Ga0501076_0458420_148_783 211
388 3300049592 Ga0501076_0464334 Ga0501076_0464334_95_730 211
389 3300049593 Ga0501077_0014054 Ga0501077_0014054_3828_4463 211
390 3300049593 Ga0501077_0025415 Ga0501077_0025415_3005_3640 211
391 3300049650 Ga0501199_000966 Ga0501199_000966_353_988 211
392 3300049652 Ga0501202_002220 Ga0501202_002220_1934_2569 211
393 3300049655 Ga0501208_004521 Ga0501208_004521_394_1029 211
394 3300049656 Ga0501209_000634 Ga0501209_000634_885_1520 211
395 3300049661 Ga0501217_010982 Ga0501217_010982_252_887 211
396 3300049665 Ga0501227_077089 Ga0501227_077089_209_844 211
397 3300049668 Ga0501233_001024 Ga0501233_001024_4083_4718 211
398 3300049669 Ga0501235_005843 Ga0501235_005843_1966_2601 211
399 3300049670 Ga0501236_025732 Ga0501236_025732_68_703 211
400 3300049675 Ga0501243_001231 Ga0501243_001231_2575_3210 211
401 3300049676 Ga0501246_000121 Ga0501246_000121_272_907 211
402 3300049681 Ga0501251_000290 Ga0501251_000290_2305_2940 211
403 3300049685 Ga0501256_005709 Ga0501256_005709_35_670 211
404 3300049686 Ga0501257_011113 Ga0501257_011113_199_834 211
405 3300049690 Ga0501261_004095 Ga0501261_004095_299_934 211
406 3300049704 Ga0501221_002583 Ga0501221_002583_258_893 211
407 3300049705 Ga0501225_0020194 Ga0501225_0020194_842_1477 211
408 3300049706 Ga0501229_000424 Ga0501229_000424_106_741 211
409 3300049707 Ga0501234_000290 Ga0501234_000290_4051_4686 211
410 3300049741 Ga0501079_0089110 Ga0501079_0089110_720_1355 211
411 3300049742 Ga0501080_0085095 Ga0501080_0085095_1984_2619 211
412 3300049743 Ga0501081_0160934 Ga0501081_0160934_807_1442 211
413 3300049761 Ga0501264_000674 Ga0501264_000674_2108_2743 211
414 3300049763 Ga0501266_001401 Ga0501266_001401_1853_2488 211
415 3300049774 Ga0501278_001930 Ga0501278_001930_609_1244 211
416 3300049775 Ga0501279_002809 Ga0501279_002809_794_1429 211
417 3300049777 Ga0501281_00924 Ga0501281_00924_1128_1763 211
418 3300049779 Ga0501283_004328 Ga0501283_004328_93_728 211
419 3300050507 nmdc:mga05p37_1214327_c1 nmdc:mga05p37_1214327_c1_61_696 211
420 3300050507 nmdc:mga05p37_156259_c1 nmdc:mga05p37_156259_c1_355_996 211
421 3300050507 nmdc:mga05p37_176866_c1 nmdc:mga05p37_176866_c1_242_877 211
422 3300050507 nmdc:mga05p37_35207_c1 nmdc:mga05p37_35207_c1_4270_4905 211
423 3300050507 nmdc:mga05p37_75048_c1 nmdc:mga05p37_75048_c1_1506_2168 211
424 3300050508 nmdc:mga09592_57742_c1 nmdc:mga09592_57742_c1_138_773 211
425 3300050509 nmdc:mga0qj67_8816_c1 nmdc:mga0qj67_8816_c1_6840_7475 211
426 3300050511 nmdc:mga08y16_7280_c1 nmdc:mga08y16_7280_c1_9102_9737 211
427 3300050512 nmdc:mga0n895_291448_c1 nmdc:mga0n895_291448_c1_510_1145 211
428 3300050512 nmdc:mga0n895_378447_c1 nmdc:mga0n895_378447_c1_568_1203 211
429 3300050512 nmdc:mga0n895_408790_c1 nmdc:mga0n895_408790_c1_656_1291 211
430 3300050513 nmdc:mga0rr50_102750_c1 nmdc:mga0rr50_102750_c1_282_917 211
431 3300050513 nmdc:mga0rr50_864788_c1 nmdc:mga0rr50_864788_c1_113_748 211
432 3300050514 nmdc:mga08x19_28970_c1 nmdc:mga08x19_28970_c1_1818_2453 211
433 3300050514 nmdc:mga08x19_58793_c1 nmdc:mga08x19_58793_c1_769_1404 211
434 3300050514 nmdc:mga08x19_62829_c1 nmdc:mga08x19_62829_c1_1583_2218 211
435 3300050515 nmdc:mga0a205_33911_c1 nmdc:mga0a205_33911_c1_96_731 211
436 3300050515 nmdc:mga0a205_35961_c1 nmdc:mga0a205_35961_c1_4070_4705 211
437 3300050515 nmdc:mga0a205_538846_c1 nmdc:mga0a205_538846_c1_288_923 211
438 3300050515 nmdc:mga0a205_6503_c1 nmdc:mga0a205_6503_c1_210_845 211
439 3300059424 Ga0590075_004459 Ga0590075_004459_392_1027 211
440 3300060353 Ga0501082_0471300 Ga0501082_0471300_305_940 211
441 3300005345 Ga0070692_10001597 Ga0070692_100015975 212
442 3300005345 Ga0070692_10035483 Ga0070692_100354833 212
443 3300005353 Ga0070669_100112110 Ga0070669_1001121102 212
444 3300005354 Ga0070675_100048236 Ga0070675_1000482363 212
445 3300005438 Ga0070701_10286350 Ga0070701_102863502 212
446 3300005439 Ga0070711_100439564 Ga0070711_1004395642 212
447 3300005440 Ga0070705_100042809 Ga0070705_1000428093 212
448 3300005444 Ga0070694_100047946 Ga0070694_1000479463 212
449 3300005444 Ga0070694_100397414 Ga0070694_1003974142 212
450 3300005458 Ga0070681_10014199 Ga0070681_100141992 212
451 3300005466 Ga0070685_10139038 Ga0070685_101390381 212
452 3300005543 Ga0070672_100045389 Ga0070672_1000453892 212
453 3300005545 Ga0070695_100189390 Ga0070695_1001893902 212
454 3300005545 Ga0070695_100575094 Ga0070695_1005750941 212
455 3300005548 Ga0070665_100470014 Ga0070665_1004700142 212
456 3300005549 Ga0070704_100008135 Ga0070704_1000081354 212
457 3300005840 Ga0068870_10006146 Ga0068870_100061464 212
458 3300006237 Ga0097621_100007328 Ga0097621_1000073283 212
459 3300006358 Ga0068871_100001107 Ga0068871_10000110717 212
460 3300007076 Ga0075435_100318908 Ga0075435_1003189082 212
461 3300009147 Ga0114129_10027396 Ga0114129_100273963 212
462 3300009176 Ga0105242_10259609 Ga0105242_102596093 212
463 3300013104 Ga0157370_10640920 Ga0157370_106409202 212
464 3300025912 Ga0207707_10002734 Ga0207707_1000273417 212
465 3300025918 Ga0207662_10333653 Ga0207662_103336532 212
466 3300025918 Ga0207662_10483314 Ga0207662_104833141 212
467 3300025926 Ga0207659_10010800 Ga0207659_100108003 212
468 3300025933 Ga0207706_10483263 Ga0207706_104832631 212
469 3300025934 Ga0207686_10237243 Ga0207686_102372432 212
470 3300025940 Ga0207691_10030425 Ga0207691_100304252 212
471 3300025944 Ga0207661_10723134 Ga0207661_107231342 212
472 3300025986 Ga0207658_10374305 Ga0207658_103743052 212
