F489385
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1065 | 349 | 1065 | 212 |
Family's Representative Sequence
| Representative Sequence | 3300049589|Ga0501073_0055066|Ga0501073_0055066_1364_2122 |
| Length | 252 |
| Sequence | VHSVPAESAKAGNAEAPADVLAGTLRVNEVFFSIQGESTWAGEPCVFVRLTGCPLRCTYCDTEYAFREGETRTIASVVQQVESFGCRVVEVTGGEPLAQKRCLDLVRVLCERGCTVLIETSGAVDIGPVDSRAIRIVDLKTPGSGEMERNLWSNMQQLRPRDEVKFVVTSREDYDWAKQQMTRLDLAGMVQRGQLRAVLMSAAWEQRKGLEIAGCAGLHPRTLAEWILADRLPVRMQSQLHKIIWDPQTRGV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 2 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 194 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 196 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 197 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 198 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 199 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 200 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 201 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 202 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 203 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 204 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 205 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 206 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 207 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 208 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 209 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 210 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 212 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 213 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 214 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 216 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 217 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 220 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 221 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 222 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 223 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 224 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 225 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 226 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 227 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 228 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 229 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 230 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 231 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 232 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 233 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 234 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 235 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 236 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 237 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 238 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 239 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 240 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 241 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 242 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 243 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 244 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 245 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 246 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 247 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 268 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 269 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 270 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 273 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 274 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 275 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 276 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 277 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 278 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 279 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 280 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 281 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 282 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 283 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 284 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 304 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 305 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 306 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 307 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 308 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 309 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 310 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 311 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 312 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 313 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 314 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 315 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 316 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 317 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 318 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 319 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 320 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 321 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 322 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 323 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 327 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 328 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 329 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 330 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 331 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 332 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 333 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 346 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 348 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.09 |
| Nodule | 0 |
| Rhizoplane | 1.6 |
| Rhizosphere | 97.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10021274 | 3300002459 | Bacteria | 1344 |
| 2 | Ga0065704_10015486 | 3300005289 | Bacteria | 1781 |
| 3 | Ga0065704_10140576 | 3300005289 | Unclassified | 1521 |
| 4 | Ga0065712_10087465 | 3300005290 | Unclassified | 2576 |
| 5 | Ga0065712_10128456 | 3300005290 | Bacteria | 1578 |
| 6 | Ga0065712_10187895 | 3300005290 | Unclassified | 1161 |
| 7 | Ga0065712_10276063 | 3300005290 | Bacteria | 905 |
| 8 | Ga0065715_10022852 | 3300005293 | Bacteria | 1819 |
| 9 | Ga0065715_10142070 | 3300005293 | Bacteria | 1839 |
| 10 | Ga0065707_10137543 | 3300005295 | Bacteria | 1819 |
| 11 | Ga0065707_10338296 | 3300005295 | Bacteria | 938 |
| 12 | Ga0070676_10007566 | 3300005328 | Bacteria | 5833 |
| 13 | Ga0070676_10151114 | 3300005328 | Bacteria | 1486 |
| 14 | Ga0070676_10427478 | 3300005328 | Bacteria | 927 |
| 15 | Ga0070683_100013326 | 3300005329 | Bacteria | 7167 |
| 16 | Ga0070683_100169018 | 3300005329 | Bacteria | 2075 |
| 17 | Ga0070683_100529077 | 3300005329 | Bacteria | 1127 |
| 18 | Ga0070690_100000336 | 3300005330 | Bacteria | 24075 |
| 19 | Ga0070690_100004162 | 3300005330 | Bacteria | 8002 |
| 20 | Ga0070690_100035498 | 3300005330 | Bacteria | 3129 |
| 21 | Ga0070690_100050976 | 3300005330 | Bacteria | 2641 |
| 22 | Ga0070670_100002699 | 3300005331 | Bacteria | 14659 |
| 23 | Ga0070670_100035231 | 3300005331 | Bacteria | 4309 |
| 24 | Ga0070670_100119293 | 3300005331 | Unclassified | 2275 |
| 25 | Ga0070670_100627597 | 3300005331 | Bacteria | 963 |
| 26 | Ga0070670_100640967 | 3300005331 | Bacteria | 953 |
| 27 | Ga0070677_10005848 | 3300005333 | Bacteria | 4073 |
| 28 | Ga0070677_10143361 | 3300005333 | Bacteria | 1104 |
| 29 | Ga0068869_100032669 | 3300005334 | Bacteria | 3669 |
| 30 | Ga0068869_100283775 | 3300005334 | Bacteria | 1332 |
| 31 | Ga0070666_10007593 | 3300005335 | Bacteria | 6690 |
| 32 | Ga0070666_10008555 | 3300005335 | Bacteria | 6358 |
| 33 | Ga0070666_10232264 | 3300005335 | Bacteria | 1303 |
| 34 | Ga0070680_100167068 | 3300005336 | Bacteria | 1850 |
| 35 | Ga0070680_100235862 | 3300005336 | Bacteria | 1545 |
| 36 | Ga0068868_100061553 | 3300005338 | Bacteria | 2974 |
| 37 | Ga0068868_100076743 | 3300005338 | Bacteria | 2672 |
| 38 | Ga0068868_100130709 | 3300005338 | Bacteria | 2054 |
| 39 | Ga0068868_100200115 | 3300005338 | Bacteria | 1665 |
| 40 | Ga0068868_100300052 | 3300005338 | Bacteria | 1364 |
| 41 | Ga0068868_100392814 | 3300005338 | Bacteria | 1196 |
| 42 | Ga0070660_100012311 | 3300005339 | Bacteria | 6105 |
| 43 | Ga0070660_100104112 | 3300005339 | Bacteria | 2251 |
| 44 | Ga0070689_100000066 | 3300005340 | Bacteria | 62639 |
| 45 | Ga0070689_100089945 | 3300005340 | Bacteria | 2418 |
| 46 | Ga0070689_100095286 | 3300005340 | Unclassified | 2351 |
| 47 | Ga0070689_100137192 | 3300005340 | Bacteria | 1965 |
| 48 | Ga0070689_100176621 | 3300005340 | Bacteria | 1733 |
| 49 | Ga0070689_100324812 | 3300005340 | Bacteria | 1286 |
| 50 | Ga0070689_100460076 | 3300005340 | Bacteria | 1084 |
| 51 | Ga0070689_100630372 | 3300005340 | Unclassified | 931 |
| 52 | Ga0070687_100232773 | 3300005343 | Bacteria | 1135 |
| 53 | Ga0070661_100018875 | 3300005344 | Bacteria | 4909 |
| 54 | Ga0070692_10001597 | 3300005345 | Bacteria | 8322 |
| 55 | Ga0070692_10035483 | 3300005345 | Bacteria | 2525 |
| 56 | Ga0070668_100275499 | 3300005347 | Unclassified | 1404 |
| 57 | Ga0070668_100338028 | 3300005347 | Unclassified | 1271 |
| 58 | Ga0070669_100001454 | 3300005353 | Bacteria | 17172 |
| 59 | Ga0070669_100012223 | 3300005353 | Bacteria | 6094 |
| 60 | Ga0070669_100016030 | 3300005353 | Bacteria | 5348 |
| 61 | Ga0070669_100081558 | 3300005353 | Bacteria | 2410 |
| 62 | Ga0070669_100105804 | 3300005353 | Bacteria | 2129 |
| 63 | Ga0070669_100112110 | 3300005353 | Bacteria | 2071 |
| 64 | Ga0070669_100341127 | 3300005353 | Bacteria | 1214 |
| 65 | Ga0070675_100000147 | 3300005354 | Bacteria | 42295 |
| 66 | Ga0070675_100003888 | 3300005354 | Bacteria | 11318 |
| 67 | Ga0070675_100008321 | 3300005354 | Bacteria | 8046 |
| 68 | Ga0070675_100048236 | 3300005354 | Bacteria | 3491 |
| 69 | Ga0070675_100051067 | 3300005354 | Bacteria | 3397 |
| 70 | Ga0070675_100247922 | 3300005354 | Bacteria | 1558 |
| 71 | Ga0070675_100356514 | 3300005354 | Bacteria | 1298 |
| 72 | Ga0070675_100390088 | 3300005354 | Bacteria | 1241 |
| 73 | Ga0070675_100668551 | 3300005354 | Unclassified | 945 |
| 74 | Ga0070671_100007961 | 3300005355 | Bacteria | 8477 |
| 75 | Ga0070671_100032528 | 3300005355 | Bacteria | 4312 |
| 76 | Ga0070671_100164771 | 3300005355 | Bacteria | 1874 |
| 77 | Ga0070674_100002716 | 3300005356 | Bacteria | 9792 |
| 78 | Ga0070674_100064531 | 3300005356 | Bacteria | 2566 |
| 79 | Ga0070674_100814911 | 3300005356 | Bacteria | 807 |
| 80 | Ga0070673_100000103 | 3300005364 | Bacteria | 38215 |
| 81 | Ga0070673_100003965 | 3300005364 | Bacteria | 9304 |
| 82 | Ga0070673_100009418 | 3300005364 | Bacteria | 6554 |
| 83 | Ga0070673_100713120 | 3300005364 | Bacteria | 922 |
| 84 | Ga0070688_100001477 | 3300005365 | Bacteria | 11687 |
| 85 | Ga0070688_100003218 | 3300005365 | Bacteria | 8369 |
| 86 | Ga0070688_100023138 | 3300005365 | Bacteria | 3651 |
| 87 | Ga0070688_100055066 | 3300005365 | Bacteria | 2494 |
| 88 | Ga0070688_100065786 | 3300005365 | Bacteria | 2305 |
| 89 | Ga0070688_100105296 | 3300005365 | Bacteria | 1867 |
| 90 | Ga0070688_100416269 | 3300005365 | Bacteria | 998 |
| 91 | Ga0070688_100623179 | 3300005365 | Bacteria | 828 |
| 92 | Ga0070659_100349461 | 3300005366 | Unclassified | 1240 |
| 93 | Ga0070659_100375231 | 3300005366 | Bacteria | 1197 |
| 94 | Ga0070667_100083176 | 3300005367 | Bacteria | 2742 |
| 95 | Ga0070667_100325363 | 3300005367 | Bacteria | 1388 |
| 96 | Ga0070703_10031065 | 3300005406 | Bacteria | 1613 |
| 97 | Ga0070703_10040636 | 3300005406 | Bacteria | 1447 |
| 98 | Ga0070703_10232710 | 3300005406 | Bacteria | 739 |
| 99 | Ga0070709_10132027 | 3300005434 | Bacteria | 1706 |
| 100 | Ga0070714_100253206 | 3300005435 | Unclassified | 1629 |
| 101 | Ga0070710_10027928 | 3300005437 | Bacteria | 3014 |
| 102 | Ga0070701_10000020 | 3300005438 | Bacteria | 41399 |
| 103 | Ga0070701_10051314 | 3300005438 | Bacteria | 2140 |
| 104 | Ga0070701_10138561 | 3300005438 | Bacteria | 1389 |
| 105 | Ga0070701_10155126 | 3300005438 | Bacteria | 1322 |
| 106 | Ga0070701_10286350 | 3300005438 | Bacteria | 1008 |
| 107 | Ga0070701_10524117 | 3300005438 | Bacteria | 773 |
| 108 | Ga0070711_100439564 | 3300005439 | Unclassified | 1066 |
| 109 | Ga0070711_100465652 | 3300005439 | Bacteria | 1037 |
| 110 | Ga0070705_100038491 | 3300005440 | Bacteria | 2706 |
| 111 | Ga0070705_100042809 | 3300005440 | Bacteria | 2591 |
| 112 | Ga0070705_100069953 | 3300005440 | Bacteria | 2118 |
| 113 | Ga0070705_100186311 | 3300005440 | Bacteria | 1410 |
| 114 | Ga0070705_100401137 | 3300005440 | Unclassified | 1015 |
| 115 | Ga0070700_100000818 | 3300005441 | Bacteria | 15281 |
| 116 | Ga0070700_100004171 | 3300005441 | Bacteria | 7535 |
| 117 | Ga0070700_100004954 | 3300005441 | Bacteria | 7006 |
| 118 | Ga0070700_100143607 | 3300005441 | Bacteria | 1625 |
| 119 | Ga0070700_100694100 | 3300005441 | Bacteria | 808 |
| 120 | Ga0070700_100776910 | 3300005441 | Bacteria | 769 |
| 121 | Ga0070694_100047946 | 3300005444 | Bacteria | 2872 |
| 122 | Ga0070694_100054370 | 3300005444 | Bacteria | 2712 |
| 123 | Ga0070694_100106143 | 3300005444 | Bacteria | 1994 |
| 124 | Ga0070694_100116412 | 3300005444 | Unclassified | 1912 |
| 125 | Ga0070694_100397414 | 3300005444 | Bacteria | 1078 |
| 126 | Ga0070708_100022317 | 3300005445 | Bacteria | 5367 |
| 127 | Ga0070708_100101619 | 3300005445 | Bacteria | 2633 |
| 128 | Ga0070708_100260591 | 3300005445 | Bacteria | 1630 |
| 129 | Ga0070708_100422162 | 3300005445 | Unclassified | 1258 |
| 130 | Ga0070708_100905832 | 3300005445 | Bacteria | 828 |
| 131 | Ga0070663_100009569 | 3300005455 | Bacteria | 6006 |
| 132 | Ga0070663_100032089 | 3300005455 | Bacteria | 3617 |
| 133 | Ga0070678_100002436 | 3300005456 | Bacteria | 10191 |
| 134 | Ga0070678_100016979 | 3300005456 | Bacteria | 4673 |
| 135 | Ga0070678_100032871 | 3300005456 | Bacteria | 3595 |
| 136 | Ga0070678_100055019 | 3300005456 | Bacteria | 2903 |
| 137 | Ga0070678_100071199 | 3300005456 | Bacteria | 2602 |
| 138 | Ga0070678_100137887 | 3300005456 | Bacteria | 1948 |
| 139 | Ga0070678_101014404 | 3300005456 | Bacteria | 763 |
| 140 | Ga0070662_100027204 | 3300005457 | Bacteria | 3967 |
| 141 | Ga0070662_100100568 | 3300005457 | Bacteria | 2188 |
| 142 | Ga0070662_100276377 | 3300005457 | Bacteria | 1358 |
| 143 | Ga0070662_100989909 | 3300005457 | Unclassified | 719 |
| 144 | Ga0070681_10014199 | 3300005458 | Bacteria | 7925 |
| 145 | Ga0070681_10073223 | 3300005458 | Bacteria | 3388 |
| 146 | Ga0070681_10129868 | 3300005458 | Bacteria | 2451 |
| 147 | Ga0068867_100001096 | 3300005459 | Bacteria | 18486 |
| 148 | Ga0068867_100002876 | 3300005459 | Bacteria | 12113 |
| 149 | Ga0068867_100027704 | 3300005459 | Bacteria | 4075 |
| 150 | Ga0068867_100093506 | 3300005459 | Bacteria | 2285 |
| 151 | Ga0068867_100094484 | 3300005459 | Bacteria | 2274 |
| 152 | Ga0068867_100345586 | 3300005459 | Bacteria | 1240 |
| 153 | Ga0068867_100383805 | 3300005459 | Bacteria | 1181 |
| 154 | Ga0068867_101115018 | 3300005459 | Unclassified | 721 |
| 155 | Ga0070685_10000069 | 3300005466 | Bacteria | 60941 |
| 156 | Ga0070685_10019371 | 3300005466 | Bacteria | 3670 |
| 157 | Ga0070685_10031005 | 3300005466 | Bacteria | 2983 |
| 158 | Ga0070685_10062750 | 3300005466 | Bacteria | 2180 |
| 159 | Ga0070685_10139038 | 3300005466 | Bacteria | 1527 |
| 160 | Ga0070685_10165941 | 3300005466 | Bacteria | 1411 |
| 161 | Ga0070685_10167642 | 3300005466 | Bacteria | 1405 |
| 162 | Ga0070706_100096995 | 3300005467 | Bacteria | 2738 |
| 163 | Ga0070706_100144241 | 3300005467 | Bacteria | 2223 |
| 164 | Ga0070706_100631082 | 3300005467 | Bacteria | 995 |
| 165 | Ga0070707_100000021 | 3300005468 | Bacteria | 130642 |
| 166 | Ga0070707_100038006 | 3300005468 | Bacteria | 4597 |
| 167 | Ga0070707_100041900 | 3300005468 | Bacteria | 4383 |
| 168 | Ga0070707_100069599 | 3300005468 | Bacteria | 3388 |
| 169 | Ga0070707_100669326 | 3300005468 | Unclassified | 1001 |
| 170 | Ga0070698_100029698 | 3300005471 | Bacteria | 5675 |
| 171 | Ga0070698_100196500 | 3300005471 | Bacteria | 1954 |
| 172 | Ga0070698_100289952 | 3300005471 | Unclassified | 1568 |
| 173 | Ga0070699_100001737 | 3300005518 | Bacteria | 19888 |
| 174 | Ga0070699_100002012 | 3300005518 | Bacteria | 18361 |
| 175 | Ga0070699_100037057 | 3300005518 | Bacteria | 4219 |
| 176 | Ga0070699_100053591 | 3300005518 | Bacteria | 3491 |
| 177 | Ga0070699_100218236 | 3300005518 | Bacteria | 1699 |
| 178 | Ga0070699_100335870 | 3300005518 | Unclassified | 1359 |
| 179 | Ga0070679_100171169 | 3300005530 | Bacteria | 2144 |
| 180 | Ga0070684_100768542 | 3300005535 | Bacteria | 900 |
| 181 | Ga0070697_100048178 | 3300005536 | Bacteria | 3455 |
| 182 | Ga0070697_100061083 | 3300005536 | Bacteria | 3073 |
| 183 | Ga0070697_100139549 | 3300005536 | Bacteria | 2037 |
| 184 | Ga0070697_100178419 | 3300005536 | Bacteria | 1800 |
| 185 | Ga0070697_100538973 | 3300005536 | Bacteria | 1023 |
| 186 | Ga0068853_100459082 | 3300005539 | Bacteria | 1199 |
| 187 | Ga0070672_100002045 | 3300005543 | Bacteria | 12704 |
| 188 | Ga0070672_100011300 | 3300005543 | Bacteria | 6227 |
| 189 | Ga0070672_100045389 | 3300005543 | Bacteria | 3398 |
| 190 | Ga0070672_100093050 | 3300005543 | Bacteria | 2435 |
| 191 | Ga0070672_100136771 | 3300005543 | Bacteria | 2018 |
| 192 | Ga0070672_100151381 | 3300005543 | Bacteria | 1919 |
| 193 | Ga0070672_100227374 | 3300005543 | Bacteria | 1566 |
| 194 | Ga0070686_100000100 | 3300005544 | Bacteria | 59351 |
| 195 | Ga0070686_100002508 | 3300005544 | Bacteria | 10110 |
| 196 | Ga0070686_100022866 | 3300005544 | Bacteria | 3729 |
| 197 | Ga0070686_100040570 | 3300005544 | Bacteria | 2905 |
| 198 | Ga0070686_100118755 | 3300005544 | Bacteria | 1813 |
| 199 | Ga0070695_100005877 | 3300005545 | Bacteria | 7240 |
| 200 | Ga0070695_100050017 | 3300005545 | Bacteria | 2677 |
| 201 | Ga0070695_100063731 | 3300005545 | Bacteria | 2396 |
| 202 | Ga0070695_100189390 | 3300005545 | Bacteria | 1463 |
| 203 | Ga0070695_100575094 | 3300005545 | Bacteria | 881 |
| 204 | Ga0070695_100799634 | 3300005545 | Bacteria | 755 |
| 205 | Ga0070696_100002986 | 3300005546 | Bacteria | 11235 |
| 206 | Ga0070696_100003911 | 3300005546 | Bacteria | 9952 |
| 207 | Ga0070696_100011890 | 3300005546 | Bacteria | 5834 |
| 208 | Ga0070696_100073659 | 3300005546 | Bacteria | 2407 |
| 209 | Ga0070696_100101272 | 3300005546 | Bacteria | 2064 |