473 3300026075 Ga0207708_10320605 Ga0207708_103206052 212
474 3300026095 Ga0207676_10316048 Ga0207676_103160482 212
475 3300026121 Ga0207683_10075220 Ga0207683_100752203 212
476 3300036401 Ga0373937_0103302 Ga0373937_0103302_1340_1978 212
477 3300036401 Ga0373937_0631625 Ga0373937_0631625_271_909 212
478 3300039093 Ga0400489_76132 Ga0400489_76132_269_907 212
479 3300044673 Ga0453683_0105451 Ga0453683_0105451_264_941 212
480 3300044712 Ga0453684_0011762 Ga0453684_0011762_7268_7912 212
481 3300047320 Ga0495672_0000911 Ga0495672_0000911_5801_6439 212
482 3300049522 Ga0501299_023155 Ga0501299_023155_438_1121 212
483 3300049588 Ga0501072_0556800 Ga0501072_0556800_50_688 212
484 3300049589 Ga0501073_0002831 Ga0501073_0002831_4659_5297 212
485 3300050513 nmdc:mga0rr50_283931_c1 nmdc:mga0rr50_283931_c1_572_1210 212
486 3300002459 JGI24751J29686_10021274 JGI24751J29686_100212742 213
487 3300005290 Ga0065712_10087465 Ga0065712_100874653 213
488 3300005290 Ga0065712_10128456 Ga0065712_101284562 213
489 3300005290 Ga0065712_10276063 Ga0065712_102760631 213
490 3300005293 Ga0065715_10142070 Ga0065715_101420703 213
491 3300005295 Ga0065707_10338296 Ga0065707_103382962 213
492 3300005328 Ga0070676_10151114 Ga0070676_101511142 213
493 3300005328 Ga0070676_10427478 Ga0070676_104274782 213
494 3300005329 Ga0070683_100529077 Ga0070683_1005290772 213
495 3300005330 Ga0070690_100004162 Ga0070690_1000041625 213
496 3300005331 Ga0070670_100002699 Ga0070670_1000026993 213
497 3300005331 Ga0070670_100119293 Ga0070670_1001192933 213
498 3300005331 Ga0070670_100627597 Ga0070670_1006275972 213
499 3300005331 Ga0070670_100640967 Ga0070670_1006409671 213
500 3300005333 Ga0070677_10005848 Ga0070677_100058483 213
501 3300005333 Ga0070677_10143361 Ga0070677_101433611 213
502 3300005334 Ga0068869_100032669 Ga0068869_1000326695 213
503 3300005334 Ga0068869_100283775 Ga0068869_1002837752 213
504 3300005335 Ga0070666_10007593 Ga0070666_100075932 213
505 3300005335 Ga0070666_10232264 Ga0070666_102322642 213
506 3300005336 Ga0070680_100235862 Ga0070680_1002358622 213
507 3300005338 Ga0068868_100076743 Ga0068868_1000767433 213
508 3300005338 Ga0068868_100392814 Ga0068868_1003928142 213
509 3300005340 Ga0070689_100089945 Ga0070689_1000899452 213
510 3300005340 Ga0070689_100095286 Ga0070689_1000952862 213
511 3300005340 Ga0070689_100137192 Ga0070689_1001371923 213
512 3300005340 Ga0070689_100176621 Ga0070689_1001766211 213
513 3300005340 Ga0070689_100324812 Ga0070689_1003248122 213
514 3300005343 Ga0070687_100232773 Ga0070687_1002327732 213
515 3300005344 Ga0070661_100018875 Ga0070661_1000188753 213
516 3300005347 Ga0070668_100338028 Ga0070668_1003380282 213
517 3300005353 Ga0070669_100012223 Ga0070669_1000122233 213
518 3300005353 Ga0070669_100016030 Ga0070669_1000160305 213
519 3300005353 Ga0070669_100081558 Ga0070669_1000815583 213
520 3300005353 Ga0070669_100105804 Ga0070669_1001058042 213
521 3300005354 Ga0070675_100000147 Ga0070675_10000014714 213
522 3300005354 Ga0070675_100003888 Ga0070675_1000038883 213
523 3300005354 Ga0070675_100008321 Ga0070675_10000832112 213
524 3300005354 Ga0070675_100247922 Ga0070675_1002479222 213
525 3300005354 Ga0070675_100356514 Ga0070675_1003565142 213
526 3300005354 Ga0070675_100390088 Ga0070675_1003900882 213
527 3300005354 Ga0070675_100668551 Ga0070675_1006685512 213
528 3300005355 Ga0070671_100007961 Ga0070671_1000079613 213
529 3300005355 Ga0070671_100164771 Ga0070671_1001647712 213
530 3300005356 Ga0070674_100814911 Ga0070674_1008149111 213
531 3300005364 Ga0070673_100009418 Ga0070673_1000094184 213
532 3300005364 Ga0070673_100713120 Ga0070673_1007131201 213
533 3300005365 Ga0070688_100003218 Ga0070688_10000321814 213
534 3300005365 Ga0070688_100023138 Ga0070688_1000231384 213
535 3300005365 Ga0070688_100065786 Ga0070688_1000657861 213
536 3300005365 Ga0070688_100416269 Ga0070688_1004162692 213
537 3300005365 Ga0070688_100623179 Ga0070688_1006231791 213
538 3300005366 Ga0070659_100349461 Ga0070659_1003494612 213
539 3300005367 Ga0070667_100083176 Ga0070667_1000831762 213
540 3300005367 Ga0070667_100325363 Ga0070667_1003253631 213
541 3300005406 Ga0070703_10031065 Ga0070703_100310652 213
542 3300005406 Ga0070703_10040636 Ga0070703_100406362 213
543 3300005406 Ga0070703_10232710 Ga0070703_102327101 213
544 3300005434 Ga0070709_10132027 Ga0070709_101320272 213
545 3300005438 Ga0070701_10051314 Ga0070701_100513142 213
546 3300005438 Ga0070701_10155126 Ga0070701_101551262 213
547 3300005438 Ga0070701_10524117 Ga0070701_105241171 213
548 3300005439 Ga0070711_100465652 Ga0070711_1004656521 213
549 3300005440 Ga0070705_100038491 Ga0070705_1000384912 213
550 3300005441 Ga0070700_100004171 Ga0070700_1000041714 213
551 3300005441 Ga0070700_100004954 Ga0070700_1000049543 213
552 3300005441 Ga0070700_100143607 Ga0070700_1001436072 213
553 3300005441 Ga0070700_100694100 Ga0070700_1006941002 213
554 3300005445 Ga0070708_100260591 Ga0070708_1002605912 213
555 3300005445 Ga0070708_100422162 Ga0070708_1004221622 213
556 3300005445 Ga0070708_100905832 Ga0070708_1009058321 213
557 3300005455 Ga0070663_100009569 Ga0070663_1000095694 213
558 3300005456 Ga0070678_100016979 Ga0070678_1000169792 213
559 3300005456 Ga0070678_100055019 Ga0070678_1000550194 213
560 3300005456 Ga0070678_100071199 Ga0070678_1000711993 213
561 3300005456 Ga0070678_100137887 Ga0070678_1001378873 213
562 3300005456 Ga0070678_101014404 Ga0070678_1010144041 213
563 3300005457 Ga0070662_100276377 Ga0070662_1002763772 213