| 210 | Ga0070696_100190801 | 3300005546 | Unclassified | 1525 |
| 211 | Ga0070696_100250978 | 3300005546 | Bacteria | 1338 |
| 212 | Ga0070696_100259553 | 3300005546 | Bacteria | 1317 |
| 213 | Ga0070693_100169167 | 3300005547 | Bacteria | 1398 |
| 214 | Ga0070665_100340116 | 3300005548 | Unclassified | 1505 |
| 215 | Ga0070665_100422305 | 3300005548 | Bacteria | 1342 |
| 216 | Ga0070665_100470014 | 3300005548 | Bacteria | 1268 |
| 217 | Ga0070704_100003197 | 3300005549 | Bacteria | 9366 |
| 218 | Ga0070704_100008135 | 3300005549 | Bacteria | 6271 |
| 219 | Ga0070704_100009518 | 3300005549 | Bacteria | 5877 |
| 220 | Ga0070704_100012684 | 3300005549 | Bacteria | 5214 |
| 221 | Ga0070704_100040734 | 3300005549 | Bacteria | 3200 |
| 222 | Ga0070704_100139194 | 3300005549 | Bacteria | 1892 |
| 223 | Ga0070704_100175606 | 3300005549 | Unclassified | 1708 |
| 224 | Ga0070704_100187522 | 3300005549 | Bacteria | 1660 |
| 225 | Ga0070704_100631817 | 3300005549 | Bacteria | 944 |
| 226 | Ga0070704_100708027 | 3300005549 | Unclassified | 893 |
| 227 | Ga0068855_100098552 | 3300005563 | Bacteria | 3367 |
| 228 | Ga0068855_100112064 | 3300005563 | Bacteria | 3131 |
| 229 | Ga0070664_100000584 | 3300005564 | Bacteria | 27791 |
| 230 | Ga0070664_100013313 | 3300005564 | Bacteria | 6698 |
| 231 | Ga0070664_100029223 | 3300005564 | Bacteria | 4594 |
| 232 | Ga0070664_100091172 | 3300005564 | Bacteria | 2638 |
| 233 | Ga0070664_100107093 | 3300005564 | Bacteria | 2437 |
| 234 | Ga0070664_100447347 | 3300005564 | Bacteria | 1186 |
| 235 | Ga0070664_100590851 | 3300005564 | Unclassified | 1029 |
| 236 | Ga0068857_100020770 | 3300005577 | Bacteria | 5778 |
| 237 | Ga0068854_100174919 | 3300005578 | Bacteria | 1673 |
| 238 | Ga0070702_100023978 | 3300005615 | Bacteria | 3249 |
| 239 | Ga0070702_100116927 | 3300005615 | Bacteria | 1663 |
| 240 | Ga0070702_100432589 | 3300005615 | Bacteria | 950 |
| 241 | Ga0068852_101377789 | 3300005616 | Unclassified | 727 |
| 242 | Ga0068859_100004613 | 3300005617 | Bacteria | 14046 |
| 243 | Ga0068859_100051697 | 3300005617 | Bacteria | 4131 |
| 244 | Ga0068859_100095636 | 3300005617 | Bacteria | 3023 |
| 245 | Ga0068859_100174261 | 3300005617 | Bacteria | 2233 |
| 246 | Ga0068859_100343076 | 3300005617 | Bacteria | 1588 |
| 247 | Ga0068859_100481130 | 3300005617 | Bacteria | 1337 |
| 248 | Ga0068864_100008151 | 3300005618 | Bacteria | 8641 |
| 249 | Ga0068864_100029037 | 3300005618 | Bacteria | 4679 |
| 250 | Ga0068864_100038432 | 3300005618 | Bacteria | 4087 |
| 251 | Ga0068864_100111730 | 3300005618 | Bacteria | 2435 |
| 252 | Ga0068864_100177764 | 3300005618 | Bacteria | 1944 |
| 253 | Ga0068864_100471794 | 3300005618 | Bacteria | 1203 |
| 254 | Ga0068866_10002332 | 3300005718 | Bacteria | 7869 |
| 255 | Ga0068866_10202778 | 3300005718 | Bacteria | 1186 |
| 256 | Ga0068861_100005416 | 3300005719 | Bacteria | 8639 |
| 257 | Ga0068861_100045160 | 3300005719 | Bacteria | 3316 |
| 258 | Ga0068861_100053791 | 3300005719 | Bacteria | 3065 |
| 259 | Ga0068861_100253404 | 3300005719 | Bacteria | 1503 |
| 260 | Ga0068861_100454974 | 3300005719 | Unclassified | 1148 |
| 261 | Ga0068861_100685254 | 3300005719 | Bacteria | 951 |
| 262 | Ga0068870_10001025 | 3300005840 | Bacteria | 11049 |
| 263 | Ga0068870_10006146 | 3300005840 | Bacteria | 5280 |
| 264 | Ga0068863_100002234 | 3300005841 | Bacteria | 19218 |
| 265 | Ga0068863_100165117 | 3300005841 | Bacteria | 2123 |
| 266 | Ga0068863_100168822 | 3300005841 | Bacteria | 2098 |
| 267 | Ga0068858_100001888 | 3300005842 | Bacteria | 21404 |
| 268 | Ga0068858_100030600 | 3300005842 | Bacteria | 4999 |
| 269 | Ga0068858_100038117 | 3300005842 | Bacteria | 4458 |
| 270 | Ga0068858_100126799 | 3300005842 | Bacteria | 2391 |
| 271 | Ga0068858_100292889 | 3300005842 | Bacteria | 1552 |
| 272 | Ga0068858_100833859 | 3300005842 | Bacteria | 900 |
| 273 | Ga0068858_100986190 | 3300005842 | Bacteria | 825 |
| 274 | Ga0068860_100033522 | 3300005843 | Bacteria | 4927 |
| 275 | Ga0068860_100033985 | 3300005843 | Bacteria | 4892 |
| 276 | Ga0068860_100054885 | 3300005843 | Bacteria | 3787 |
| 277 | Ga0068860_100066357 | 3300005843 | Bacteria | 3428 |
| 278 | Ga0068860_100484848 | 3300005843 | Bacteria | 1233 |
| 279 | Ga0068862_100006477 | 3300005844 | Bacteria | 9723 |
| 280 | Ga0068862_100018207 | 3300005844 | Bacteria | 5848 |
| 281 | Ga0068862_100030874 | 3300005844 | Bacteria | 4518 |
| 282 | Ga0068862_100042813 | 3300005844 | Bacteria | 3858 |
| 283 | Ga0068862_100218963 | 3300005844 | Bacteria | 1723 |
| 284 | Ga0081455_10000786 | 3300005937 | Bacteria | 40744 |
| 285 | Ga0081455_10214401 | 3300005937 | Bacteria | 1432 |
| 286 | Ga0081539_10146522 | 3300005985 | Bacteria | 1141 |
| 287 | Ga0070715_10015855 | 3300006163 | Bacteria | 2819 |
| 288 | Ga0070716_100206208 | 3300006173 | Bacteria | 1310 |
| 289 | Ga0070716_100220732 | 3300006173 | Bacteria | 1273 |
| 290 | Ga0070716_100514022 | 3300006173 | Bacteria | 886 |
| 291 | Ga0070716_100639853 | 3300006173 | Unclassified | 805 |
| 292 | Ga0070712_100135942 | 3300006175 | Bacteria | 1869 |
| 293 | Ga0097621_100001601 | 3300006237 | Bacteria | 15491 |
| 294 | Ga0097621_100007328 | 3300006237 | Bacteria | 7885 |
| 295 | Ga0097621_100023648 | 3300006237 | Bacteria | 4786 |
| 296 | Ga0097621_100056007 | 3300006237 | Bacteria | 3220 |
| 297 | Ga0097621_100086311 | 3300006237 | Bacteria | 2619 |
| 298 | Ga0097621_100091837 | 3300006237 | Bacteria | 2542 |
| 299 | Ga0068871_100001107 | 3300006358 | Bacteria | 18079 |
| 300 | Ga0068871_100010328 | 3300006358 | Bacteria | 6806 |
| 301 | Ga0068871_100026278 | 3300006358 | Bacteria | 4541 |
| 302 | Ga0068871_100033300 | 3300006358 | Bacteria | 4080 |
| 303 | Ga0068871_100193809 | 3300006358 | Bacteria | 1751 |
| 304 | Ga0068871_100340182 | 3300006358 | Bacteria | 1325 |
| 305 | Ga0068871_100352776 | 3300006358 | Bacteria | 1301 |
| 306 | Ga0075428_100012493 | 3300006844 | Bacteria | 9444 |
| 307 | Ga0075428_100018081 | 3300006844 | Bacteria | 7790 |
| 308 | Ga0075428_100037061 | 3300006844 | Bacteria | 5371 |
| 309 | Ga0075428_100055313 | 3300006844 | Bacteria | 4348 |
| 310 | Ga0075428_100066734 | 3300006844 | Bacteria | 3939 |
| 311 | Ga0075428_100109374 | 3300006844 | Bacteria | 3011 |
| 312 | Ga0075428_100388623 | 3300006844 | Bacteria | 1496 |
| 313 | Ga0075428_100565104 | 3300006844 | Bacteria | 1216 |
| 314 | Ga0075430_100001196 | 3300006846 | Bacteria | 20813 |
| 315 | Ga0075430_100003466 | 3300006846 | Bacteria | 13203 |
| 316 | Ga0075430_100006133 | 3300006846 | Bacteria | 10128 |
| 317 | Ga0075430_100009586 | 3300006846 | Bacteria | 8182 |
| 318 | Ga0075430_100180315 | 3300006846 | Bacteria | 1757 |
| 319 | Ga0075430_100700891 | 3300006846 | Bacteria | 835 |
| 320 | Ga0075431_100028775 | 3300006847 | Bacteria | 5713 |
| 321 | Ga0075431_100073904 | 3300006847 | Bacteria | 3517 |
| 322 | Ga0075431_100111492 | 3300006847 | Bacteria | 2823 |
| 323 | Ga0075431_100177222 | 3300006847 | Bacteria | 2189 |
| 324 | Ga0075431_100535423 | 3300006847 | Bacteria | 1160 |
| 325 | Ga0075431_101174045 | 3300006847 | Unclassified | 731 |
| 326 | Ga0075433_10000936 | 3300006852 | Bacteria | 20611 |
| 327 | Ga0075433_10001275 | 3300006852 | Bacteria | 18416 |
| 328 | Ga0075433_10013705 | 3300006852 | Bacteria | 6602 |
| 329 | Ga0075433_10067320 | 3300006852 | Bacteria | 3143 |
| 330 | Ga0075433_10110458 | 3300006852 | Bacteria | 2439 |
| 331 | Ga0075433_10129334 | 3300006852 | Bacteria | 2243 |
| 332 | Ga0075433_10338702 | 3300006852 | Bacteria | 1329 |
| 333 | Ga0075433_10381076 | 3300006852 | Bacteria | 1245 |
| 334 | Ga0075433_10492670 | 3300006852 | Bacteria | 1079 |
| 335 | Ga0075433_10540806 | 3300006852 | Bacteria | 1024 |
| 336 | Ga0075434_100000049 | 3300006871 | Bacteria | 57417 |
| 337 | Ga0075434_100011998 | 3300006871 | Bacteria | 8199 |
| 338 | Ga0075434_100021443 | 3300006871 | Bacteria | 6278 |
| 339 | Ga0075434_100025831 | 3300006871 | Bacteria | 5749 |
| 340 | Ga0075434_100046934 | 3300006871 | Bacteria | 4286 |
| 341 | Ga0075434_100047314 | 3300006871 | Bacteria | 4268 |
| 342 | Ga0075434_100132783 | 3300006871 | Unclassified | 2509 |
| 343 | Ga0075434_100187017 | 3300006871 | Bacteria | 2091 |
| 344 | Ga0075434_100634562 | 3300006871 | Bacteria | 1087 |
| 345 | Ga0075429_100001236 | 3300006880 | Bacteria | 20721 |
| 346 | Ga0075429_100018761 | 3300006880 | Bacteria | 5990 |
| 347 | Ga0075429_100044586 | 3300006880 | Bacteria | 3857 |
| 348 | Ga0075429_100161158 | 3300006880 | Bacteria | 1964 |
| 349 | Ga0075429_100213590 | 3300006880 | Bacteria | 1690 |
| 350 | Ga0075429_100215362 | 3300006880 | Bacteria | 1683 |
| 351 | Ga0075429_100425496 | 3300006880 | Bacteria | 1163 |
| 352 | Ga0068865_100086899 | 3300006881 | Bacteria | 2258 |
| 353 | Ga0068865_100266952 | 3300006881 | Bacteria | 1357 |
| 354 | Ga0068865_100339852 | 3300006881 | Bacteria | 1213 |
| 355 | Ga0075436_100000420 | 3300006914 | Bacteria | 27162 |
| 356 | Ga0075436_100019413 | 3300006914 | Bacteria | 4658 |
| 357 | Ga0075436_100019739 | 3300006914 | Bacteria | 4621 |
| 358 | Ga0075436_100025325 | 3300006914 | Bacteria | 4082 |
| 359 | Ga0075436_100037192 | 3300006914 | Bacteria | 3360 |
| 360 | Ga0075436_100322257 | 3300006914 | Unclassified | 1110 |
| 361 | Ga0097620_100004613 | 3300006931 | Bacteria | 14046 |
| 362 | Ga0097620_100051695 | 3300006931 | Bacteria | 4131 |
| 363 | Ga0097620_100095631 | 3300006931 | Bacteria | 3023 |
| 364 | Ga0097620_100174262 | 3300006931 | Bacteria | 2233 |
| 365 | Ga0097620_100343077 | 3300006931 | Bacteria | 1588 |
| 366 | Ga0097620_100481101 | 3300006931 | Bacteria | 1337 |
| 367 | Ga0075435_100000059 | 3300007076 | Bacteria | 56189 |
| 368 | Ga0075435_100004605 | 3300007076 | Bacteria | 9499 |
| 369 | Ga0075435_100005562 | 3300007076 | Bacteria | 8819 |
| 370 | Ga0075435_100013234 | 3300007076 | Bacteria | 6131 |
| 371 | Ga0075435_100057562 | 3300007076 | Bacteria | 3145 |
| 372 | Ga0075435_100154261 | 3300007076 | Bacteria | 1932 |
| 373 | Ga0075435_100233022 | 3300007076 | Bacteria | 1564 |
| 374 | Ga0075435_100287762 | 3300007076 | Unclassified | 1404 |
| 375 | Ga0075435_100318908 | 3300007076 | Bacteria | 1330 |
| 376 | Ga0111539_10000326 | 3300009094 | Bacteria | 58218 |
| 377 | Ga0111539_10004673 | 3300009094 | Bacteria | 17895 |
| 378 | Ga0111539_10004769 | 3300009094 | Bacteria | 17699 |
| 379 | Ga0111539_10007551 | 3300009094 | Bacteria | 13899 |
| 380 | Ga0111539_10010427 | 3300009094 | Bacteria | 11694 |
| 381 | Ga0111539_10017167 | 3300009094 | Bacteria | 8959 |
| 382 | Ga0111539_10042960 | 3300009094 | Bacteria | 5423 |
| 383 | Ga0111539_10054412 | 3300009094 | Bacteria | 4762 |
| 384 | Ga0111539_10057964 | 3300009094 | Bacteria | 4597 |
| 385 | Ga0111539_10078245 | 3300009094 | Bacteria | 3891 |
| 386 | Ga0111539_10123247 | 3300009094 | Bacteria | 3038 |
| 387 | Ga0111539_10621651 | 3300009094 | Bacteria | 1258 |
| 388 | Ga0111539_10646306 | 3300009094 | Bacteria | 1232 |
| 389 | Ga0105245_10267491 | 3300009098 | Unclassified | 1666 |
| 390 | Ga0105247_10003020 | 3300009101 | Bacteria | 11147 |
| 391 | Ga0105247_10010076 | 3300009101 | Bacteria | 5726 |
| 392 | Ga0105247_10270811 | 3300009101 | Bacteria | 1168 |
| 393 | Ga0114129_10002862 | 3300009147 | Bacteria | 24132 |
| 394 | Ga0114129_10004893 | 3300009147 | Bacteria | 18907 |
| 395 | Ga0114129_10006748 | 3300009147 | Bacteria | 16297 |
| 396 | Ga0114129_10008062 | 3300009147 | Bacteria | 15009 |
| 397 | Ga0114129_10018292 | 3300009147 | Bacteria | 9981 |
| 398 | Ga0114129_10027396 | 3300009147 | Bacteria | 8068 |
| 399 | Ga0114129_10031782 | 3300009147 | Bacteria | 7463 |
| 400 | Ga0114129_10038284 | 3300009147 | Bacteria | 6766 |
| 401 | Ga0114129_10049334 | 3300009147 | Bacteria | 5914 |
| 402 | Ga0114129_10056630 | 3300009147 | Bacteria | 5490 |
| 403 | Ga0114129_10063676 | 3300009147 | Bacteria | 5148 |
| 404 | Ga0114129_10082166 | 3300009147 | Bacteria | 4477 |
| 405 | Ga0114129_10094153 | 3300009147 | Bacteria | 4149 |
| 406 | Ga0114129_10126682 | 3300009147 | Bacteria | 3510 |
| 407 | Ga0114129_10204942 | 3300009147 | Bacteria | 2669 |
| 408 | Ga0114129_10252394 | 3300009147 | Bacteria | 2367 |
| 409 | Ga0114129_10706218 | 3300009147 | Bacteria | 1295 |
| 410 | Ga0114129_10753893 | 3300009147 | Bacteria | 1246 |
| 411 | Ga0114129_10787619 | 3300009147 | Bacteria | 1214 |
| 412 | Ga0114129_10951071 | 3300009147 | Bacteria | 1085 |
| 413 | Ga0105243_10000238 | 3300009148 | Bacteria | 63019 |
| 414 | Ga0105243_10025094 | 3300009148 | Bacteria | 4552 |
| 415 | Ga0105243_10872003 | 3300009148 | Unclassified | 893 |
| 416 | Ga0105242_10001243 | 3300009176 | Bacteria | 20071 |
| 417 | Ga0105242_10004726 | 3300009176 | Bacteria | 10547 |
| 418 | Ga0105242_10007339 | 3300009176 | Bacteria | 8485 |
| 419 | Ga0105242_10098152 | 3300009176 | Bacteria | 2478 |
| 420 | Ga0105242_10259609 | 3300009176 | Bacteria | 1569 |
| 421 | Ga0105242_10847090 | 3300009176 | Bacteria | 909 |
| 422 | Ga0105248_10013509 | 3300009177 | Bacteria | 8989 |
| 423 | Ga0105248_10017801 | 3300009177 | Bacteria | 7840 |
| 424 | Ga0105248_10056753 | 3300009177 | Bacteria | 4393 |
| 425 | Ga0105248_10081647 | 3300009177 | Bacteria | 3634 |
| 426 | Ga0105248_10126720 | 3300009177 | Bacteria | 2880 |
| 427 | Ga0105248_10139979 | 3300009177 | Bacteria | 2729 |
| 428 | Ga0105248_10151210 | 3300009177 | Bacteria | 2619 |
| 429 | Ga0105248_10271331 | 3300009177 | Bacteria | 1910 |
| 430 | Ga0105248_10811528 | 3300009177 | Unclassified | 1056 |
| 431 | Ga0105248_11395260 | 3300009177 | Bacteria | 793 |
| 432 | Ga0105238_10686821 | 3300009551 | Bacteria | 1035 |
| 433 | Ga0105249_10051517 | 3300009553 | Bacteria | 3755 |
| 434 | Ga0105249_10269044 | 3300009553 | Bacteria | 1697 |
| 435 | Ga0105249_11078758 | 3300009553 | Bacteria | 873 |
| 436 | Ga0157371_10184330 | 3300013102 | Bacteria | 1493 |
| 437 | Ga0157370_10640920 | 3300013104 | Bacteria | 971 |
| 438 | Ga0157369_10337892 | 3300013105 | Bacteria | 1564 |
| 439 | Ga0157374_10064849 | 3300013296 | Bacteria | 3429 |
| 440 | Ga0157374_10496237 | 3300013296 | Unclassified | 1225 |
| 441 | Ga0157374_10504422 | 3300013296 | Bacteria | 1215 |
| 442 | Ga0157374_10554208 | 3300013296 | Unclassified | 1157 |
| 443 | Ga0157378_10002332 | 3300013297 | Bacteria | 16867 |
| 444 | Ga0157378_10174325 | 3300013297 | Bacteria | 2019 |
| 445 | Ga0157378_10659056 | 3300013297 | Bacteria | 1063 |
| 446 | Ga0163162_10102935 | 3300013306 | Bacteria | 2949 |
| 447 | Ga0163162_10465786 | 3300013306 | Bacteria | 1395 |
| 448 | Ga0163162_11271088 | 3300013306 | Bacteria | 836 |
| 449 | Ga0157375_10022418 | 3300013308 | Bacteria | 5813 |
| 450 | Ga0157375_10050333 | 3300013308 | Bacteria | 4086 |
| 451 | Ga0157375_10089852 | 3300013308 | Bacteria | 3129 |
| 452 | Ga0157375_10115922 | 3300013308 | Bacteria | 2782 |
| 453 | Ga0157375_10212801 | 3300013308 | Bacteria | 2091 |
| 454 | Ga0157375_10535202 | 3300013308 | Bacteria | 1334 |
| 455 | Ga0163163_10401399 | 3300014325 | Bacteria | 1429 |
| 456 | Ga0157380_10002955 | 3300014326 | Bacteria | 11565 |
| 457 | Ga0157380_10003616 | 3300014326 | Bacteria | 10632 |
| 458 | Ga0157380_10010138 | 3300014326 | Bacteria | 6772 |
| 459 | Ga0157380_10029391 | 3300014326 | Bacteria | 4201 |
| 460 | Ga0157380_10104200 | 3300014326 | Bacteria | 2369 |
| 461 | Ga0157380_10106662 | 3300014326 | Bacteria | 2345 |
| 462 | Ga0157380_10197607 | 3300014326 | Bacteria | 1781 |
| 463 | Ga0157380_10265843 | 3300014326 | Bacteria | 1561 |
| 464 | Ga0157380_10319912 | 3300014326 | Bacteria | 1438 |
| 465 | Ga0157380_10486371 | 3300014326 | Bacteria | 1195 |
| 466 | Ga0157380_10791525 | 3300014326 | Bacteria | 964 |
| 467 | Ga0157380_11151838 | 3300014326 | Bacteria | 817 |
| 468 | Ga0157380_11331560 | 3300014326 | Bacteria | 766 |
| 469 | Ga0157377_10018169 | 3300014745 | Bacteria | 3652 |
| 470 | Ga0157377_10018864 | 3300014745 | Bacteria | 3593 |
| 471 | Ga0157377_10047355 | 3300014745 | Bacteria | 2408 |
| 472 | Ga0157377_10095111 | 3300014745 | Bacteria | 1766 |
| 473 | Ga0157377_10248787 | 3300014745 | Bacteria | 1151 |
| 474 | Ga0157379_10009913 | 3300014968 | Bacteria | 8299 |
| 475 | Ga0157379_10017365 | 3300014968 | Bacteria | 6340 |
| 476 | Ga0157379_10067559 | 3300014968 | Bacteria | 3195 |
| 477 | Ga0157376_10048960 | 3300014969 | Bacteria | 3499 |
| 478 | Ga0157376_10160959 | 3300014969 | Bacteria | 2035 |
| 479 | Ga0157376_10431110 | 3300014969 | Bacteria | 1281 |
| 480 | Ga0157376_10455653 | 3300014969 | Bacteria | 1249 |
| 481 | Ga0157376_10650086 | 3300014969 | Unclassified | 1055 |
| 482 | Ga0163161_10031367 | 3300017792 | Bacteria | 3787 |
| 483 | Ga0163161_10161833 | 3300017792 | Bacteria | 1707 |
| 484 | Ga0207697_10000575 | 3300025315 | Bacteria | 20854 |
| 485 | Ga0207682_10001469 | 3300025893 | Bacteria | 10886 |
| 486 | Ga0207682_10011353 | 3300025893 | Bacteria | 3478 |
| 487 | Ga0207682_10030408 | 3300025893 | Bacteria | 2163 |
| 488 | Ga0207682_10033322 | 3300025893 | Bacteria | 2073 |
| 489 | Ga0207682_10129069 | 3300025893 | Bacteria | 1127 |
| 490 | Ga0207692_10035866 | 3300025898 | Bacteria | 2413 |
| 491 | Ga0207692_10060517 | 3300025898 | Bacteria | 1959 |
| 492 | Ga0207642_10017132 | 3300025899 | Bacteria | 2748 |
| 493 | Ga0207642_10110274 | 3300025899 | Bacteria | 1400 |
| 494 | Ga0207710_10003937 | 3300025900 | Bacteria | 6552 |
| 495 | Ga0207710_10047460 | 3300025900 | Unclassified | 1920 |
| 496 | Ga0207710_10365696 | 3300025900 | Bacteria | 736 |
| 497 | Ga0207688_10000078 | 3300025901 | Bacteria | 37290 |
| 498 | Ga0207688_10221170 | 3300025901 | Bacteria | 1141 |
| 499 | Ga0207680_10051609 | 3300025903 | Bacteria | 2460 |
| 500 | Ga0207680_10765267 | 3300025903 | Bacteria | 692 |
| 501 | Ga0207685_10011619 | 3300025905 | Bacteria | 2654 |
| 502 | Ga0207685_10107174 | 3300025905 | Bacteria | 1205 |
| 503 | Ga0207645_10002104 | 3300025907 | Bacteria | 15935 |
| 504 | Ga0207645_10002597 | 3300025907 | Bacteria | 14090 |
| 505 | Ga0207645_10007763 | 3300025907 | Bacteria | 7551 |
| 506 | Ga0207645_10128802 | 3300025907 | Bacteria | 1646 |
| 507 | Ga0207643_10000706 | 3300025908 | Bacteria | 20718 |
| 508 | Ga0207643_10084543 | 3300025908 | Bacteria | 1842 |
| 509 | Ga0207684_10000737 | 3300025910 | Bacteria | 38452 |
| 510 | Ga0207684_10031826 | 3300025910 | Bacteria | 4487 |
| 511 | Ga0207684_10142894 | 3300025910 | Bacteria | 2058 |
| 512 | Ga0207684_10296558 | 3300025910 | Unclassified | 1394 |
| 513 | Ga0207684_10681152 | 3300025910 | Bacteria | 875 |
| 514 | Ga0207654_10091248 | 3300025911 | Unclassified | 1857 |
| 515 | Ga0207707_10002734 | 3300025912 | Bacteria | 15763 |
| 516 | Ga0207707_10070129 | 3300025912 | Bacteria | 3054 |
| 517 | Ga0207693_10013276 | 3300025915 | Bacteria | 6645 |
| 518 | Ga0207663_10870600 | 3300025916 | Bacteria | 720 |
| 519 | Ga0207660_10004716 | 3300025917 | Bacteria | 8877 |