564 3300005457 Ga0070662_100989909 Ga0070662_1009899091 213
565 3300005459 Ga0068867_100002876 Ga0068867_1000028768 213
566 3300005459 Ga0068867_100093506 Ga0068867_1000935062 213
567 3300005459 Ga0068867_100094484 Ga0068867_1000944842 213
568 3300005459 Ga0068867_100345586 Ga0068867_1003455862 213
569 3300005459 Ga0068867_100383805 Ga0068867_1003838051 213
570 3300005459 Ga0068867_101115018 Ga0068867_1011150181 213
571 3300005466 Ga0070685_10019371 Ga0070685_100193713 213
572 3300005466 Ga0070685_10031005 Ga0070685_100310054 213
573 3300005467 Ga0070706_100631082 Ga0070706_1006310822 213
574 3300005468 Ga0070707_100069599 Ga0070707_1000695993 213
575 3300005471 Ga0070698_100196500 Ga0070698_1001965002 213
576 3300005518 Ga0070699_100002012 Ga0070699_10000201213 213
577 3300005518 Ga0070699_100053591 Ga0070699_1000535913 213
578 3300005518 Ga0070699_100218236 Ga0070699_1002182361 213
579 3300005535 Ga0070684_100768542 Ga0070684_1007685421 213
580 3300005536 Ga0070697_100139549 Ga0070697_1001395493 213
581 3300005536 Ga0070697_100538973 Ga0070697_1005389731 213
582 3300005543 Ga0070672_100011300 Ga0070672_1000113006 213
583 3300005543 Ga0070672_100093050 Ga0070672_1000930502 213
584 3300005543 Ga0070672_100136771 Ga0070672_1001367713 213
585 3300005543 Ga0070672_100227374 Ga0070672_1002273742 213
586 3300005544 Ga0070686_100002508 Ga0070686_1000025088 213
587 3300005544 Ga0070686_100022866 Ga0070686_1000228662 213
588 3300005544 Ga0070686_100118755 Ga0070686_1001187553 213
589 3300005545 Ga0070695_100005877 Ga0070695_1000058773 213
590 3300005545 Ga0070695_100050017 Ga0070695_1000500172 213
591 3300005546 Ga0070696_100002986 Ga0070696_10000298612 213
592 3300005546 Ga0070696_100011890 Ga0070696_1000118906 213
593 3300005546 Ga0070696_100190801 Ga0070696_1001908012 213
594 3300005547 Ga0070693_100169167 Ga0070693_1001691672 213
595 3300005549 Ga0070704_100003197 Ga0070704_1000031975 213
596 3300005549 Ga0070704_100009518 Ga0070704_1000095182 213
597 3300005549 Ga0070704_100175606 Ga0070704_1001756062 213
598 3300005549 Ga0070704_100187522 Ga0070704_1001875222 213
599 3300005549 Ga0070704_100631817 Ga0070704_1006318171 213
600 3300005563 Ga0068855_100098552 Ga0068855_1000985524 213
601 3300005564 Ga0070664_100013313 Ga0070664_1000133133 213
602 3300005564 Ga0070664_100091172 Ga0070664_1000911723 213
603 3300005564 Ga0070664_100447347 Ga0070664_1004473471 213
604 3300005564 Ga0070664_100590851 Ga0070664_1005908512 213
605 3300005578 Ga0068854_100174919 Ga0068854_1001749192 213
606 3300005615 Ga0070702_100432589 Ga0070702_1004325892 213
607 3300005616 Ga0068852_101377789 Ga0068852_1013777891 213
608 3300005617 Ga0068859_100051697 Ga0068859_1000516975 213
609 3300005617 Ga0068859_100095636 Ga0068859_1000956364 213
610 3300005617 Ga0068859_100174261 Ga0068859_1001742612 213
611 3300005617 Ga0068859_100343076 Ga0068859_1003430761 213
612 3300005617 Ga0068859_100481130 Ga0068859_1004811301 213
613 3300005618 Ga0068864_100008151 Ga0068864_1000081514 213
614 3300005618 Ga0068864_100029037 Ga0068864_1000290373 213
615 3300005618 Ga0068864_100038432 Ga0068864_1000384322 213
616 3300005618 Ga0068864_100111730 Ga0068864_1001117302 213
617 3300005618 Ga0068864_100177764 Ga0068864_1001777642 213
618 3300005618 Ga0068864_100471794 Ga0068864_1004717942 213
619 3300005719 Ga0068861_100005416 Ga0068861_1000054164 213
620 3300005719 Ga0068861_100045160 Ga0068861_1000451602 213
621 3300005719 Ga0068861_100253404 Ga0068861_1002534043 213
622 3300005719 Ga0068861_100454974 Ga0068861_1004549742 213
623 3300005719 Ga0068861_100685254 Ga0068861_1006852541 213
624 3300005840 Ga0068870_10001025 Ga0068870_1000102515 213
625 3300005841 Ga0068863_100002234 Ga0068863_10000223420 213
626 3300005841 Ga0068863_100165117 Ga0068863_1001651171 213
627 3300005841 Ga0068863_100168822 Ga0068863_1001688223 213
628 3300005842 Ga0068858_100001888 Ga0068858_1000018887 213
629 3300005842 Ga0068858_100030600 Ga0068858_1000306002 213
630 3300005842 Ga0068858_100038117 Ga0068858_1000381174 213
631 3300005842 Ga0068858_100292889 Ga0068858_1002928892 213
632 3300005843 Ga0068860_100054885 Ga0068860_1000548853 213
633 3300005843 Ga0068860_100066357 Ga0068860_1000663572 213
634 3300005844 Ga0068862_100006477 Ga0068862_1000064773 213
635 3300005844 Ga0068862_100030874 Ga0068862_1000308743 213
636 3300005844 Ga0068862_100042813 Ga0068862_1000428133 213
637 3300005844 Ga0068862_100218963 Ga0068862_1002189632 213
638 3300005937 Ga0081455_10214401 Ga0081455_102144012 213
639 3300005985 Ga0081539_10146522 Ga0081539_101465221 213
640 3300006173 Ga0070716_100514022 Ga0070716_1005140222 213
641 3300006173 Ga0070716_100639853 Ga0070716_1006398531 213
642 3300006175 Ga0070712_100135942 Ga0070712_1001359422 213
643 3300006237 Ga0097621_100023648 Ga0097621_1000236483 213
644 3300006237 Ga0097621_100091837 Ga0097621_1000918374 213
645 3300006358 Ga0068871_100010328 Ga0068871_1000103284 213
646 3300006358 Ga0068871_100026278 Ga0068871_1000262782 213
647 3300006358 Ga0068871_100193809 Ga0068871_1001938092 213
648 3300006358 Ga0068871_100340182 Ga0068871_1003401822 213
649 3300006844 Ga0075428_100012493 Ga0075428_10001249313 213
650 3300006844 Ga0075428_100018081 Ga0075428_1000180814 213
651 3300006844 Ga0075428_100055313 Ga0075428_1000553133 213
652 3300006844 Ga0075428_100066734 Ga0075428_1000667343 213
653 3300006844 Ga0075428_100109374 Ga0075428_1001093744 213
654 3300006844 Ga0075428_100388623 Ga0075428_1003886232 213