| 520 | Ga0207660_10037729 | 3300025917 | Bacteria | 3369 |
| 521 | Ga0207660_10142675 | 3300025917 | Bacteria | 1832 |
| 522 | Ga0207662_10001063 | 3300025918 | Bacteria | 12911 |
| 523 | Ga0207662_10001208 | 3300025918 | Bacteria | 12343 |
| 524 | Ga0207662_10140373 | 3300025918 | Bacteria | 1530 |
| 525 | Ga0207662_10333653 | 3300025918 | Bacteria | 1015 |
| 526 | Ga0207662_10483314 | 3300025918 | Bacteria | 851 |
| 527 | Ga0207657_10060146 | 3300025919 | Bacteria | 3261 |
| 528 | Ga0207657_10093048 | 3300025919 | Bacteria | 2511 |
| 529 | Ga0207649_10018165 | 3300025920 | Bacteria | 3994 |
| 530 | Ga0207649_10029456 | 3300025920 | Bacteria | 3242 |
| 531 | Ga0207652_10124757 | 3300025921 | Bacteria | 2293 |
| 532 | Ga0207646_10000231 | 3300025922 | Bacteria | 76772 |
| 533 | Ga0207646_10000547 | 3300025922 | Bacteria | 49465 |
| 534 | Ga0207646_10127744 | 3300025922 | Bacteria | 2286 |
| 535 | Ga0207646_10611216 | 3300025922 | Unclassified | 978 |
| 536 | Ga0207681_10023929 | 3300025923 | Bacteria | 3913 |
| 537 | Ga0207681_10064590 | 3300025923 | Bacteria | 2528 |
| 538 | Ga0207681_10095334 | 3300025923 | Bacteria | 2134 |
| 539 | Ga0207681_10162286 | 3300025923 | Bacteria | 1686 |
| 540 | Ga0207681_10194009 | 3300025923 | Bacteria | 1556 |
| 541 | Ga0207694_10130066 | 3300025924 | Bacteria | 2017 |
| 542 | Ga0207650_10007478 | 3300025925 | Bacteria | 7445 |
| 543 | Ga0207650_10070542 | 3300025925 | Bacteria | 2626 |
| 544 | Ga0207650_10114607 | 3300025925 | Unclassified | 2091 |
| 545 | Ga0207650_10150803 | 3300025925 | Bacteria | 1834 |
| 546 | Ga0207650_10261694 | 3300025925 | Bacteria | 1403 |
| 547 | Ga0207650_10601054 | 3300025925 | Bacteria | 925 |
| 548 | Ga0207659_10000075 | 3300025926 | Bacteria | 63221 |
| 549 | Ga0207659_10000939 | 3300025926 | Bacteria | 17393 |
| 550 | Ga0207659_10002741 | 3300025926 | Bacteria | 10504 |
| 551 | Ga0207659_10010800 | 3300025926 | Bacteria | 5748 |
| 552 | Ga0207659_10132383 | 3300025926 | Bacteria | 1926 |
| 553 | Ga0207659_10168017 | 3300025926 | Bacteria | 1728 |
| 554 | Ga0207659_10270178 | 3300025926 | Bacteria | 1387 |
| 555 | Ga0207659_10289572 | 3300025926 | Bacteria | 1341 |
| 556 | Ga0207659_10635974 | 3300025926 | Bacteria | 911 |
| 557 | Ga0207659_10870072 | 3300025926 | Bacteria | 775 |
| 558 | Ga0207687_10057635 | 3300025927 | Bacteria | 2730 |
| 559 | Ga0207700_11125101 | 3300025928 | Bacteria | 702 |
| 560 | Ga0207644_10096143 | 3300025931 | Bacteria | 2216 |
| 561 | Ga0207644_10102458 | 3300025931 | Bacteria | 2153 |
| 562 | Ga0207644_10107568 | 3300025931 | Bacteria | 2104 |
| 563 | Ga0207706_10005586 | 3300025933 | Bacteria | 11718 |
| 564 | Ga0207706_10026033 | 3300025933 | Bacteria | 5237 |
| 565 | Ga0207706_10402085 | 3300025933 | Bacteria | 1187 |
| 566 | Ga0207706_10403920 | 3300025933 | Bacteria | 1184 |
| 567 | Ga0207706_10483263 | 3300025933 | Unclassified | 1070 |
| 568 | Ga0207706_10672387 | 3300025933 | Bacteria | 886 |
| 569 | Ga0207686_10004046 | 3300025934 | Bacteria | 7869 |
| 570 | Ga0207686_10015028 | 3300025934 | Bacteria | 4322 |
| 571 | Ga0207686_10032259 | 3300025934 | Bacteria | 3117 |
| 572 | Ga0207686_10237243 | 3300025934 | Bacteria | 1325 |
| 573 | Ga0207709_10005269 | 3300025935 | Bacteria | 7354 |
| 574 | Ga0207670_10000098 | 3300025936 | Bacteria | 60320 |
| 575 | Ga0207670_10018572 | 3300025936 | Bacteria | 4231 |
| 576 | Ga0207670_10018961 | 3300025936 | Bacteria | 4194 |
| 577 | Ga0207670_10064879 | 3300025936 | Bacteria | 2505 |
| 578 | Ga0207670_10114531 | 3300025936 | Bacteria | 1949 |
| 579 | Ga0207670_10153793 | 3300025936 | Bacteria | 1710 |
| 580 | Ga0207670_10281125 | 3300025936 | Bacteria | 1297 |
| 581 | Ga0207669_10038016 | 3300025937 | Bacteria | 2767 |
| 582 | Ga0207669_10095631 | 3300025937 | Bacteria | 1948 |
| 583 | Ga0207669_10377503 | 3300025937 | Bacteria | 1104 |
| 584 | Ga0207669_10411894 | 3300025937 | Bacteria | 1061 |
| 585 | Ga0207704_10006357 | 3300025938 | Bacteria | 5505 |
| 586 | Ga0207704_10145885 | 3300025938 | Bacteria | 1662 |
| 587 | Ga0207704_10173104 | 3300025938 | Bacteria | 1551 |
| 588 | Ga0207704_10883530 | 3300025938 | Bacteria | 751 |
| 589 | Ga0207665_10129988 | 3300025939 | Bacteria | 1786 |
| 590 | Ga0207665_10135890 | 3300025939 | Bacteria | 1749 |
| 591 | Ga0207665_10294556 | 3300025939 | Bacteria | 1211 |
| 592 | Ga0207691_10000209 | 3300025940 | Bacteria | 56763 |
| 593 | Ga0207691_10008047 | 3300025940 | Bacteria | 10134 |
| 594 | Ga0207691_10016035 | 3300025940 | Bacteria | 7118 |
| 595 | Ga0207691_10030425 | 3300025940 | Bacteria | 5044 |
| 596 | Ga0207691_10064712 | 3300025940 | Bacteria | 3312 |
| 597 | Ga0207691_10200556 | 3300025940 | Bacteria | 1737 |
| 598 | Ga0207691_10374381 | 3300025940 | Bacteria | 1216 |
| 599 | Ga0207691_10569750 | 3300025940 | Bacteria | 960 |
| 600 | Ga0207691_10713245 | 3300025940 | Unclassified | 845 |
| 601 | Ga0207711_10007687 | 3300025941 | Bacteria | 9013 |
| 602 | Ga0207711_10076709 | 3300025941 | Bacteria | 2911 |
| 603 | Ga0207711_10174978 | 3300025941 | Bacteria | 1949 |
| 604 | Ga0207711_10691119 | 3300025941 | Bacteria | 951 |
| 605 | Ga0207711_10825436 | 3300025941 | Unclassified | 863 |
| 606 | Ga0207689_10003806 | 3300025942 | Bacteria | 13754 |
| 607 | Ga0207689_10004341 | 3300025942 | Bacteria | 12917 |
| 608 | Ga0207689_10009073 | 3300025942 | Bacteria | 8612 |
| 609 | Ga0207689_10111980 | 3300025942 | Bacteria | 2243 |
| 610 | Ga0207689_10182618 | 3300025942 | Bacteria | 1730 |
| 611 | Ga0207689_10578185 | 3300025942 | Unclassified | 944 |
| 612 | Ga0207661_10053538 | 3300025944 | Bacteria | 3230 |
| 613 | Ga0207661_10723134 | 3300025944 | Bacteria | 916 |
| 614 | Ga0207679_10002301 | 3300025945 | Bacteria | 11774 |
| 615 | Ga0207679_10003057 | 3300025945 | Bacteria | 10362 |
| 616 | Ga0207679_10004433 | 3300025945 | Bacteria | 8744 |
| 617 | Ga0207679_10024651 | 3300025945 | Bacteria | 4126 |
| 618 | Ga0207679_10285976 | 3300025945 | Bacteria | 1416 |
| 619 | Ga0207667_10175780 | 3300025949 | Bacteria | 2200 |
| 620 | Ga0207651_10000027 | 3300025960 | Bacteria | 69165 |
| 621 | Ga0207651_10001655 | 3300025960 | Bacteria | 10222 |
| 622 | Ga0207651_10139926 | 3300025960 | Bacteria | 1868 |
| 623 | Ga0207651_10233236 | 3300025960 | Unclassified | 1495 |
| 624 | Ga0207651_10580045 | 3300025960 | Unclassified | 978 |
| 625 | Ga0207712_10411109 | 3300025961 | Bacteria | 1139 |
| 626 | Ga0207668_10203382 | 3300025972 | Bacteria | 1579 |
| 627 | Ga0207668_10804354 | 3300025972 | Bacteria | 832 |
| 628 | Ga0207640_10620184 | 3300025981 | Bacteria | 918 |
| 629 | Ga0207640_10896771 | 3300025981 | Bacteria | 774 |
| 630 | Ga0207658_10011910 | 3300025986 | Bacteria | 5930 |
| 631 | Ga0207658_10092466 | 3300025986 | Bacteria | 2350 |
| 632 | Ga0207658_10374305 | 3300025986 | Bacteria | 1246 |
| 633 | Ga0207677_10232312 | 3300026023 | Bacteria | 1486 |
| 634 | Ga0207677_10394383 | 3300026023 | Bacteria | 1172 |
| 635 | Ga0207677_10423021 | 3300026023 | Bacteria | 1135 |
| 636 | Ga0207703_10010388 | 3300026035 | Bacteria | 7283 |
| 637 | Ga0207703_10015685 | 3300026035 | Bacteria | 5909 |
| 638 | Ga0207703_10053921 | 3300026035 | Bacteria | 3269 |
| 639 | Ga0207703_10236358 | 3300026035 | Bacteria | 1641 |
| 640 | Ga0207703_10326843 | 3300026035 | Bacteria | 1406 |
| 641 | Ga0207678_10011052 | 3300026067 | Bacteria | 7930 |
| 642 | Ga0207678_10029975 | 3300026067 | Bacteria | 4750 |
| 643 | Ga0207708_10000853 | 3300026075 | Bacteria | 22965 |
| 644 | Ga0207708_10001575 | 3300026075 | Bacteria | 17042 |
| 645 | Ga0207708_10002902 | 3300026075 | Bacteria | 12636 |
| 646 | Ga0207708_10004792 | 3300026075 | Bacteria | 9964 |
| 647 | Ga0207708_10320605 | 3300026075 | Bacteria | 1265 |
| 648 | Ga0207708_10337523 | 3300026075 | Bacteria | 1233 |
| 649 | Ga0207708_10441513 | 3300026075 | Bacteria | 1082 |
| 650 | Ga0207708_10590216 | 3300026075 | Unclassified | 940 |
| 651 | Ga0207641_10005189 | 3300026088 | Bacteria | 11136 |
| 652 | Ga0207641_10029000 | 3300026088 | Bacteria | 4575 |
| 653 | Ga0207641_10147973 | 3300026088 | Bacteria | 2125 |
| 654 | Ga0207641_10465013 | 3300026088 | Bacteria | 1224 |
| 655 | Ga0207641_10540184 | 3300026088 | Bacteria | 1136 |
| 656 | Ga0207641_10718470 | 3300026088 | Bacteria | 985 |
| 657 | Ga0207641_10781211 | 3300026088 | Bacteria | 944 |
| 658 | Ga0207641_11090744 | 3300026088 | Bacteria | 797 |
| 659 | Ga0207648_10000543 | 3300026089 | Bacteria | 42056 |
| 660 | Ga0207648_10001158 | 3300026089 | Bacteria | 29542 |
| 661 | Ga0207648_10004219 | 3300026089 | Bacteria | 14853 |
| 662 | Ga0207648_10005943 | 3300026089 | Bacteria | 12209 |
| 663 | Ga0207648_10203058 | 3300026089 | Bacteria | 1758 |
| 664 | Ga0207648_10276221 | 3300026089 | Unclassified | 1502 |
| 665 | Ga0207648_10549894 | 3300026089 | Bacteria | 1060 |
| 666 | Ga0207648_10637825 | 3300026089 | Bacteria | 984 |
| 667 | Ga0207676_10009537 | 3300026095 | Bacteria | 6910 |
| 668 | Ga0207676_10020875 | 3300026095 | Bacteria | 4799 |
| 669 | Ga0207676_10070443 | 3300026095 | Bacteria | 2804 |
| 670 | Ga0207676_10316048 | 3300026095 | Bacteria | 1432 |
| 671 | Ga0207676_10648925 | 3300026095 | Bacteria | 1018 |
| 672 | Ga0207674_10029412 | 3300026116 | Bacteria | 5784 |
| 673 | Ga0207674_10426578 | 3300026116 | Bacteria | 1281 |
| 674 | Ga0207675_100004884 | 3300026118 | Bacteria | 12928 |
| 675 | Ga0207675_100025879 | 3300026118 | Bacteria | 5459 |
| 676 | Ga0207675_100126472 | 3300026118 | Bacteria | 2421 |
| 677 | Ga0207675_100992494 | 3300026118 | Bacteria | 858 |
| 678 | Ga0207683_10001107 | 3300026121 | Bacteria | 24547 |
| 679 | Ga0207683_10002196 | 3300026121 | Bacteria | 17160 |
| 680 | Ga0207683_10011362 | 3300026121 | Bacteria | 7597 |
| 681 | Ga0207683_10017195 | 3300026121 | Bacteria | 6159 |
| 682 | Ga0207683_10031021 | 3300026121 | Bacteria | 4637 |
| 683 | Ga0207683_10075220 | 3300026121 | Bacteria | 2989 |
| 684 | Ga0207683_10116045 | 3300026121 | Bacteria | 2400 |
| 685 | Ga0207683_10187113 | 3300026121 | Bacteria | 1879 |
| 686 | Ga0207698_10304153 | 3300026142 | Bacteria | 1486 |
| 687 | Ga0209969_1000120 | 3300027360 | Bacteria | 9962 |
| 688 | Ga0209967_1000144 | 3300027364 | Bacteria | 9733 |
| 689 | Ga0209967_1003541 | 3300027364 | Bacteria | 2056 |
| 690 | Ga0209981_1000003 | 3300027378 | Bacteria | 30420 |
| 691 | Ga0209996_1000058 | 3300027395 | Bacteria | 15054 |
| 692 | Ga0209984_1000444 | 3300027424 | Bacteria | 4509 |
| 693 | Ga0209984_1010133 | 3300027424 | Unclassified | 1205 |
| 694 | Ga0210000_1000024 | 3300027462 | Bacteria | 23307 |
| 695 | Ga0209995_1000087 | 3300027471 | Bacteria | 14662 |
| 696 | Ga0209995_1018580 | 3300027471 | Bacteria | 1147 |
| 697 | Ga0209968_1000019 | 3300027526 | Bacteria | 32234 |
| 698 | Ga0209999_1000055 | 3300027543 | Bacteria | 12672 |
| 699 | Ga0209982_1001564 | 3300027552 | Bacteria | 3145 |
| 700 | Ga0209970_1000013 | 3300027614 | Bacteria | 24097 |
| 701 | Ga0210002_1000024 | 3300027617 | Bacteria | 23321 |
| 702 | Ga0209983_1001530 | 3300027665 | Bacteria | 5144 |
| 703 | Ga0209983_1028790 | 3300027665 | Bacteria | 1180 |
| 704 | Ga0209971_1000232 | 3300027682 | Bacteria | 15872 |
| 705 | Ga0209966_1000331 | 3300027695 | Bacteria | 14989 |
| 706 | Ga0209998_10000094 | 3300027717 | Bacteria | 35182 |
| 707 | Ga0209998_10095011 | 3300027717 | Bacteria | 734 |
| 708 | Ga0209974_10001696 | 3300027876 | Bacteria | 7979 |
| 709 | Ga0209974_10028942 | 3300027876 | Bacteria | 1835 |
| 710 | Ga0209974_10150074 | 3300027876 | Unclassified | 841 |
| 711 | Ga0207428_10000089 | 3300027907 | Bacteria | 127333 |
| 712 | Ga0207428_10000529 | 3300027907 | Bacteria | 45592 |
| 713 | Ga0207428_10005145 | 3300027907 | Bacteria | 12252 |
| 714 | Ga0207428_10006577 | 3300027907 | Bacteria | 10711 |
| 715 | Ga0207428_10009135 | 3300027907 | Bacteria | 8908 |
| 716 | Ga0207428_10036379 | 3300027907 | Bacteria | 4015 |
| 717 | Ga0207428_10041262 | 3300027907 | Bacteria | 3737 |
| 718 | Ga0207428_10087031 | 3300027907 | Bacteria | 2431 |
| 719 | Ga0207428_10096747 | 3300027907 | Bacteria | 2286 |
| 720 | Ga0268266_10261906 | 3300028379 | Bacteria | 1603 |
| 721 | Ga0268266_10356310 | 3300028379 | Bacteria | 1376 |
| 722 | Ga0268266_10773398 | 3300028379 | Unclassified | 927 |
| 723 | Ga0268265_10014428 | 3300028380 | Bacteria | 5383 |
| 724 | Ga0268265_10033808 | 3300028380 | Bacteria | 3720 |
| 725 | Ga0268265_10047123 | 3300028380 | Bacteria | 3228 |
| 726 | Ga0268265_10468822 | 3300028380 | Bacteria | 1180 |
| 727 | Ga0268265_10779926 | 3300028380 | Bacteria | 930 |
| 728 | Ga0268265_10886111 | 3300028380 | Bacteria | 875 |
| 729 | Ga0268264_10042594 | 3300028381 | Bacteria | 3759 |
| 730 | Ga0268264_10058684 | 3300028381 | Bacteria | 3223 |
| 731 | Ga0268264_10073918 | 3300028381 | Bacteria | 2894 |
| 732 | Ga0265332_10114114 | 3300031238 | Bacteria | 1137 |
| 733 | Ga0307408_100013769 | 3300031548 | Bacteria | 5368 |
| 734 | Ga0307408_100173814 | 3300031548 | Unclassified | 1722 |
| 735 | Ga0307408_100278417 | 3300031548 | Bacteria | 1392 |
| 736 | Ga0307405_10586391 | 3300031731 | Bacteria | 907 |
| 737 | Ga0307413_10596162 | 3300031824 | Bacteria | 903 |
| 738 | Ga0307410_10296321 | 3300031852 | Bacteria | 1275 |
| 739 | Ga0307412_10034734 | 3300031911 | Bacteria | 3215 |
| 740 | Ga0307409_100370716 | 3300031995 | Bacteria | 1358 |
| 741 | Ga0307416_100052642 | 3300032002 | Bacteria | 3261 |
| 742 | Ga0307416_100105257 | 3300032002 | Unclassified | 2469 |
| 743 | Ga0307416_100138240 | 3300032002 | Bacteria | 2209 |
| 744 | Ga0307416_100390432 | 3300032002 | Bacteria | 1426 |
| 745 | Ga0307416_100497949 | 3300032002 | Bacteria | 1282 |
| 746 | Ga0307416_100656294 | 3300032002 | Bacteria | 1134 |
| 747 | Ga0307414_10050348 | 3300032004 | Bacteria | 2885 |
| 748 | Ga0307411_10474862 | 3300032005 | Bacteria | 1052 |
| 749 | Ga0307415_100077488 | 3300032126 | Unclassified | 2361 |
| 750 | Ga0307415_100126033 | 3300032126 | Bacteria | 1930 |
| 751 | Ga0307415_100358610 | 3300032126 | Bacteria | 1230 |
| 752 | Ga0373958_0034645 | 3300034819 | Bacteria | 1007 |
| 753 | Ga0373958_0042935 | 3300034819 | Bacteria | 930 |
| 754 | Ga0373926_0030225 | 3300035083 | Unclassified | 1907 |
| 755 | Ga0373926_0084736 | 3300035083 | Bacteria | 1175 |
| 756 | Ga0373940_0106412 | 3300035088 | Bacteria | 857 |
| 757 | Ga0373949_0111813 | 3300035090 | Bacteria | 759 |
| 758 | Ga0373949_0133286 | 3300035090 | Unclassified | 706 |
| 759 | Ga0373952_0012701 | 3300035092 | Bacteria | 1661 |
| 760 | Ga0373923_0236918 | 3300035111 | Bacteria | 852 |
| 761 | Ga0373939_0177465 | 3300035114 | Unclassified | 792 |
| 762 | Ga0373941_0098558 | 3300035115 | Unclassified | 1014 |
| 763 | Ga0373941_0149254 | 3300035115 | Unclassified | 856 |
| 764 | Ga0373945_0023198 | 3300035116 | Bacteria | 2143 |
| 765 | Ga0373960_0009345 | 3300035121 | Bacteria | 2373 |
| 766 | Ga0373943_0223882 | 3300035170 | Unclassified | 1049 |
| 767 | Ga0373931_0009512 | 3300035691 | Bacteria | 4647 |
| 768 | Ga0373927_0525940 | 3300035695 | Bacteria | 782 |
| 769 | Ga0373933_0048168 | 3300035724 | Bacteria | 2537 |
| 770 | Ga0373937_0086289 | 3300036401 | Bacteria | 2905 |
| 771 | Ga0373937_0103302 | 3300036401 | Bacteria | 2647 |
| 772 | Ga0373937_0285603 | 3300036401 | Bacteria | 1559 |
| 773 | Ga0373937_0631625 | 3300036401 | Bacteria | 1016 |
| 774 | Ga0373937_0631680 | 3300036401 | Bacteria | 1016 |
| 775 | Ga0373925_0027581 | 3300037068 | Bacteria | 4157 |
| 776 | Ga0373925_0552846 | 3300037068 | Bacteria | 947 |
| 777 | Ga0400490_10325 | 3300038726 | Bacteria | 52681 |
| 778 | Ga0400491_11348 | 3300038727 | Bacteria | 7348 |
| 779 | Ga0400489_76132 | 3300039093 | Bacteria | 1104 |
| 780 | Ga0439438_058205 | 3300041405 | Bacteria | 971 |
| 781 | Ga0439447_010933 | 3300041407 | Bacteria | 2673 |
| 782 | Ga0439453_0003992 | 3300041408 | Bacteria | 2167 |
| 783 | Ga0439461_0035251 | 3300041410 | Bacteria | 1061 |
| 784 | Ga0451853_1940769 | 3300041512 | Unclassified | 1591 |
| 785 | Ga0451853_2329500 | 3300041512 | Bacteria | 1103 |
| 786 | Ga0439433_0017488 | 3300041999 | Bacteria | 1592 |
| 787 | Ga0439441_003072 | 3300042001 | Bacteria | 2420 |
| 788 | Ga0439448_0035817 | 3300042005 | Bacteria | 1591 |
| 789 | Ga0439432_035110 | 3300042006 | Bacteria | 1607 |
| 790 | Ga0439450_000289 | 3300042008 | Bacteria | 6222 |
| 791 | Ga0439450_019708 | 3300042008 | Bacteria | 1432 |
| 792 | Ga0439450_125750 | 3300042008 | Bacteria | 662 |
| 793 | Ga0439451_016701 | 3300042009 | Bacteria | 1478 |
| 794 | Ga0439452_013979 | 3300042010 | Bacteria | 2240 |
| 795 | Ga0439456_015300 | 3300042013 | Unclassified | 1602 |
| 796 | Ga0439456_056997 | 3300042013 | Bacteria | 857 |
| 797 | Ga0450923_016385 | 3300042125 | Bacteria | 1395 |
| 798 | Ga0450923_065484 | 3300042125 | Archaea | 799 |
| 799 | Ga0450896_002429 | 3300042133 | Bacteria | 2402 |
| 800 | Ga0450896_015549 | 3300042133 | Bacteria | 1090 |
| 801 | Ga0439446_0045893 | 3300042156 | Bacteria | 1296 |
| 802 | Ga0439446_0068646 | 3300042156 | Bacteria | 1081 |
| 803 | Ga0450909_027822 | 3300042185 | Bacteria | 854 |
| 804 | Ga0439434_0003138 | 3300042435 | Bacteria | 4858 |
| 805 | Ga0439434_0110659 | 3300042435 | Bacteria | 890 |
| 806 | Ga0439434_0115256 | 3300042435 | Bacteria | 873 |
| 807 | Ga0439435_0021616 | 3300042436 | Bacteria | 1672 |
| 808 | Ga0439435_0185312 | 3300042436 | Bacteria | 681 |
| 809 | Ga0439460_0076306 | 3300042461 | Unclassified | 1045 |
| 810 | Ga0451577_0000099 | 3300042876 | Bacteria | 191842 |
| 811 | Ga0451577_0010642 | 3300042876 | Bacteria | 8765 |
| 812 | Ga0451577_0035953 | 3300042876 | Bacteria | 4462 |
| 813 | Ga0451577_0039088 | 3300042876 | Bacteria | 4264 |
| 814 | Ga0451577_0091136 | 3300042876 | Bacteria | 2721 |
| 815 | Ga0451577_0179114 | 3300042876 | Bacteria | 1911 |
| 816 | Ga0439440_0063986 | 3300042993 | Unclassified | 944 |
| 817 | Ga0453683_0105451 | 3300044673 | Unclassified | 1770 |
| 818 | Ga0453684_0000350 | 3300044712 | Bacteria | 191841 |
| 819 | Ga0453684_0011762 | 3300044712 | Bacteria | 14591 |
| 820 | Ga0453684_0027518 | 3300044712 | Bacteria | 8150 |
| 821 | Ga0453684_0039023 | 3300044712 | Bacteria | 6477 |
| 822 | Ga0453684_0143678 | 3300044712 | Bacteria | 2845 |
| 823 | Ga0451576_0000471 | 3300045051 | Bacteria | 91500 |
| 824 | Ga0451576_0005198 | 3300045051 | Bacteria | 16438 |
| 825 | Ga0451576_0021687 | 3300045051 | Bacteria | 6978 |
| 826 | Ga0451576_0135313 | 3300045051 | Bacteria | 2569 |
| 827 | Ga0451576_0359059 | 3300045051 | Bacteria | 1526 |
| 828 | Ga0495629_0014650 | 3300046459 | Bacteria | 5640 |
| 829 | Ga0495594_0018424 | 3300046499 | Bacteria | 3697 |
| 830 | Ga0495594_0025661 | 3300046499 | Unclassified | 3168 |
| 831 | Ga0495594_0052839 | 3300046499 | Bacteria | 2237 |
| 832 | Ga0495628_0302254 | 3300046516 | Unclassified | 1184 |
| 833 | Ga0495628_0406239 | 3300046516 | Bacteria | 994 |
| 834 | Ga0495652_0417177 | 3300046529 | Bacteria | 947 |
| 835 | Ga0495640_0332069 | 3300046533 | Unclassified | 940 |
| 836 | Ga0495586_0338789 | 3300046535 | Bacteria | 863 |
| 837 | Ga0495598_0027179 | 3300046537 | Bacteria | 1576 |
| 838 | Ga0495598_0161640 | 3300046537 | Bacteria | 788 |
| 839 | Ga0495621_0000253 | 3300046539 | Bacteria | 12748 |
| 840 | Ga0495633_0155955 | 3300046558 | Bacteria | 1054 |
| 841 | Ga0495659_0017881 | 3300046664 | Bacteria | 2356 |
| 842 | Ga0495599_0363725 | 3300046678 | Bacteria | 866 |
| 843 | Ga0495647_0184952 | 3300046681 | Bacteria | 908 |
| 844 | Ga0495658_0018821 | 3300046683 | Bacteria | 3597 |
| 845 | Ga0495670_0254419 | 3300046691 | Bacteria | 937 |
| 846 | Ga0495581_0010104 | 3300047315 | Bacteria | 5461 |
| 847 | Ga0495636_0066656 | 3300047318 | Bacteria | 1531 |
| 848 | Ga0495672_0000911 | 3300047320 | Bacteria | 30934 |
| 849 | Ga0495676_0198153 | 3300047321 | Bacteria | 1397 |
| 850 | Ga0495614_0080214 | 3300048089 | Bacteria | 1413 |
| 851 | Ga0496101_0398909 | 3300048904 | Bacteria | 1083 |
| 852 | Ga0496104_0076988 | 3300048907 | Bacteria | 3178 |
| 853 | Ga0496104_0208295 | 3300048907 | Bacteria | 1867 |
| 854 | Ga0496105_0886466 | 3300048908 | Bacteria | 673 |
| 855 | Ga0496106_0308293 | 3300048909 | Bacteria | 1270 |
| 856 | Ga0496106_0417224 | 3300048909 | Bacteria | 1079 |
| 857 | Ga0496108_0082559 | 3300048911 | Bacteria | 2725 |
| 858 | Ga0496108_0685324 | 3300048911 | Bacteria | 889 |
| 859 | Ga0496109_0222921 | 3300048912 | Unclassified | 1773 |
| 860 | Ga0496110_0035808 | 3300048913 | Bacteria | 4309 |
| 861 | Ga0496112_0005329 | 3300048915 | Bacteria | 11101 |
| 862 | Ga0496112_0005642 | 3300048915 | Bacteria | 10865 |
| 863 | Ga0496112_0110221 | 3300048915 | Bacteria | 2723 |
| 864 | Ga0496112_0435803 | 3300048915 | Bacteria | 1249 |
| 865 | Ga0496113_0049333 | 3300048916 | Bacteria | 3134 |
| 866 | Ga0496113_0462915 | 3300048916 | Bacteria | 1019 |
| 867 | Ga0496114_0052718 | 3300048917 | Bacteria | 3389 |
| 868 | Ga0501291_000488 | 3300049514 | Bacteria | 4616 |
| 869 | Ga0501293_004272 | 3300049516 | Bacteria | 1123 |
| 870 | Ga0501295_000527 | 3300049518 | Bacteria | 3586 |
| 871 | Ga0501298_000073 | 3300049521 | Bacteria | 11007 |
| 872 | Ga0501298_032825 | 3300049521 | Bacteria | 1026 |
| 873 | Ga0501299_000048 | 3300049522 | Bacteria | 13201 |
| 874 | Ga0501299_023155 | 3300049522 | Unclassified | 1150 |
| 875 | Ga0501300_000939 | 3300049523 | Bacteria | 4450 |
| 876 | Ga0501301_000833 | 3300049524 | Bacteria | 1917 |
| 877 | Ga0501303_001510 | 3300049526 | Bacteria | 1739 |
| 878 | Ga0501031_0021701 | 3300049568 | Bacteria | 4186 |
| 879 | Ga0501031_0342664 | 3300049568 | Unclassified | 967 |
| 880 | Ga0501033_0091133 | 3300049570 | Bacteria | 2230 |
| 881 | Ga0501034_0468185 | 3300049571 | Bacteria | 1176 |
| 882 | Ga0501036_0301083 | 3300049572 | Bacteria | 1341 |
| 883 | Ga0501036_0341214 | 3300049572 | Bacteria | 1251 |
| 884 | Ga0501036_0437191 | 3300049572 | Unclassified | 1090 |
| 885 | Ga0501038_0254514 | 3300049574 | Bacteria | 1390 |
| 886 | Ga0501039_0127983 | 3300049575 | Unclassified | 1993 |
| 887 | Ga0501039_0458174 | 3300049575 | Bacteria | 1001 |
| 888 | Ga0501039_0629334 | 3300049575 | Unclassified | 840 |
| 889 | Ga0501040_0011021 | 3300049576 | Bacteria | 5910 |
| 890 | Ga0501040_0013239 | 3300049576 | Bacteria | 5426 |
| 891 | Ga0501040_0128933 | 3300049576 | Bacteria | 1778 |
| 892 | Ga0501041_0018990 | 3300049577 | Bacteria | 4097 |
| 893 | Ga0501041_0069816 | 3300049577 | Bacteria | 2156 |
| 894 | Ga0501041_0113525 | 3300049577 | Unclassified | 1682 |
| 895 | Ga0501041_0171110 | 3300049577 | Bacteria | 1359 |
| 896 | Ga0501041_0173713 | 3300049577 | Bacteria | 1348 |
| 897 | Ga0501042_0106405 | 3300049578 | Bacteria | 2019 |
| 898 | Ga0501042_0197623 | 3300049578 | Bacteria | 1450 |
| 899 | Ga0501042_0237533 | 3300049578 | Bacteria | 1315 |
| 900 | Ga0501042_0245446 | 3300049578 | Bacteria | 1292 |
| 901 | Ga0501046_0298905 | 3300049580 | Bacteria | 1176 |
| 902 | Ga0501048_0064134 | 3300049582 | Bacteria | 2598 |
| 903 | Ga0501048_0191872 | 3300049582 | Bacteria | 1448 |
| 904 | Ga0501048_0197359 | 3300049582 | Bacteria | 1426 |
| 905 | Ga0501048_0280676 | 3300049582 | Bacteria | 1184 |
| 906 | Ga0501068_0018839 | 3300049584 | Bacteria | 4000 |
| 907 | Ga0501071_0120294 | 3300049587 | Bacteria | 1946 |
| 908 | Ga0501071_0305490 | 3300049587 | Unclassified | 1206 |
| 909 | Ga0501072_0235406 | 3300049588 | Bacteria | 1458 |
| 910 | Ga0501072_0556800 | 3300049588 | Bacteria | 905 |
| 911 | Ga0501073_0002831 | 3300049589 | Bacteria | 13000 |
| 912 | Ga0501073_0055066 | 3300049589 | Bacteria | 2784 |
| 913 | Ga0501074_0201538 | 3300049590 | Bacteria | 1418 |
| 914 | Ga0501075_0035944 | 3300049591 | Bacteria | 3696 |
| 915 | Ga0501075_0291361 | 3300049591 | Unclassified | 1243 |
| 916 | Ga0501075_0413234 | 3300049591 | Bacteria | 1029 |
| 917 | Ga0501076_0018458 | 3300049592 | Bacteria | 5318 |
| 918 | Ga0501076_0107571 | 3300049592 | Bacteria | 2252 |
| 919 | Ga0501076_0232805 | 3300049592 | Bacteria | 1506 |
| 920 | Ga0501076_0242849 | 3300049592 | Bacteria | 1473 |
| 921 | Ga0501076_0458420 | 3300049592 | Unclassified | 1050 |
| 922 | Ga0501076_0464334 | 3300049592 | Unclassified | 1042 |
| 923 | Ga0501076_0776991 | 3300049592 | Bacteria | 790 |
| 924 | Ga0501077_0014054 | 3300049593 | Bacteria | 5022 |
| 925 | Ga0501077_0025415 | 3300049593 | Bacteria | 3762 |
| 926 | Ga0501077_0437545 | 3300049593 | Unclassified | 837 |
| 927 | Ga0501199_000966 | 3300049650 | Bacteria | 2575 |
| 928 | Ga0501202_002220 | 3300049652 | Bacteria | 3241 |
| 929 | Ga0501202_102510 | 3300049652 | Bacteria | 699 |
| 930 | Ga0501208_004521 | 3300049655 | Bacteria | 1644 |
| 931 | Ga0501209_000634 | 3300049656 | Bacteria | 4353 |
| 932 | Ga0501217_010982 | 3300049661 | Bacteria | 1996 |
| 933 | Ga0501217_044275 | 3300049661 | Bacteria | 1143 |
| 934 | Ga0501227_077089 | 3300049665 | Bacteria | 871 |
| 935 | Ga0501233_001024 | 3300049668 | Bacteria | 4752 |
| 936 | Ga0501235_005843 | 3300049669 | Bacteria | 2679 |
| 937 | Ga0501236_025732 | 3300049670 | Bacteria | 901 |
| 938 | Ga0501243_001231 | 3300049675 | Bacteria | 3669 |
| 939 | Ga0501246_000121 | 3300049676 | Bacteria | 4745 |
| 940 | Ga0501249_032973 | 3300049679 | Bacteria | 1159 |
| 941 | Ga0501251_000290 | 3300049681 | Bacteria | 4440 |
| 942 | Ga0501256_005709 | 3300049685 | Bacteria | 1104 |
| 943 | Ga0501257_011113 | 3300049686 | Bacteria | 2052 |
| 944 | Ga0501261_004095 | 3300049690 | Bacteria | 1793 |
| 945 | Ga0501221_002583 | 3300049704 | Bacteria | 2986 |
| 946 | Ga0501225_0020194 | 3300049705 | Bacteria | 1841 |
| 947 | Ga0501229_000424 | 3300049706 | Bacteria | 4772 |
| 948 | Ga0501234_000290 | 3300049707 | Bacteria | 7353 |
| 949 | Ga0501079_0048048 | 3300049741 | Bacteria | 3293 |
| 950 | Ga0501079_0089110 | 3300049741 | Bacteria | 2389 |
| 951 | Ga0501079_0115525 | 3300049741 | Bacteria | 2086 |
| 952 | Ga0501079_0486125 | 3300049741 | Unclassified | 970 |
| 953 | Ga0501080_0062248 | 3300049742 | Bacteria | 3473 |
| 954 | Ga0501080_0085095 | 3300049742 | Bacteria | 2938 |
| 955 | Ga0501080_0872456 | 3300049742 | Bacteria | 786 |
| 956 | Ga0501081_0090955 | 3300049743 | Bacteria | 2146 |
| 957 | Ga0501081_0160934 | 3300049743 | Bacteria | 1618 |
| 958 | Ga0501081_1037128 | 3300049743 | Bacteria | 620 |
| 959 | Ga0501263_026085 | 3300049760 | Bacteria | 807 |
| 960 | Ga0501264_000674 | 3300049761 | Bacteria | 4684 |
| 961 | Ga0501266_001401 | 3300049763 | Bacteria | 3079 |
| 962 | Ga0501278_001930 | 3300049774 | Bacteria | 1459 |
| 963 | Ga0501279_002809 | 3300049775 | Bacteria | 2270 |
| 964 | Ga0501281_00924 | 3300049777 | Bacteria | 2474 |
| 965 | Ga0501283_004328 | 3300049779 | Bacteria | 1914 |
| 966 | Ga0501283_007596 | 3300049779 | Bacteria | 1547 |
| 967 | Ga0501045_0258946 | 3300049824 | Bacteria | 1295 |
| 968 | Ga0501045_0621411 | 3300049824 | Unclassified | 799 |
| 969 | nmdc:mga05p37_1214327_c1 | 3300050507 | Bacteria | 778 |
| 970 | nmdc:mga05p37_127165_c1 | 3300050507 | Bacteria | 3129 |
| 971 | nmdc:mga05p37_156259_c1 | 3300050507 | Bacteria | 2787 |
| 972 | nmdc:mga05p37_176866_c1 | 3300050507 | Bacteria | 2599 |
| 973 | nmdc:mga05p37_193021_c1 | 3300050507 | Bacteria | 2471 |
| 974 | nmdc:mga05p37_2169_c1 | 3300050507 | Bacteria | 22888 |
| 975 | nmdc:mga05p37_30866_c1 | 3300050507 | Bacteria | 6541 |
| 976 | nmdc:mga05p37_35207_c1 | 3300050507 | Bacteria | 6138 |
| 977 | nmdc:mga05p37_376704_c1 | 3300050507 | Bacteria | 1664 |
| 978 | nmdc:mga05p37_411232_c2 | 3300050507 | Bacteria | 1182 |
| 979 | nmdc:mga05p37_53643_c2 | 3300050507 | Bacteria | 4487 |
| 980 | nmdc:mga05p37_6745_c1 | 3300050507 | Bacteria | 13538 |
| 981 | nmdc:mga05p37_74645_c1 | 3300050507 | Bacteria | 4174 |
| 982 | nmdc:mga05p37_74813_c1 | 3300050507 | Bacteria | 4169 |
| 983 | nmdc:mga05p37_75048_c1 | 3300050507 | Bacteria | 4162 |
| 984 | nmdc:mga05p37_760502_c1 | 3300050507 | Unclassified | 1066 |
| 985 | nmdc:mga09592_123314_c1 | 3300050508 | Bacteria | 2227 |
| 986 | nmdc:mga09592_142368_c1 | 3300050508 | Bacteria | 2067 |
| 987 | nmdc:mga09592_160271_c1 | 3300050508 | Bacteria | 1943 |
| 988 | nmdc:mga09592_397043_c1 | 3300050508 | Bacteria | 1192 |
| 989 | nmdc:mga09592_477817_c1 | 3300050508 | Bacteria | 1074 |
| 990 | nmdc:mga09592_4935_c1 | 3300050508 | Bacteria | 10818 |
| 991 | nmdc:mga09592_57742_c1 | 3300050508 | Bacteria | 3281 |
| 992 | nmdc:mga0qj67_116349_c1 | 3300050509 | Bacteria | 2160 |
| 993 | nmdc:mga0qj67_212178_c1 | 3300050509 | Bacteria | 1572 |
| 994 | nmdc:mga0qj67_256855_c1 | 3300050509 | Bacteria | 1418 |
| 995 | nmdc:mga0qj67_8816_c1 | 3300050509 | Bacteria | 7485 |
| 996 | nmdc:mga06r32_1105884_c1 | 3300050510 | Bacteria | 741 |
| 997 | nmdc:mga06r32_1114373_c1 | 3300050510 | Unclassified | 738 |
| 998 | nmdc:mga06r32_1232812_c1 | 3300050510 | Unclassified | 693 |
| 999 | nmdc:mga06r32_185062_c1 | 3300050510 | Bacteria | 2069 |
| 1000 | nmdc:mga06r32_55337_c1 | 3300050510 | Bacteria | 3805 |
| 1001 | nmdc:mga06r32_58087_c1 | 3300050510 | Bacteria | 3718 |
| 1002 | nmdc:mga08y16_1340_c1 | 3300050511 | Bacteria | 24552 |
| 1003 | nmdc:mga08y16_1540_c1 | 3300050511 | Bacteria | 23195 |
| 1004 | nmdc:mga08y16_159603_c1 | 3300050511 | Bacteria | 2343 |
| 1005 | nmdc:mga08y16_2229_c1 | 3300050511 | Bacteria | 19859 |
| 1006 | nmdc:mga08y16_244510_c1 | 3300050511 | Bacteria | 1854 |
| 1007 | nmdc:mga08y16_2595_c1 | 3300050511 | Bacteria | 18556 |
| 1008 | nmdc:mga08y16_45702_c1 | 3300050511 | Bacteria | 4587 |
| 1009 | nmdc:mga08y16_55323_c1 | 3300050511 | Bacteria | 4147 |
| 1010 | nmdc:mga08y16_7280_c1 | 3300050511 | Bacteria | 11614 |
| 1011 | nmdc:mga08y16_75653_c1 | 3300050511 | Bacteria | 3510 |
| 1012 | nmdc:mga0n895_108093_c1 | 3300050512 | Unclassified | 2796 |
| 1013 | nmdc:mga0n895_14984_c1 | 3300050512 | Bacteria | 7062 |
| 1014 | nmdc:mga0n895_1500_c1 | 3300050512 | Bacteria | 17509 |
| 1015 | nmdc:mga0n895_18994_c1 | 3300050512 | Bacteria | 6377 |
| 1016 | nmdc:mga0n895_223446_c1 | 3300050512 | Bacteria | 1911 |
| 1017 | nmdc:mga0n895_291448_c1 | 3300050512 | Bacteria | 1655 |
| 1018 | nmdc:mga0n895_308498_c1 | 3300050512 | Bacteria | 1604 |
| 1019 | nmdc:mga0n895_378447_c1 | 3300050512 | Unclassified | 1433 |
| 1020 | nmdc:mga0n895_408790_c1 | 3300050512 | Bacteria | 1373 |
| 1021 | nmdc:mga0n895_702168_c1 | 3300050512 | Bacteria | 1007 |
| 1022 | nmdc:mga0n895_95_c1 | 3300050512 | Bacteria | 52030 |
| 1023 | nmdc:mga0rr50_102750_c1 | 3300050513 | Bacteria | 2249 |
| 1024 | nmdc:mga0rr50_105623_c1 | 3300050513 | Bacteria | 2221 |
| 1025 | nmdc:mga0rr50_13491_c1 | 3300050513 | Bacteria | 5321 |
| 1026 | nmdc:mga0rr50_17771_c1 | 3300050513 | Bacteria | 4759 |
| 1027 | nmdc:mga0rr50_193363_c1 | 3300050513 | Bacteria | 1669 |
| 1028 | nmdc:mga0rr50_283931_c1 | 3300050513 | Bacteria | 1382 |
| 1029 | nmdc:mga0rr50_28_c1 | 3300050513 | Bacteria | 108950 |
| 1030 | nmdc:mga0rr50_4559_c1 | 3300050513 | Bacteria | 8153 |
| 1031 | nmdc:mga0rr50_46608_c1 | 3300050513 | Bacteria | 3192 |
| 1032 | nmdc:mga0rr50_788376_c1 | 3300050513 | Bacteria | 811 |
| 1033 | nmdc:mga0rr50_864788_c1 | 3300050513 | Bacteria | 771 |
| 1034 | nmdc:mga08x19_11377_c1 | 3300050514 | Bacteria | 5356 |
| 1035 | nmdc:mga08x19_121_c1 | 3300050514 | Bacteria | 69968 |
| 1036 | nmdc:mga08x19_28970_c1 | 3300050514 | Bacteria | 3472 |
| 1037 | nmdc:mga08x19_55142_c1 | 3300050514 | Bacteria | 2561 |
| 1038 | nmdc:mga08x19_58793_c1 | 3300050514 | Bacteria | 2488 |
| 1039 | nmdc:mga08x19_62829_c1 | 3300050514 | Bacteria | 2408 |
| 1040 | nmdc:mga08x19_91733_c1 | 3300050514 | Bacteria | 2005 |
| 1041 | nmdc:mga0a205_1053_c2 | 3300050515 | Bacteria | 7492 |
| 1042 | nmdc:mga0a205_33911_c1 | 3300050515 | Bacteria | 4896 |
| 1043 | nmdc:mga0a205_35961_c1 | 3300050515 | Bacteria | 4757 |
| 1044 | nmdc:mga0a205_384820_c1 | 3300050515 | Bacteria | 1268 |
| 1045 | nmdc:mga0a205_431012_c1 | 3300050515 | Bacteria | 1180 |
| 1046 | nmdc:mga0a205_476_c1 | 3300050515 | Bacteria | 31298 |
| 1047 | nmdc:mga0a205_538846_c1 | 3300050515 | Unclassified | 1023 |
| 1048 | nmdc:mga0a205_53893_c1 | 3300050515 | Bacteria | 3882 |
| 1049 | nmdc:mga0a205_552440_c1 | 3300050515 | Bacteria | 1007 |
| 1050 | nmdc:mga0a205_5677_c1 | 3300050515 | Bacteria | 11242 |
| 1051 | nmdc:mga0a205_6503_c1 | 3300050515 | Bacteria | 10566 |
| 1052 | nmdc:mga0a205_78431_c1 | 3300050515 | Unclassified | 3191 |
| 1053 | Ga0495601_0009411 | 3300053077 | Bacteria | 5778 |
| 1054 | Ga0495601_0147173 | 3300053077 | Bacteria | 1537 |
| 1055 | Ga0495619_0487330 | 3300053085 | Unclassified | 848 |
| 1056 | Ga0500555_005302 | 3300053103 | Bacteria | 3657 |
| 1057 | Ga0501084_0054920 | 3300054114 | Bacteria | 3332 |
| 1058 | Ga0590075_004459 | 3300059424 | Bacteria | 3316 |
| 1059 | Ga0501082_0069283 | 3300060353 | Bacteria | 3037 |
| 1060 | Ga0501082_0381461 | 3300060353 | Bacteria | 1230 |
| 1061 | Ga0501082_0471300 | 3300060353 | Bacteria | 1097 |
| 1062 | Ga0501082_0644367 | 3300060353 | Unclassified | 927 |
| 1063 | Ga0501082_0703868 | 3300060353 | Bacteria | 884 |
| 1064 | Ga0530510_0066955 | 3300061734 | Bacteria | 2605 |
| 1065 | Ga0530510_0288448 | 3300061734 | Bacteria | 1227 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050510 | nmdc:mga06r32_1232812_c1 | nmdc:mga06r32_1232812_c1_58_603 | 181 |
| 2 | 3300042008 | Ga0439450_125750 | Ga0439450_125750_43_603 | 186 |
| 3 | 3300042436 | Ga0439435_0185312 | Ga0439435_0185312_53_613 | 186 |
| 4 | 3300028380 | Ga0268265_10886111 | Ga0268265_108861111 | 189 |
| 5 | 3300042008 | Ga0439450_019708 | Ga0439450_019708_838_1407 | 189 |
| 6 | 3300042156 | Ga0439446_0068646 | Ga0439446_0068646_49_618 | 189 |
| 7 | 3300049652 | Ga0501202_102510 | Ga0501202_102510_14_583 | 189 |
| 8 | 3300035115 | Ga0373941_0149254 | Ga0373941_0149254_259_831 | 190 |
| 9 | 3300049742 | Ga0501080_0872456 | Ga0501080_0872456_204_776 | 190 |
| 10 | 3300046683 | Ga0495658_0018821 | Ga0495658_0018821_14_589 | 191 |
| 11 | 3300048904 | Ga0496101_0398909 | Ga0496101_0398909_461_1036 | 191 |
| 12 | 3300049571 | Ga0501034_0468185 | Ga0501034_0468185_46_621 | 191 |
| 13 | 3300049582 | Ga0501048_0064134 | Ga0501048_0064134_1988_2563 | 191 |
| 14 | 3300049593 | Ga0501077_0437545 | Ga0501077_0437545_11_586 | 191 |
| 15 | 3300049741 | Ga0501079_0115525 | Ga0501079_0115525_1472_2047 | 191 |
| 16 | 3300049743 | Ga0501081_1037128 | Ga0501081_1037128_28_603 | 191 |
| 17 | 3300050513 | nmdc:mga0rr50_788376_c1 | nmdc:mga0rr50_788376_c1_212_787 | 191 |
| 18 | 3300005440 | Ga0070705_100186311 | Ga0070705_1001863112 | 193 |
| 19 | 3300025934 | Ga0207686_10004046 | Ga0207686_100040462 | 193 |
| 20 | 3300005441 | Ga0070700_100776910 | Ga0070700_1007769101 | 197 |
| 21 | 3300014326 | Ga0157380_10029391 | Ga0157380_100293912 | 197 |
| 22 | 3300026075 | Ga0207708_10441513 | Ga0207708_104415132 | 197 |
| 23 | 3300049760 | Ga0501263_026085 | Ga0501263_026085_120_713 | 197 |
| 24 | 3300005546 | Ga0070696_100073659 | Ga0070696_1000736592 | 198 |
| 25 | 3300005338 | Ga0068868_100200115 | Ga0068868_1002001152 | 200 |
| 26 | 3300005539 | Ga0068853_100459082 | Ga0068853_1004590822 | 200 |
| 27 | 3300005842 | Ga0068858_100126799 | Ga0068858_1001267991 | 200 |
| 28 | 3300005843 | Ga0068860_100484848 | Ga0068860_1004848481 | 200 |
| 29 | 3300009177 | Ga0105248_10056753 | Ga0105248_100567533 | 200 |
| 30 | 3300025903 | Ga0207680_10765267 | Ga0207680_107652671 | 200 |
| 31 | 3300025941 | Ga0207711_10076709 | Ga0207711_100767093 | 200 |
| 32 | 3300025981 | Ga0207640_10896771 | Ga0207640_108967711 | 200 |
| 33 | 3300026023 | Ga0207677_10232312 | Ga0207677_102323122 | 200 |
| 34 | 3300026035 | Ga0207703_10053921 | Ga0207703_100539213 | 200 |
| 35 | 3300042876 | Ga0451577_0035953 | Ga0451577_0035953_1663_2313 | 203 |
| 36 | 3300044712 | Ga0453684_0143678 | Ga0453684_0143678_1227_1877 | 203 |
| 37 | 3300045051 | Ga0451576_0000471 | Ga0451576_0000471_56565_57215 | 203 |
| 38 | 3300042993 | Ga0439440_0063986 | Ga0439440_0063986_62_676 | 204 |
| 39 | 3300028379 | Ga0268266_10261906 | Ga0268266_102619062 | 206 |
| 40 | 3300035088 | Ga0373940_0106412 | Ga0373940_0106412_35_655 | 206 |
| 41 | 3300035691 | Ga0373931_0009512 | Ga0373931_0009512_2030_2650 | 206 |
| 42 | 3300047318 | Ga0495636_0066656 | Ga0495636_0066656_28_648 | 206 |
| 43 | 3300009094 | Ga0111539_10007551 | Ga0111539_100075513 | 207 |
| 44 | 3300027717 | Ga0209998_10095011 | Ga0209998_100950111 | 207 |
| 45 | 3300027907 | Ga0207428_10009135 | Ga0207428_1000913514 | 207 |
| 46 | 3300038726 | Ga0400490_10325 | Ga0400490_10325_44823_45500 | 207 |
| 47 | 3300038727 | Ga0400491_11348 | Ga0400491_11348_3882_4559 | 207 |
| 48 | 3300050511 | nmdc:mga08y16_2229_c1 | nmdc:mga08y16_2229_c1_5417_6058 | 207 |
| 49 | 3300025933 | Ga0207706_10672387 | Ga0207706_106723871 | 208 |
| 50 | 3300042876 | Ga0451577_0000099 | Ga0451577_0000099_28632_29288 | 209 |
| 51 | 3300044712 | Ga0453684_0000350 | Ga0453684_0000350_162555_163211 | 209 |
| 52 | 3300005289 | Ga0065704_10015486 | Ga0065704_100154861 | 211 |
| 53 | 3300005289 | Ga0065704_10140576 | Ga0065704_101405762 | 211 |
| 54 | 3300005290 | Ga0065712_10187895 | Ga0065712_101878951 | 211 |
| 55 | 3300005293 | Ga0065715_10022852 | Ga0065715_100228522 | 211 |
| 56 | 3300005295 | Ga0065707_10137543 | Ga0065707_101375432 | 211 |
| 57 | 3300005328 | Ga0070676_10007566 | Ga0070676_100075662 | 211 |
| 58 | 3300005329 | Ga0070683_100013326 | Ga0070683_1000133267 | 211 |
| 59 | 3300005329 | Ga0070683_100169018 | Ga0070683_1001690182 | 211 |
| 60 | 3300005330 | Ga0070690_100000336 | Ga0070690_10000033617 | 211 |
| 61 | 3300005330 | Ga0070690_100035498 | Ga0070690_1000354982 | 211 |