655 3300006844 Ga0075428_100565104 Ga0075428_1005651041 213
656 3300006846 Ga0075430_100001196 Ga0075430_10000119614 213
657 3300006846 Ga0075430_100003466 Ga0075430_10000346619 213
658 3300006846 Ga0075430_100180315 Ga0075430_1001803152 213
659 3300006846 Ga0075430_100700891 Ga0075430_1007008911 213
660 3300006847 Ga0075431_100028775 Ga0075431_1000287755 213
661 3300006847 Ga0075431_100111492 Ga0075431_1001114922 213
662 3300006847 Ga0075431_100177222 Ga0075431_1001772222 213
663 3300006847 Ga0075431_100535423 Ga0075431_1005354232 213
664 3300006847 Ga0075431_101174045 Ga0075431_1011740451 213
665 3300006852 Ga0075433_10000936 Ga0075433_100009368 213
666 3300006852 Ga0075433_10001275 Ga0075433_100012753 213
667 3300006852 Ga0075433_10013705 Ga0075433_100137051 213
668 3300006852 Ga0075433_10110458 Ga0075433_101104581 213
669 3300006852 Ga0075433_10338702 Ga0075433_103387022 213
670 3300006852 Ga0075433_10381076 Ga0075433_103810761 213
671 3300006871 Ga0075434_100000049 Ga0075434_10000004939 213
672 3300006871 Ga0075434_100011998 Ga0075434_1000119987 213
673 3300006871 Ga0075434_100021443 Ga0075434_1000214433 213
674 3300006871 Ga0075434_100046934 Ga0075434_1000469343 213
675 3300006871 Ga0075434_100047314 Ga0075434_1000473144 213
676 3300006871 Ga0075434_100132783 Ga0075434_1001327833 213
677 3300006871 Ga0075434_100187017 Ga0075434_1001870173 213
678 3300006871 Ga0075434_100634562 Ga0075434_1006345621 213
679 3300006880 Ga0075429_100044586 Ga0075429_1000445863 213
680 3300006880 Ga0075429_100161158 Ga0075429_1001611582 213
681 3300006880 Ga0075429_100213590 Ga0075429_1002135901 213
682 3300006880 Ga0075429_100215362 Ga0075429_1002153623 213
683 3300006880 Ga0075429_100425496 Ga0075429_1004254962 213
684 3300006881 Ga0068865_100086899 Ga0068865_1000868992 213
685 3300006914 Ga0075436_100000420 Ga0075436_10000042020 213
686 3300006914 Ga0075436_100019413 Ga0075436_1000194132 213
687 3300006914 Ga0075436_100019739 Ga0075436_1000197394 213
688 3300006931 Ga0097620_100051695 Ga0097620_1000516953 213
689 3300006931 Ga0097620_100095631 Ga0097620_1000956314 213
690 3300006931 Ga0097620_100174262 Ga0097620_1001742622 213
691 3300006931 Ga0097620_100343077 Ga0097620_1003430771 213
692 3300006931 Ga0097620_100481101 Ga0097620_1004811011 213
693 3300007076 Ga0075435_100000059 Ga0075435_10000005937 213
694 3300007076 Ga0075435_100004605 Ga0075435_1000046054 213
695 3300007076 Ga0075435_100005562 Ga0075435_1000055628 213
696 3300007076 Ga0075435_100013234 Ga0075435_1000132344 213
697 3300007076 Ga0075435_100057562 Ga0075435_1000575623 213
698 3300007076 Ga0075435_100154261 Ga0075435_1001542612 213
699 3300007076 Ga0075435_100233022 Ga0075435_1002330222 213
700 3300007076 Ga0075435_100287762 Ga0075435_1002877621 213
701 3300009094 Ga0111539_10000326 Ga0111539_1000032640 213
702 3300009094 Ga0111539_10004673 Ga0111539_100046735 213
703 3300009094 Ga0111539_10004769 Ga0111539_1000476917 213
704 3300009094 Ga0111539_10017167 Ga0111539_100171673 213
705 3300009094 Ga0111539_10042960 Ga0111539_100429603 213
706 3300009094 Ga0111539_10054412 Ga0111539_100544123 213
707 3300009094 Ga0111539_10057964 Ga0111539_100579642 213
708 3300009094 Ga0111539_10078245 Ga0111539_100782454 213
709 3300009094 Ga0111539_10123247 Ga0111539_101232473 213
710 3300009094 Ga0111539_10621651 Ga0111539_106216512 213
711 3300009094 Ga0111539_10646306 Ga0111539_106463062 213
712 3300009098 Ga0105245_10267491 Ga0105245_102674912 213
713 3300009101 Ga0105247_10003020 Ga0105247_1000302010 213
714 3300009101 Ga0105247_10010076 Ga0105247_100100766 213
715 3300009101 Ga0105247_10270811 Ga0105247_102708111 213
716 3300009147 Ga0114129_10002862 Ga0114129_1000286220 213
717 3300009147 Ga0114129_10006748 Ga0114129_1000674820 213
718 3300009147 Ga0114129_10008062 Ga0114129_1000806213 213
719 3300009147 Ga0114129_10031782 Ga0114129_100317822 213
720 3300009147 Ga0114129_10038284 Ga0114129_100382843 213
721 3300009147 Ga0114129_10049334 Ga0114129_100493344 213
722 3300009147 Ga0114129_10056630 Ga0114129_100566301 213
723 3300009147 Ga0114129_10063676 Ga0114129_100636764 213
724 3300009147 Ga0114129_10082166 Ga0114129_100821663 213
725 3300009147 Ga0114129_10204942 Ga0114129_102049422 213
726 3300009147 Ga0114129_10252394 Ga0114129_102523943 213
727 3300009147 Ga0114129_10706218 Ga0114129_107062182 213
728 3300009147 Ga0114129_10753893 Ga0114129_107538932 213
729 3300009147 Ga0114129_10787619 Ga0114129_107876191 213
730 3300009147 Ga0114129_10951071 Ga0114129_109510711 213
731 3300009148 Ga0105243_10025094 Ga0105243_100250942 213
732 3300009148 Ga0105243_10872003 Ga0105243_108720032 213
733 3300009176 Ga0105242_10004726 Ga0105242_1000472617 213
734 3300009176 Ga0105242_10098152 Ga0105242_100981523 213
735 3300009176 Ga0105242_10847090 Ga0105242_108470902 213
736 3300009177 Ga0105248_10013509 Ga0105248_100135093 213
737 3300009177 Ga0105248_10017801 Ga0105248_100178018 213
738 3300009177 Ga0105248_10081647 Ga0105248_100816473 213
739 3300009177 Ga0105248_10126720 Ga0105248_101267203 213
740 3300009177 Ga0105248_10139979 Ga0105248_101399793 213
741 3300009177 Ga0105248_10151210 Ga0105248_101512102 213
742 3300009177 Ga0105248_10811528 Ga0105248_108115281 213
743 3300009177 Ga0105248_11395260 Ga0105248_113952602 213
744 3300009553 Ga0105249_10051517 Ga0105249_100515172 213
745 3300009553 Ga0105249_10269044 Ga0105249_102690442 213
746 3300009553 Ga0105249_11078758 Ga0105249_110787581 213