| 62 | 3300005330 | Ga0070690_100050976 | Ga0070690_1000509762 | 211 |
| 63 | 3300005331 | Ga0070670_100035231 | Ga0070670_1000352315 | 211 |
| 64 | 3300005335 | Ga0070666_10008555 | Ga0070666_100085554 | 211 |
| 65 | 3300005336 | Ga0070680_100167068 | Ga0070680_1001670682 | 211 |
| 66 | 3300005338 | Ga0068868_100061553 | Ga0068868_1000615534 | 211 |
| 67 | 3300005338 | Ga0068868_100130709 | Ga0068868_1001307091 | 211 |
| 68 | 3300005338 | Ga0068868_100300052 | Ga0068868_1003000522 | 211 |
| 69 | 3300005339 | Ga0070660_100012311 | Ga0070660_1000123112 | 211 |
| 70 | 3300005339 | Ga0070660_100104112 | Ga0070660_1001041122 | 211 |
| 71 | 3300005340 | Ga0070689_100000066 | Ga0070689_10000006619 | 211 |
| 72 | 3300005340 | Ga0070689_100460076 | Ga0070689_1004600761 | 211 |
| 73 | 3300005340 | Ga0070689_100630372 | Ga0070689_1006303722 | 211 |
| 74 | 3300005347 | Ga0070668_100275499 | Ga0070668_1002754992 | 211 |
| 75 | 3300005353 | Ga0070669_100001454 | Ga0070669_1000014544 | 211 |
| 76 | 3300005353 | Ga0070669_100341127 | Ga0070669_1003411272 | 211 |
| 77 | 3300005354 | Ga0070675_100051067 | Ga0070675_1000510675 | 211 |
| 78 | 3300005355 | Ga0070671_100032528 | Ga0070671_1000325283 | 211 |
| 79 | 3300005356 | Ga0070674_100002716 | Ga0070674_1000027164 | 211 |
| 80 | 3300005356 | Ga0070674_100064531 | Ga0070674_1000645313 | 211 |
| 81 | 3300005364 | Ga0070673_100000103 | Ga0070673_10000010346 | 211 |
| 82 | 3300005364 | Ga0070673_100003965 | Ga0070673_1000039654 | 211 |
| 83 | 3300005365 | Ga0070688_100001477 | Ga0070688_1000014777 | 211 |
| 84 | 3300005365 | Ga0070688_100055066 | Ga0070688_1000550663 | 211 |
| 85 | 3300005365 | Ga0070688_100105296 | Ga0070688_1001052963 | 211 |
| 86 | 3300005366 | Ga0070659_100375231 | Ga0070659_1003752311 | 211 |
| 87 | 3300005435 | Ga0070714_100253206 | Ga0070714_1002532062 | 211 |
| 88 | 3300005437 | Ga0070710_10027928 | Ga0070710_100279283 | 211 |
| 89 | 3300005438 | Ga0070701_10000020 | Ga0070701_1000002017 | 211 |
| 90 | 3300005438 | Ga0070701_10138561 | Ga0070701_101385612 | 211 |
| 91 | 3300005440 | Ga0070705_100069953 | Ga0070705_1000699532 | 211 |
| 92 | 3300005440 | Ga0070705_100401137 | Ga0070705_1004011371 | 211 |
| 93 | 3300005441 | Ga0070700_100000818 | Ga0070700_10000081810 | 211 |
| 94 | 3300005444 | Ga0070694_100054370 | Ga0070694_1000543702 | 211 |
| 95 | 3300005444 | Ga0070694_100106143 | Ga0070694_1001061432 | 211 |
| 96 | 3300005444 | Ga0070694_100116412 | Ga0070694_1001164122 | 211 |
| 97 | 3300005445 | Ga0070708_100022317 | Ga0070708_1000223172 | 211 |
| 98 | 3300005445 | Ga0070708_100101619 | Ga0070708_1001016192 | 211 |
| 99 | 3300005455 | Ga0070663_100032089 | Ga0070663_1000320892 | 211 |
| 100 | 3300005456 | Ga0070678_100002436 | Ga0070678_1000024366 | 211 |
| 101 | 3300005456 | Ga0070678_100032871 | Ga0070678_1000328713 | 211 |
| 102 | 3300005457 | Ga0070662_100027204 | Ga0070662_1000272045 | 211 |
| 103 | 3300005457 | Ga0070662_100100568 | Ga0070662_1001005683 | 211 |
| 104 | 3300005458 | Ga0070681_10073223 | Ga0070681_100732232 | 211 |
| 105 | 3300005458 | Ga0070681_10129868 | Ga0070681_101298684 | 211 |
| 106 | 3300005459 | Ga0068867_100001096 | Ga0068867_10000109610 | 211 |
| 107 | 3300005459 | Ga0068867_100027704 | Ga0068867_1000277044 | 211 |
| 108 | 3300005466 | Ga0070685_10000069 | Ga0070685_1000006952 | 211 |
| 109 | 3300005466 | Ga0070685_10062750 | Ga0070685_100627502 | 211 |
| 110 | 3300005466 | Ga0070685_10165941 | Ga0070685_101659412 | 211 |
| 111 | 3300005466 | Ga0070685_10167642 | Ga0070685_101676422 | 211 |
| 112 | 3300005467 | Ga0070706_100096995 | Ga0070706_1000969952 | 211 |
| 113 | 3300005467 | Ga0070706_100144241 | Ga0070706_1001442412 | 211 |
| 114 | 3300005468 | Ga0070707_100000021 | Ga0070707_10000002179 | 211 |
| 115 | 3300005468 | Ga0070707_100038006 | Ga0070707_1000380063 | 211 |
| 116 | 3300005468 | Ga0070707_100041900 | Ga0070707_1000419003 | 211 |
| 117 | 3300005468 | Ga0070707_100669326 | Ga0070707_1006693261 | 211 |
| 118 | 3300005471 | Ga0070698_100029698 | Ga0070698_1000296982 | 211 |
| 119 | 3300005471 | Ga0070698_100289952 | Ga0070698_1002899522 | 211 |
| 120 | 3300005518 | Ga0070699_100001737 | Ga0070699_1000017372 | 211 |
| 121 | 3300005518 | Ga0070699_100037057 | Ga0070699_1000370574 | 211 |
| 122 | 3300005518 | Ga0070699_100335870 | Ga0070699_1003358702 | 211 |
| 123 | 3300005530 | Ga0070679_100171169 | Ga0070679_1001711692 | 211 |
| 124 | 3300005536 | Ga0070697_100048178 | Ga0070697_1000481782 | 211 |
| 125 | 3300005536 | Ga0070697_100061083 | Ga0070697_1000610832 | 211 |
| 126 | 3300005536 | Ga0070697_100178419 | Ga0070697_1001784192 | 211 |
| 127 | 3300005543 | Ga0070672_100002045 | Ga0070672_1000020453 | 211 |
| 128 | 3300005543 | Ga0070672_100151381 | Ga0070672_1001513812 | 211 |
| 129 | 3300005544 | Ga0070686_100000100 | Ga0070686_10000010015 | 211 |
| 130 | 3300005544 | Ga0070686_100040570 | Ga0070686_1000405702 | 211 |
| 131 | 3300005545 | Ga0070695_100063731 | Ga0070695_1000637312 | 211 |
| 132 | 3300005545 | Ga0070695_100799634 | Ga0070695_1007996341 | 211 |
| 133 | 3300005546 | Ga0070696_100003911 | Ga0070696_1000039113 | 211 |
| 134 | 3300005546 | Ga0070696_100101272 | Ga0070696_1001012722 | 211 |
| 135 | 3300005546 | Ga0070696_100250978 | Ga0070696_1002509782 | 211 |
| 136 | 3300005546 | Ga0070696_100259553 | Ga0070696_1002595532 | 211 |
| 137 | 3300005548 | Ga0070665_100340116 | Ga0070665_1003401162 | 211 |
| 138 | 3300005548 | Ga0070665_100422305 | Ga0070665_1004223052 | 211 |
| 139 | 3300005549 | Ga0070704_100012684 | Ga0070704_1000126842 | 211 |
| 140 | 3300005549 | Ga0070704_100040734 | Ga0070704_1000407342 | 211 |
| 141 | 3300005549 | Ga0070704_100139194 | Ga0070704_1001391943 | 211 |
| 142 | 3300005549 | Ga0070704_100708027 | Ga0070704_1007080271 | 211 |
| 143 | 3300005563 | Ga0068855_100112064 | Ga0068855_1001120644 | 211 |
| 144 | 3300005564 | Ga0070664_100000584 | Ga0070664_10000058421 | 211 |
| 145 | 3300005564 | Ga0070664_100029223 | Ga0070664_1000292236 | 211 |
| 146 | 3300005564 | Ga0070664_100107093 | Ga0070664_1001070932 | 211 |
| 147 | 3300005577 | Ga0068857_100020770 | Ga0068857_1000207707 | 211 |
| 148 | 3300005615 | Ga0070702_100023978 | Ga0070702_1000239783 | 211 |
| 149 | 3300005615 | Ga0070702_100116927 | Ga0070702_1001169272 | 211 |
| 150 | 3300005617 | Ga0068859_100004613 | Ga0068859_1000046134 | 211 |
| 151 | 3300005718 | Ga0068866_10002332 | Ga0068866_100023327 | 211 |
| 152 | 3300005718 | Ga0068866_10202778 | Ga0068866_102027781 | 211 |
| 153 | 3300005719 | Ga0068861_100053791 | Ga0068861_1000537912 | 211 |
| 154 | 3300005842 | Ga0068858_100833859 | Ga0068858_1008338592 | 211 |
| 155 | 3300005842 | Ga0068858_100986190 | Ga0068858_1009861901 | 211 |
| 156 | 3300005843 | Ga0068860_100033522 | Ga0068860_1000335223 | 211 |
| 157 | 3300005843 | Ga0068860_100033985 | Ga0068860_1000339852 | 211 |
| 158 | 3300005844 | Ga0068862_100018207 | Ga0068862_1000182073 | 211 |
| 159 | 3300005937 | Ga0081455_10000786 | Ga0081455_1000078628 | 211 |
| 160 | 3300006163 | Ga0070715_10015855 | Ga0070715_100158553 | 211 |
| 161 | 3300006173 | Ga0070716_100206208 | Ga0070716_1002062082 | 211 |
| 162 | 3300006173 | Ga0070716_100220732 | Ga0070716_1002207322 | 211 |
| 163 | 3300006237 | Ga0097621_100001601 | Ga0097621_10000160115 | 211 |
| 164 | 3300006237 | Ga0097621_100056007 | Ga0097621_1000560074 | 211 |
| 165 | 3300006237 | Ga0097621_100086311 | Ga0097621_1000863112 | 211 |
| 166 | 3300006358 | Ga0068871_100033300 | Ga0068871_1000333003 | 211 |
| 167 | 3300006358 | Ga0068871_100352776 | Ga0068871_1003527763 | 211 |
| 168 | 3300006844 | Ga0075428_100037061 | Ga0075428_1000370612 | 211 |
| 169 | 3300006846 | Ga0075430_100006133 | Ga0075430_1000061333 | 211 |
| 170 | 3300006846 | Ga0075430_100009586 | Ga0075430_1000095865 | 211 |
| 171 | 3300006847 | Ga0075431_100073904 | Ga0075431_1000739043 | 211 |
| 172 | 3300006852 | Ga0075433_10067320 | Ga0075433_100673203 | 211 |
| 173 | 3300006852 | Ga0075433_10129334 | Ga0075433_101293342 | 211 |
| 174 | 3300006852 | Ga0075433_10492670 | Ga0075433_104926702 | 211 |
| 175 | 3300006852 | Ga0075433_10540806 | Ga0075433_105408061 | 211 |
| 176 | 3300006871 | Ga0075434_100025831 | Ga0075434_1000258312 | 211 |
| 177 | 3300006880 | Ga0075429_100001236 | Ga0075429_10000123619 | 211 |
| 178 | 3300006880 | Ga0075429_100018761 | Ga0075429_1000187616 | 211 |
| 179 | 3300006881 | Ga0068865_100266952 | Ga0068865_1002669522 | 211 |
| 180 | 3300006881 | Ga0068865_100339852 | Ga0068865_1003398523 | 211 |
| 181 | 3300006914 | Ga0075436_100025325 | Ga0075436_1000253256 | 211 |
| 182 | 3300006914 | Ga0075436_100037192 | Ga0075436_1000371925 | 211 |
| 183 | 3300006914 | Ga0075436_100322257 | Ga0075436_1003222572 | 211 |
| 184 | 3300006931 | Ga0097620_100004613 | Ga0097620_1000046134 | 211 |
| 185 | 3300009094 | Ga0111539_10010427 | Ga0111539_100104275 | 211 |
| 186 | 3300009147 | Ga0114129_10004893 | Ga0114129_100048939 | 211 |
| 187 | 3300009147 | Ga0114129_10018292 | Ga0114129_100182927 | 211 |
| 188 | 3300009147 | Ga0114129_10094153 | Ga0114129_100941532 | 211 |
| 189 | 3300009147 | Ga0114129_10126682 | Ga0114129_101266822 | 211 |
| 190 | 3300009148 | Ga0105243_10000238 | Ga0105243_1000023828 | 211 |
| 191 | 3300009176 | Ga0105242_10001243 | Ga0105242_1000124317 | 211 |
| 192 | 3300009176 | Ga0105242_10007339 | Ga0105242_100073395 | 211 |
| 193 | 3300009177 | Ga0105248_10271331 | Ga0105248_102713312 | 211 |
| 194 | 3300009551 | Ga0105238_10686821 | Ga0105238_106868212 | 211 |
| 195 | 3300013102 | Ga0157371_10184330 | Ga0157371_101843301 | 211 |
| 196 | 3300013105 | Ga0157369_10337892 | Ga0157369_103378922 | 211 |
| 197 | 3300013296 | Ga0157374_10064849 | Ga0157374_100648495 | 211 |
| 198 | 3300013296 | Ga0157374_10504422 | Ga0157374_105044222 | 211 |
| 199 | 3300013297 | Ga0157378_10002332 | Ga0157378_100023325 | 211 |
| 200 | 3300013297 | Ga0157378_10174325 | Ga0157378_101743252 | 211 |
| 201 | 3300013306 | Ga0163162_10102935 | Ga0163162_101029354 | 211 |
| 202 | 3300013308 | Ga0157375_10022418 | Ga0157375_100224186 | 211 |
| 203 | 3300013308 | Ga0157375_10089852 | Ga0157375_100898523 | 211 |
| 204 | 3300014326 | Ga0157380_10002955 | Ga0157380_100029556 | 211 |
| 205 | 3300014326 | Ga0157380_10486371 | Ga0157380_104863712 | 211 |
| 206 | 3300014745 | Ga0157377_10018864 | Ga0157377_100188645 | 211 |
| 207 | 3300014969 | Ga0157376_10048960 | Ga0157376_100489601 | 211 |
| 208 | 3300014969 | Ga0157376_10650086 | Ga0157376_106500861 | 211 |
| 209 | 3300017792 | Ga0163161_10161833 | Ga0163161_101618332 | 211 |
| 210 | 3300025893 | Ga0207682_10011353 | Ga0207682_100113534 | 211 |
| 211 | 3300025898 | Ga0207692_10035866 | Ga0207692_100358662 | 211 |
| 212 | 3300025899 | Ga0207642_10110274 | Ga0207642_101102742 | 211 |
| 213 | 3300025901 | Ga0207688_10221170 | Ga0207688_102211701 | 211 |
| 214 | 3300025903 | Ga0207680_10051609 | Ga0207680_100516092 | 211 |
| 215 | 3300025905 | Ga0207685_10011619 | Ga0207685_100116192 | 211 |
| 216 | 3300025907 | Ga0207645_10007763 | Ga0207645_100077638 | 211 |
| 217 | 3300025910 | Ga0207684_10000737 | Ga0207684_1000073735 | 211 |
| 218 | 3300025910 | Ga0207684_10031826 | Ga0207684_100318264 | 211 |
| 219 | 3300025910 | Ga0207684_10296558 | Ga0207684_102965582 | 211 |
| 220 | 3300025911 | Ga0207654_10091248 | Ga0207654_100912483 | 211 |
| 221 | 3300025912 | Ga0207707_10070129 | Ga0207707_100701293 | 211 |
| 222 | 3300025917 | Ga0207660_10004716 | Ga0207660_100047167 | 211 |
| 223 | 3300025917 | Ga0207660_10142675 | Ga0207660_101426752 | 211 |
| 224 | 3300025918 | Ga0207662_10001208 | Ga0207662_1000120812 | 211 |
| 225 | 3300025918 | Ga0207662_10140373 | Ga0207662_101403732 | 211 |
| 226 | 3300025919 | Ga0207657_10060146 | Ga0207657_100601462 | 211 |
| 227 | 3300025919 | Ga0207657_10093048 | Ga0207657_100930482 | 211 |
| 228 | 3300025920 | Ga0207649_10029456 | Ga0207649_100294562 | 211 |
| 229 | 3300025921 | Ga0207652_10124757 | Ga0207652_101247572 | 211 |
| 230 | 3300025922 | Ga0207646_10000231 | Ga0207646_1000023175 | 211 |
| 231 | 3300025922 | Ga0207646_10000547 | Ga0207646_1000054743 | 211 |
| 232 | 3300025922 | Ga0207646_10127744 | Ga0207646_101277442 | 211 |
| 233 | 3300025922 | Ga0207646_10611216 | Ga0207646_106112161 | 211 |
| 234 | 3300025923 | Ga0207681_10064590 | Ga0207681_100645903 | 211 |
| 235 | 3300025925 | Ga0207650_10114607 | Ga0207650_101146072 | 211 |
| 236 | 3300025926 | Ga0207659_10168017 | Ga0207659_101680172 | 211 |
| 237 | 3300025926 | Ga0207659_10289572 | Ga0207659_102895722 | 211 |
| 238 | 3300025927 | Ga0207687_10057635 | Ga0207687_100576352 | 211 |
| 239 | 3300025928 | Ga0207700_11125101 | Ga0207700_111251011 | 211 |
| 240 | 3300025931 | Ga0207644_10107568 | Ga0207644_101075684 | 211 |
| 241 | 3300025933 | Ga0207706_10005586 | Ga0207706_1000558611 | 211 |
| 242 | 3300025933 | Ga0207706_10403920 | Ga0207706_104039202 | 211 |
| 243 | 3300025934 | Ga0207686_10015028 | Ga0207686_100150283 | 211 |
| 244 | 3300025936 | Ga0207670_10000098 | Ga0207670_1000009816 | 211 |
| 245 | 3300025936 | Ga0207670_10018961 | Ga0207670_100189612 | 211 |
| 246 | 3300025936 | Ga0207670_10064879 | Ga0207670_100648792 | 211 |
| 247 | 3300025937 | Ga0207669_10411894 | Ga0207669_104118941 | 211 |
| 248 | 3300025938 | Ga0207704_10145885 | Ga0207704_101458852 | 211 |
| 249 | 3300025939 | Ga0207665_10129988 | Ga0207665_101299882 | 211 |
| 250 | 3300025939 | Ga0207665_10135890 | Ga0207665_101358902 | 211 |
| 251 | 3300025940 | Ga0207691_10000209 | Ga0207691_100002092 | 211 |
| 252 | 3300025940 | Ga0207691_10016035 | Ga0207691_100160355 | 211 |
| 253 | 3300025941 | Ga0207711_10007687 | Ga0207711_100076878 | 211 |
| 254 | 3300025942 | Ga0207689_10003806 | Ga0207689_1000380611 | 211 |
| 255 | 3300025942 | Ga0207689_10182618 | Ga0207689_101826181 | 211 |
| 256 | 3300025942 | Ga0207689_10578185 | Ga0207689_105781851 | 211 |
| 257 | 3300025944 | Ga0207661_10053538 | Ga0207661_100535382 | 211 |
| 258 | 3300025945 | Ga0207679_10002301 | Ga0207679_100023013 | 211 |
| 259 | 3300025945 | Ga0207679_10003057 | Ga0207679_100030577 | 211 |
| 260 | 3300025945 | Ga0207679_10285976 | Ga0207679_102859762 | 211 |
| 261 | 3300025949 | Ga0207667_10175780 | Ga0207667_101757802 | 211 |
| 262 | 3300025960 | Ga0207651_10000027 | Ga0207651_1000002775 | 211 |
| 263 | 3300025960 | Ga0207651_10233236 | Ga0207651_102332362 | 211 |
| 264 | 3300025960 | Ga0207651_10580045 | Ga0207651_105800452 | 211 |
| 265 | 3300025961 | Ga0207712_10411109 | Ga0207712_104111092 | 211 |
| 266 | 3300025972 | Ga0207668_10804354 | Ga0207668_108043541 | 211 |
| 267 | 3300025986 | Ga0207658_10011910 | Ga0207658_100119105 | 211 |
| 268 | 3300025986 | Ga0207658_10092466 | Ga0207658_100924664 | 211 |
| 269 | 3300026023 | Ga0207677_10394383 | Ga0207677_103943832 | 211 |
| 270 | 3300026067 | Ga0207678_10029975 | Ga0207678_100299755 | 211 |
| 271 | 3300026075 | Ga0207708_10001575 | Ga0207708_100015754 | 211 |
| 272 | 3300026075 | Ga0207708_10590216 | Ga0207708_105902161 | 211 |
| 273 | 3300026088 | Ga0207641_10718470 | Ga0207641_107184701 | 211 |
| 274 | 3300026089 | Ga0207648_10000543 | Ga0207648_1000054328 | 211 |
| 275 | 3300026089 | Ga0207648_10004219 | Ga0207648_1000421916 | 211 |
| 276 | 3300026116 | Ga0207674_10029412 | Ga0207674_100294122 | 211 |
| 277 | 3300026121 | Ga0207683_10001107 | Ga0207683_100011077 | 211 |
| 278 | 3300026121 | Ga0207683_10017195 | Ga0207683_100171955 | 211 |
| 279 | 3300027360 | Ga0209969_1000120 | Ga0209969_100012012 | 211 |
| 280 | 3300027364 | Ga0209967_1000144 | Ga0209967_10001447 | 211 |
| 281 | 3300027364 | Ga0209967_1003541 | Ga0209967_10035412 | 211 |
| 282 | 3300027378 | Ga0209981_1000003 | Ga0209981_100000328 | 211 |
| 283 | 3300027395 | Ga0209996_1000058 | Ga0209996_10000583 | 211 |
| 284 | 3300027424 | Ga0209984_1000444 | Ga0209984_10004444 | 211 |
| 285 | 3300027424 | Ga0209984_1010133 | Ga0209984_10101332 | 211 |
| 286 | 3300027462 | Ga0210000_1000024 | Ga0210000_100002415 | 211 |
| 287 | 3300027471 | Ga0209995_1000087 | Ga0209995_10000873 | 211 |
| 288 | 3300027471 | Ga0209995_1018580 | Ga0209995_10185802 | 211 |
| 289 | 3300027526 | Ga0209968_1000019 | Ga0209968_100001919 | 211 |
| 290 | 3300027543 | Ga0209999_1000055 | Ga0209999_100005511 | 211 |
| 291 | 3300027552 | Ga0209982_1001564 | Ga0209982_10015643 | 211 |
| 292 | 3300027614 | Ga0209970_1000013 | Ga0209970_100001321 | 211 |
| 293 | 3300027617 | Ga0210002_1000024 | Ga0210002_10000249 | 211 |
| 294 | 3300027665 | Ga0209983_1001530 | Ga0209983_10015302 | 211 |
| 295 | 3300027665 | Ga0209983_1028790 | Ga0209983_10287902 | 211 |
| 296 | 3300027682 | Ga0209971_1000232 | Ga0209971_10002324 | 211 |
| 297 | 3300027695 | Ga0209966_1000331 | Ga0209966_100033110 | 211 |
| 298 | 3300027717 | Ga0209998_10000094 | Ga0209998_1000009422 | 211 |
| 299 | 3300027876 | Ga0209974_10001696 | Ga0209974_100016967 | 211 |
| 300 | 3300027876 | Ga0209974_10028942 | Ga0209974_100289422 | 211 |
| 301 | 3300027876 | Ga0209974_10150074 | Ga0209974_101500741 | 211 |
| 302 | 3300027907 | Ga0207428_10000529 | Ga0207428_1000052926 | 211 |
| 303 | 3300027907 | Ga0207428_10006577 | Ga0207428_1000657710 | 211 |
| 304 | 3300028380 | Ga0268265_10779926 | Ga0268265_107799261 | 211 |
| 305 | 3300028381 | Ga0268264_10073918 | Ga0268264_100739183 | 211 |
| 306 | 3300031548 | Ga0307408_100013769 | Ga0307408_1000137696 | 211 |
| 307 | 3300031548 | Ga0307408_100173814 | Ga0307408_1001738142 | 211 |
| 308 | 3300031731 | Ga0307405_10586391 | Ga0307405_105863912 | 211 |
| 309 | 3300031824 | Ga0307413_10596162 | Ga0307413_105961622 | 211 |
| 310 | 3300031911 | Ga0307412_10034734 | Ga0307412_100347344 | 211 |
| 311 | 3300031995 | Ga0307409_100370716 | Ga0307409_1003707161 | 211 |
| 312 | 3300032004 | Ga0307414_10050348 | Ga0307414_100503485 | 211 |
| 313 | 3300032126 | Ga0307415_100126033 | Ga0307415_1001260333 | 211 |
| 314 | 3300034819 | Ga0373958_0042935 | Ga0373958_0042935_252_887 | 211 |
| 315 | 3300035083 | Ga0373926_0030225 | Ga0373926_0030225_846_1481 | 211 |
| 316 | 3300035092 | Ga0373952_0012701 | Ga0373952_0012701_357_992 | 211 |
| 317 | 3300035111 | Ga0373923_0236918 | Ga0373923_0236918_26_661 | 211 |
| 318 | 3300035115 | Ga0373941_0098558 | Ga0373941_0098558_166_813 | 211 |
| 319 | 3300035121 | Ga0373960_0009345 | Ga0373960_0009345_678_1313 | 211 |
| 320 | 3300035724 | Ga0373933_0048168 | Ga0373933_0048168_1529_2164 | 211 |
| 321 | 3300036401 | Ga0373937_0086289 | Ga0373937_0086289_450_1085 | 211 |
| 322 | 3300041405 | Ga0439438_058205 | Ga0439438_058205_203_838 | 211 |
| 323 | 3300041407 | Ga0439447_010933 | Ga0439447_010933_403_1038 | 211 |
| 324 | 3300041410 | Ga0439461_0035251 | Ga0439461_0035251_336_971 | 211 |
| 325 | 3300042001 | Ga0439441_003072 | Ga0439441_003072_1302_1937 | 211 |
| 326 | 3300042005 | Ga0439448_0035817 | Ga0439448_0035817_800_1435 | 211 |