747 3300013296 Ga0157374_10496237 Ga0157374_104962372 213
748 3300013296 Ga0157374_10554208 Ga0157374_105542082 213
749 3300013297 Ga0157378_10659056 Ga0157378_106590561 213
750 3300013306 Ga0163162_10465786 Ga0163162_104657863 213
751 3300013306 Ga0163162_11271088 Ga0163162_112710882 213
752 3300013308 Ga0157375_10050333 Ga0157375_100503334 213
753 3300013308 Ga0157375_10115922 Ga0157375_101159222 213
754 3300013308 Ga0157375_10212801 Ga0157375_102128013 213
755 3300013308 Ga0157375_10535202 Ga0157375_105352022 213
756 3300014325 Ga0163163_10401399 Ga0163163_104013992 213
757 3300014326 Ga0157380_10003616 Ga0157380_100036164 213
758 3300014326 Ga0157380_10010138 Ga0157380_100101384 213
759 3300014326 Ga0157380_10104200 Ga0157380_101042002 213
760 3300014326 Ga0157380_10106662 Ga0157380_101066622 213
761 3300014326 Ga0157380_10197607 Ga0157380_101976072 213
762 3300014326 Ga0157380_10265843 Ga0157380_102658432 213
763 3300014326 Ga0157380_10319912 Ga0157380_103199122 213
764 3300014326 Ga0157380_10791525 Ga0157380_107915251 213
765 3300014326 Ga0157380_11151838 Ga0157380_111518381 213
766 3300014326 Ga0157380_11331560 Ga0157380_113315601 213
767 3300014745 Ga0157377_10018169 Ga0157377_100181693 213
768 3300014745 Ga0157377_10047355 Ga0157377_100473551 213
769 3300014745 Ga0157377_10095111 Ga0157377_100951112 213
770 3300014745 Ga0157377_10248787 Ga0157377_102487871 213
771 3300014968 Ga0157379_10009913 Ga0157379_100099133 213
772 3300014968 Ga0157379_10017365 Ga0157379_100173656 213
773 3300014968 Ga0157379_10067559 Ga0157379_100675592 213
774 3300014969 Ga0157376_10160959 Ga0157376_101609593 213
775 3300014969 Ga0157376_10431110 Ga0157376_104311102 213
776 3300014969 Ga0157376_10455653 Ga0157376_104556532 213
777 3300017792 Ga0163161_10031367 Ga0163161_100313673 213
778 3300025315 Ga0207697_10000575 Ga0207697_1000057520 213
779 3300025893 Ga0207682_10001469 Ga0207682_100014698 213
780 3300025893 Ga0207682_10030408 Ga0207682_100304083 213
781 3300025893 Ga0207682_10033322 Ga0207682_100333222 213
782 3300025893 Ga0207682_10129069 Ga0207682_101290691 213
783 3300025898 Ga0207692_10060517 Ga0207692_100605174 213
784 3300025899 Ga0207642_10017132 Ga0207642_100171323 213
785 3300025900 Ga0207710_10003937 Ga0207710_1000393713 213
786 3300025900 Ga0207710_10047460 Ga0207710_100474601 213
787 3300025900 Ga0207710_10365696 Ga0207710_103656962 213
788 3300025901 Ga0207688_10000078 Ga0207688_100000788 213
789 3300025905 Ga0207685_10107174 Ga0207685_101071741 213
790 3300025907 Ga0207645_10002104 Ga0207645_100021043 213
791 3300025907 Ga0207645_10002597 Ga0207645_100025976 213
792 3300025907 Ga0207645_10128802 Ga0207645_101288022 213
793 3300025908 Ga0207643_10000706 Ga0207643_1000070617 213
794 3300025908 Ga0207643_10084543 Ga0207643_100845432 213
795 3300025910 Ga0207684_10142894 Ga0207684_101428942 213
796 3300025910 Ga0207684_10681152 Ga0207684_106811521 213
797 3300025915 Ga0207693_10013276 Ga0207693_100132766 213
798 3300025916 Ga0207663_10870600 Ga0207663_108706001 213
799 3300025917 Ga0207660_10037729 Ga0207660_100377292 213
800 3300025918 Ga0207662_10001063 Ga0207662_100010633 213
801 3300025920 Ga0207649_10018165 Ga0207649_100181653 213
802 3300025923 Ga0207681_10023929 Ga0207681_100239295 213
803 3300025923 Ga0207681_10095334 Ga0207681_100953342 213
804 3300025923 Ga0207681_10162286 Ga0207681_101622862 213
805 3300025923 Ga0207681_10194009 Ga0207681_101940091 213
806 3300025924 Ga0207694_10130066 Ga0207694_101300662 213
807 3300025925 Ga0207650_10007478 Ga0207650_1000747813 213
808 3300025925 Ga0207650_10070542 Ga0207650_100705422 213
809 3300025925 Ga0207650_10150803 Ga0207650_101508031 213
810 3300025925 Ga0207650_10261694 Ga0207650_102616942 213
811 3300025925 Ga0207650_10601054 Ga0207650_106010541 213
812 3300025926 Ga0207659_10000075 Ga0207659_1000007556 213
813 3300025926 Ga0207659_10000939 Ga0207659_1000093921 213
814 3300025926 Ga0207659_10002741 Ga0207659_100027413 213
815 3300025926 Ga0207659_10132383 Ga0207659_101323832 213
816 3300025926 Ga0207659_10270178 Ga0207659_102701782 213
817 3300025926 Ga0207659_10635974 Ga0207659_106359742 213
818 3300025926 Ga0207659_10870072 Ga0207659_108700721 213
819 3300025931 Ga0207644_10096143 Ga0207644_100961433 213
820 3300025931 Ga0207644_10102458 Ga0207644_101024583 213
821 3300025933 Ga0207706_10026033 Ga0207706_100260334 213
822 3300025933 Ga0207706_10402085 Ga0207706_104020852 213
823 3300025934 Ga0207686_10032259 Ga0207686_100322592 213
824 3300025935 Ga0207709_10005269 Ga0207709_100052696 213
825 3300025936 Ga0207670_10018572 Ga0207670_100185723 213
826 3300025936 Ga0207670_10114531 Ga0207670_101145312 213
827 3300025936 Ga0207670_10153793 Ga0207670_101537932 213
828 3300025936 Ga0207670_10281125 Ga0207670_102811252 213
829 3300025937 Ga0207669_10038016 Ga0207669_100380162 213
830 3300025937 Ga0207669_10095631 Ga0207669_100956312 213
831 3300025937 Ga0207669_10377503 Ga0207669_103775032 213
832 3300025938 Ga0207704_10006357 Ga0207704_100063576 213
833 3300025938 Ga0207704_10173104 Ga0207704_101731042 213
834 3300025938 Ga0207704_10883530 Ga0207704_108835301 213
835 3300025939 Ga0207665_10294556 Ga0207665_102945562 213
836 3300025940 Ga0207691_10008047 Ga0207691_1000804713 213
837 3300025940 Ga0207691_10064712 Ga0207691_100647125 213
838 3300025940 Ga0207691_10200556 Ga0207691_102005563 213
839 3300025940 Ga0207691_10374381 Ga0207691_103743812 213
840 3300025940 Ga0207691_10569750 Ga0207691_105697501 213
841 3300025940 Ga0207691_10713245 Ga0207691_107132452 213
842 3300025941 Ga0207711_10174978 Ga0207711_101749782 213
843 3300025941 Ga0207711_10691119 Ga0207711_106911192 213
844 3300025941 Ga0207711_10825436 Ga0207711_108254361 213
845 3300025942 Ga0207689_10004341 Ga0207689_100043417 213
846 3300025942 Ga0207689_10009073 Ga0207689_100090732 213
847 3300025942 Ga0207689_10111980 Ga0207689_101119802 213
848 3300025945 Ga0207679_10004433 Ga0207679_100044334 213
849 3300025945 Ga0207679_10024651 Ga0207679_100246512 213
850 3300025960 Ga0207651_10001655 Ga0207651_100016558 213
851 3300025960 Ga0207651_10139926 Ga0207651_101399262 213
852 3300025972 Ga0207668_10203382 Ga0207668_102033822 213
853 3300025981 Ga0207640_10620184 Ga0207640_106201841 213
854 3300026023 Ga0207677_10423021 Ga0207677_104230212 213
855 3300026035 Ga0207703_10010388 Ga0207703_100103883 213
856 3300026035 Ga0207703_10015685 Ga0207703_100156855 213
857 3300026035 Ga0207703_10236358 Ga0207703_102363582 213
858 3300026035 Ga0207703_10326843 Ga0207703_103268432 213
859 3300026067 Ga0207678_10011052 Ga0207678_100110525 213
860 3300026075 Ga0207708_10000853 Ga0207708_1000085321 213
861 3300026075 Ga0207708_10002902 Ga0207708_1000290213 213
862 3300026075 Ga0207708_10004792 Ga0207708_100047925 213
863 3300026075 Ga0207708_10337523 Ga0207708_103375232 213
864 3300026088 Ga0207641_10005189 Ga0207641_1000518910 213
865 3300026088 Ga0207641_10029000 Ga0207641_100290003 213
866 3300026088 Ga0207641_10147973 Ga0207641_101479733 213
867 3300026088 Ga0207641_10465013 Ga0207641_104650131 213
868 3300026088 Ga0207641_10540184 Ga0207641_105401842 213
869 3300026088 Ga0207641_10781211 Ga0207641_107812111 213
870 3300026088 Ga0207641_11090744 Ga0207641_110907441 213
871 3300026089 Ga0207648_10001158 Ga0207648_1000115821 213
872 3300026089 Ga0207648_10005943 Ga0207648_100059435 213
873 3300026089 Ga0207648_10203058 Ga0207648_102030582 213
874 3300026089 Ga0207648_10276221 Ga0207648_102762212 213
875 3300026089 Ga0207648_10549894 Ga0207648_105498942 213
876 3300026089 Ga0207648_10637825 Ga0207648_106378251 213
877 3300026095 Ga0207676_10009537 Ga0207676_100095374 213
878 3300026095 Ga0207676_10020875 Ga0207676_100208752 213
879 3300026095 Ga0207676_10070443 Ga0207676_100704432 213
880 3300026095 Ga0207676_10648925 Ga0207676_106489251 213
881 3300026116 Ga0207674_10426578 Ga0207674_104265782 213
882 3300026118 Ga0207675_100004884 Ga0207675_1000048847 213
883 3300026118 Ga0207675_100025879 Ga0207675_1000258795 213
884 3300026118 Ga0207675_100126472 Ga0207675_1001264722 213
885 3300026118 Ga0207675_100992494 Ga0207675_1009924942 213
886 3300026121 Ga0207683_10002196 Ga0207683_100021964 213
887 3300026121 Ga0207683_10011362 Ga0207683_100113625 213
888 3300026121 Ga0207683_10031021 Ga0207683_100310217 213
889 3300026121 Ga0207683_10116045 Ga0207683_101160453 213
890 3300026121 Ga0207683_10187113 Ga0207683_101871131 213
891 3300026142 Ga0207698_10304153 Ga0207698_103041533 213
892 3300027907 Ga0207428_10000089 Ga0207428_1000008938 213
893 3300027907 Ga0207428_10005145 Ga0207428_1000514511 213
894 3300027907 Ga0207428_10036379 Ga0207428_100363793 213
895 3300027907 Ga0207428_10041262 Ga0207428_100412622 213
896 3300027907 Ga0207428_10087031 Ga0207428_100870312 213
897 3300027907 Ga0207428_10096747 Ga0207428_100967473 213
898 3300028379 Ga0268266_10356310 Ga0268266_103563102 213
899 3300028379 Ga0268266_10773398 Ga0268266_107733981 213
900 3300028380 Ga0268265_10014428 Ga0268265_100144284 213
901 3300028380 Ga0268265_10033808 Ga0268265_100338084 213
902 3300028380 Ga0268265_10047123 Ga0268265_100471233 213
903 3300028380 Ga0268265_10468822 Ga0268265_104688222 213
904 3300028381 Ga0268264_10042594 Ga0268264_100425943 213
905 3300028381 Ga0268264_10058684 Ga0268264_100586843 213
906 3300031238 Ga0265332_10114114 Ga0265332_101141141 213
907 3300031548 Ga0307408_100278417 Ga0307408_1002784172 213
908 3300031852 Ga0307410_10296321 Ga0307410_102963211 213
909 3300032002 Ga0307416_100052642 Ga0307416_1000526423 213
910 3300032002 Ga0307416_100105257 Ga0307416_1001052572 213
911 3300032002 Ga0307416_100138240 Ga0307416_1001382402 213
912 3300032002 Ga0307416_100390432 Ga0307416_1003904322 213
913 3300032002 Ga0307416_100497949 Ga0307416_1004979492 213
914 3300032002 Ga0307416_100656294 Ga0307416_1006562941 213
915 3300032005 Ga0307411_10474862 Ga0307411_104748621 213
916 3300032126 Ga0307415_100077488 Ga0307415_1000774884 213
917 3300032126 Ga0307415_100358610 Ga0307415_1003586102 213
918 3300034819 Ga0373958_0034645 Ga0373958_0034645_270_911 213
919 3300035083 Ga0373926_0084736 Ga0373926_0084736_421_1062 213
920 3300035090 Ga0373949_0111813 Ga0373949_0111813_87_728 213
921 3300035090 Ga0373949_0133286 Ga0373949_0133286_55_696 213
922 3300035114 Ga0373939_0177465 Ga0373939_0177465_26_667 213
923 3300035116 Ga0373945_0023198 Ga0373945_0023198_905_1546 213
924 3300035170 Ga0373943_0223882 Ga0373943_0223882_114_755 213
925 3300035695 Ga0373927_0525940 Ga0373927_0525940_45_686 213
926 3300036401 Ga0373937_0285603 Ga0373937_0285603_315_956 213
927 3300036401 Ga0373937_0631680 Ga0373937_0631680_34_675 213
928 3300037068 Ga0373925_0027581 Ga0373925_0027581_352_993 213
929 3300037068 Ga0373925_0552846 Ga0373925_0552846_119_760 213
930 3300041408 Ga0439453_0003992 Ga0439453_0003992_376_1017 213
931 3300041512 Ga0451853_1940769 Ga0451853_1940769_632_1273 213
932 3300041512 Ga0451853_2329500 Ga0451853_2329500_44_685 213