| 327 | 3300042006 | Ga0439432_035110 | Ga0439432_035110_288_923 | 211 |
| 328 | 3300042008 | Ga0439450_000289 | Ga0439450_000289_5137_5772 | 211 |
| 329 | 3300042010 | Ga0439452_013979 | Ga0439452_013979_967_1602 | 211 |
| 330 | 3300042013 | Ga0439456_015300 | Ga0439456_015300_149_784 | 211 |
| 331 | 3300042013 | Ga0439456_056997 | Ga0439456_056997_126_761 | 211 |
| 332 | 3300042156 | Ga0439446_0045893 | Ga0439446_0045893_217_852 | 211 |
| 333 | 3300042185 | Ga0450909_027822 | Ga0450909_027822_28_663 | 211 |
| 334 | 3300042435 | Ga0439434_0003138 | Ga0439434_0003138_1768_2403 | 211 |
| 335 | 3300042876 | Ga0451577_0010642 | Ga0451577_0010642_7486_8130 | 211 |
| 336 | 3300042876 | Ga0451577_0179114 | Ga0451577_0179114_981_1616 | 211 |
| 337 | 3300044712 | Ga0453684_0027518 | Ga0453684_0027518_3467_4111 | 211 |
| 338 | 3300045051 | Ga0451576_0005198 | Ga0451576_0005198_12089_12724 | 211 |
| 339 | 3300045051 | Ga0451576_0021687 | Ga0451576_0021687_6234_6869 | 211 |
| 340 | 3300045051 | Ga0451576_0135313 | Ga0451576_0135313_1411_2046 | 211 |
| 341 | 3300045051 | Ga0451576_0359059 | Ga0451576_0359059_825_1460 | 211 |
| 342 | 3300046459 | Ga0495629_0014650 | Ga0495629_0014650_1962_2597 | 211 |
| 343 | 3300046499 | Ga0495594_0018424 | Ga0495594_0018424_1566_2201 | 211 |
| 344 | 3300046499 | Ga0495594_0025661 | Ga0495594_0025661_931_1566 | 211 |
| 345 | 3300046499 | Ga0495594_0052839 | Ga0495594_0052839_445_1080 | 211 |
| 346 | 3300046516 | Ga0495628_0302254 | Ga0495628_0302254_416_1051 | 211 |
| 347 | 3300046533 | Ga0495640_0332069 | Ga0495640_0332069_106_741 | 211 |
| 348 | 3300046535 | Ga0495586_0338789 | Ga0495586_0338789_211_846 | 211 |
| 349 | 3300047315 | Ga0495581_0010104 | Ga0495581_0010104_1210_1845 | 211 |
| 350 | 3300047321 | Ga0495676_0198153 | Ga0495676_0198153_718_1353 | 211 |
| 351 | 3300048089 | Ga0495614_0080214 | Ga0495614_0080214_370_1005 | 211 |
| 352 | 3300048908 | Ga0496105_0886466 | Ga0496105_0886466_16_651 | 211 |
| 353 | 3300048909 | Ga0496106_0308293 | Ga0496106_0308293_38_673 | 211 |
| 354 | 3300048911 | Ga0496108_0082559 | Ga0496108_0082559_174_809 | 211 |
| 355 | 3300048913 | Ga0496110_0035808 | Ga0496110_0035808_2645_3280 | 211 |
| 356 | 3300048915 | Ga0496112_0435803 | Ga0496112_0435803_130_765 | 211 |
| 357 | 3300048916 | Ga0496113_0462915 | Ga0496113_0462915_370_1005 | 211 |
| 358 | 3300048917 | Ga0496114_0052718 | Ga0496114_0052718_1458_2093 | 211 |
| 359 | 3300049514 | Ga0501291_000488 | Ga0501291_000488_1591_2226 | 211 |
| 360 | 3300049516 | Ga0501293_004272 | Ga0501293_004272_447_1082 | 211 |
| 361 | 3300049518 | Ga0501295_000527 | Ga0501295_000527_745_1380 | 211 |
| 362 | 3300049521 | Ga0501298_000073 | Ga0501298_000073_9715_10350 | 211 |
| 363 | 3300049522 | Ga0501299_000048 | Ga0501299_000048_4062_4697 | 211 |
| 364 | 3300049523 | Ga0501300_000939 | Ga0501300_000939_2656_3291 | 211 |
| 365 | 3300049524 | Ga0501301_000833 | Ga0501301_000833_966_1601 | 211 |
| 366 | 3300049526 | Ga0501303_001510 | Ga0501303_001510_199_834 | 211 |
| 367 | 3300049568 | Ga0501031_0021701 | Ga0501031_0021701_3387_4022 | 211 |
| 368 | 3300049568 | Ga0501031_0342664 | Ga0501031_0342664_114_752 | 211 |
| 369 | 3300049572 | Ga0501036_0341214 | Ga0501036_0341214_432_1079 | 211 |
| 370 | 3300049572 | Ga0501036_0437191 | Ga0501036_0437191_232_867 | 211 |
| 371 | 3300049575 | Ga0501039_0127983 | Ga0501039_0127983_1100_1735 | 211 |
| 372 | 3300049575 | Ga0501039_0458174 | Ga0501039_0458174_75_722 | 211 |
| 373 | 3300049575 | Ga0501039_0629334 | Ga0501039_0629334_179_814 | 211 |
| 374 | 3300049576 | Ga0501040_0011021 | Ga0501040_0011021_4738_5373 | 211 |
| 375 | 3300049577 | Ga0501041_0113525 | Ga0501041_0113525_324_959 | 211 |
| 376 | 3300049577 | Ga0501041_0171110 | Ga0501041_0171110_643_1278 | 211 |
| 377 | 3300049577 | Ga0501041_0173713 | Ga0501041_0173713_318_953 | 211 |
| 378 | 3300049578 | Ga0501042_0197623 | Ga0501042_0197623_266_913 | 211 |
| 379 | 3300049580 | Ga0501046_0298905 | Ga0501046_0298905_510_1157 | 211 |
| 380 | 3300049582 | Ga0501048_0280676 | Ga0501048_0280676_37_684 | 211 |
| 381 | 3300049584 | Ga0501068_0018839 | Ga0501068_0018839_1056_1691 | 211 |
| 382 | 3300049587 | Ga0501071_0305490 | Ga0501071_0305490_477_1112 | 211 |
| 383 | 3300049590 | Ga0501074_0201538 | Ga0501074_0201538_205_840 | 211 |
| 384 | 3300049591 | Ga0501075_0291361 | Ga0501075_0291361_442_1077 | 211 |
| 385 | 3300049592 | Ga0501076_0018458 | Ga0501076_0018458_2421_3056 | 211 |
| 386 | 3300049592 | Ga0501076_0242849 | Ga0501076_0242849_467_1102 | 211 |
| 387 | 3300049592 | Ga0501076_0458420 | Ga0501076_0458420_148_783 | 211 |
| 388 | 3300049592 | Ga0501076_0464334 | Ga0501076_0464334_95_730 | 211 |
| 389 | 3300049593 | Ga0501077_0014054 | Ga0501077_0014054_3828_4463 | 211 |
| 390 | 3300049593 | Ga0501077_0025415 | Ga0501077_0025415_3005_3640 | 211 |
| 391 | 3300049650 | Ga0501199_000966 | Ga0501199_000966_353_988 | 211 |
| 392 | 3300049652 | Ga0501202_002220 | Ga0501202_002220_1934_2569 | 211 |
| 393 | 3300049655 | Ga0501208_004521 | Ga0501208_004521_394_1029 | 211 |
| 394 | 3300049656 | Ga0501209_000634 | Ga0501209_000634_885_1520 | 211 |
| 395 | 3300049661 | Ga0501217_010982 | Ga0501217_010982_252_887 | 211 |
| 396 | 3300049665 | Ga0501227_077089 | Ga0501227_077089_209_844 | 211 |
| 397 | 3300049668 | Ga0501233_001024 | Ga0501233_001024_4083_4718 | 211 |
| 398 | 3300049669 | Ga0501235_005843 | Ga0501235_005843_1966_2601 | 211 |
| 399 | 3300049670 | Ga0501236_025732 | Ga0501236_025732_68_703 | 211 |
| 400 | 3300049675 | Ga0501243_001231 | Ga0501243_001231_2575_3210 | 211 |
| 401 | 3300049676 | Ga0501246_000121 | Ga0501246_000121_272_907 | 211 |
| 402 | 3300049681 | Ga0501251_000290 | Ga0501251_000290_2305_2940 | 211 |
| 403 | 3300049685 | Ga0501256_005709 | Ga0501256_005709_35_670 | 211 |
| 404 | 3300049686 | Ga0501257_011113 | Ga0501257_011113_199_834 | 211 |
| 405 | 3300049690 | Ga0501261_004095 | Ga0501261_004095_299_934 | 211 |
| 406 | 3300049704 | Ga0501221_002583 | Ga0501221_002583_258_893 | 211 |
| 407 | 3300049705 | Ga0501225_0020194 | Ga0501225_0020194_842_1477 | 211 |
| 408 | 3300049706 | Ga0501229_000424 | Ga0501229_000424_106_741 | 211 |
| 409 | 3300049707 | Ga0501234_000290 | Ga0501234_000290_4051_4686 | 211 |
| 410 | 3300049741 | Ga0501079_0089110 | Ga0501079_0089110_720_1355 | 211 |
| 411 | 3300049742 | Ga0501080_0085095 | Ga0501080_0085095_1984_2619 | 211 |
| 412 | 3300049743 | Ga0501081_0160934 | Ga0501081_0160934_807_1442 | 211 |
| 413 | 3300049761 | Ga0501264_000674 | Ga0501264_000674_2108_2743 | 211 |
| 414 | 3300049763 | Ga0501266_001401 | Ga0501266_001401_1853_2488 | 211 |
| 415 | 3300049774 | Ga0501278_001930 | Ga0501278_001930_609_1244 | 211 |
| 416 | 3300049775 | Ga0501279_002809 | Ga0501279_002809_794_1429 | 211 |
| 417 | 3300049777 | Ga0501281_00924 | Ga0501281_00924_1128_1763 | 211 |
| 418 | 3300049779 | Ga0501283_004328 | Ga0501283_004328_93_728 | 211 |
| 419 | 3300050507 | nmdc:mga05p37_1214327_c1 | nmdc:mga05p37_1214327_c1_61_696 | 211 |
| 420 | 3300050507 | nmdc:mga05p37_156259_c1 | nmdc:mga05p37_156259_c1_355_996 | 211 |
| 421 | 3300050507 | nmdc:mga05p37_176866_c1 | nmdc:mga05p37_176866_c1_242_877 | 211 |
| 422 | 3300050507 | nmdc:mga05p37_35207_c1 | nmdc:mga05p37_35207_c1_4270_4905 | 211 |
| 423 | 3300050507 | nmdc:mga05p37_75048_c1 | nmdc:mga05p37_75048_c1_1506_2168 | 211 |
| 424 | 3300050508 | nmdc:mga09592_57742_c1 | nmdc:mga09592_57742_c1_138_773 | 211 |
| 425 | 3300050509 | nmdc:mga0qj67_8816_c1 | nmdc:mga0qj67_8816_c1_6840_7475 | 211 |
| 426 | 3300050511 | nmdc:mga08y16_7280_c1 | nmdc:mga08y16_7280_c1_9102_9737 | 211 |
| 427 | 3300050512 | nmdc:mga0n895_291448_c1 | nmdc:mga0n895_291448_c1_510_1145 | 211 |
| 428 | 3300050512 | nmdc:mga0n895_378447_c1 | nmdc:mga0n895_378447_c1_568_1203 | 211 |
| 429 | 3300050512 | nmdc:mga0n895_408790_c1 | nmdc:mga0n895_408790_c1_656_1291 | 211 |
| 430 | 3300050513 | nmdc:mga0rr50_102750_c1 | nmdc:mga0rr50_102750_c1_282_917 | 211 |
| 431 | 3300050513 | nmdc:mga0rr50_864788_c1 | nmdc:mga0rr50_864788_c1_113_748 | 211 |
| 432 | 3300050514 | nmdc:mga08x19_28970_c1 | nmdc:mga08x19_28970_c1_1818_2453 | 211 |
| 433 | 3300050514 | nmdc:mga08x19_58793_c1 | nmdc:mga08x19_58793_c1_769_1404 | 211 |
| 434 | 3300050514 | nmdc:mga08x19_62829_c1 | nmdc:mga08x19_62829_c1_1583_2218 | 211 |
| 435 | 3300050515 | nmdc:mga0a205_33911_c1 | nmdc:mga0a205_33911_c1_96_731 | 211 |
| 436 | 3300050515 | nmdc:mga0a205_35961_c1 | nmdc:mga0a205_35961_c1_4070_4705 | 211 |
| 437 | 3300050515 | nmdc:mga0a205_538846_c1 | nmdc:mga0a205_538846_c1_288_923 | 211 |
| 438 | 3300050515 | nmdc:mga0a205_6503_c1 | nmdc:mga0a205_6503_c1_210_845 | 211 |
| 439 | 3300059424 | Ga0590075_004459 | Ga0590075_004459_392_1027 | 211 |
| 440 | 3300060353 | Ga0501082_0471300 | Ga0501082_0471300_305_940 | 211 |
| 441 | 3300005345 | Ga0070692_10001597 | Ga0070692_100015975 | 212 |
| 442 | 3300005345 | Ga0070692_10035483 | Ga0070692_100354833 | 212 |
| 443 | 3300005353 | Ga0070669_100112110 | Ga0070669_1001121102 | 212 |
| 444 | 3300005354 | Ga0070675_100048236 | Ga0070675_1000482363 | 212 |
| 445 | 3300005438 | Ga0070701_10286350 | Ga0070701_102863502 | 212 |
| 446 | 3300005439 | Ga0070711_100439564 | Ga0070711_1004395642 | 212 |
| 447 | 3300005440 | Ga0070705_100042809 | Ga0070705_1000428093 | 212 |
| 448 | 3300005444 | Ga0070694_100047946 | Ga0070694_1000479463 | 212 |
| 449 | 3300005444 | Ga0070694_100397414 | Ga0070694_1003974142 | 212 |
| 450 | 3300005458 | Ga0070681_10014199 | Ga0070681_100141992 | 212 |
| 451 | 3300005466 | Ga0070685_10139038 | Ga0070685_101390381 | 212 |
| 452 | 3300005543 | Ga0070672_100045389 | Ga0070672_1000453892 | 212 |
| 453 | 3300005545 | Ga0070695_100189390 | Ga0070695_1001893902 | 212 |
| 454 | 3300005545 | Ga0070695_100575094 | Ga0070695_1005750941 | 212 |
| 455 | 3300005548 | Ga0070665_100470014 | Ga0070665_1004700142 | 212 |
| 456 | 3300005549 | Ga0070704_100008135 | Ga0070704_1000081354 | 212 |
| 457 | 3300005840 | Ga0068870_10006146 | Ga0068870_100061464 | 212 |
| 458 | 3300006237 | Ga0097621_100007328 | Ga0097621_1000073283 | 212 |
| 459 | 3300006358 | Ga0068871_100001107 | Ga0068871_10000110717 | 212 |
| 460 | 3300007076 | Ga0075435_100318908 | Ga0075435_1003189082 | 212 |
| 461 | 3300009147 | Ga0114129_10027396 | Ga0114129_100273963 | 212 |
| 462 | 3300009176 | Ga0105242_10259609 | Ga0105242_102596093 | 212 |
| 463 | 3300013104 | Ga0157370_10640920 | Ga0157370_106409202 | 212 |
| 464 | 3300025912 | Ga0207707_10002734 | Ga0207707_1000273417 | 212 |
| 465 | 3300025918 | Ga0207662_10333653 | Ga0207662_103336532 | 212 |
| 466 | 3300025918 | Ga0207662_10483314 | Ga0207662_104833141 | 212 |
| 467 | 3300025926 | Ga0207659_10010800 | Ga0207659_100108003 | 212 |
| 468 | 3300025933 | Ga0207706_10483263 | Ga0207706_104832631 | 212 |
| 469 | 3300025934 | Ga0207686_10237243 | Ga0207686_102372432 | 212 |
| 470 | 3300025940 | Ga0207691_10030425 | Ga0207691_100304252 | 212 |
| 471 | 3300025944 | Ga0207661_10723134 | Ga0207661_107231342 | 212 |
| 472 | 3300025986 | Ga0207658_10374305 | Ga0207658_103743052 | 212 |
| 473 | 3300026075 | Ga0207708_10320605 | Ga0207708_103206052 | 212 |
| 474 | 3300026095 | Ga0207676_10316048 | Ga0207676_103160482 | 212 |
| 475 | 3300026121 | Ga0207683_10075220 | Ga0207683_100752203 | 212 |
| 476 | 3300036401 | Ga0373937_0103302 | Ga0373937_0103302_1340_1978 | 212 |
| 477 | 3300036401 | Ga0373937_0631625 | Ga0373937_0631625_271_909 | 212 |
| 478 | 3300039093 | Ga0400489_76132 | Ga0400489_76132_269_907 | 212 |
| 479 | 3300044673 | Ga0453683_0105451 | Ga0453683_0105451_264_941 | 212 |
| 480 | 3300044712 | Ga0453684_0011762 | Ga0453684_0011762_7268_7912 | 212 |
| 481 | 3300047320 | Ga0495672_0000911 | Ga0495672_0000911_5801_6439 | 212 |
| 482 | 3300049522 | Ga0501299_023155 | Ga0501299_023155_438_1121 | 212 |
| 483 | 3300049588 | Ga0501072_0556800 | Ga0501072_0556800_50_688 | 212 |
| 484 | 3300049589 | Ga0501073_0002831 | Ga0501073_0002831_4659_5297 | 212 |
| 485 | 3300050513 | nmdc:mga0rr50_283931_c1 | nmdc:mga0rr50_283931_c1_572_1210 | 212 |
| 486 | 3300002459 | JGI24751J29686_10021274 | JGI24751J29686_100212742 | 213 |
| 487 | 3300005290 | Ga0065712_10087465 | Ga0065712_100874653 | 213 |
| 488 | 3300005290 | Ga0065712_10128456 | Ga0065712_101284562 | 213 |
| 489 | 3300005290 | Ga0065712_10276063 | Ga0065712_102760631 | 213 |
| 490 | 3300005293 | Ga0065715_10142070 | Ga0065715_101420703 | 213 |
| 491 | 3300005295 | Ga0065707_10338296 | Ga0065707_103382962 | 213 |
| 492 | 3300005328 | Ga0070676_10151114 | Ga0070676_101511142 | 213 |
| 493 | 3300005328 | Ga0070676_10427478 | Ga0070676_104274782 | 213 |
| 494 | 3300005329 | Ga0070683_100529077 | Ga0070683_1005290772 | 213 |
| 495 | 3300005330 | Ga0070690_100004162 | Ga0070690_1000041625 | 213 |
| 496 | 3300005331 | Ga0070670_100002699 | Ga0070670_1000026993 | 213 |
| 497 | 3300005331 | Ga0070670_100119293 | Ga0070670_1001192933 | 213 |
| 498 | 3300005331 | Ga0070670_100627597 | Ga0070670_1006275972 | 213 |
| 499 | 3300005331 | Ga0070670_100640967 | Ga0070670_1006409671 | 213 |
| 500 | 3300005333 | Ga0070677_10005848 | Ga0070677_100058483 | 213 |
| 501 | 3300005333 | Ga0070677_10143361 | Ga0070677_101433611 | 213 |
| 502 | 3300005334 | Ga0068869_100032669 | Ga0068869_1000326695 | 213 |
| 503 | 3300005334 | Ga0068869_100283775 | Ga0068869_1002837752 | 213 |
| 504 | 3300005335 | Ga0070666_10007593 | Ga0070666_100075932 | 213 |
| 505 | 3300005335 | Ga0070666_10232264 | Ga0070666_102322642 | 213 |
| 506 | 3300005336 | Ga0070680_100235862 | Ga0070680_1002358622 | 213 |
| 507 | 3300005338 | Ga0068868_100076743 | Ga0068868_1000767433 | 213 |
| 508 | 3300005338 | Ga0068868_100392814 | Ga0068868_1003928142 | 213 |
| 509 | 3300005340 | Ga0070689_100089945 | Ga0070689_1000899452 | 213 |
| 510 | 3300005340 | Ga0070689_100095286 | Ga0070689_1000952862 | 213 |
| 511 | 3300005340 | Ga0070689_100137192 | Ga0070689_1001371923 | 213 |
| 512 | 3300005340 | Ga0070689_100176621 | Ga0070689_1001766211 | 213 |
| 513 | 3300005340 | Ga0070689_100324812 | Ga0070689_1003248122 | 213 |
| 514 | 3300005343 | Ga0070687_100232773 | Ga0070687_1002327732 | 213 |
| 515 | 3300005344 | Ga0070661_100018875 | Ga0070661_1000188753 | 213 |
| 516 | 3300005347 | Ga0070668_100338028 | Ga0070668_1003380282 | 213 |
| 517 | 3300005353 | Ga0070669_100012223 | Ga0070669_1000122233 | 213 |
| 518 | 3300005353 | Ga0070669_100016030 | Ga0070669_1000160305 | 213 |
| 519 | 3300005353 | Ga0070669_100081558 | Ga0070669_1000815583 | 213 |
| 520 | 3300005353 | Ga0070669_100105804 | Ga0070669_1001058042 | 213 |
| 521 | 3300005354 | Ga0070675_100000147 | Ga0070675_10000014714 | 213 |
| 522 | 3300005354 | Ga0070675_100003888 | Ga0070675_1000038883 | 213 |
| 523 | 3300005354 | Ga0070675_100008321 | Ga0070675_10000832112 | 213 |
| 524 | 3300005354 | Ga0070675_100247922 | Ga0070675_1002479222 | 213 |
| 525 | 3300005354 | Ga0070675_100356514 | Ga0070675_1003565142 | 213 |
| 526 | 3300005354 | Ga0070675_100390088 | Ga0070675_1003900882 | 213 |
| 527 | 3300005354 | Ga0070675_100668551 | Ga0070675_1006685512 | 213 |
| 528 | 3300005355 | Ga0070671_100007961 | Ga0070671_1000079613 | 213 |
| 529 | 3300005355 | Ga0070671_100164771 | Ga0070671_1001647712 | 213 |
| 530 | 3300005356 | Ga0070674_100814911 | Ga0070674_1008149111 | 213 |
| 531 | 3300005364 | Ga0070673_100009418 | Ga0070673_1000094184 | 213 |
| 532 | 3300005364 | Ga0070673_100713120 | Ga0070673_1007131201 | 213 |
| 533 | 3300005365 | Ga0070688_100003218 | Ga0070688_10000321814 | 213 |
| 534 | 3300005365 | Ga0070688_100023138 | Ga0070688_1000231384 | 213 |
| 535 | 3300005365 | Ga0070688_100065786 | Ga0070688_1000657861 | 213 |
| 536 | 3300005365 | Ga0070688_100416269 | Ga0070688_1004162692 | 213 |
| 537 | 3300005365 | Ga0070688_100623179 | Ga0070688_1006231791 | 213 |
| 538 | 3300005366 | Ga0070659_100349461 | Ga0070659_1003494612 | 213 |
| 539 | 3300005367 | Ga0070667_100083176 | Ga0070667_1000831762 | 213 |
| 540 | 3300005367 | Ga0070667_100325363 | Ga0070667_1003253631 | 213 |
| 541 | 3300005406 | Ga0070703_10031065 | Ga0070703_100310652 | 213 |
| 542 | 3300005406 | Ga0070703_10040636 | Ga0070703_100406362 | 213 |
| 543 | 3300005406 | Ga0070703_10232710 | Ga0070703_102327101 | 213 |
| 544 | 3300005434 | Ga0070709_10132027 | Ga0070709_101320272 | 213 |
| 545 | 3300005438 | Ga0070701_10051314 | Ga0070701_100513142 | 213 |
| 546 | 3300005438 | Ga0070701_10155126 | Ga0070701_101551262 | 213 |
| 547 | 3300005438 | Ga0070701_10524117 | Ga0070701_105241171 | 213 |
| 548 | 3300005439 | Ga0070711_100465652 | Ga0070711_1004656521 | 213 |
| 549 | 3300005440 | Ga0070705_100038491 | Ga0070705_1000384912 | 213 |
| 550 | 3300005441 | Ga0070700_100004171 | Ga0070700_1000041714 | 213 |
| 551 | 3300005441 | Ga0070700_100004954 | Ga0070700_1000049543 | 213 |
| 552 | 3300005441 | Ga0070700_100143607 | Ga0070700_1001436072 | 213 |
| 553 | 3300005441 | Ga0070700_100694100 | Ga0070700_1006941002 | 213 |
| 554 | 3300005445 | Ga0070708_100260591 | Ga0070708_1002605912 | 213 |
| 555 | 3300005445 | Ga0070708_100422162 | Ga0070708_1004221622 | 213 |
| 556 | 3300005445 | Ga0070708_100905832 | Ga0070708_1009058321 | 213 |
| 557 | 3300005455 | Ga0070663_100009569 | Ga0070663_1000095694 | 213 |
| 558 | 3300005456 | Ga0070678_100016979 | Ga0070678_1000169792 | 213 |
| 559 | 3300005456 | Ga0070678_100055019 | Ga0070678_1000550194 | 213 |
| 560 | 3300005456 | Ga0070678_100071199 | Ga0070678_1000711993 | 213 |
| 561 | 3300005456 | Ga0070678_100137887 | Ga0070678_1001378873 | 213 |
| 562 | 3300005456 | Ga0070678_101014404 | Ga0070678_1010144041 | 213 |
| 563 | 3300005457 | Ga0070662_100276377 | Ga0070662_1002763772 | 213 |
| 564 | 3300005457 | Ga0070662_100989909 | Ga0070662_1009899091 | 213 |
| 565 | 3300005459 | Ga0068867_100002876 | Ga0068867_1000028768 | 213 |
| 566 | 3300005459 | Ga0068867_100093506 | Ga0068867_1000935062 | 213 |
| 567 | 3300005459 | Ga0068867_100094484 | Ga0068867_1000944842 | 213 |
| 568 | 3300005459 | Ga0068867_100345586 | Ga0068867_1003455862 | 213 |
| 569 | 3300005459 | Ga0068867_100383805 | Ga0068867_1003838051 | 213 |
| 570 | 3300005459 | Ga0068867_101115018 | Ga0068867_1011150181 | 213 |
| 571 | 3300005466 | Ga0070685_10019371 | Ga0070685_100193713 | 213 |
| 572 | 3300005466 | Ga0070685_10031005 | Ga0070685_100310054 | 213 |
| 573 | 3300005467 | Ga0070706_100631082 | Ga0070706_1006310822 | 213 |
| 574 | 3300005468 | Ga0070707_100069599 | Ga0070707_1000695993 | 213 |
| 575 | 3300005471 | Ga0070698_100196500 | Ga0070698_1001965002 | 213 |
| 576 | 3300005518 | Ga0070699_100002012 | Ga0070699_10000201213 | 213 |
| 577 | 3300005518 | Ga0070699_100053591 | Ga0070699_1000535913 | 213 |
| 578 | 3300005518 | Ga0070699_100218236 | Ga0070699_1002182361 | 213 |
| 579 | 3300005535 | Ga0070684_100768542 | Ga0070684_1007685421 | 213 |
| 580 | 3300005536 | Ga0070697_100139549 | Ga0070697_1001395493 | 213 |
| 581 | 3300005536 | Ga0070697_100538973 | Ga0070697_1005389731 | 213 |
| 582 | 3300005543 | Ga0070672_100011300 | Ga0070672_1000113006 | 213 |
| 583 | 3300005543 | Ga0070672_100093050 | Ga0070672_1000930502 | 213 |
| 584 | 3300005543 | Ga0070672_100136771 | Ga0070672_1001367713 | 213 |
| 585 | 3300005543 | Ga0070672_100227374 | Ga0070672_1002273742 | 213 |
| 586 | 3300005544 | Ga0070686_100002508 | Ga0070686_1000025088 | 213 |
| 587 | 3300005544 | Ga0070686_100022866 | Ga0070686_1000228662 | 213 |
| 588 | 3300005544 | Ga0070686_100118755 | Ga0070686_1001187553 | 213 |
| 589 | 3300005545 | Ga0070695_100005877 | Ga0070695_1000058773 | 213 |
| 590 | 3300005545 | Ga0070695_100050017 | Ga0070695_1000500172 | 213 |
| 591 | 3300005546 | Ga0070696_100002986 | Ga0070696_10000298612 | 213 |
| 592 | 3300005546 | Ga0070696_100011890 | Ga0070696_1000118906 | 213 |
| 593 | 3300005546 | Ga0070696_100190801 | Ga0070696_1001908012 | 213 |
| 594 | 3300005547 | Ga0070693_100169167 | Ga0070693_1001691672 | 213 |
| 595 | 3300005549 | Ga0070704_100003197 | Ga0070704_1000031975 | 213 |
| 596 | 3300005549 | Ga0070704_100009518 | Ga0070704_1000095182 | 213 |
| 597 | 3300005549 | Ga0070704_100175606 | Ga0070704_1001756062 | 213 |
| 598 | 3300005549 | Ga0070704_100187522 | Ga0070704_1001875222 | 213 |
| 599 | 3300005549 | Ga0070704_100631817 | Ga0070704_1006318171 | 213 |
| 600 | 3300005563 | Ga0068855_100098552 | Ga0068855_1000985524 | 213 |
| 601 | 3300005564 | Ga0070664_100013313 | Ga0070664_1000133133 | 213 |
| 602 | 3300005564 | Ga0070664_100091172 | Ga0070664_1000911723 | 213 |
| 603 | 3300005564 | Ga0070664_100447347 | Ga0070664_1004473471 | 213 |
| 604 | 3300005564 | Ga0070664_100590851 | Ga0070664_1005908512 | 213 |
| 605 | 3300005578 | Ga0068854_100174919 | Ga0068854_1001749192 | 213 |
| 606 | 3300005615 | Ga0070702_100432589 | Ga0070702_1004325892 | 213 |
| 607 | 3300005616 | Ga0068852_101377789 | Ga0068852_1013777891 | 213 |
| 608 | 3300005617 | Ga0068859_100051697 | Ga0068859_1000516975 | 213 |
| 609 | 3300005617 | Ga0068859_100095636 | Ga0068859_1000956364 | 213 |
| 610 | 3300005617 | Ga0068859_100174261 | Ga0068859_1001742612 | 213 |
| 611 | 3300005617 | Ga0068859_100343076 | Ga0068859_1003430761 | 213 |
| 612 | 3300005617 | Ga0068859_100481130 | Ga0068859_1004811301 | 213 |
| 613 | 3300005618 | Ga0068864_100008151 | Ga0068864_1000081514 | 213 |
| 614 | 3300005618 | Ga0068864_100029037 | Ga0068864_1000290373 | 213 |
| 615 | 3300005618 | Ga0068864_100038432 | Ga0068864_1000384322 | 213 |
| 616 | 3300005618 | Ga0068864_100111730 | Ga0068864_1001117302 | 213 |
| 617 | 3300005618 | Ga0068864_100177764 | Ga0068864_1001777642 | 213 |
| 618 | 3300005618 | Ga0068864_100471794 | Ga0068864_1004717942 | 213 |
| 619 | 3300005719 | Ga0068861_100005416 | Ga0068861_1000054164 | 213 |
| 620 | 3300005719 | Ga0068861_100045160 | Ga0068861_1000451602 | 213 |
| 621 | 3300005719 | Ga0068861_100253404 | Ga0068861_1002534043 | 213 |
| 622 | 3300005719 | Ga0068861_100454974 | Ga0068861_1004549742 | 213 |
| 623 | 3300005719 | Ga0068861_100685254 | Ga0068861_1006852541 | 213 |
| 624 | 3300005840 | Ga0068870_10001025 | Ga0068870_1000102515 | 213 |
| 625 | 3300005841 | Ga0068863_100002234 | Ga0068863_10000223420 | 213 |
| 626 | 3300005841 | Ga0068863_100165117 | Ga0068863_1001651171 | 213 |
| 627 | 3300005841 | Ga0068863_100168822 | Ga0068863_1001688223 | 213 |
| 628 | 3300005842 | Ga0068858_100001888 | Ga0068858_1000018887 | 213 |
| 629 | 3300005842 | Ga0068858_100030600 | Ga0068858_1000306002 | 213 |
| 630 | 3300005842 | Ga0068858_100038117 | Ga0068858_1000381174 | 213 |
| 631 | 3300005842 | Ga0068858_100292889 | Ga0068858_1002928892 | 213 |
| 632 | 3300005843 | Ga0068860_100054885 | Ga0068860_1000548853 | 213 |
| 633 | 3300005843 | Ga0068860_100066357 | Ga0068860_1000663572 | 213 |
| 634 | 3300005844 | Ga0068862_100006477 | Ga0068862_1000064773 | 213 |
| 635 | 3300005844 | Ga0068862_100030874 | Ga0068862_1000308743 | 213 |
| 636 | 3300005844 | Ga0068862_100042813 | Ga0068862_1000428133 | 213 |
| 637 | 3300005844 | Ga0068862_100218963 | Ga0068862_1002189632 | 213 |
| 638 | 3300005937 | Ga0081455_10214401 | Ga0081455_102144012 | 213 |
| 639 | 3300005985 | Ga0081539_10146522 | Ga0081539_101465221 | 213 |
| 640 | 3300006173 | Ga0070716_100514022 | Ga0070716_1005140222 | 213 |
| 641 | 3300006173 | Ga0070716_100639853 | Ga0070716_1006398531 | 213 |
| 642 | 3300006175 | Ga0070712_100135942 | Ga0070712_1001359422 | 213 |
| 643 | 3300006237 | Ga0097621_100023648 | Ga0097621_1000236483 | 213 |
| 644 | 3300006237 | Ga0097621_100091837 | Ga0097621_1000918374 | 213 |
| 645 | 3300006358 | Ga0068871_100010328 | Ga0068871_1000103284 | 213 |
| 646 | 3300006358 | Ga0068871_100026278 | Ga0068871_1000262782 | 213 |
| 647 | 3300006358 | Ga0068871_100193809 | Ga0068871_1001938092 | 213 |
| 648 | 3300006358 | Ga0068871_100340182 | Ga0068871_1003401822 | 213 |
| 649 | 3300006844 | Ga0075428_100012493 | Ga0075428_10001249313 | 213 |
| 650 | 3300006844 | Ga0075428_100018081 | Ga0075428_1000180814 | 213 |
| 651 | 3300006844 | Ga0075428_100055313 | Ga0075428_1000553133 | 213 |
| 652 | 3300006844 | Ga0075428_100066734 | Ga0075428_1000667343 | 213 |
| 653 | 3300006844 | Ga0075428_100109374 | Ga0075428_1001093744 | 213 |
| 654 | 3300006844 | Ga0075428_100388623 | Ga0075428_1003886232 | 213 |
| 655 | 3300006844 | Ga0075428_100565104 | Ga0075428_1005651041 | 213 |
| 656 | 3300006846 | Ga0075430_100001196 | Ga0075430_10000119614 | 213 |
| 657 | 3300006846 | Ga0075430_100003466 | Ga0075430_10000346619 | 213 |
| 658 | 3300006846 | Ga0075430_100180315 | Ga0075430_1001803152 | 213 |
| 659 | 3300006846 | Ga0075430_100700891 | Ga0075430_1007008911 | 213 |
| 660 | 3300006847 | Ga0075431_100028775 | Ga0075431_1000287755 | 213 |
| 661 | 3300006847 | Ga0075431_100111492 | Ga0075431_1001114922 | 213 |
| 662 | 3300006847 | Ga0075431_100177222 | Ga0075431_1001772222 | 213 |
| 663 | 3300006847 | Ga0075431_100535423 | Ga0075431_1005354232 | 213 |
| 664 | 3300006847 | Ga0075431_101174045 | Ga0075431_1011740451 | 213 |
| 665 | 3300006852 | Ga0075433_10000936 | Ga0075433_100009368 | 213 |
| 666 | 3300006852 | Ga0075433_10001275 | Ga0075433_100012753 | 213 |
| 667 | 3300006852 | Ga0075433_10013705 | Ga0075433_100137051 | 213 |
| 668 | 3300006852 | Ga0075433_10110458 | Ga0075433_101104581 | 213 |
| 669 | 3300006852 | Ga0075433_10338702 | Ga0075433_103387022 | 213 |
| 670 | 3300006852 | Ga0075433_10381076 | Ga0075433_103810761 | 213 |
| 671 | 3300006871 | Ga0075434_100000049 | Ga0075434_10000004939 | 213 |
| 672 | 3300006871 | Ga0075434_100011998 | Ga0075434_1000119987 | 213 |
| 673 | 3300006871 | Ga0075434_100021443 | Ga0075434_1000214433 | 213 |
| 674 | 3300006871 | Ga0075434_100046934 | Ga0075434_1000469343 | 213 |
| 675 | 3300006871 | Ga0075434_100047314 | Ga0075434_1000473144 | 213 |
| 676 | 3300006871 | Ga0075434_100132783 | Ga0075434_1001327833 | 213 |
| 677 | 3300006871 | Ga0075434_100187017 | Ga0075434_1001870173 | 213 |
| 678 | 3300006871 | Ga0075434_100634562 | Ga0075434_1006345621 | 213 |
| 679 | 3300006880 | Ga0075429_100044586 | Ga0075429_1000445863 | 213 |
| 680 | 3300006880 | Ga0075429_100161158 | Ga0075429_1001611582 | 213 |
| 681 | 3300006880 | Ga0075429_100213590 | Ga0075429_1002135901 | 213 |
| 682 | 3300006880 | Ga0075429_100215362 | Ga0075429_1002153623 | 213 |
| 683 | 3300006880 | Ga0075429_100425496 | Ga0075429_1004254962 | 213 |
| 684 | 3300006881 | Ga0068865_100086899 | Ga0068865_1000868992 | 213 |
| 685 | 3300006914 | Ga0075436_100000420 | Ga0075436_10000042020 | 213 |
| 686 | 3300006914 | Ga0075436_100019413 | Ga0075436_1000194132 | 213 |
| 687 | 3300006914 | Ga0075436_100019739 | Ga0075436_1000197394 | 213 |
| 688 | 3300006931 | Ga0097620_100051695 | Ga0097620_1000516953 | 213 |
| 689 | 3300006931 | Ga0097620_100095631 | Ga0097620_1000956314 | 213 |
| 690 | 3300006931 | Ga0097620_100174262 | Ga0097620_1001742622 | 213 |
| 691 | 3300006931 | Ga0097620_100343077 | Ga0097620_1003430771 | 213 |
| 692 | 3300006931 | Ga0097620_100481101 | Ga0097620_1004811011 | 213 |
| 693 | 3300007076 | Ga0075435_100000059 | Ga0075435_10000005937 | 213 |
| 694 | 3300007076 | Ga0075435_100004605 | Ga0075435_1000046054 | 213 |
| 695 | 3300007076 | Ga0075435_100005562 | Ga0075435_1000055628 | 213 |
| 696 | 3300007076 | Ga0075435_100013234 | Ga0075435_1000132344 | 213 |
| 697 | 3300007076 | Ga0075435_100057562 | Ga0075435_1000575623 | 213 |
| 698 | 3300007076 | Ga0075435_100154261 | Ga0075435_1001542612 | 213 |
| 699 | 3300007076 | Ga0075435_100233022 | Ga0075435_1002330222 | 213 |
| 700 | 3300007076 | Ga0075435_100287762 | Ga0075435_1002877621 | 213 |
| 701 | 3300009094 | Ga0111539_10000326 | Ga0111539_1000032640 | 213 |
| 702 | 3300009094 | Ga0111539_10004673 | Ga0111539_100046735 | 213 |
| 703 | 3300009094 | Ga0111539_10004769 | Ga0111539_1000476917 | 213 |
| 704 | 3300009094 | Ga0111539_10017167 | Ga0111539_100171673 | 213 |
| 705 | 3300009094 | Ga0111539_10042960 | Ga0111539_100429603 | 213 |
| 706 | 3300009094 | Ga0111539_10054412 | Ga0111539_100544123 | 213 |
| 707 | 3300009094 | Ga0111539_10057964 | Ga0111539_100579642 | 213 |
| 708 | 3300009094 | Ga0111539_10078245 | Ga0111539_100782454 | 213 |
| 709 | 3300009094 | Ga0111539_10123247 | Ga0111539_101232473 | 213 |
| 710 | 3300009094 | Ga0111539_10621651 | Ga0111539_106216512 | 213 |
| 711 | 3300009094 | Ga0111539_10646306 | Ga0111539_106463062 | 213 |
| 712 | 3300009098 | Ga0105245_10267491 | Ga0105245_102674912 | 213 |
| 713 | 3300009101 | Ga0105247_10003020 | Ga0105247_1000302010 | 213 |
| 714 | 3300009101 | Ga0105247_10010076 | Ga0105247_100100766 | 213 |
| 715 | 3300009101 | Ga0105247_10270811 | Ga0105247_102708111 | 213 |
| 716 | 3300009147 | Ga0114129_10002862 | Ga0114129_1000286220 | 213 |
| 717 | 3300009147 | Ga0114129_10006748 | Ga0114129_1000674820 | 213 |
| 718 | 3300009147 | Ga0114129_10008062 | Ga0114129_1000806213 | 213 |
| 719 | 3300009147 | Ga0114129_10031782 | Ga0114129_100317822 | 213 |
| 720 | 3300009147 | Ga0114129_10038284 | Ga0114129_100382843 | 213 |
| 721 | 3300009147 | Ga0114129_10049334 | Ga0114129_100493344 | 213 |
| 722 | 3300009147 | Ga0114129_10056630 | Ga0114129_100566301 | 213 |
| 723 | 3300009147 | Ga0114129_10063676 | Ga0114129_100636764 | 213 |
| 724 | 3300009147 | Ga0114129_10082166 | Ga0114129_100821663 | 213 |
| 725 | 3300009147 | Ga0114129_10204942 | Ga0114129_102049422 | 213 |
| 726 | 3300009147 | Ga0114129_10252394 | Ga0114129_102523943 | 213 |
| 727 | 3300009147 | Ga0114129_10706218 | Ga0114129_107062182 | 213 |
| 728 | 3300009147 | Ga0114129_10753893 | Ga0114129_107538932 | 213 |
| 729 | 3300009147 | Ga0114129_10787619 | Ga0114129_107876191 | 213 |
| 730 | 3300009147 | Ga0114129_10951071 | Ga0114129_109510711 | 213 |
| 731 | 3300009148 | Ga0105243_10025094 | Ga0105243_100250942 | 213 |
| 732 | 3300009148 | Ga0105243_10872003 | Ga0105243_108720032 | 213 |
| 733 | 3300009176 | Ga0105242_10004726 | Ga0105242_1000472617 | 213 |
| 734 | 3300009176 | Ga0105242_10098152 | Ga0105242_100981523 | 213 |
| 735 | 3300009176 | Ga0105242_10847090 | Ga0105242_108470902 | 213 |
| 736 | 3300009177 | Ga0105248_10013509 | Ga0105248_100135093 | 213 |
| 737 | 3300009177 | Ga0105248_10017801 | Ga0105248_100178018 | 213 |
| 738 | 3300009177 | Ga0105248_10081647 | Ga0105248_100816473 | 213 |
| 739 | 3300009177 | Ga0105248_10126720 | Ga0105248_101267203 | 213 |
| 740 | 3300009177 | Ga0105248_10139979 | Ga0105248_101399793 | 213 |
| 741 | 3300009177 | Ga0105248_10151210 | Ga0105248_101512102 | 213 |
| 742 | 3300009177 | Ga0105248_10811528 | Ga0105248_108115281 | 213 |
| 743 | 3300009177 | Ga0105248_11395260 | Ga0105248_113952602 | 213 |
| 744 | 3300009553 | Ga0105249_10051517 | Ga0105249_100515172 | 213 |
| 745 | 3300009553 | Ga0105249_10269044 | Ga0105249_102690442 | 213 |
| 746 | 3300009553 | Ga0105249_11078758 | Ga0105249_110787581 | 213 |
| 747 | 3300013296 | Ga0157374_10496237 | Ga0157374_104962372 | 213 |
| 748 | 3300013296 | Ga0157374_10554208 | Ga0157374_105542082 | 213 |
| 749 | 3300013297 | Ga0157378_10659056 | Ga0157378_106590561 | 213 |
| 750 | 3300013306 | Ga0163162_10465786 | Ga0163162_104657863 | 213 |
| 751 | 3300013306 | Ga0163162_11271088 | Ga0163162_112710882 | 213 |
| 752 | 3300013308 | Ga0157375_10050333 | Ga0157375_100503334 | 213 |
| 753 | 3300013308 | Ga0157375_10115922 | Ga0157375_101159222 | 213 |
| 754 | 3300013308 | Ga0157375_10212801 | Ga0157375_102128013 | 213 |
| 755 | 3300013308 | Ga0157375_10535202 | Ga0157375_105352022 | 213 |
| 756 | 3300014325 | Ga0163163_10401399 | Ga0163163_104013992 | 213 |
| 757 | 3300014326 | Ga0157380_10003616 | Ga0157380_100036164 | 213 |
| 758 | 3300014326 | Ga0157380_10010138 | Ga0157380_100101384 | 213 |
| 759 | 3300014326 | Ga0157380_10104200 | Ga0157380_101042002 | 213 |
| 760 | 3300014326 | Ga0157380_10106662 | Ga0157380_101066622 | 213 |
| 761 | 3300014326 | Ga0157380_10197607 | Ga0157380_101976072 | 213 |
| 762 | 3300014326 | Ga0157380_10265843 | Ga0157380_102658432 | 213 |
| 763 | 3300014326 | Ga0157380_10319912 | Ga0157380_103199122 | 213 |
| 764 | 3300014326 | Ga0157380_10791525 | Ga0157380_107915251 | 213 |
| 765 | 3300014326 | Ga0157380_11151838 | Ga0157380_111518381 | 213 |
| 766 | 3300014326 | Ga0157380_11331560 | Ga0157380_113315601 | 213 |
| 767 | 3300014745 | Ga0157377_10018169 | Ga0157377_100181693 | 213 |
| 768 | 3300014745 | Ga0157377_10047355 | Ga0157377_100473551 | 213 |
| 769 | 3300014745 | Ga0157377_10095111 | Ga0157377_100951112 | 213 |
| 770 | 3300014745 | Ga0157377_10248787 | Ga0157377_102487871 | 213 |
| 771 | 3300014968 | Ga0157379_10009913 | Ga0157379_100099133 | 213 |
| 772 | 3300014968 | Ga0157379_10017365 | Ga0157379_100173656 | 213 |
| 773 | 3300014968 | Ga0157379_10067559 | Ga0157379_100675592 | 213 |
| 774 | 3300014969 | Ga0157376_10160959 | Ga0157376_101609593 | 213 |
| 775 | 3300014969 | Ga0157376_10431110 | Ga0157376_104311102 | 213 |
| 776 | 3300014969 | Ga0157376_10455653 | Ga0157376_104556532 | 213 |
| 777 | 3300017792 | Ga0163161_10031367 | Ga0163161_100313673 | 213 |
| 778 | 3300025315 | Ga0207697_10000575 | Ga0207697_1000057520 | 213 |
| 779 | 3300025893 | Ga0207682_10001469 | Ga0207682_100014698 | 213 |
| 780 | 3300025893 | Ga0207682_10030408 | Ga0207682_100304083 | 213 |
| 781 | 3300025893 | Ga0207682_10033322 | Ga0207682_100333222 | 213 |
| 782 | 3300025893 | Ga0207682_10129069 | Ga0207682_101290691 | 213 |
| 783 | 3300025898 | Ga0207692_10060517 | Ga0207692_100605174 | 213 |
| 784 | 3300025899 | Ga0207642_10017132 | Ga0207642_100171323 | 213 |
| 785 | 3300025900 | Ga0207710_10003937 | Ga0207710_1000393713 | 213 |
| 786 | 3300025900 | Ga0207710_10047460 | Ga0207710_100474601 | 213 |
| 787 | 3300025900 | Ga0207710_10365696 | Ga0207710_103656962 | 213 |
| 788 | 3300025901 | Ga0207688_10000078 | Ga0207688_100000788 | 213 |
| 789 | 3300025905 | Ga0207685_10107174 | Ga0207685_101071741 | 213 |
| 790 | 3300025907 | Ga0207645_10002104 | Ga0207645_100021043 | 213 |
| 791 | 3300025907 | Ga0207645_10002597 | Ga0207645_100025976 | 213 |
| 792 | 3300025907 | Ga0207645_10128802 | Ga0207645_101288022 | 213 |
| 793 | 3300025908 | Ga0207643_10000706 | Ga0207643_1000070617 | 213 |
| 794 | 3300025908 | Ga0207643_10084543 | Ga0207643_100845432 | 213 |
| 795 | 3300025910 | Ga0207684_10142894 | Ga0207684_101428942 | 213 |
| 796 | 3300025910 | Ga0207684_10681152 | Ga0207684_106811521 | 213 |
| 797 | 3300025915 | Ga0207693_10013276 | Ga0207693_100132766 | 213 |
| 798 | 3300025916 | Ga0207663_10870600 | Ga0207663_108706001 | 213 |
| 799 | 3300025917 | Ga0207660_10037729 | Ga0207660_100377292 | 213 |
| 800 | 3300025918 | Ga0207662_10001063 | Ga0207662_100010633 | 213 |
| 801 | 3300025920 | Ga0207649_10018165 | Ga0207649_100181653 | 213 |
| 802 | 3300025923 | Ga0207681_10023929 | Ga0207681_100239295 | 213 |
| 803 | 3300025923 | Ga0207681_10095334 | Ga0207681_100953342 | 213 |
| 804 | 3300025923 | Ga0207681_10162286 | Ga0207681_101622862 | 213 |
| 805 | 3300025923 | Ga0207681_10194009 | Ga0207681_101940091 | 213 |
| 806 | 3300025924 | Ga0207694_10130066 | Ga0207694_101300662 | 213 |
| 807 | 3300025925 | Ga0207650_10007478 | Ga0207650_1000747813 | 213 |
| 808 | 3300025925 | Ga0207650_10070542 | Ga0207650_100705422 | 213 |
| 809 | 3300025925 | Ga0207650_10150803 | Ga0207650_101508031 | 213 |
| 810 | 3300025925 | Ga0207650_10261694 | Ga0207650_102616942 | 213 |
| 811 | 3300025925 | Ga0207650_10601054 | Ga0207650_106010541 | 213 |
| 812 | 3300025926 | Ga0207659_10000075 | Ga0207659_1000007556 | 213 |
| 813 | 3300025926 | Ga0207659_10000939 | Ga0207659_1000093921 | 213 |
| 814 | 3300025926 | Ga0207659_10002741 | Ga0207659_100027413 | 213 |
| 815 | 3300025926 | Ga0207659_10132383 | Ga0207659_101323832 | 213 |
| 816 | 3300025926 | Ga0207659_10270178 | Ga0207659_102701782 | 213 |
| 817 | 3300025926 | Ga0207659_10635974 | Ga0207659_106359742 | 213 |
| 818 | 3300025926 | Ga0207659_10870072 | Ga0207659_108700721 | 213 |
| 819 | 3300025931 | Ga0207644_10096143 | Ga0207644_100961433 | 213 |
| 820 | 3300025931 | Ga0207644_10102458 | Ga0207644_101024583 | 213 |
| 821 | 3300025933 | Ga0207706_10026033 | Ga0207706_100260334 | 213 |
| 822 | 3300025933 | Ga0207706_10402085 | Ga0207706_104020852 | 213 |
| 823 | 3300025934 | Ga0207686_10032259 | Ga0207686_100322592 | 213 |
| 824 | 3300025935 | Ga0207709_10005269 | Ga0207709_100052696 | 213 |
| 825 | 3300025936 | Ga0207670_10018572 | Ga0207670_100185723 | 213 |
| 826 | 3300025936 | Ga0207670_10114531 | Ga0207670_101145312 | 213 |
| 827 | 3300025936 | Ga0207670_10153793 | Ga0207670_101537932 | 213 |
| 828 | 3300025936 | Ga0207670_10281125 | Ga0207670_102811252 | 213 |
| 829 | 3300025937 | Ga0207669_10038016 | Ga0207669_100380162 | 213 |
| 830 | 3300025937 | Ga0207669_10095631 | Ga0207669_100956312 | 213 |
| 831 | 3300025937 | Ga0207669_10377503 | Ga0207669_103775032 | 213 |
| 832 | 3300025938 | Ga0207704_10006357 | Ga0207704_100063576 | 213 |
| 833 | 3300025938 | Ga0207704_10173104 | Ga0207704_101731042 | 213 |
| 834 | 3300025938 | Ga0207704_10883530 | Ga0207704_108835301 | 213 |
| 835 | 3300025939 | Ga0207665_10294556 | Ga0207665_102945562 | 213 |
| 836 | 3300025940 | Ga0207691_10008047 | Ga0207691_1000804713 | 213 |
| 837 | 3300025940 | Ga0207691_10064712 | Ga0207691_100647125 | 213 |
| 838 | 3300025940 | Ga0207691_10200556 | Ga0207691_102005563 | 213 |
| 839 | 3300025940 | Ga0207691_10374381 | Ga0207691_103743812 | 213 |
| 840 | 3300025940 | Ga0207691_10569750 | Ga0207691_105697501 | 213 |
| 841 | 3300025940 | Ga0207691_10713245 | Ga0207691_107132452 | 213 |
| 842 | 3300025941 | Ga0207711_10174978 | Ga0207711_101749782 | 213 |
| 843 | 3300025941 | Ga0207711_10691119 | Ga0207711_106911192 | 213 |
| 844 | 3300025941 | Ga0207711_10825436 | Ga0207711_108254361 | 213 |
| 845 | 3300025942 | Ga0207689_10004341 | Ga0207689_100043417 | 213 |