933 3300041999 Ga0439433_0017488 Ga0439433_0017488_426_1067 213
934 3300042009 Ga0439451_016701 Ga0439451_016701_369_1046 213
935 3300042125 Ga0450923_016385 Ga0450923_016385_633_1274 213
936 3300042125 Ga0450923_065484 Ga0450923_065484_138_779 213
937 3300042133 Ga0450896_002429 Ga0450896_002429_609_1250 213
938 3300042133 Ga0450896_015549 Ga0450896_015549_13_654 213
939 3300042435 Ga0439434_0110659 Ga0439434_0110659_172_843 213
940 3300042435 Ga0439434_0115256 Ga0439434_0115256_76_717 213
941 3300042436 Ga0439435_0021616 Ga0439435_0021616_170_811 213
942 3300042461 Ga0439460_0076306 Ga0439460_0076306_225_866 213
943 3300042876 Ga0451577_0039088 Ga0451577_0039088_1219_1872 213
944 3300042876 Ga0451577_0091136 Ga0451577_0091136_1030_1671 213
945 3300044712 Ga0453684_0039023 Ga0453684_0039023_3894_4535 213
946 3300046516 Ga0495628_0406239 Ga0495628_0406239_125_766 213
947 3300046529 Ga0495652_0417177 Ga0495652_0417177_78_719 213
948 3300046537 Ga0495598_0027179 Ga0495598_0027179_638_1279 213
949 3300046537 Ga0495598_0161640 Ga0495598_0161640_65_727 213
950 3300046539 Ga0495621_0000253 Ga0495621_0000253_9481_10122 213
951 3300046558 Ga0495633_0155955 Ga0495633_0155955_54_695 213
952 3300046664 Ga0495659_0017881 Ga0495659_0017881_928_1569 213
953 3300046678 Ga0495599_0363725 Ga0495599_0363725_213_854 213
954 3300046681 Ga0495647_0184952 Ga0495647_0184952_136_777 213
955 3300046691 Ga0495670_0254419 Ga0495670_0254419_276_917 213
956 3300048907 Ga0496104_0076988 Ga0496104_0076988_721_1362 213
957 3300048907 Ga0496104_0208295 Ga0496104_0208295_191_832 213
958 3300048909 Ga0496106_0417224 Ga0496106_0417224_286_936 213
959 3300048911 Ga0496108_0685324 Ga0496108_0685324_211_852 213
960 3300048912 Ga0496109_0222921 Ga0496109_0222921_178_819 213
961 3300048915 Ga0496112_0005329 Ga0496112_0005329_3230_3871 213
962 3300048915 Ga0496112_0005642 Ga0496112_0005642_8795_9436 213
963 3300048915 Ga0496112_0110221 Ga0496112_0110221_1953_2594 213
964 3300048916 Ga0496113_0049333 Ga0496113_0049333_935_1576 213
965 3300049521 Ga0501298_032825 Ga0501298_032825_108_749 213
966 3300049570 Ga0501033_0091133 Ga0501033_0091133_499_1140 213
967 3300049572 Ga0501036_0301083 Ga0501036_0301083_266_913 213
968 3300049574 Ga0501038_0254514 Ga0501038_0254514_634_1332 213
969 3300049576 Ga0501040_0013239 Ga0501040_0013239_432_1073 213
970 3300049576 Ga0501040_0128933 Ga0501040_0128933_908_1549 213
971 3300049577 Ga0501041_0018990 Ga0501041_0018990_2763_3461 213
972 3300049577 Ga0501041_0069816 Ga0501041_0069816_244_885 213
973 3300049578 Ga0501042_0106405 Ga0501042_0106405_1259_1918 213
974 3300049578 Ga0501042_0237533 Ga0501042_0237533_74_721 213
975 3300049578 Ga0501042_0245446 Ga0501042_0245446_74_715 213
976 3300049582 Ga0501048_0191872 Ga0501048_0191872_98_739 213
977 3300049582 Ga0501048_0197359 Ga0501048_0197359_571_1269 213
978 3300049587 Ga0501071_0120294 Ga0501071_0120294_325_1023 213
979 3300049588 Ga0501072_0235406 Ga0501072_0235406_589_1287 213
980 3300049589 Ga0501073_0055066 Ga0501073_0055066_1364_2122 213
981 3300049591 Ga0501075_0035944 Ga0501075_0035944_2722_3420 213
982 3300049591 Ga0501075_0413234 Ga0501075_0413234_107_748 213
983 3300049592 Ga0501076_0107571 Ga0501076_0107571_1418_2116 213
984 3300049592 Ga0501076_0232805 Ga0501076_0232805_322_963 213
985 3300049592 Ga0501076_0776991 Ga0501076_0776991_116_757 213
986 3300049661 Ga0501217_044275 Ga0501217_044275_404_1045 213
987 3300049679 Ga0501249_032973 Ga0501249_032973_140_781 213
988 3300049741 Ga0501079_0048048 Ga0501079_0048048_2245_2886 213
989 3300049741 Ga0501079_0486125 Ga0501079_0486125_65_763 213
990 3300049742 Ga0501080_0062248 Ga0501080_0062248_2633_3274 213
991 3300049743 Ga0501081_0090955 Ga0501081_0090955_870_1568 213
992 3300049779 Ga0501283_007596 Ga0501283_007596_158_799 213
993 3300049824 Ga0501045_0258946 Ga0501045_0258946_613_1254 213
994 3300049824 Ga0501045_0621411 Ga0501045_0621411_75_773 213
995 3300050507 nmdc:mga05p37_127165_c1 nmdc:mga05p37_127165_c1_495_1136 213
996 3300050507 nmdc:mga05p37_193021_c1 nmdc:mga05p37_193021_c1_1203_1844 213
997 3300050507 nmdc:mga05p37_2169_c1 nmdc:mga05p37_2169_c1_12774_13415 213
998 3300050507 nmdc:mga05p37_30866_c1 nmdc:mga05p37_30866_c1_5445_6086 213
999 3300050507 nmdc:mga05p37_376704_c1 nmdc:mga05p37_376704_c1_185_826 213
1000 3300050507 nmdc:mga05p37_411232_c2 nmdc:mga05p37_411232_c2_47_688 213
1001 3300050507 nmdc:mga05p37_53643_c2 nmdc:mga05p37_53643_c2_1877_2518 213
1002 3300050507 nmdc:mga05p37_6745_c1 nmdc:mga05p37_6745_c1_12781_13422 213
1003 3300050507 nmdc:mga05p37_74645_c1 nmdc:mga05p37_74645_c1_2102_2743 213
1004 3300050507 nmdc:mga05p37_74813_c1 nmdc:mga05p37_74813_c1_3093_3734 213
1005 3300050507 nmdc:mga05p37_760502_c1 nmdc:mga05p37_760502_c1_69_710 213
1006 3300050508 nmdc:mga09592_123314_c1 nmdc:mga09592_123314_c1_1553_2194 213
1007 3300050508 nmdc:mga09592_142368_c1 nmdc:mga09592_142368_c1_1125_1766 213
1008 3300050508 nmdc:mga09592_160271_c1 nmdc:mga09592_160271_c1_1107_1748 213
1009 3300050508 nmdc:mga09592_397043_c1 nmdc:mga09592_397043_c1_520_1161 213
1010 3300050508 nmdc:mga09592_477817_c1 nmdc:mga09592_477817_c1_30_671 213
1011 3300050508 nmdc:mga09592_4935_c1 nmdc:mga09592_4935_c1_5241_5882 213
1012 3300050509 nmdc:mga0qj67_116349_c1 nmdc:mga0qj67_116349_c1_384_1025 213
1013 3300050509 nmdc:mga0qj67_212178_c1 nmdc:mga0qj67_212178_c1_896_1537 213
1014 3300050509 nmdc:mga0qj67_256855_c1 nmdc:mga0qj67_256855_c1_373_1014 213
1015 3300050510 nmdc:mga06r32_1105884_c1 nmdc:mga06r32_1105884_c1_80_721 213
1016 3300050510 nmdc:mga06r32_1114373_c1 nmdc:mga06r32_1114373_c1_78_719 213
1017 3300050510 nmdc:mga06r32_185062_c1 nmdc:mga06r32_185062_c1_1143_1784 213
1018 3300050510 nmdc:mga06r32_55337_c1 nmdc:mga06r32_55337_c1_1464_2105 213
1019 3300050510 nmdc:mga06r32_58087_c1 nmdc:mga06r32_58087_c1_80_721 213
1020 3300050511 nmdc:mga08y16_1340_c1 nmdc:mga08y16_1340_c1_16013_16654 213
1021 3300050511 nmdc:mga08y16_1540_c1 nmdc:mga08y16_1540_c1_694_1335 213
1022 3300050511 nmdc:mga08y16_159603_c1 nmdc:mga08y16_159603_c1_1550_2191 213
1023 3300050511 nmdc:mga08y16_244510_c1 nmdc:mga08y16_244510_c1_589_1230 213
1024 3300050511 nmdc:mga08y16_2595_c1 nmdc:mga08y16_2595_c1_6479_7120 213
1025 3300050511 nmdc:mga08y16_45702_c1 nmdc:mga08y16_45702_c1_2404_3045 213
1026 3300050511 nmdc:mga08y16_55323_c1 nmdc:mga08y16_55323_c1_109_750 213
1027 3300050511 nmdc:mga08y16_75653_c1 nmdc:mga08y16_75653_c1_1580_2221 213
1028 3300050512 nmdc:mga0n895_108093_c1 nmdc:mga0n895_108093_c1_2028_2669 213
1029 3300050512 nmdc:mga0n895_14984_c1 nmdc:mga0n895_14984_c1_2920_3561 213
1030 3300050512 nmdc:mga0n895_1500_c1 nmdc:mga0n895_1500_c1_12676_13317 213
1031 3300050512 nmdc:mga0n895_18994_c1 nmdc:mga0n895_18994_c1_3909_4598 213
1032 3300050512 nmdc:mga0n895_223446_c1 nmdc:mga0n895_223446_c1_1208_1849 213
1033 3300050512 nmdc:mga0n895_308498_c1 nmdc:mga0n895_308498_c1_445_1086 213
1034 3300050512 nmdc:mga0n895_702168_c1 nmdc:mga0n895_702168_c1_296_937 213
1035 3300050512 nmdc:mga0n895_95_c1 nmdc:mga0n895_95_c1_13770_14411 213
1036 3300050513 nmdc:mga0rr50_105623_c1 nmdc:mga0rr50_105623_c1_924_1565 213
1037 3300050513 nmdc:mga0rr50_13491_c1 nmdc:mga0rr50_13491_c1_2278_2919 213
1038 3300050513 nmdc:mga0rr50_17771_c1 nmdc:mga0rr50_17771_c1_67_708 213
1039 3300050513 nmdc:mga0rr50_193363_c1 nmdc:mga0rr50_193363_c1_393_1034 213
1040 3300050513 nmdc:mga0rr50_28_c1 nmdc:mga0rr50_28_c1_45929_46570 213
1041 3300050513 nmdc:mga0rr50_4559_c1 nmdc:mga0rr50_4559_c1_4325_5014 213
1042 3300050513 nmdc:mga0rr50_46608_c1 nmdc:mga0rr50_46608_c1_2074_2715 213
1043 3300050514 nmdc:mga08x19_11377_c1 nmdc:mga08x19_11377_c1_3027_3668 213
1044 3300050514 nmdc:mga08x19_121_c1 nmdc:mga08x19_121_c1_25717_26358 213
1045 3300050514 nmdc:mga08x19_55142_c1 nmdc:mga08x19_55142_c1_1636_2277 213
1046 3300050514 nmdc:mga08x19_91733_c1 nmdc:mga08x19_91733_c1_775_1416 213
1047 3300050515 nmdc:mga0a205_1053_c2 nmdc:mga0a205_1053_c2_6306_6947 213
1048 3300050515 nmdc:mga0a205_384820_c1 nmdc:mga0a205_384820_c1_565_1215 213
1049 3300050515 nmdc:mga0a205_431012_c1 nmdc:mga0a205_431012_c1_229_870 213
1050 3300050515 nmdc:mga0a205_476_c1 nmdc:mga0a205_476_c1_16399_17040 213
1051 3300050515 nmdc:mga0a205_53893_c1 nmdc:mga0a205_53893_c1_1661_2302 213
1052 3300050515 nmdc:mga0a205_552440_c1 nmdc:mga0a205_552440_c1_292_981 213
1053 3300050515 nmdc:mga0a205_5677_c1 nmdc:mga0a205_5677_c1_3629_4270 213
1054 3300050515 nmdc:mga0a205_78431_c1 nmdc:mga0a205_78431_c1_701_1342 213
1055 3300053077 Ga0495601_0009411 Ga0495601_0009411_1805_2446 213
1056 3300053077 Ga0495601_0147173 Ga0495601_0147173_143_784 213
1057 3300053085 Ga0495619_0487330 Ga0495619_0487330_68_709 213
1058 3300053103 Ga0500555_005302 Ga0500555_005302_2854_3495 213
1059 3300054114 Ga0501084_0054920 Ga0501084_0054920_1924_2622 213
1060 3300060353 Ga0501082_0069283 Ga0501082_0069283_1693_2334 213
1061 3300060353 Ga0501082_0381461 Ga0501082_0381461_267_908 213
1062 3300060353 Ga0501082_0644367 Ga0501082_0644367_158_856 213
1063 3300060353 Ga0501082_0703868 Ga0501082_0703868_209_868 213
1064 3300061734 Ga0530510_0066955 Ga0530510_0066955_904_1545 213
1065 3300061734 Ga0530510_0288448 Ga0530510_0288448_187_828 213

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

47

139

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nhl-assembly1.cif.gz_A crystal structure of quee from escherichia coli 0.806 2 202
5tgs-assembly1.cif.gz_A crystal structure of quee from bacillus subtilis with methionine bound 0.8043 2 206
5tgs-assembly1.cif.gz_B crystal structure of quee from bacillus subtilis with methionine bound 0.7885 2 206
5th5-assembly1.cif.gz_A crystal structure of quee from bacillus subtilis with 6-carboxypterin-5'-deoxyadenosyl ester bound 0.787 2 213
5th5-assembly1.cif.gz_A crystal structure of quee from bacillus subtilis with 6-carboxypterin-5'-deoxyadenosyl ester bound 0.78 2 213
ID Description Score Start End Superfamily
af_Q59039_1_242_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8286 4 205 3.20.20.70
af_Q2G1X7_4_231_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8202 2 206 3.20.20.70
af_P64554_2_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.815 1 205 3.20.20.70
af_P75794_7_292_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7961 22 172 3.20.20.70
af_Q2G1X7_4_231_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7895 2 206 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A381SXU2-F1-model_v4 Radical SAM core domain-containing protein 0.9968 49 213 GO:0016829
GO:0051539
AF-A0A7W0LCA8-F1-model_v4 7-carboxy-7-deazaguanine synthase 0.9968 66 213 GO:0051539
AF-A0A2V6KKF6-F1-model_v4 7-carboxy-7-deazaguanine synthase 0.9955 44 213 GO:0016829
GO:0051539
AF-A0A2V5MAR6-F1-model_v4 7-carboxy-7-deazaguanine synthase 0.9955 53 213 GO:0051539
AF-A0A7Y1SHN7-F1-model_v4 deleted 0.9948 70 153

Feature Viewer

pLDDT pTM Quality
94.7 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map