| 846 | 3300025942 | Ga0207689_10009073 | Ga0207689_100090732 | 213 |
| 847 | 3300025942 | Ga0207689_10111980 | Ga0207689_101119802 | 213 |
| 848 | 3300025945 | Ga0207679_10004433 | Ga0207679_100044334 | 213 |
| 849 | 3300025945 | Ga0207679_10024651 | Ga0207679_100246512 | 213 |
| 850 | 3300025960 | Ga0207651_10001655 | Ga0207651_100016558 | 213 |
| 851 | 3300025960 | Ga0207651_10139926 | Ga0207651_101399262 | 213 |
| 852 | 3300025972 | Ga0207668_10203382 | Ga0207668_102033822 | 213 |
| 853 | 3300025981 | Ga0207640_10620184 | Ga0207640_106201841 | 213 |
| 854 | 3300026023 | Ga0207677_10423021 | Ga0207677_104230212 | 213 |
| 855 | 3300026035 | Ga0207703_10010388 | Ga0207703_100103883 | 213 |
| 856 | 3300026035 | Ga0207703_10015685 | Ga0207703_100156855 | 213 |
| 857 | 3300026035 | Ga0207703_10236358 | Ga0207703_102363582 | 213 |
| 858 | 3300026035 | Ga0207703_10326843 | Ga0207703_103268432 | 213 |
| 859 | 3300026067 | Ga0207678_10011052 | Ga0207678_100110525 | 213 |
| 860 | 3300026075 | Ga0207708_10000853 | Ga0207708_1000085321 | 213 |
| 861 | 3300026075 | Ga0207708_10002902 | Ga0207708_1000290213 | 213 |
| 862 | 3300026075 | Ga0207708_10004792 | Ga0207708_100047925 | 213 |
| 863 | 3300026075 | Ga0207708_10337523 | Ga0207708_103375232 | 213 |
| 864 | 3300026088 | Ga0207641_10005189 | Ga0207641_1000518910 | 213 |
| 865 | 3300026088 | Ga0207641_10029000 | Ga0207641_100290003 | 213 |
| 866 | 3300026088 | Ga0207641_10147973 | Ga0207641_101479733 | 213 |
| 867 | 3300026088 | Ga0207641_10465013 | Ga0207641_104650131 | 213 |
| 868 | 3300026088 | Ga0207641_10540184 | Ga0207641_105401842 | 213 |
| 869 | 3300026088 | Ga0207641_10781211 | Ga0207641_107812111 | 213 |
| 870 | 3300026088 | Ga0207641_11090744 | Ga0207641_110907441 | 213 |
| 871 | 3300026089 | Ga0207648_10001158 | Ga0207648_1000115821 | 213 |
| 872 | 3300026089 | Ga0207648_10005943 | Ga0207648_100059435 | 213 |
| 873 | 3300026089 | Ga0207648_10203058 | Ga0207648_102030582 | 213 |
| 874 | 3300026089 | Ga0207648_10276221 | Ga0207648_102762212 | 213 |
| 875 | 3300026089 | Ga0207648_10549894 | Ga0207648_105498942 | 213 |
| 876 | 3300026089 | Ga0207648_10637825 | Ga0207648_106378251 | 213 |
| 877 | 3300026095 | Ga0207676_10009537 | Ga0207676_100095374 | 213 |
| 878 | 3300026095 | Ga0207676_10020875 | Ga0207676_100208752 | 213 |
| 879 | 3300026095 | Ga0207676_10070443 | Ga0207676_100704432 | 213 |
| 880 | 3300026095 | Ga0207676_10648925 | Ga0207676_106489251 | 213 |
| 881 | 3300026116 | Ga0207674_10426578 | Ga0207674_104265782 | 213 |
| 882 | 3300026118 | Ga0207675_100004884 | Ga0207675_1000048847 | 213 |
| 883 | 3300026118 | Ga0207675_100025879 | Ga0207675_1000258795 | 213 |
| 884 | 3300026118 | Ga0207675_100126472 | Ga0207675_1001264722 | 213 |
| 885 | 3300026118 | Ga0207675_100992494 | Ga0207675_1009924942 | 213 |
| 886 | 3300026121 | Ga0207683_10002196 | Ga0207683_100021964 | 213 |
| 887 | 3300026121 | Ga0207683_10011362 | Ga0207683_100113625 | 213 |
| 888 | 3300026121 | Ga0207683_10031021 | Ga0207683_100310217 | 213 |
| 889 | 3300026121 | Ga0207683_10116045 | Ga0207683_101160453 | 213 |
| 890 | 3300026121 | Ga0207683_10187113 | Ga0207683_101871131 | 213 |
| 891 | 3300026142 | Ga0207698_10304153 | Ga0207698_103041533 | 213 |
| 892 | 3300027907 | Ga0207428_10000089 | Ga0207428_1000008938 | 213 |
| 893 | 3300027907 | Ga0207428_10005145 | Ga0207428_1000514511 | 213 |
| 894 | 3300027907 | Ga0207428_10036379 | Ga0207428_100363793 | 213 |
| 895 | 3300027907 | Ga0207428_10041262 | Ga0207428_100412622 | 213 |
| 896 | 3300027907 | Ga0207428_10087031 | Ga0207428_100870312 | 213 |
| 897 | 3300027907 | Ga0207428_10096747 | Ga0207428_100967473 | 213 |
| 898 | 3300028379 | Ga0268266_10356310 | Ga0268266_103563102 | 213 |
| 899 | 3300028379 | Ga0268266_10773398 | Ga0268266_107733981 | 213 |
| 900 | 3300028380 | Ga0268265_10014428 | Ga0268265_100144284 | 213 |
| 901 | 3300028380 | Ga0268265_10033808 | Ga0268265_100338084 | 213 |
| 902 | 3300028380 | Ga0268265_10047123 | Ga0268265_100471233 | 213 |
| 903 | 3300028380 | Ga0268265_10468822 | Ga0268265_104688222 | 213 |
| 904 | 3300028381 | Ga0268264_10042594 | Ga0268264_100425943 | 213 |
| 905 | 3300028381 | Ga0268264_10058684 | Ga0268264_100586843 | 213 |
| 906 | 3300031238 | Ga0265332_10114114 | Ga0265332_101141141 | 213 |
| 907 | 3300031548 | Ga0307408_100278417 | Ga0307408_1002784172 | 213 |
| 908 | 3300031852 | Ga0307410_10296321 | Ga0307410_102963211 | 213 |
| 909 | 3300032002 | Ga0307416_100052642 | Ga0307416_1000526423 | 213 |
| 910 | 3300032002 | Ga0307416_100105257 | Ga0307416_1001052572 | 213 |
| 911 | 3300032002 | Ga0307416_100138240 | Ga0307416_1001382402 | 213 |
| 912 | 3300032002 | Ga0307416_100390432 | Ga0307416_1003904322 | 213 |
| 913 | 3300032002 | Ga0307416_100497949 | Ga0307416_1004979492 | 213 |
| 914 | 3300032002 | Ga0307416_100656294 | Ga0307416_1006562941 | 213 |
| 915 | 3300032005 | Ga0307411_10474862 | Ga0307411_104748621 | 213 |
| 916 | 3300032126 | Ga0307415_100077488 | Ga0307415_1000774884 | 213 |
| 917 | 3300032126 | Ga0307415_100358610 | Ga0307415_1003586102 | 213 |
| 918 | 3300034819 | Ga0373958_0034645 | Ga0373958_0034645_270_911 | 213 |
| 919 | 3300035083 | Ga0373926_0084736 | Ga0373926_0084736_421_1062 | 213 |
| 920 | 3300035090 | Ga0373949_0111813 | Ga0373949_0111813_87_728 | 213 |
| 921 | 3300035090 | Ga0373949_0133286 | Ga0373949_0133286_55_696 | 213 |
| 922 | 3300035114 | Ga0373939_0177465 | Ga0373939_0177465_26_667 | 213 |
| 923 | 3300035116 | Ga0373945_0023198 | Ga0373945_0023198_905_1546 | 213 |
| 924 | 3300035170 | Ga0373943_0223882 | Ga0373943_0223882_114_755 | 213 |
| 925 | 3300035695 | Ga0373927_0525940 | Ga0373927_0525940_45_686 | 213 |
| 926 | 3300036401 | Ga0373937_0285603 | Ga0373937_0285603_315_956 | 213 |
| 927 | 3300036401 | Ga0373937_0631680 | Ga0373937_0631680_34_675 | 213 |
| 928 | 3300037068 | Ga0373925_0027581 | Ga0373925_0027581_352_993 | 213 |
| 929 | 3300037068 | Ga0373925_0552846 | Ga0373925_0552846_119_760 | 213 |
| 930 | 3300041408 | Ga0439453_0003992 | Ga0439453_0003992_376_1017 | 213 |
| 931 | 3300041512 | Ga0451853_1940769 | Ga0451853_1940769_632_1273 | 213 |
| 932 | 3300041512 | Ga0451853_2329500 | Ga0451853_2329500_44_685 | 213 |
| 933 | 3300041999 | Ga0439433_0017488 | Ga0439433_0017488_426_1067 | 213 |
| 934 | 3300042009 | Ga0439451_016701 | Ga0439451_016701_369_1046 | 213 |
| 935 | 3300042125 | Ga0450923_016385 | Ga0450923_016385_633_1274 | 213 |
| 936 | 3300042125 | Ga0450923_065484 | Ga0450923_065484_138_779 | 213 |
| 937 | 3300042133 | Ga0450896_002429 | Ga0450896_002429_609_1250 | 213 |
| 938 | 3300042133 | Ga0450896_015549 | Ga0450896_015549_13_654 | 213 |
| 939 | 3300042435 | Ga0439434_0110659 | Ga0439434_0110659_172_843 | 213 |
| 940 | 3300042435 | Ga0439434_0115256 | Ga0439434_0115256_76_717 | 213 |
| 941 | 3300042436 | Ga0439435_0021616 | Ga0439435_0021616_170_811 | 213 |
| 942 | 3300042461 | Ga0439460_0076306 | Ga0439460_0076306_225_866 | 213 |
| 943 | 3300042876 | Ga0451577_0039088 | Ga0451577_0039088_1219_1872 | 213 |
| 944 | 3300042876 | Ga0451577_0091136 | Ga0451577_0091136_1030_1671 | 213 |
| 945 | 3300044712 | Ga0453684_0039023 | Ga0453684_0039023_3894_4535 | 213 |
| 946 | 3300046516 | Ga0495628_0406239 | Ga0495628_0406239_125_766 | 213 |
| 947 | 3300046529 | Ga0495652_0417177 | Ga0495652_0417177_78_719 | 213 |
| 948 | 3300046537 | Ga0495598_0027179 | Ga0495598_0027179_638_1279 | 213 |
| 949 | 3300046537 | Ga0495598_0161640 | Ga0495598_0161640_65_727 | 213 |
| 950 | 3300046539 | Ga0495621_0000253 | Ga0495621_0000253_9481_10122 | 213 |
| 951 | 3300046558 | Ga0495633_0155955 | Ga0495633_0155955_54_695 | 213 |
| 952 | 3300046664 | Ga0495659_0017881 | Ga0495659_0017881_928_1569 | 213 |
| 953 | 3300046678 | Ga0495599_0363725 | Ga0495599_0363725_213_854 | 213 |
| 954 | 3300046681 | Ga0495647_0184952 | Ga0495647_0184952_136_777 | 213 |
| 955 | 3300046691 | Ga0495670_0254419 | Ga0495670_0254419_276_917 | 213 |
| 956 | 3300048907 | Ga0496104_0076988 | Ga0496104_0076988_721_1362 | 213 |
| 957 | 3300048907 | Ga0496104_0208295 | Ga0496104_0208295_191_832 | 213 |
| 958 | 3300048909 | Ga0496106_0417224 | Ga0496106_0417224_286_936 | 213 |
| 959 | 3300048911 | Ga0496108_0685324 | Ga0496108_0685324_211_852 | 213 |
| 960 | 3300048912 | Ga0496109_0222921 | Ga0496109_0222921_178_819 | 213 |
| 961 | 3300048915 | Ga0496112_0005329 | Ga0496112_0005329_3230_3871 | 213 |
| 962 | 3300048915 | Ga0496112_0005642 | Ga0496112_0005642_8795_9436 | 213 |
| 963 | 3300048915 | Ga0496112_0110221 | Ga0496112_0110221_1953_2594 | 213 |
| 964 | 3300048916 | Ga0496113_0049333 | Ga0496113_0049333_935_1576 | 213 |
| 965 | 3300049521 | Ga0501298_032825 | Ga0501298_032825_108_749 | 213 |
| 966 | 3300049570 | Ga0501033_0091133 | Ga0501033_0091133_499_1140 | 213 |
| 967 | 3300049572 | Ga0501036_0301083 | Ga0501036_0301083_266_913 | 213 |
| 968 | 3300049574 | Ga0501038_0254514 | Ga0501038_0254514_634_1332 | 213 |
| 969 | 3300049576 | Ga0501040_0013239 | Ga0501040_0013239_432_1073 | 213 |
| 970 | 3300049576 | Ga0501040_0128933 | Ga0501040_0128933_908_1549 | 213 |
| 971 | 3300049577 | Ga0501041_0018990 | Ga0501041_0018990_2763_3461 | 213 |
| 972 | 3300049577 | Ga0501041_0069816 | Ga0501041_0069816_244_885 | 213 |
| 973 | 3300049578 | Ga0501042_0106405 | Ga0501042_0106405_1259_1918 | 213 |
| 974 | 3300049578 | Ga0501042_0237533 | Ga0501042_0237533_74_721 | 213 |
| 975 | 3300049578 | Ga0501042_0245446 | Ga0501042_0245446_74_715 | 213 |
| 976 | 3300049582 | Ga0501048_0191872 | Ga0501048_0191872_98_739 | 213 |
| 977 | 3300049582 | Ga0501048_0197359 | Ga0501048_0197359_571_1269 | 213 |
| 978 | 3300049587 | Ga0501071_0120294 | Ga0501071_0120294_325_1023 | 213 |
| 979 | 3300049588 | Ga0501072_0235406 | Ga0501072_0235406_589_1287 | 213 |
| 980 | 3300049589 | Ga0501073_0055066 | Ga0501073_0055066_1364_2122 | 213 |
| 981 | 3300049591 | Ga0501075_0035944 | Ga0501075_0035944_2722_3420 | 213 |
| 982 | 3300049591 | Ga0501075_0413234 | Ga0501075_0413234_107_748 | 213 |
| 983 | 3300049592 | Ga0501076_0107571 | Ga0501076_0107571_1418_2116 | 213 |
| 984 | 3300049592 | Ga0501076_0232805 | Ga0501076_0232805_322_963 | 213 |
| 985 | 3300049592 | Ga0501076_0776991 | Ga0501076_0776991_116_757 | 213 |
| 986 | 3300049661 | Ga0501217_044275 | Ga0501217_044275_404_1045 | 213 |
| 987 | 3300049679 | Ga0501249_032973 | Ga0501249_032973_140_781 | 213 |
| 988 | 3300049741 | Ga0501079_0048048 | Ga0501079_0048048_2245_2886 | 213 |
| 989 | 3300049741 | Ga0501079_0486125 | Ga0501079_0486125_65_763 | 213 |
| 990 | 3300049742 | Ga0501080_0062248 | Ga0501080_0062248_2633_3274 | 213 |
| 991 | 3300049743 | Ga0501081_0090955 | Ga0501081_0090955_870_1568 | 213 |
| 992 | 3300049779 | Ga0501283_007596 | Ga0501283_007596_158_799 | 213 |
| 993 | 3300049824 | Ga0501045_0258946 | Ga0501045_0258946_613_1254 | 213 |
| 994 | 3300049824 | Ga0501045_0621411 | Ga0501045_0621411_75_773 | 213 |
| 995 | 3300050507 | nmdc:mga05p37_127165_c1 | nmdc:mga05p37_127165_c1_495_1136 | 213 |
| 996 | 3300050507 | nmdc:mga05p37_193021_c1 | nmdc:mga05p37_193021_c1_1203_1844 | 213 |
| 997 | 3300050507 | nmdc:mga05p37_2169_c1 | nmdc:mga05p37_2169_c1_12774_13415 | 213 |
| 998 | 3300050507 | nmdc:mga05p37_30866_c1 | nmdc:mga05p37_30866_c1_5445_6086 | 213 |
| 999 | 3300050507 | nmdc:mga05p37_376704_c1 | nmdc:mga05p37_376704_c1_185_826 | 213 |
| 1000 | 3300050507 | nmdc:mga05p37_411232_c2 | nmdc:mga05p37_411232_c2_47_688 | 213 |
| 1001 | 3300050507 | nmdc:mga05p37_53643_c2 | nmdc:mga05p37_53643_c2_1877_2518 | 213 |
| 1002 | 3300050507 | nmdc:mga05p37_6745_c1 | nmdc:mga05p37_6745_c1_12781_13422 | 213 |
| 1003 | 3300050507 | nmdc:mga05p37_74645_c1 | nmdc:mga05p37_74645_c1_2102_2743 | 213 |
| 1004 | 3300050507 | nmdc:mga05p37_74813_c1 | nmdc:mga05p37_74813_c1_3093_3734 | 213 |
| 1005 | 3300050507 | nmdc:mga05p37_760502_c1 | nmdc:mga05p37_760502_c1_69_710 | 213 |
| 1006 | 3300050508 | nmdc:mga09592_123314_c1 | nmdc:mga09592_123314_c1_1553_2194 | 213 |
| 1007 | 3300050508 | nmdc:mga09592_142368_c1 | nmdc:mga09592_142368_c1_1125_1766 | 213 |
| 1008 | 3300050508 | nmdc:mga09592_160271_c1 | nmdc:mga09592_160271_c1_1107_1748 | 213 |
| 1009 | 3300050508 | nmdc:mga09592_397043_c1 | nmdc:mga09592_397043_c1_520_1161 | 213 |
| 1010 | 3300050508 | nmdc:mga09592_477817_c1 | nmdc:mga09592_477817_c1_30_671 | 213 |
| 1011 | 3300050508 | nmdc:mga09592_4935_c1 | nmdc:mga09592_4935_c1_5241_5882 | 213 |
| 1012 | 3300050509 | nmdc:mga0qj67_116349_c1 | nmdc:mga0qj67_116349_c1_384_1025 | 213 |
| 1013 | 3300050509 | nmdc:mga0qj67_212178_c1 | nmdc:mga0qj67_212178_c1_896_1537 | 213 |
| 1014 | 3300050509 | nmdc:mga0qj67_256855_c1 | nmdc:mga0qj67_256855_c1_373_1014 | 213 |
| 1015 | 3300050510 | nmdc:mga06r32_1105884_c1 | nmdc:mga06r32_1105884_c1_80_721 | 213 |
| 1016 | 3300050510 | nmdc:mga06r32_1114373_c1 | nmdc:mga06r32_1114373_c1_78_719 | 213 |
| 1017 | 3300050510 | nmdc:mga06r32_185062_c1 | nmdc:mga06r32_185062_c1_1143_1784 | 213 |
| 1018 | 3300050510 | nmdc:mga06r32_55337_c1 | nmdc:mga06r32_55337_c1_1464_2105 | 213 |
| 1019 | 3300050510 | nmdc:mga06r32_58087_c1 | nmdc:mga06r32_58087_c1_80_721 | 213 |
| 1020 | 3300050511 | nmdc:mga08y16_1340_c1 | nmdc:mga08y16_1340_c1_16013_16654 | 213 |
| 1021 | 3300050511 | nmdc:mga08y16_1540_c1 | nmdc:mga08y16_1540_c1_694_1335 | 213 |
| 1022 | 3300050511 | nmdc:mga08y16_159603_c1 | nmdc:mga08y16_159603_c1_1550_2191 | 213 |
| 1023 | 3300050511 | nmdc:mga08y16_244510_c1 | nmdc:mga08y16_244510_c1_589_1230 | 213 |
| 1024 | 3300050511 | nmdc:mga08y16_2595_c1 | nmdc:mga08y16_2595_c1_6479_7120 | 213 |
| 1025 | 3300050511 | nmdc:mga08y16_45702_c1 | nmdc:mga08y16_45702_c1_2404_3045 | 213 |
| 1026 | 3300050511 | nmdc:mga08y16_55323_c1 | nmdc:mga08y16_55323_c1_109_750 | 213 |
| 1027 | 3300050511 | nmdc:mga08y16_75653_c1 | nmdc:mga08y16_75653_c1_1580_2221 | 213 |
| 1028 | 3300050512 | nmdc:mga0n895_108093_c1 | nmdc:mga0n895_108093_c1_2028_2669 | 213 |
| 1029 | 3300050512 | nmdc:mga0n895_14984_c1 | nmdc:mga0n895_14984_c1_2920_3561 | 213 |
| 1030 | 3300050512 | nmdc:mga0n895_1500_c1 | nmdc:mga0n895_1500_c1_12676_13317 | 213 |
| 1031 | 3300050512 | nmdc:mga0n895_18994_c1 | nmdc:mga0n895_18994_c1_3909_4598 | 213 |
| 1032 | 3300050512 | nmdc:mga0n895_223446_c1 | nmdc:mga0n895_223446_c1_1208_1849 | 213 |
| 1033 | 3300050512 | nmdc:mga0n895_308498_c1 | nmdc:mga0n895_308498_c1_445_1086 | 213 |
| 1034 | 3300050512 | nmdc:mga0n895_702168_c1 | nmdc:mga0n895_702168_c1_296_937 | 213 |
| 1035 | 3300050512 | nmdc:mga0n895_95_c1 | nmdc:mga0n895_95_c1_13770_14411 | 213 |
| 1036 | 3300050513 | nmdc:mga0rr50_105623_c1 | nmdc:mga0rr50_105623_c1_924_1565 | 213 |
| 1037 | 3300050513 | nmdc:mga0rr50_13491_c1 | nmdc:mga0rr50_13491_c1_2278_2919 | 213 |
| 1038 | 3300050513 | nmdc:mga0rr50_17771_c1 | nmdc:mga0rr50_17771_c1_67_708 | 213 |
| 1039 | 3300050513 | nmdc:mga0rr50_193363_c1 | nmdc:mga0rr50_193363_c1_393_1034 | 213 |
| 1040 | 3300050513 | nmdc:mga0rr50_28_c1 | nmdc:mga0rr50_28_c1_45929_46570 | 213 |
| 1041 | 3300050513 | nmdc:mga0rr50_4559_c1 | nmdc:mga0rr50_4559_c1_4325_5014 | 213 |
| 1042 | 3300050513 | nmdc:mga0rr50_46608_c1 | nmdc:mga0rr50_46608_c1_2074_2715 | 213 |
| 1043 | 3300050514 | nmdc:mga08x19_11377_c1 | nmdc:mga08x19_11377_c1_3027_3668 | 213 |
| 1044 | 3300050514 | nmdc:mga08x19_121_c1 | nmdc:mga08x19_121_c1_25717_26358 | 213 |
| 1045 | 3300050514 | nmdc:mga08x19_55142_c1 | nmdc:mga08x19_55142_c1_1636_2277 | 213 |
| 1046 | 3300050514 | nmdc:mga08x19_91733_c1 | nmdc:mga08x19_91733_c1_775_1416 | 213 |
| 1047 | 3300050515 | nmdc:mga0a205_1053_c2 | nmdc:mga0a205_1053_c2_6306_6947 | 213 |
| 1048 | 3300050515 | nmdc:mga0a205_384820_c1 | nmdc:mga0a205_384820_c1_565_1215 | 213 |
| 1049 | 3300050515 | nmdc:mga0a205_431012_c1 | nmdc:mga0a205_431012_c1_229_870 | 213 |
| 1050 | 3300050515 | nmdc:mga0a205_476_c1 | nmdc:mga0a205_476_c1_16399_17040 | 213 |
| 1051 | 3300050515 | nmdc:mga0a205_53893_c1 | nmdc:mga0a205_53893_c1_1661_2302 | 213 |
| 1052 | 3300050515 | nmdc:mga0a205_552440_c1 | nmdc:mga0a205_552440_c1_292_981 | 213 |
| 1053 | 3300050515 | nmdc:mga0a205_5677_c1 | nmdc:mga0a205_5677_c1_3629_4270 | 213 |
| 1054 | 3300050515 | nmdc:mga0a205_78431_c1 | nmdc:mga0a205_78431_c1_701_1342 | 213 |
| 1055 | 3300053077 | Ga0495601_0009411 | Ga0495601_0009411_1805_2446 | 213 |
| 1056 | 3300053077 | Ga0495601_0147173 | Ga0495601_0147173_143_784 | 213 |
| 1057 | 3300053085 | Ga0495619_0487330 | Ga0495619_0487330_68_709 | 213 |
| 1058 | 3300053103 | Ga0500555_005302 | Ga0500555_005302_2854_3495 | 213 |
| 1059 | 3300054114 | Ga0501084_0054920 | Ga0501084_0054920_1924_2622 | 213 |
| 1060 | 3300060353 | Ga0501082_0069283 | Ga0501082_0069283_1693_2334 | 213 |
| 1061 | 3300060353 | Ga0501082_0381461 | Ga0501082_0381461_267_908 | 213 |
| 1062 | 3300060353 | Ga0501082_0644367 | Ga0501082_0644367_158_856 | 213 |
| 1063 | 3300060353 | Ga0501082_0703868 | Ga0501082_0703868_209_868 | 213 |
| 1064 | 3300061734 | Ga0530510_0066955 | Ga0530510_0066955_904_1545 | 213 |
| 1065 | 3300061734 | Ga0530510_0288448 | Ga0530510_0288448_187_828 | 213 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6nhl-assembly1.cif.gz_A | crystal structure of quee from escherichia coli | 0.806 | 2 | 202 |
| 5tgs-assembly1.cif.gz_A | crystal structure of quee from bacillus subtilis with methionine bound | 0.8043 | 2 | 206 |
| 5tgs-assembly1.cif.gz_B | crystal structure of quee from bacillus subtilis with methionine bound | 0.7885 | 2 | 206 |
| 5th5-assembly1.cif.gz_A | crystal structure of quee from bacillus subtilis with 6-carboxypterin-5'-deoxyadenosyl ester bound | 0.787 | 2 | 213 |
| 5th5-assembly1.cif.gz_A | crystal structure of quee from bacillus subtilis with 6-carboxypterin-5'-deoxyadenosyl ester bound | 0.78 | 2 | 213 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q59039_1_242_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8286 | 4 | 205 | 3.20.20.70 |
| af_Q2G1X7_4_231_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8202 | 2 | 206 | 3.20.20.70 |
| af_P64554_2_223_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.815 | 1 | 205 | 3.20.20.70 |
| af_P75794_7_292_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.7961 | 22 | 172 | 3.20.20.70 |
| af_Q2G1X7_4_231_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.7895 | 2 | 206 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A381SXU2-F1-model_v4 | Radical SAM core domain-containing protein | 0.9968 | 49 | 213 |
GO:0016829
GO:0051539 |
| AF-A0A7W0LCA8-F1-model_v4 | 7-carboxy-7-deazaguanine synthase | 0.9968 | 66 | 213 |
GO:0051539
|
| AF-A0A2V6KKF6-F1-model_v4 | 7-carboxy-7-deazaguanine synthase | 0.9955 | 44 | 213 |
GO:0016829
GO:0051539 |
| AF-A0A2V5MAR6-F1-model_v4 | 7-carboxy-7-deazaguanine synthase | 0.9955 | 53 | 213 |
GO:0051539
|
| AF-A0A7Y1SHN7-F1-model_v4 | deleted | 0.9948 | 70 | 153 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar