F489337

General Info

Members Datasets Scaffolds Average Seq Length
1063 475 913 427

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2548876994|2550692510
Length 486
Sequence ILGSGVIGVTSAYYLARAGHQVTVLDRQPGPALETSFANAGQISPGYASPWGAPGIPLKALKWMFEEHAPLAIRPDGTLQQLRWMWQMLRNCSADRYAVNKERMVRLAEYSRDCFRELRAATGIDYEGRQQGTLQLFRTQEQFDGAAKDIAVLRQSGVPFELLSREQLAGAEPALAKVSHKLTGGLRLPNDETGDCQLFTTKLAKMAEELGVQFRYDVDIQASARRCLRGGAGFVLRQLPASHRRHSGVSAEGLFDHRAGGRLPRRAGLDHPRRNLQDRRHPLRQPHPRGRHGGSGRFQQELVRGDAYVVALGSYSANFLRRIVDIPVYPLKGYSITVPVVDSRAAPVSTILDETYKIAVTRFDNRIRVGGMAEVVGFNKELNPKRRATLELVVNDLFPGAGNTAQASFWTGLRPMTPDGTPIVGATPLNNLFLNTGHGTLGWTMSCGSGQLLADLISGKRPAIAADDLSMARYLGQRQFSSAVTA

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
5 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
6 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
7 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
8 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
9 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
10 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
11 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
12 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
13 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
14 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
15 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
16 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
17 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
18 2519103095 Burkholderia sp. KJ006 Isolate Nodule
19 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
20 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
21 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
22 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
23 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
24 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
25 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
26 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
27 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
28 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
29 2643221556 Massilia sp. Root1485 Isolate Unclassified
30 2643221558 Rhizobium sp. Root149 Isolate Unclassified
31 2643221645 Massilia sp. Root351 Isolate Unclassified
32 2643221664 Massilia sp. Root418 Isolate Unclassified
33 2643221684 Massilia sp. Root133 Isolate Unclassified
34 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
35 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
36 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
37 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
38 2738541280 Massilia sp. GV090 Isolate Unclassified
39 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
40 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
41 2738541297 Duganella sp. GV083 Isolate Unclassified
42 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
43 2738541300 Massilia sp. GV016 Isolate Unclassified
44 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
45 2738541357 Duganella sp. GV053 Isolate Unclassified
46 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
47 2738543003 Duganella sp. GV066 Isolate Unclassified
48 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
49 2738543018 Massilia sp. GV045 Isolate Unclassified
50 2738543026 Duganella sp. GV089 Isolate Unclassified
51 2738543029 Duganella sp. GV039 Isolate Unclassified
52 2738543030 Massilia sp. GV097 Isolate Unclassified
53 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
54 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
55 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
56 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
57 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
58 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
59 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
60 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
61 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
62 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
63 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
64 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
65 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
66 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
67 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
68 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
69 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
70 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
71 2818991450 Burkholderia sp. 604 Isolate Unclassified
72 2818991452 Burkholderia cepacia 561 Isolate Unclassified
73 2821131069 Duganella sp. 1224 Isolate Unclassified
74 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
75 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
76 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
77 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
78 2842711865 Duganella sp. R-73148 Isolate Unclassified
79 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
80 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
81 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
82 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
83 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
84 2857553236 Duganella sp. R-74557 Isolate Unclassified
85 2857558681 Duganella sp. R-74565 Isolate Unclassified
86 2857564685 Duganella sp. R-74599 Isolate Unclassified
87 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
88 2865014394 Pantoea sp. R-71966 Isolate Unclassified
89 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
90 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
91 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
92 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
93 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
94 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
95 2885266251 Ralstonia sp. SET104 Isolate Nodule
96 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
97 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
98 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
99 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
100 2904424332 Duganella sp. 1411 Isolate Rhizosphere
101 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
102 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
103 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
104 2904564687 Burkholderia sp. 571 Isolate Unclassified
105 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
106 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
107 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
108 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
109 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
110 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
111 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
112 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
113 2919476304 Duganella sp. 3397 Isolate Unclassified
114 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
115 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
116 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
117 2928058823 Ralstonia sp. 1138 Isolate Unclassified
118 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
119 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
120 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
121 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
122 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
123 2928163908 Burkholderia sp. 567 Isolate Unclassified
124 2928170801 Burkholderia sp. 572 Isolate Unclassified
125 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
126 2928536128 Burkholderia sola 565 Isolate Unclassified
127 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
128 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
129 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
130 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
131 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
132 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
133 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
134 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
135 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
136 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
137 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
138 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
139 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
140 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
141 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
142 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
143 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
144 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
145 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
146 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
147 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
148 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
149 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
150 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
151 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
152 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
153 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
154 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
155 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
156 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
157 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
158 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
159 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
160 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
161 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
162 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
163 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
164 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
165 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
166 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
167 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
168 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
169 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
170 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
171 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
172 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
173 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
174 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
175 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
176 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
177 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
178 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
179 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
180 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
181 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
182 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
183 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
184 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
185 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
186 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
187 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
188 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
189 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
190 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
191 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
192 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
193 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
194 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
195 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
196 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
197 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
198 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
199 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
200 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
201 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
202 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
203 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
204 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
205 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
206 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
207 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
208 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
209 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
210 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
211 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
212 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
213 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
217 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
219 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
220 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
221 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
222 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
223 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
224 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
225 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
226 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
228 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
229 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
230 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
231 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
232 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
233 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
234 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
235 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
236 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
237 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
238 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
258 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
259 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
260 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
261 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
262 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
263 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
264 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
265 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
266 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
267 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
268 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
269 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
270 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
271 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
272 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
273 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
274 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
275 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
276 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
277 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
278 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
279 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
280 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
281 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
282 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
283 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
284 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
285 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
286 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
287 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
288 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
289 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
290 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
291 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
292 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
293 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
294 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
295 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
296 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
297 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
298 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
299 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
300 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
301 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
302 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
303 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
304 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
305 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
306 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
307 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
308 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
309 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
310 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
311 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
312 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
313 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
314 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
315 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
316 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
317 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
318 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
319 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
320 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
321 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
322 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
323 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
324 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
325 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
326 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
327 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
328 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
329 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
330 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
331 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
332 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
333 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
334 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
335 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
336 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
337 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
338 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
339 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
340 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
341 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
342 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
343 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
344 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
345 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
346 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
347 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
348 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
349 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
350 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
351 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
352 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
353 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
354 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
355 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
356 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
357 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
358 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
359 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
360 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
361 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
362 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
363 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
364 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
365 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
366 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
367 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
368 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
369 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
370 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
371 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
372 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
373 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
374 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
375 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
376 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
377 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
378 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
379 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
380 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
381 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
382 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
383 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
384 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
385 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
386 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
387 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
388 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
389 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
390 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
391 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
392 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
393 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
394 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
395 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
396 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
397 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
398 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
399 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
400 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
401 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
402 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
403 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
404 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
405 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
406 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
407 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
408 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
409 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
410 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
412 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
413 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
416 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
417 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
419 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
421 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
422 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
423 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
424 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
425 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
426 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
427 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
428 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
429 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
430 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
431 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
432 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
433 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
434 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
435 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
436 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
437 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
438 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
439 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
440 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
441 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
442 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
443 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
444 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
445 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
446 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
447 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
448 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
449 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
450 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
451 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
452 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
453 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
454 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
455 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
458 639633007 Azoarcus olearius BH72 Isolate Unclassified
459 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
460 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
461 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
462 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
463 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
464 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
465 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
466 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
467 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
468 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
469 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
470 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
471 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
472 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
473 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
474 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
475 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.38
Metatranscriptomes 1.51
Isolates 14.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.35
Nodule 2.45
Rhizoplane 3.1
Rhizosphere 67.83
Stem 0
Stem Tuber 0
Unclassified 16.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000401 3300001915 Bacteria 13061
2 JGI24740J21852_10000321 3300001979 Bacteria 20355
3 JGI24739J22299_10006043 3300001989 Bacteria 4582
4 JGI24735J21928_10000185 3300002067 Bacteria 22276
5 JGI24735J21928_10000211 3300002067 Bacteria 20387
6 JGI24735J21928_10001957 3300002067 Bacteria 7236
7 JGI24735J21928_10004968 3300002067 Bacteria 4432
8 JGI24735J21928_10008800 3300002067 Bacteria 3257
9 JGI24738J21930_10002074 3300002075 Bacteria 5368
10 JGI25155J39150_1000080 3300002704 Bacteria 56018
11 JGI25156J39149_1000112 3300002705 Bacteria 59192
12 JGI25156J39149_1000128 3300002705 Bacteria 56012
13 JGI25156J39149_1002049 3300002705 Bacteria 7668
14 JGI25156J39149_1002067 3300002705 Bacteria 7625
15 JGI25156J39149_1003272 3300002705 Bacteria 5375
16 JGI25156J39149_1003825 3300002705 Bacteria 4788
17 JGI25154J39366_1000143 3300002738 Bacteria 56016
18 JGI25154J39366_1000228 3300002738 Bacteria 37567
19 JGI25154J39366_1000987 3300002738 Bacteria 11522
20 JGI25154J39366_1002015 3300002738 Bacteria 5878
21 JGI25157J39369_1000134 3300002741 Bacteria 61613
22 JGI25150J39212_1005914 3300002774 Bacteria 2573
23 JGI25159J45721_1000415 3300002987 Bacteria 19675
24 rootH1_10051707 3300003316 Bacteria 6215
25 rootH2_10118416 3300003320 Bacteria 3450
26 rootL2_10096030 3300003322 Bacteria 1785
27 JGI25160J50197_1000818 3300003354 Bacteria 16694
28 Ga0007410J51695_1020040 3300003574 Bacteria 1329
29 Ga0007416J51690_1024636 3300003577 Bacteria 1647
30 Ga0006562J51391_1027748 3300003578 Bacteria 1400
31 Ga0055538_1000045 3300003751 Bacteria 139066
32 Ga0055538_1001125 3300003751 Bacteria 5779
33 Ga0055539_1000064 3300003752 Bacteria 139066
34 Ga0055533_1000074 3300003756 Bacteria 139066
35 Ga0055533_1001120 3300003756 Bacteria 7618
36 Ga0055533_1001259 3300003756 Bacteria 6969
37 Ga0055533_1005185 3300003756 Bacteria 2149
38 Ga0055532_1000039 3300003758 Bacteria 198049
39 Ga0055532_1000101 3300003758 Bacteria 92881
40 Ga0055525_1000008 3300003759 Bacteria 604287
41 Ga0055525_1000092 3300003759 Bacteria 139066
42 Ga0055527_1000024 3300003760 Bacteria 198049
43 Ga0055527_1000493 3300003760 Bacteria 14159
44 Ga0055527_1000532 3300003760 Bacteria 12837
45 Ga0055535_1000028 3300003761 Bacteria 198049
46 Ga0055535_1001248 3300003761 Bacteria 14159
47 Ga0055535_1001362 3300003761 Bacteria 12837
48 Ga0055542_1000047 3300003762 Bacteria 198049
49 Ga0055542_1001239 3300003762 Bacteria 14176
50 Ga0055542_1001248 3300003762 Bacteria 14073
51 Ga0055529_1000054 3300003763 Bacteria 198049
52 Ga0055529_1000068 3300003763 Bacteria 163911
53 Ga0055529_1000492 3300003763 Bacteria 36023
54 Ga0055526_1000050 3300003771 Bacteria 117283
55 Ga0055526_1000266 3300003771 Bacteria 44005
56 Ga0055526_1008612 3300003771 Bacteria 5054
57 Ga0055537_1002528 3300003773 Bacteria 6062
58 Ga0055524_1000008 3300003775 Bacteria 297761
59 Ga0055524_1000757 3300003775 Bacteria 21800
60 Ga0055534_1001148 3300003784 Bacteria 11208
61 Ga0055528_1007588 3300003790 Bacteria 4777
62 Ga0055541_1000046 3300003841 Bacteria 139066
63 Ga0055541_1000338 3300003841 Bacteria 14759
64 Ga0058692_1002178 3300003856 Bacteria 6693
65 Ga0058692_1010584 3300003856 Bacteria 2274
66 Ga0058692_1011276 3300003856 Bacteria 2167
67 Ga0058860_12094178 3300004801 Bacteria 1385
68 Ga0065165_1001552 3300005262 Bacteria 23926
69 Ga0065165_1002547 3300005262 Bacteria 15111
70 Ga0070660_100000016 3300005339 Bacteria 102648
71 Ga0070660_100005437 3300005339 Bacteria 8822
72 Ga0070660_100060822 3300005339 Bacteria 2932
73 Ga0070668_100012227 3300005347 Bacteria 6395
74 Ga0070659_100000014 3300005366 Bacteria 178272
75 Ga0070659_100008470 3300005366 Bacteria 7514
76 Ga0070663_100002932 3300005455 Bacteria 9709
77 Ga0070663_100067188 3300005455 Bacteria 2600
78 Ga0070663_100085631 3300005455 Bacteria 2326
79 Ga0068867_100259328 3300005459 Bacteria 1417
80 Ga0068853_100002082 3300005539 Bacteria 14838
81 Ga0068853_100013775 3300005539 Bacteria 6607
82 Ga0068855_100000072 3300005563 Bacteria 121486
83 Ga0068855_100004807 3300005563 Bacteria 16490
84 Ga0068855_100013735 3300005563 Bacteria 9761
85 Ga0068855_100046114 3300005563 Bacteria 5153
86 Ga0068855_100068318 3300005563 Bacteria 4137
87 Ga0068855_100124015 3300005563 Bacteria 2955
88 Ga0068857_100220021 3300005577 Bacteria 1734
89 Ga0068854_100073808 3300005578 Bacteria 2501
90 Ga0068856_100089098 3300005614 Bacteria 3068
91 Ga0068852_100120980 3300005616 Bacteria 2397
92 Ga0075364_10101476 3300006051 Bacteria 1916
93 Ga0075369_10050767 3300006186 Bacteria 1795
94 Ga0075434_100124417 3300006871 Bacteria 2596
95 Ga0099826_10000001 3300006948 Bacteria 1155201
96 Ga0105251_10001940 3300009011 Bacteria 16937
97 Ga0105251_10003240 3300009011 Bacteria 11970
98 Ga0105251_10003354 3300009011 Bacteria 11660
99 Ga0105244_10001399 3300009036 Bacteria 19606
100 Ga0105244_10006780 3300009036 Bacteria 7367
101 Ga0105250_10008806 3300009092 Bacteria 4274
102 Ga0105240_10003437 3300009093 Bacteria 24590
103 Ga0105240_10007932 3300009093 Bacteria 15315
104 Ga0105240_10020875 3300009093 Bacteria 8724
105 Ga0105240_10108247 3300009093 Bacteria 3368
106 Ga0105241_10110149 3300009174 Bacteria 2203
107 Ga0105241_10135866 3300009174 Bacteria 1996
108 Ga0105237_10007453 3300009545 Bacteria 11973
109 Ga0105238_10008553 3300009551 Bacteria 10241
110 Ga0105238_10046424 3300009551 Bacteria 4384
111 Ga0105238_10327108 3300009551 Bacteria 1519
112 Ga0105239_10012776 3300010375 Bacteria 9342
113 Ga0105246_10033371 3300011119 Bacteria 3421
114 Ga0157371_10000060 3300013102 Bacteria 170456
115 Ga0157371_10060213 3300013102 Bacteria 2692
116 Ga0157370_10008182 3300013104 Bacteria 11305
117 Ga0157369_10001025 3300013105 Bacteria 35250
118 Ga0157369_10002277 3300013105 Bacteria 23092
119 Ga0157369_10017044 3300013105 Bacteria 8162
120 Ga0157374_10000065 3300013296 Bacteria 108630
121 Ga0157374_10154109 3300013296 Bacteria 2235
122 Ga0157378_10304588 3300013297 Bacteria 1543
123 Ga0157372_10005829 3300013307 Bacteria 13120
124 Ga0157372_10373069 3300013307 Bacteria 1662
125 Ga0182008_10017279 3300014497 Bacteria 3743
126 Ga0182006_1000029 3300015261 Bacteria 247579
127 Ga0182006_1001675 3300015261 Bacteria 13013
128 Ga0182006_1011977 3300015261 Bacteria 3798
129 Ga0182007_10022643 3300015262 Bacteria 2216
130 Ga0182005_1000012 3300015265 Bacteria 396944
131 Ga0183361_10039 3300016635 Bacteria 25237
132 Ga0197907_10094810 3300020069 Bacteria 2302
133 Ga0206356_10207775 3300020070 Bacteria 6647
134 Ga0206355_1201316 3300020076 Bacteria 1527
135 Ga0206352_10616037 3300020078 Bacteria 1387
136 Ga0206350_10823393 3300020080 Bacteria 1322
137 Ga0206353_10857790 3300020082 Bacteria 9460
138 Ga0213872_10000078 3300021361 Bacteria 89790
139 Ga0213872_10028116 3300021361 Bacteria 2580
140 Ga0213872_10035227 3300021361 Bacteria 2289
141 Ga0213872_10049988 3300021361 Bacteria 1898
142 Ga0224712_10014477 3300022467 Bacteria 2541
143 Ga0224712_10053556 3300022467 Bacteria 1580
144 Ga0224712_10077390 3300022467 Bacteria 1365
145 Ga0209435_100016 3300025206 Bacteria 305566
146 Ga0209435_101536 3300025206 Bacteria 2878
147 Ga0209784_100002 3300025224 Bacteria 1753105
148 Ga0209784_100355 3300025224 Bacteria 22209
149 Ga0209566_100003 3300025225 Bacteria 1753105
150 Ga0209566_100206 3300025225 Bacteria 60781
151 Ga0209674_100004 3300025226 Bacteria 1753105
152 Ga0209674_100013 3300025226 Bacteria 813140
153 Ga0209674_100317 3300025226 Bacteria 31110
154 Ga0209674_100508 3300025226 Bacteria 16000
155 Ga0209672_100010 3300025228 Bacteria 873151
156 Ga0209672_100019 3300025228 Bacteria 432215
157 Ga0209672_100051 3300025228 Bacteria 234414
158 Ga0209672_100663 3300025228 Bacteria 17421
159 Ga0209147_100006 3300025229 Bacteria 873276
160 Ga0209147_100023 3300025229 Bacteria 437803
161 Ga0209147_100026 3300025229 Bacteria 421622
162 Ga0209147_100192 3300025229 Bacteria 70162
163 Ga0209147_100544 3300025229 Bacteria 21444
164 Ga0209563_100003 3300025230 Bacteria 1932942
165 Ga0209563_100006 3300025230 Bacteria 1753105
166 Ga0207427_100524 3300025231 Bacteria 19948
167 Ga0209437_100166 3300025233 Bacteria 144787
168 Ga0209258_100010 3300025242 Bacteria 873276
169 Ga0209258_100031 3300025242 Bacteria 463572
170 Ga0209258_100345 3300025242 Bacteria 67870
171 Ga0209258_100358 3300025242 Bacteria 61852
172 Ga0207425_1000198 3300025245 Bacteria 48223
173 Ga0209646_1000007 3300025246 Bacteria 670994
174 Ga0209646_1000022 3300025246 Bacteria 446621
175 Ga0209646_1000033 3300025246 Bacteria 369507
176 Ga0209026_1000031 3300025250 Bacteria 325747
177 Ga0209677_100003 3300025253 Bacteria 1753105
178 Ga0209677_102782 3300025253 Bacteria 6219
179 Ga0209148_1000018 3300025254 Bacteria 756247
180 Ga0209148_1000021 3300025254 Bacteria 714645
181 Ga0209148_1000027 3300025254 Bacteria 616374
182 Ga0209148_1000400 3300025254 Bacteria 50569
183 Ga0209148_1001190 3300025254 Bacteria 14889
184 Ga0209148_1005336 3300025254 Bacteria 2969
185 Ga0209759_1000160 3300025256 Bacteria 116290
186 Ga0209759_1000227 3300025256 Bacteria 84278
187 Ga0209759_1000830 3300025256 Bacteria 24405
188 Ga0209759_1002634 3300025256 Bacteria 7717
189 Ga0209759_1005851 3300025256 Bacteria 4219
190 Ga0209759_1007134 3300025256 Bacteria 3643
191 Ga0209759_1008597 3300025256 Bacteria 3166
192 Ga0209233_1000135 3300025261 Bacteria 201057
193 Ga0209565_1000136 3300025263 Bacteria 103019
194 Ga0209565_1012467 3300025263 Bacteria 2028
195 Ga0209455_1000015 3300025272 Bacteria 756128
196 Ga0209455_1000026 3300025272 Bacteria 653778
197 Ga0209455_1000213 3300025272 Bacteria 82040
198 Ga0209455_1000746 3300025272 Bacteria 18598
199 Ga0209673_1000201 3300025273 Bacteria 120059
200 Ga0209675_1000670 3300025291 Bacteria 24015
201 Ga0209025_1004560 3300025294 Bacteria 11922
202 Ga0209564_1000002 3300025295 Bacteria 1636803
203 Ga0209564_1000007 3300025295 Bacteria 1028582
204 Ga0209564_1002172 3300025295 Bacteria 16506
205 Ga0209564_1003554 3300025295 Bacteria 10463
206 Ga0209564_1030619 3300025295 Bacteria 1664
207 Ga0209758_1001300 3300025297 Bacteria 30598
208 Ga0209256_1000005 3300025299 Bacteria 1315082
209 Ga0207426_1000183 3300025302 Bacteria 154449
210 Ga0207655_1010700 3300025728 Bacteria 5544
211 Ga0207713_1024483 3300025735 Bacteria 2814
212 Ga0207647_10002579 3300025904 Bacteria 13712
213 Ga0207647_10005988 3300025904 Bacteria 8859
214 Ga0207647_10013632 3300025904 Bacteria 5629
215 Ga0207647_10014941 3300025904 Bacteria 5335
216 Ga0207647_10021360 3300025904 Bacteria 4322
217 Ga0207705_10000909 3300025909 Bacteria 24236
218 Ga0207705_10068844 3300025909 Bacteria 2563
219 Ga0207654_10020282 3300025911 Bacteria 3521
220 Ga0207695_10001378 3300025913 Bacteria 41129
221 Ga0207695_10003550 3300025913 Bacteria 21855
222 Ga0207695_10017376 3300025913 Bacteria 8370
223 Ga0207695_10022439 3300025913 Bacteria 7163
224 Ga0207671_10018507 3300025914 Bacteria 5341
225 Ga0207671_10062016 3300025914 Bacteria 2775
226 Ga0207657_10000001 3300025919 Bacteria 458536
227 Ga0207657_10011207 3300025919 Bacteria 8914
228 Ga0207657_10162278 3300025919 Bacteria 1815
229 Ga0207694_10005502 3300025924 Bacteria 9721
230 Ga0207694_10005690 3300025924 Bacteria 9559
231 Ga0207690_10000006 3300025932 Bacteria 433880
232 Ga0207690_10062100 3300025932 Bacteria 2542
233 Ga0207686_10106992 3300025934 Bacteria 1879
234 Ga0207689_10256758 3300025942 Bacteria 1446
235 Ga0207667_10000055 3300025949 Bacteria 223770
236 Ga0207667_10005385 3300025949 Bacteria 15603
237 Ga0207667_10009859 3300025949 Bacteria 11214
238 Ga0207667_10023435 3300025949 Bacteria 6798
239 Ga0207667_10026316 3300025949 Bacteria 6358
240 Ga0207667_10102192 3300025949 Bacteria 2957
241 Ga0207668_10023326 3300025972 Bacteria 3975
242 Ga0207639_10011574 3300026041 Bacteria 6129
243 Ga0207678_10000640 3300026067 Bacteria 32171
244 Ga0207702_10215259 3300026078 Bacteria 1788
245 Ga0207648_10073287 3300026089 Bacteria 2984
246 Ga0207698_10136833 3300026142 Bacteria 2103
247 Ga0209371_1000202 3300027312 Bacteria 85989
248 Ga0209371_1002201 3300027312 Bacteria 11330
249 Ga0209371_1006356 3300027312 Bacteria 4392
250 Ga0209371_1013531 3300027312 Bacteria 2285
251 Ga0209282_1000001 3300027666 Bacteria 2450367
252 Ga0307515_10114288 3300028794 Bacteria 3122
253 Ga0265338_10000183 3300028800 Bacteria 117272
254 Ga0265338_10001296 3300028800 Bacteria 41001
255 Ga0268256_1000189 3300030500 Bacteria 72206
256 Ga0268256_1001207 3300030500 Bacteria 16482
257 Ga0268256_1007934 3300030500 Bacteria 3705
258 Ga0268256_1011771 3300030500 Bacteria 2744
259 Ga0265314_10045322 3300031711 Bacteria 3110
260 Ga0307407_10045476 3300031903 Bacteria 2481
261 Ga0307412_10000008 3300031911 Bacteria 461034
262 Ga0307412_10016506 3300031911 Bacteria 4400
263 Ga0316583_10000075 3300032133 Bacteria 20871
264 Ga0373927_0099159 3300035695 Bacteria 1894
265 Ga0395899_0000041 3300037312 Bacteria 255615
266 Ga0395899_0001045 3300037312 Bacteria 25131
267 Ga0395899_0001913 3300037312 Bacteria 17173
268 Ga0395899_0005775 3300037312 Bacteria 9606
269 Ga0395899_0013914 3300037312 Bacteria 6144
270 Ga0395899_0027231 3300037312 Bacteria 4311
271 Ga0395900_0000065 3300037418 Bacteria 196327
272 Ga0395900_0000077 3300037418 Bacteria 179525
273 Ga0395900_0000097 3300037418 Bacteria 161598
274 Ga0395900_0001188 3300037418 Bacteria 32276
275 Ga0395900_0001196 3300037418 Bacteria 32097
276 Ga0395900_0003753 3300037418 Bacteria 16318
277 Ga0395900_0024334 3300037418 Bacteria 6200
278 Ga0395900_0038860 3300037418 Bacteria 4905
279 Ga0395900_0065140 3300037418 Bacteria 3743
280 Ga0395900_0192157 3300037418 Bacteria 2070
281 Ga0395898_0000220 3300037466 Bacteria 146473
282 Ga0395898_0000359 3300037466 Bacteria 100304
283 Ga0395898_0002178 3300037466 Bacteria 23964
284 Ga0395898_0021459 3300037466 Bacteria 6549
285 Ga0395898_0297620 3300037466 Bacteria 1539
286 Ga0395905_0000185 3300037471 Bacteria 99394
287 Ga0395905_0009767 3300037471 Bacteria 9358
288 Ga0395905_0026588 3300037471 Bacteria 5456
289 Ga0395905_0099536 3300037471 Bacteria 2730
290 Ga0395905_0143228 3300037471 Bacteria 2249
291 Ga0395905_0182492 3300037471 Bacteria 1970
292 Ga0395901_0000011 3300038443 Bacteria 400724
293 Ga0395901_0000085 3300038443 Bacteria 126093
294 Ga0395901_0000639 3300038443 Bacteria 40528
295 Ga0395901_0000928 3300038443 Bacteria 31902
296 Ga0395901_0001168 3300038443 Bacteria 27890
297 Ga0395901_0001807 3300038443 Bacteria 22099
298 Ga0395901_0018670 3300038443 Bacteria 7083
299 Ga0395901_0100600 3300038443 Bacteria 3032
300 Ga0436361_0051331 3300039447 Bacteria 27824
301 Ga0436361_0081046 3300039447 Bacteria 44857
302 Ga0436361_0233238 3300039447 Bacteria 7286
303 Ga0436361_0457272 3300039447 Bacteria 12371
304 Ga0436361_0461069 3300039447 Bacteria 3811
305 Ga0436361_0732452 3300039447 Bacteria 3970
306 Ga0436361_0997150 3300039447 Bacteria 20731
307 Ga0436361_1068465 3300039447 Bacteria 2558
308 Ga0439466_0000136 3300041411 Bacteria 28940
309 Ga0439465_0014195 3300041413 Bacteria 2483
310 Ga0439433_0007872 3300041999 Bacteria 2304
311 Ga0439448_0000397 3300042005 Bacteria 9912
312 Ga0439455_0006374 3300042012 Bacteria 2446
313 Ga0439455_0012221 3300042012 Bacteria 1924
314 Ga0450911_003740 3300042115 Bacteria 2617
315 Ga0450907_001052 3300042146 Bacteria 6453
316 Ga0439464_0005502 3300042439 Bacteria 3277
317 Ga0466969_0003870 3300044656 Bacteria 7945
318 Ga0466969_0011061 3300044656 Bacteria 4778
319 Ga0466969_0075275 3300044656 Bacteria 1618
320 Ga0466972_0032058 3300044658 Bacteria 2582
321 Ga0466972_0077901 3300044658 Bacteria 1578
322 Ga0466977_0156671 3300044666 Bacteria 1471
323 Ga0466965_0012256 3300044683 Bacteria 4029
324 Ga0466965_0014090 3300044683 Bacteria 3782
325 Ga0466965_0016894 3300044683 Bacteria 3480
326 Ga0466966_0000002 3300044684 Bacteria 370962
327 Ga0466966_0003020 3300044684 Bacteria 11101
328 Ga0466966_0019301 3300044684 Bacteria 4487
329 Ga0466966_0029417 3300044684 Bacteria 3574
330 Ga0466961_0000061 3300044693 Bacteria 64795
331 Ga0466961_0058701 3300044693 Bacteria 2447
332 Ga0466961_0088868 3300044693 Bacteria 1952
333 Ga0466963_0003013 3300044694 Bacteria 9526
334 Ga0466963_0037902 3300044694 Bacteria 3151
335 Ga0466964_0001523 3300044706 Bacteria 7970
336 Ga0466971_0008015 3300044719 Bacteria 4604
337 Ga0466968_0003359 3300044735 Bacteria 5915
338 Ga0466968_0005763 3300044735 Bacteria 4647
339 Ga0466957_0000075 3300044842 Bacteria 38931
340 Ga0466957_0002815 3300044842 Bacteria 9408
341 Ga0466957_0022510 3300044842 Bacteria 3719
342 Ga0466957_0046544 3300044842 Bacteria 2634
343 Ga0466960_0100405 3300044901 Bacteria 1489
344 Ga0466959_0009742 3300045049 Bacteria 6843
345 Ga0466959_0039385 3300045049 Bacteria 3492
346 Ga0466959_0052406 3300045049 Bacteria 2988
347 Ga0451576_0018798 3300045051 Bacteria 7555
348 Ga0466958_0002064 3300045836 Bacteria 9933
349 Ga0466958_0020934 3300045836 Bacteria 3818
350 Ga0466958_0027882 3300045836 Bacteria 3344
351 Ga0466958_0108779 3300045836 Bacteria 1729
352 Ga0495617_000001 3300046452 Bacteria 877032
353 Ga0495617_000021 3300046452 Bacteria 215885
354 Ga0495617_015762 3300046452 Bacteria 2558
355 Ga0495627_000007 3300046453 Bacteria 575915
356 Ga0495627_000026 3300046453 Bacteria 238494
357 Ga0495592_0028762 3300046454 Bacteria 4206
358 Ga0495592_0034333 3300046454 Bacteria 3824
359 Ga0495603_0032716 3300046455 Bacteria 3128
360 Ga0495590_0000010 3300046457 Bacteria 317890
361 Ga0495590_0000028 3300046457 Bacteria 152333
362 Ga0495590_0000083 3300046457 Bacteria 62385
363 Ga0495590_0000820 3300046457 Bacteria 14123
364 Ga0495590_0004307 3300046457 Bacteria 5751
365 Ga0495590_0039625 3300046457 Bacteria 1643
366 Ga0495591_000007 3300046458 Bacteria 366385
367 Ga0495591_000038 3300046458 Bacteria 157347
368 Ga0495629_0000119 3300046459 Bacteria 69922
369 Ga0495629_0005983 3300046459 Bacteria 9045
370 Ga0495629_0007935 3300046459 Bacteria 7809
371 Ga0495629_0012236 3300046459 Bacteria 6215
372 Ga0495629_0012487 3300046459 Bacteria 6152
373 Ga0495629_0021233 3300046459 Bacteria 4634
374 Ga0495638_0000157 3300046460 Bacteria 107187
375 Ga0495638_0006691 3300046460 Bacteria 8352
376 Ga0495638_0034096 3300046460 Bacteria 3251
377 Ga0495638_0047636 3300046460 Bacteria 2686
378 Ga0495641_0030934 3300046461 Bacteria 2562
379 Ga0495651_0026578 3300046462 Bacteria 4508
380 Ga0495653_0000010 3300046463 Bacteria 274131
381 Ga0495653_0000105 3300046463 Bacteria 69642
382 Ga0495653_0001720 3300046463 Bacteria 17247
383 Ga0495653_0004899 3300046463 Bacteria 10861
384 Ga0495653_0005296 3300046463 Bacteria 10491
385 Ga0495653_0010674 3300046463 Bacteria 7521
386 Ga0495653_0014076 3300046463 Bacteria 6522
387 Ga0495653_0034739 3300046463 Bacteria 3983
388 Ga0495653_0114335 3300046463 Bacteria 1934
389 Ga0495653_0119173 3300046463 Bacteria 1884
390 Ga0495650_0000085 3300046471 Bacteria 235655
391 Ga0495650_0000159 3300046471 Bacteria 152501
392 Ga0495650_0000194 3300046471 Bacteria 131682
393 Ga0495650_0000299 3300046471 Bacteria 90064
394 Ga0495650_0000410 3300046471 Bacteria 70515
395 Ga0495650_0000595 3300046471 Bacteria 49927
396 Ga0495650_0001326 3300046471 Bacteria 24868
397 Ga0495650_0008519 3300046471 Bacteria 5967
398 Ga0495650_0022964 3300046471 Bacteria 2980
399 Ga0495580_0000291 3300046472 Bacteria 40835
400 Ga0495580_0001451 3300046472 Bacteria 20796
401 Ga0495580_0002463 3300046472 Bacteria 16164
402 Ga0495580_0005978 3300046472 Bacteria 9973
403 Ga0495580_0010366 3300046472 Bacteria 7264
404 Ga0495580_0018264 3300046472 Bacteria 5223
405 Ga0495580_0056101 3300046472 Bacteria 2774
406 Ga0495582_0004843 3300046473 Bacteria 7551
407 Ga0495582_0007260 3300046473 Bacteria 6144
408 Ga0495582_0009445 3300046473 Bacteria 5372
409 Ga0495582_0011544 3300046473 Bacteria 4866
410 Ga0495605_0000004 3300046474 Bacteria 395282
411 Ga0495605_0000027 3300046474 Bacteria 220680
412 Ga0495605_0000160 3300046474 Bacteria 86202
413 Ga0495605_0003001 3300046474 Bacteria 10192
414 Ga0495605_0005586 3300046474 Bacteria 7311
415 Ga0495605_0044987 3300046474 Bacteria 2178
416 Ga0495639_0006666 3300046475 Bacteria 4969
417 Ga0495662_0064856 3300046476 Bacteria 1765
418 Ga0495664_0000037 3300046477 Bacteria 70108
419 Ga0495664_0052460 3300046477 Bacteria 2423
420 Ga0495584_0000234 3300046491 Bacteria 39911
421 Ga0495584_0000390 3300046491 Bacteria 30206
422 Ga0495584_0013417 3300046491 Bacteria 4183
423 Ga0495585_0000521 3300046492 Bacteria 36396
424 Ga0495585_0001083 3300046492 Bacteria 22419
425 Ga0495585_0036248 3300046492 Bacteria 2783
426 Ga0495594_0019212 3300046499 Bacteria 3629
427 Ga0495594_0039169 3300046499 Bacteria 2590
428 Ga0495596_0000276 3300046500 Bacteria 34053
429 Ga0495596_0005192 3300046500 Bacteria 6193
430 Ga0495596_0012822 3300046500 Bacteria 3575
431 Ga0495596_0027136 3300046500 Bacteria 2305
432 Ga0495596_0027302 3300046500 Bacteria 2297
433 Ga0495596_0041783 3300046500 Bacteria 1807
434 Ga0495607_0000272 3300046501 Bacteria 55661
435 Ga0495607_0002570 3300046501 Bacteria 14663
436 Ga0495607_0010437 3300046501 Bacteria 6244
437 Ga0495607_0016076 3300046501 Bacteria 4835
438 Ga0495607_0041184 3300046501 Bacteria 2745
439 Ga0495583_0000006 3300046506 Bacteria 436893
440 Ga0495583_0000182 3300046506 Bacteria 107009
441 Ga0495583_0013576 3300046506 Bacteria 4535
442 Ga0495583_0013600 3300046506 Bacteria 4527
443 Ga0495583_0014902 3300046506 Bacteria 4256
444 Ga0495606_0000088 3300046507 Bacteria 155985
445 Ga0495606_0000103 3300046507 Bacteria 145893
446 Ga0495606_0000132 3300046507 Bacteria 126919
447 Ga0495606_0000247 3300046507 Bacteria 95120
448 Ga0495606_0002709 3300046507 Bacteria 19972
449 Ga0495606_0005424 3300046507 Bacteria 12220
450 Ga0495606_0013103 3300046507 Bacteria 6584
451 Ga0495606_0013303 3300046507 Bacteria 6517
452 Ga0495606_0013765 3300046507 Bacteria 6365
453 Ga0495606_0014367 3300046507 Bacteria 6186
454 Ga0495606_0018038 3300046507 Bacteria 5308
455 Ga0495606_0049803 3300046507 Bacteria 2744
456 Ga0495606_0083158 3300046507 Bacteria 1985
457 Ga0495606_0099810 3300046507 Bacteria 1769
458 Ga0495608_0041172 3300046511 Bacteria 3093
459 Ga0495610_0000008 3300046512 Bacteria 622732
460 Ga0495610_0002900 3300046512 Bacteria 13881
461 Ga0495610_0004713 3300046512 Bacteria 9955
462 Ga0495610_0005527 3300046512 Bacteria 8954
463 Ga0495610_0007881 3300046512 Bacteria 6999
464 Ga0495610_0009532 3300046512 Bacteria 6126
465 Ga0495616_0001024 3300046513 Bacteria 20008
466 Ga0495616_0002266 3300046513 Bacteria 12867
467 Ga0495616_0005147 3300046513 Bacteria 8115
468 Ga0495618_0003931 3300046514 Bacteria 9171
469 Ga0495620_0028049 3300046515 Bacteria 2624
470 Ga0495628_0006279 3300046516 Bacteria 10376
471 Ga0495628_0010178 3300046516 Bacteria 8000
472 Ga0495628_0025525 3300046516 Bacteria 4827
473 Ga0495628_0047828 3300046516 Bacteria 3391
474 Ga0495628_0084124 3300046516 Bacteria 2469
475 Ga0495630_0005881 3300046517 Bacteria 8676
476 Ga0495631_0000105 3300046518 Bacteria 55305
477 Ga0495631_0003775 3300046518 Bacteria 8241
478 Ga0495631_0024157 3300046518 Bacteria 2808
479 Ga0495632_0000024 3300046519 Bacteria 179517
480 Ga0495632_0000043 3300046519 Bacteria 143694
481 Ga0495632_0000106 3300046519 Bacteria 85449
482 Ga0495632_0006661 3300046519 Bacteria 7386
483 Ga0495637_0000002 3300046520 Bacteria 629280
484 Ga0495637_0003552 3300046520 Bacteria 8266
485 Ga0495637_0013350 3300046520 Bacteria 3899
486 Ga0495643_0000022 3300046522 Bacteria 289691
487 Ga0495643_0000117 3300046522 Bacteria 129698
488 Ga0495643_0000552 3300046522 Bacteria 46298
489 Ga0495643_0008044 3300046522 Bacteria 6722
490 Ga0495643_0017855 3300046522 Bacteria 4137
491 Ga0495643_0024905 3300046522 Bacteria 3390
492 Ga0495643_0074302 3300046522 Bacteria 1780
493 Ga0495644_0030135 3300046523 Bacteria 2048
494 Ga0495648_0000022 3300046524 Bacteria 242791
495 Ga0495648_0000875 3300046524 Bacteria 31749
496 Ga0495648_0001544 3300046524 Bacteria 22488
497 Ga0495648_0002193 3300046524 Bacteria 18300
498 Ga0495648_0002666 3300046524 Bacteria 16142
499 Ga0495648_0004350 3300046524 Bacteria 12127
500 Ga0495648_0009106 3300046524 Bacteria 7744
501 Ga0495648_0016093 3300046524 Bacteria 5397
502 Ga0495648_0027086 3300046524 Bacteria 3844
503 Ga0495648_0035692 3300046524 Bacteria 3219
504 Ga0495666_0003723 3300046526 Bacteria 7702
505 Ga0495666_0007129 3300046526 Bacteria 5616
506 Ga0495666_0026377 3300046526 Bacteria 2864
507 Ga0495666_0028271 3300046526 Bacteria 2759
508 Ga0495666_0028744 3300046526 Bacteria 2735
509 Ga0495666_0070065 3300046526 Bacteria 1668
510 Ga0495642_0000001 3300046528 Bacteria 389656
511 Ga0495642_0000865 3300046528 Bacteria 14325
512 Ga0495642_0001857 3300046528 Bacteria 9016
513 Ga0495642_0003562 3300046528 Bacteria 6129
514 Ga0495642_0006888 3300046528 Bacteria 4358
515 Ga0495642_0018725 3300046528 Bacteria 2710
516 Ga0495652_0018710 3300046529 Bacteria 6174
517 Ga0495652_0022578 3300046529 Bacteria 5583
518 Ga0495652_0047350 3300046529 Bacteria 3687
519 Ga0495652_0110293 3300046529 Bacteria 2213
520 Ga0495654_0000002 3300046530 Bacteria 1021205
521 Ga0495654_0009202 3300046530 Bacteria 5416
522 Ga0495654_0055852 3300046530 Bacteria 1910
523 Ga0495665_0001952 3300046531 Bacteria 11127
524 Ga0495665_0003338 3300046531 Bacteria 8704
525 Ga0495665_0007204 3300046531 Bacteria 6004
526 Ga0495665_0035472 3300046531 Bacteria 2664
527 Ga0495665_0035677 3300046531 Bacteria 2656
528 Ga0495640_0052953 3300046533 Bacteria 2784
529 Ga0495640_0109210 3300046533 Bacteria 1809
530 Ga0495586_0001962 3300046535 Bacteria 11218
531 Ga0495586_0013680 3300046535 Bacteria 4305
532 Ga0495586_0017444 3300046535 Bacteria 3816
533 Ga0495587_0002254 3300046536 Bacteria 12891
534 Ga0495587_0016882 3300046536 Bacteria 4539
535 Ga0495609_0000445 3300046538 Bacteria 34051
536 Ga0495609_0000554 3300046538 Bacteria 29545
537 Ga0495609_0001464 3300046538 Bacteria 15675
538 Ga0495609_0003850 3300046538 Bacteria 8440
539 Ga0495609_0011535 3300046538 Bacteria 4205
540 Ga0495597_0000030 3300046542 Bacteria 134736
541 Ga0495597_0000070 3300046542 Bacteria 89649
542 Ga0495597_0000189 3300046542 Bacteria 55865
543 Ga0495597_0000302 3300046542 Bacteria 44243
544 Ga0495597_0001611 3300046542 Bacteria 15835
545 Ga0495597_0001677 3300046542 Bacteria 15363
546 Ga0495597_0003633 3300046542 Bacteria 8864
547 Ga0495597_0042076 3300046542 Bacteria 2038
548 Ga0495645_0007362 3300046543 Bacteria 7658
549 Ga0495645_0084025 3300046543 Bacteria 2280
550 Ga0495645_0095254 3300046543 Bacteria 2122
551 Ga0495622_0000012 3300046557 Bacteria 189011
552 Ga0495622_0000048 3300046557 Bacteria 108955
553 Ga0495633_0001106 3300046558 Bacteria 21686
554 Ga0495633_0001287 3300046558 Bacteria 19867
555 Ga0495633_0005502 3300046558 Bacteria 7710
556 Ga0495633_0012459 3300046558 Bacteria 4521
557 Ga0495633_0029467 3300046558 Bacteria 2671
558 Ga0495656_0008392 3300046615 Bacteria 3684
559 Ga0495668_0000036 3300046616 Bacteria 235057
560 Ga0495668_0000038 3300046616 Bacteria 232122
561 Ga0495668_0000280 3300046616 Bacteria 70339
562 Ga0495668_0000428 3300046616 Bacteria 54563
563 Ga0495668_0001093 3300046616 Bacteria 28137
564 Ga0495668_0001482 3300046616 Bacteria 22483
565 Ga0495668_0004604 3300046616 Bacteria 9700
566 Ga0495668_0011982 3300046616 Bacteria 5162
567 Ga0495668_0016754 3300046616 Bacteria 4259
568 Ga0495668_0047721 3300046616 Bacteria 2377
569 Ga0495634_0008649 3300046642 Bacteria 7555
570 Ga0495634_0025885 3300046642 Bacteria 4097
571 Ga0495634_0070031 3300046642 Bacteria 2312
572 Ga0495611_0000191 3300046648 Bacteria 43883
573 Ga0495611_0000408 3300046648 Bacteria 26792
574 Ga0495625_0000241 3300046660 Bacteria 85835
575 Ga0495625_0000745 3300046660 Bacteria 45415
576 Ga0495625_0001333 3300046660 Bacteria 30655
577 Ga0495625_0012563 3300046660 Bacteria 6855
578 Ga0495625_0013580 3300046660 Bacteria 6535
579 Ga0495625_0019537 3300046660 Bacteria 5252
580 Ga0495625_0027228 3300046660 Bacteria 4308
581 Ga0495625_0040024 3300046660 Bacteria 3421
582 Ga0495635_0002476 3300046663 Bacteria 12606
583 Ga0495635_0022427 3300046663 Bacteria 4396
584 Ga0495635_0174118 3300046663 Bacteria 1463
585 Ga0495659_0000008 3300046664 Bacteria 102082
586 Ga0495661_0000040 3300046665 Bacteria 151437
587 Ga0495661_0001097 3300046665 Bacteria 23749
588 Ga0495661_0001236 3300046665 Bacteria 22115
589 Ga0495661_0003616 3300046665 Bacteria 11388
590 Ga0495661_0005279 3300046665 Bacteria 9184
591 Ga0495661_0006401 3300046665 Bacteria 8278
592 Ga0495661_0007134 3300046665 Bacteria 7801
593 Ga0495661_0011445 3300046665 Bacteria 6022
594 Ga0495661_0013687 3300046665 Bacteria 5446
595 Ga0495661_0034998 3300046665 Bacteria 3156
596 Ga0495661_0040333 3300046665 Bacteria 2896
597 Ga0495661_0059347 3300046665 Bacteria 2277
598 Ga0495588_0000052 3300046674 Bacteria 304493
599 Ga0495588_0008561 3300046674 Bacteria 4700
600 Ga0495588_0011112 3300046674 Bacteria 4214
601 Ga0495588_0016502 3300046674 Bacteria 3570
602 Ga0495599_0074269 3300046678 Bacteria 2122
603 Ga0495599_0105737 3300046678 Bacteria 1753
604 Ga0495623_0009910 3300046679 Bacteria 6171
605 Ga0495623_0033966 3300046679 Bacteria 3272
606 Ga0495623_0043178 3300046679 Bacteria 2869
607 Ga0495646_0000964 3300046680 Bacteria 16453
608 Ga0495646_0008960 3300046680 Bacteria 6351
609 Ga0495646_0009760 3300046680 Bacteria 6096
610 Ga0495669_0000013 3300046684 Bacteria 151423
611 Ga0495669_0000175 3300046684 Bacteria 40487
612 Ga0495669_0021154 3300046684 Bacteria 2820
613 Ga0495669_0069591 3300046684 Bacteria 1602
614 Ga0495613_0008181 3300046689 Bacteria 7773
615 Ga0495613_0275020 3300046689 Bacteria 1170
616 Ga0495624_0008867 3300046690 Bacteria 6990
617 Ga0495624_0009686 3300046690 Bacteria 6669
618 Ga0495624_0011804 3300046690 Bacteria 5993
619 Ga0495624_0011969 3300046690 Bacteria 5948
620 Ga0495624_0032254 3300046690 Bacteria 3397
621 Ga0495671_0000002 3300046692 Bacteria 1136189
622 Ga0495671_0000155 3300046692 Bacteria 59986
623 Ga0495671_0000313 3300046692 Bacteria 41127
624 Ga0495671_0004065 3300046692 Bacteria 8832
625 Ga0495671_0006095 3300046692 Bacteria 6999
626 Ga0495671_0084363 3300046692 Bacteria 1556
627 Ga0495649_0000085 3300046694 Bacteria 80698
628 Ga0495649_0000469 3300046694 Bacteria 34749
629 Ga0495649_0002029 3300046694 Bacteria 14644
630 Ga0495649_0036293 3300046694 Bacteria 2708
631 Ga0495589_0000058 3300046794 Bacteria 107640
632 Ga0495589_0000227 3300046794 Bacteria 47488
633 Ga0495589_0001047 3300046794 Bacteria 16678
634 Ga0495589_0020385 3300046794 Bacteria 3390
635 Ga0495589_0028869 3300046794 Bacteria 2798
636 Ga0495589_0038261 3300046794 Bacteria 2402
637 Ga0495589_0040762 3300046794 Bacteria 2318
638 Ga0495600_0004893 3300046809 Bacteria 8046
639 Ga0495660_0000050 3300046810 Bacteria 140329
640 Ga0495660_0000285 3300046810 Bacteria 47026
641 Ga0495660_0000339 3300046810 Bacteria 41484
642 Ga0495660_0003258 3300046810 Bacteria 10085
643 Ga0495660_0005819 3300046810 Bacteria 7360
644 Ga0495660_0016426 3300046810 Bacteria 4268
645 Ga0495660_0029698 3300046810 Bacteria 3083
646 Ga0495581_0007807 3300047315 Bacteria 6197
647 Ga0495581_0008391 3300047315 Bacteria 5988
648 Ga0495604_0000220 3300047317 Bacteria 52204
649 Ga0495604_0012680 3300047317 Bacteria 6706
650 Ga0495604_0016491 3300047317 Bacteria 5906
651 Ga0495604_0016819 3300047317 Bacteria 5850
652 Ga0495604_0019475 3300047317 Bacteria 5432
653 Ga0495604_0082873 3300047317 Bacteria 2397
654 Ga0495604_0102648 3300047317 Bacteria 2099
655 Ga0495674_0003517 3300047319 Bacteria 15254
656 Ga0495674_0004385 3300047319 Bacteria 13569
657 Ga0495674_0004393 3300047319 Bacteria 13550
658 Ga0495674_0005533 3300047319 Bacteria 12118
659 Ga0495674_0012988 3300047319 Bacteria 7839
660 Ga0495674_0013595 3300047319 Bacteria 7647
661 Ga0495674_0030002 3300047319 Bacteria 4947
662 Ga0495674_0036553 3300047319 Bacteria 4419
663 Ga0495672_0000015 3300047320 Bacteria 502855
664 Ga0495672_0000325 3300047320 Bacteria 63353
665 Ga0495672_0000677 3300047320 Bacteria 37926
666 Ga0495672_0001219 3300047320 Bacteria 25944
667 Ga0495672_0005093 3300047320 Bacteria 10496
668 Ga0495672_0006470 3300047320 Bacteria 9062
669 Ga0495672_0009080 3300047320 Bacteria 7249
670 Ga0495676_0000029 3300047321 Bacteria 140281
671 Ga0495676_0024837 3300047321 Bacteria 5179
672 Ga0495676_0054971 3300047321 Bacteria 3160
673 Ga0495680_0001059 3300047322 Bacteria 30455
674 Ga0495680_0005882 3300047322 Bacteria 11476
675 Ga0495680_0010964 3300047322 Bacteria 8053
676 Ga0495680_0019270 3300047322 Bacteria 5768
677 Ga0495680_0095210 3300047322 Bacteria 2226
678 Ga0495683_0000012 3300047323 Bacteria 205754
679 Ga0495683_0009313 3300047323 Bacteria 5233
680 Ga0495683_0013078 3300047323 Bacteria 4346
681 Ga0495683_0018236 3300047323 Bacteria 3630
682 Ga0495683_0029389 3300047323 Bacteria 2809
683 Ga0495683_0037256 3300047323 Bacteria 2466
684 Ga0495683_0076643 3300047323 Bacteria 1635
685 Ga0495687_000002 3300047443 Bacteria 1085770
686 Ga0495687_000003 3300047443 Bacteria 859509
687 Ga0495687_000007 3300047443 Bacteria 552679
688 Ga0495687_000025 3300047443 Bacteria 310498
689 Ga0495687_000073 3300047443 Bacteria 155429
690 Ga0495687_000445 3300047443 Bacteria 51086
691 Ga0495687_000489 3300047443 Bacteria 47669
692 Ga0495687_001493 3300047443 Bacteria 21363
693 Ga0495687_020518 3300047443 Bacteria 3217
694 Ga0495687_068084 3300047443 Bacteria 1438
695 Ga0495675_0010007 3300047444 Bacteria 5914
696 Ga0495675_0040644 3300047444 Bacteria 2963
697 Ga0495675_0051409 3300047444 Bacteria 2617
698 Ga0495677_0000144 3300047445 Bacteria 34126
699 Ga0495677_0000152 3300047445 Bacteria 32933
700 Ga0495677_0001812 3300047445 Bacteria 8544
701 Ga0495677_0008040 3300047445 Bacteria 3917
702 Ga0495677_0037019 3300047445 Bacteria 1782
703 Ga0495679_000036 3300047446 Bacteria 161473
704 Ga0495679_000038 3300047446 Bacteria 157311
705 Ga0495679_001340 3300047446 Bacteria 14236
706 Ga0495679_004357 3300047446 Bacteria 6559
707 Ga0495679_010320 3300047446 Bacteria 3672
708 Ga0495679_019679 3300047446 Bacteria 2365
709 Ga0495673_0000005 3300047469 Bacteria 943364
710 Ga0495673_0000064 3300047469 Bacteria 225793
711 Ga0495673_0000109 3300047469 Bacteria 166877
712 Ga0495673_0024774 3300047469 Bacteria 2892
713 Ga0495673_0046225 3300047469 Bacteria 1930
714 Ga0495681_0000005 3300047470 Bacteria 225279
715 Ga0495681_0000555 3300047470 Bacteria 28608
716 Ga0495681_0004387 3300047470 Bacteria 9639
717 Ga0495681_0008550 3300047470 Bacteria 6406
718 Ga0495684_0055846 3300047471 Bacteria 3011
719 Ga0495686_0000015 3300047472 Bacteria 471703
720 Ga0495686_0000032 3300047472 Bacteria 345132
721 Ga0495686_0000051 3300047472 Bacteria 263489
722 Ga0495686_0016243 3300047472 Bacteria 5053
723 Ga0495686_0104020 3300047472 Bacteria 1710
724 Ga0495593_0001558 3300047673 Bacteria 13525
725 Ga0495593_0008313 3300047673 Bacteria 6039
726 Ga0495593_0009404 3300047673 Bacteria 5670
727 Ga0495593_0014443 3300047673 Bacteria 4489
728 Ga0495593_0056827 3300047673 Bacteria 2056
729 Ga0495602_0020951 3300048088 Bacteria 6446
730 Ga0495602_0022831 3300048088 Bacteria 6113
731 Ga0495602_0025386 3300048088 Bacteria 5736
732 Ga0495602_0066735 3300048088 Bacteria 3098
733 Ga0495602_0167378 3300048088 Bacteria 1709
734 Ga0495614_0005056 3300048089 Bacteria 5951
735 Ga0495614_0037762 3300048089 Bacteria 2072
736 Ga0495626_0000066 3300048091 Bacteria 141280
737 Ga0495626_0000145 3300048091 Bacteria 89603
738 Ga0495626_0010793 3300048091 Bacteria 4854
739 Ga0495626_0020232 3300048091 Bacteria 3318
740 Ga0495626_0059771 3300048091 Bacteria 1738
741 Ga0496100_0244005 3300048903 Bacteria 1326
742 Ga0496101_0001448 3300048904 Bacteria 14161
743 Ga0496101_0076508 3300048904 Bacteria 2465
744 Ga0496101_0154564 3300048904 Bacteria 1757
745 Ga0496102_0000033 3300048905 Bacteria 213952
746 Ga0496102_0004637 3300048905 Bacteria 11630
747 Ga0496102_0106004 3300048905 Bacteria 2615
748 Ga0496102_0108444 3300048905 Bacteria 2586
749 Ga0496103_0001960 3300048906 Bacteria 13315
750 Ga0496103_0002086 3300048906 Bacteria 12767
751 Ga0496103_0002298 3300048906 Bacteria 12076
752 Ga0496104_0074198 3300048907 Bacteria 3238
753 Ga0496105_0049200 3300048908 Bacteria 3480
754 Ga0496106_0000019 3300048909 Bacteria 174698
755 Ga0496106_0022320 3300048909 Bacteria 4701
756 Ga0496106_0042892 3300048909 Bacteria 3393
757 Ga0496107_0163415 3300048910 Bacteria 1651
758 Ga0496109_0006962 3300048912 Bacteria 9543
759 Ga0496109_0181892 3300048912 Bacteria 1975
760 Ga0496110_0000007 3300048913 Bacteria 114271
761 Ga0496110_0095948 3300048913 Bacteria 2657
762 Ga0496112_0037713 3300048915 Bacteria 4718
763 Ga0496112_0063266 3300048915 Bacteria 3650
764 Ga0496112_0164239 3300048915 Bacteria 2186
765 Ga0496113_0007646 3300048916 Bacteria 6974
766 Ga0496114_0032092 3300048917 Bacteria 4321
767 Ga0496114_0177710 3300048917 Bacteria 1858
768 Ga0496116_0008917 3300048919 Bacteria 8625
769 Ga0496116_0013017 3300048919 Bacteria 6746
770 Ga0496116_0013744 3300048919 Bacteria 6507
771 Ga0496116_0080780 3300048919 Bacteria 2018
772 Ga0496117_0000058 3300048920 Bacteria 264132
773 Ga0496117_0007793 3300048920 Bacteria 10322
774 Ga0496117_0015289 3300048920 Bacteria 6553
775 Ga0496117_0025869 3300048920 Bacteria 4602
776 Ga0496117_0078788 3300048920 Bacteria 2174
777 Ga0496117_0090904 3300048920 Bacteria 1965
778 Ga0496118_0003177 3300048921 Bacteria 20986
779 Ga0496118_0004991 3300048921 Bacteria 15338
780 Ga0496118_0005234 3300048921 Bacteria 14834
781 Ga0496118_0041145 3300048921 Bacteria 3663
782 Ga0496118_0052180 3300048921 Bacteria 3122
783 Ga0496118_0070827 3300048921 Bacteria 2514
784 Ga0496119_0000089 3300048922 Bacteria 134344
785 Ga0496119_0034680 3300048922 Bacteria 3317
786 Ga0496120_0000117 3300048923 Bacteria 134343
787 Ga0496120_0001811 3300048923 Bacteria 23902
788 Ga0496120_0025297 3300048923 Bacteria 3687
789 Ga0496121_0000205 3300048924 Bacteria 130748
790 Ga0496121_0000310 3300048924 Bacteria 101522
791 Ga0496121_0003570 3300048924 Bacteria 21990
792 Ga0496121_0006733 3300048924 Bacteria 14106
793 Ga0496121_0007511 3300048924 Bacteria 13151
794 Ga0496121_0010176 3300048924 Bacteria 10649
795 Ga0496121_0147738 3300048924 Bacteria 1734
796 Ga0496122_0000279 3300048925 Bacteria 114185
797 Ga0496122_0000457 3300048925 Bacteria 84895
798 Ga0496122_0002401 3300048925 Bacteria 26723
799 Ga0496122_0005248 3300048925 Bacteria 15531
800 Ga0496122_0012927 3300048925 Bacteria 8240
801 Ga0496123_0000146 3300048926 Bacteria 143990
802 Ga0496123_0000321 3300048926 Bacteria 91682
803 Ga0496123_0001138 3300048926 Bacteria 39752
804 Ga0496123_0010024 3300048926 Bacteria 8440
805 Ga0496123_0015195 3300048926 Bacteria 6332
806 Ga0496123_0120475 3300048926 Bacteria 1477
807 Ga0496124_0000007 3300048927 Bacteria 883534
808 Ga0496124_0000208 3300048927 Bacteria 115312
809 Ga0496124_0002145 3300048927 Bacteria 26496
810 Ga0496124_0005692 3300048927 Bacteria 13887
811 Ga0496124_0010579 3300048927 Bacteria 9329
812 Ga0496124_0036217 3300048927 Bacteria 4306
813 Ga0496124_0070548 3300048927 Bacteria 2898
814 Ga0496124_0141287 3300048927 Bacteria 1900
815 Ga0496125_0000895 3300048928 Bacteria 47230
816 Ga0496125_0000938 3300048928 Bacteria 45852
817 Ga0496125_0020498 3300048928 Bacteria 6204
818 Ga0496125_0023674 3300048928 Bacteria 5663
819 Ga0496125_0043939 3300048928 Bacteria 3786
820 Ga0496125_0050210 3300048928 Bacteria 3456
821 Ga0496125_0050623 3300048928 Bacteria 3437
822 Ga0496125_0091759 3300048928 Bacteria 2274
823 Ga0496126_0000034 3300048929 Bacteria 362440
824 Ga0496126_0000706 3300048929 Bacteria 60980
825 Ga0496126_0006701 3300048929 Bacteria 12792
826 Ga0496126_0023730 3300048929 Bacteria 5939
827 Ga0496126_0033941 3300048929 Bacteria 4798
828 Ga0496126_0044704 3300048929 Bacteria 4076
829 Ga0496126_0068323 3300048929 Bacteria 3173
830 Ga0496126_0140724 3300048929 Bacteria 2077
831 Ga0501308_000888 3300049128 Bacteria 2184
832 Ga0495678_000004 3300049459 Bacteria 532920
833 Ga0495678_000015 3300049459 Bacteria 309544
834 Ga0495678_000022 3300049459 Bacteria 237031
835 Ga0495678_000103 3300049459 Bacteria 103891
836 Ga0495678_001009 3300049459 Bacteria 24097
837 Ga0495678_001189 3300049459 Bacteria 21418
838 Ga0495678_029569 3300049459 Bacteria 2299
839 Ga0495682_0000038 3300049460 Bacteria 120212
840 Ga0495682_0009396 3300049460 Bacteria 3816
841 Ga0495682_0035115 3300049460 Bacteria 1847
842 Ga0501031_0001921 3300049568 Bacteria 13100
843 Ga0501031_0007771 3300049568 Bacteria 6979
844 Ga0501032_0003027 3300049569 Bacteria 13035
845 Ga0501032_0105607 3300049569 Bacteria 1866
846 Ga0501033_0000665 3300049570 Bacteria 31783
847 Ga0501033_0001358 3300049570 Bacteria 21808
848 Ga0501033_0036882 3300049570 Bacteria 3662
849 Ga0501033_0071779 3300049570 Bacteria 2543
850 Ga0501036_0000045 3300049572 Bacteria 78277
851 Ga0501037_0000236 3300049573 Bacteria 47586
852 Ga0501037_0001205 3300049573 Bacteria 19110
853 Ga0501038_0005951 3300049574 Bacteria 11281
854 Ga0501038_0014317 3300049574 Bacteria 7228
855 Ga0501038_0066255 3300049574 Bacteria 3076
856 Ga0501043_0000065 3300049579 Bacteria 93521
857 Ga0501043_0002979 3300049579 Bacteria 14103
858 Ga0501043_0207481 3300049579 Bacteria 1519
859 Ga0501046_0001304 3300049580 Bacteria 24149
860 Ga0501047_0006181 3300049581 Bacteria 11261
861 Ga0501047_0082840 3300049581 Bacteria 3083
862 Ga0501047_0083059 3300049581 Bacteria 3079
863 Ga0501047_0185404 3300049581 Bacteria 1946
864 Ga0501047_0234088 3300049581 Bacteria 1689
865 Ga0501069_0000002 3300049585 Bacteria 269636
866 Ga0501070_0000339 3300049586 Bacteria 42523
867 Ga0501070_0016944 3300049586 Bacteria 6115
868 Ga0501070_0039176 3300049586 Bacteria 3953
869 Ga0501071_0014589 3300049587 Bacteria 5376
870 Ga0501073_0008914 3300049589 Bacteria 7414
871 Ga0501074_0001070 3300049590 Bacteria 17857
872 Ga0501074_0248541 3300049590 Bacteria 1265
873 Ga0501076_0110333 3300049592 Bacteria 2224
874 Ga0501077_0035933 3300049593 Bacteria 3155
875 Ga0501209_000052 3300049656 Bacteria 11469
876 Ga0501249_003643 3300049679 Bacteria 3103
877 Ga0501079_0139149 3300049741 Bacteria 1891
878 Ga0501080_0000617 3300049742 Bacteria 28211
879 Ga0501080_0019404 3300049742 Bacteria 6299
880 Ga0501083_0185607 3300049744 Bacteria 1357
881 Ga0501083_0214208 3300049744 Bacteria 1255
882 Ga0501035_0000124 3300049822 Bacteria 93561
883 Ga0501035_0000552 3300049822 Bacteria 41623
884 Ga0501035_0004858 3300049822 Bacteria 12747
885 Ga0501035_0007250 3300049822 Bacteria 10377
886 Ga0501035_0010969 3300049822 Bacteria 8389
887 Ga0501044_0000087 3300049823 Bacteria 112979
888 Ga0501044_0001108 3300049823 Bacteria 32043
889 Ga0501044_0003419 3300049823 Bacteria 17892
890 Ga0501044_0030772 3300049823 Bacteria 5654
891 Ga0500644_0012225 3300053088 Bacteria 2368
892 Ga0500581_056119 3300053089 Bacteria 2001
893 Ga0500651_0019866 3300053093 Bacteria 4180
894 Ga0500650_0000508 3300053098 Bacteria 9861
895 Ga0500556_0000016 3300053104 Bacteria 194958
896 Ga0500569_020990 3300053109 Bacteria 1721
897 Ga0500594_0005059 3300053118 Bacteria 2915
898 Ga0500618_000032 3300053125 Bacteria 126990
899 Ga0500642_0000017 3300053130 Bacteria 167670
900 Ga0500652_000306 3300053131 Bacteria 17755
901 Ga0500658_0062856 3300053134 Bacteria 1548
902 Ga0500559_0072688 3300053136 Bacteria 1550
903 Ga0500568_0002231 3300053139 Bacteria 11614
904 Ga0500586_039428 3300053145 Bacteria 1596
905 Ga0500604_0000678 3300053151 Bacteria 9334
906 Ga0500616_0000169 3300053153 Bacteria 109205
907 Ga0500627_0136423 3300053158 Bacteria 1108
908 Ga0500645_000991 3300053730 Bacteria 16014
909 Ga0501084_0036996 3300054114 Bacteria 4078
910 Ga0587077_001466 3300059493 Bacteria 2542
911 Ga0587085_005324 3300059506 Bacteria 1510
912 Ga0466962_0006514 3300061719 Bacteria 5604
913 Ga0466962_0018488 3300061719 Bacteria 3352

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049744 Ga0501083_0214208 Ga0501083_0214208_151_1203 343
2 3300053136 Ga0500559_0072688 Ga0500559_0072688_443_1519 344
3 3300053158 Ga0500627_0136423 Ga0500627_0136423_11_1087 344
4 3300035695 Ga0373927_0099159 Ga0373927_0099159_24_1103 353
5 3300048903 Ga0496100_0244005 Ga0496100_0244005_224_1309 357
6 3300046507 Ga0495606_0018038 Ga0495606_0018038_15_1106 360
7 3300046689 Ga0495613_0275020 Ga0495613_0275020_28_1137 365
8 3300049579 Ga0501043_0207481 Ga0501043_0207481_322_1503 387
9 3300049590 Ga0501074_0248541 Ga0501074_0248541_36_1217 387
10 3300046694 Ga0495649_0000469 Ga0495649_0000469_27257_28510 389
11 iso_pu_bacteria 2921643360 2921653448 389
12 3300028794 Ga0307515_10114288 Ga0307515_101142882 403
13 3300046460 Ga0495638_0034096 Ga0495638_0034096_765_2018 403
14 3300046460 Ga0495638_0047636 Ga0495638_0047636_921_2174 403
15 3300046660 Ga0495625_0040024 Ga0495625_0040024_1877_3130 403
16 3300046665 Ga0495661_0013687 Ga0495661_0013687_3025_4278 403
17 3300048920 Ga0496117_0078788 Ga0496117_0078788_331_1584 403
18 3300048923 Ga0496120_0025297 Ga0496120_0025297_75_1328 403
19 3300048926 Ga0496123_0120475 Ga0496123_0120475_47_1300 403
20 3300048928 Ga0496125_0020498 Ga0496125_0020498_2843_4096 403
21 3300048929 Ga0496126_0023730 Ga0496126_0023730_3514_4767 403
22 3300048929 Ga0496126_0140724 Ga0496126_0140724_79_1332 403
23 3300053088 Ga0500644_0012225 Ga0500644_0012225_625_1878 403
24 3300053089 Ga0500581_056119 Ga0500581_056119_266_1519 403
25 3300053093 Ga0500651_0019866 Ga0500651_0019866_209_1462 403
26 3300053098 Ga0500650_0000508 Ga0500650_0000508_2543_3796 403
27 3300053104 Ga0500556_0000016 Ga0500556_0000016_45275_46528 403
28 3300053109 Ga0500569_020990 Ga0500569_020990_42_1295 403
29 3300053130 Ga0500642_0000017 Ga0500642_0000017_81740_82993 403
30 3300053131 Ga0500652_000306 Ga0500652_000306_11660_12913 403
31 3300053134 Ga0500658_0062856 Ga0500658_0062856_259_1512 403
32 3300053139 Ga0500568_0002231 Ga0500568_0002231_7760_9013 403
33 3300053151 Ga0500604_0000678 Ga0500604_0000678_5576_6829 403
34 3300053153 Ga0500616_0000169 Ga0500616_0000169_1574_2827 403
35 3300054114 Ga0501084_0036996 Ga0501084_0036996_1305_2564 403
36 3300049656 Ga0501209_000052 Ga0501209_000052_2189_3421 405
37 3300003320 rootH2_10118416 rootH2_101184162 407
38 iso_pu_bacteria 2643221558 2643814371 407
39 iso_pu_bacteria 2602042107 2603858197 408
40 iso_pu_bacteria 2738541281 2738745273 408
41 iso_pu_bacteria 2738543032 2739354503 408
42 iso_pu_bacteria 2739367655 2739610524 408
43 iso_pu_bacteria 2857524615 2857527588 408
44 iso_pu_bacteria 2919073203 2919073440 408
45 3300021361 Ga0213872_10028116 Ga0213872_100281163 411
46 3300039447 Ga0436361_0997150 Ga0436361_0997150_385_1635 411
47 3300046506 Ga0495583_0014902 Ga0495583_0014902_1449_2702 411
48 3300059493 Ga0587077_001466 Ga0587077_001466_105_1358 411
49 iso_pu_bacteria 2501025502 2501081178 411
50 3300003773 Ga0055537_1002528 Ga0055537_10025284 412
51 3300003775 Ga0055524_1000757 Ga0055524_10007577 412
52 3300003784 Ga0055534_1001148 Ga0055534_100114812 412
53 3300005339 Ga0070660_100060822 Ga0070660_1000608222 412
54 3300005455 Ga0070663_100067188 Ga0070663_1000671882 412
55 3300005455 Ga0070663_100085631 Ga0070663_1000856312 412
56 3300005539 Ga0068853_100002082 Ga0068853_10000208213 412
57 3300005539 Ga0068853_100013775 Ga0068853_1000137752 412
58 3300005577 Ga0068857_100220021 Ga0068857_1002200212 412
59 3300006051 Ga0075364_10101476 Ga0075364_101014762 412
60 3300025263 Ga0209565_1000136 Ga0209565_100013638 412
61 3300025291 Ga0209675_1000670 Ga0209675_10006708 412
62 3300025294 Ga0209025_1004560 Ga0209025_10045607 412
63 3300025295 Ga0209564_1003554 Ga0209564_10035543 412
64 3300026041 Ga0207639_10011574 Ga0207639_100115745 412
65 3300031903 Ga0307407_10045476 Ga0307407_100454762 412
66 3300037418 Ga0395900_0001196 Ga0395900_0001196_12837_14087 412
67 3300038443 Ga0395901_0018670 Ga0395901_0018670_5424_6674 412
68 3300039447 Ga0436361_0732452 Ga0436361_0732452_1725_2978 412
69 3300048919 Ga0496116_0013744 Ga0496116_0013744_4103_5356 412
70 3300048922 Ga0496119_0034680 Ga0496119_0034680_1006_2259 412
71 3300048928 Ga0496125_0043939 Ga0496125_0043939_1183_2436 412
72 3300048928 Ga0496125_0091759 Ga0496125_0091759_616_1869 412
73 3300049568 Ga0501031_0001921 Ga0501031_0001921_2815_4065 412
74 3300049568 Ga0501031_0007771 Ga0501031_0007771_1245_2501 412
75 3300049569 Ga0501032_0003027 Ga0501032_0003027_6643_7893 412
76 3300049569 Ga0501032_0105607 Ga0501032_0105607_459_1715 412
77 3300049570 Ga0501033_0000665 Ga0501033_0000665_16392_17642 412
78 3300049570 Ga0501033_0001358 Ga0501033_0001358_18063_19319 412
79 3300049570 Ga0501033_0036882 Ga0501033_0036882_1287_2537 412
80 3300049570 Ga0501033_0071779 Ga0501033_0071779_480_1736 412
81 3300049572 Ga0501036_0000045 Ga0501036_0000045_16056_17306 412
82 3300049573 Ga0501037_0000236 Ga0501037_0000236_17722_18978 412
83 3300049573 Ga0501037_0001205 Ga0501037_0001205_5852_7102 412
84 3300049574 Ga0501038_0005951 Ga0501038_0005951_5338_6588 412
85 3300049574 Ga0501038_0014317 Ga0501038_0014317_871_2127 412
86 3300049574 Ga0501038_0066255 Ga0501038_0066255_691_1947 412
87 3300049579 Ga0501043_0000065 Ga0501043_0000065_63426_64682 412
88 3300049579 Ga0501043_0002979 Ga0501043_0002979_8540_9790 412
89 3300049580 Ga0501046_0001304 Ga0501046_0001304_3672_4922 412
90 3300049581 Ga0501047_0006181 Ga0501047_0006181_2460_3710 412
91 3300049581 Ga0501047_0082840 Ga0501047_0082840_1306_2562 412
92 3300049581 Ga0501047_0083059 Ga0501047_0083059_1462_2718 412
93 3300049581 Ga0501047_0185404 Ga0501047_0185404_71_1327 412
94 3300049585 Ga0501069_0000002 Ga0501069_0000002_204955_206211 412
95 3300049586 Ga0501070_0000339 Ga0501070_0000339_26953_28209 412
96 3300049586 Ga0501070_0016944 Ga0501070_0016944_113_1369 412
97 3300049586 Ga0501070_0039176 Ga0501070_0039176_830_2083 412
98 3300049587 Ga0501071_0014589 Ga0501071_0014589_2074_3330 412
99 3300049589 Ga0501073_0008914 Ga0501073_0008914_1206_2462 412
100 3300049590 Ga0501074_0001070 Ga0501074_0001070_5021_6277 412
101 3300049592 Ga0501076_0110333 Ga0501076_0110333_327_1586 412
102 3300049593 Ga0501077_0035933 Ga0501077_0035933_1508_2767 412
103 3300049741 Ga0501079_0139149 Ga0501079_0139149_111_1367 412
104 3300049742 Ga0501080_0000617 Ga0501080_0000617_24276_25532 412
105 3300049742 Ga0501080_0019404 Ga0501080_0019404_2941_4200 412
106 3300049744 Ga0501083_0185607 Ga0501083_0185607_45_1304 412
107 3300049822 Ga0501035_0000124 Ga0501035_0000124_28973_30229 412
108 3300049822 Ga0501035_0004858 Ga0501035_0004858_2417_3667 412
109 3300049822 Ga0501035_0007250 Ga0501035_0007250_6008_7258 412
110 3300049822 Ga0501035_0010969 Ga0501035_0010969_4643_5899 412
111 3300049823 Ga0501044_0000087 Ga0501044_0000087_76007_77263 412
112 3300049823 Ga0501044_0001108 Ga0501044_0001108_27825_29075 412
113 3300049823 Ga0501044_0003419 Ga0501044_0003419_9037_10287 412
114 3300049823 Ga0501044_0030772 Ga0501044_0030772_402_1658 412
115 3300053145 Ga0500586_039428 Ga0500586_039428_223_1476 412
116 3300032133 Ga0316583_10000075 Ga0316583_100000756 413
117 3300002738 JGI25154J39366_1000987 JGI25154J39366_100098710 414
118 3300025233 Ga0209437_100166 Ga0209437_100166127 414
119 3300025246 Ga0209646_1000007 Ga0209646_1000007363 414
120 3300046457 Ga0495590_0039625 Ga0495590_0039625_316_1569 414
121 3300046459 Ga0495629_0000119 Ga0495629_0000119_23390_24721 414
122 3300046460 Ga0495638_0006691 Ga0495638_0006691_104_1357 414
123 3300046463 Ga0495653_0000105 Ga0495653_0000105_23123_24454 414
124 3300046471 Ga0495650_0008519 Ga0495650_0008519_1990_3243 414
125 3300046472 Ga0495580_0001451 Ga0495580_0001451_14905_16158 414
126 3300046472 Ga0495580_0005978 Ga0495580_0005978_6017_7348 414
127 3300046474 Ga0495605_0044987 Ga0495605_0044987_241_1494 414
128 3300046476 Ga0495662_0064856 Ga0495662_0064856_57_1469 414
129 3300046507 Ga0495606_0083158 Ga0495606_0083158_628_1881 414
130 3300046515 Ga0495620_0028049 Ga0495620_0028049_675_1928 414
131 3300046516 Ga0495628_0010178 Ga0495628_0010178_1830_3161 414
132 3300046524 Ga0495648_0035692 Ga0495648_0035692_1714_2967 414
133 3300046531 Ga0495665_0035677 Ga0495665_0035677_441_1772 414
134 3300046533 Ga0495640_0109210 Ga0495640_0109210_123_1454 414
135 3300046665 Ga0495661_0059347 Ga0495661_0059347_210_1463 414
136 3300046678 Ga0495599_0074269 Ga0495599_0074269_351_1604 414
137 3300046679 Ga0495623_0033966 Ga0495623_0033966_170_1423 414
138 3300046684 Ga0495669_0069591 Ga0495669_0069591_278_1531 414
139 3300046690 Ga0495624_0008867 Ga0495624_0008867_2677_4008 414
140 3300046690 Ga0495624_0011969 Ga0495624_0011969_2231_3484 414
141 3300046692 Ga0495671_0084363 Ga0495671_0084363_274_1527 414
142 3300046794 Ga0495589_0040762 Ga0495589_0040762_151_1404 414
143 3300047317 Ga0495604_0000220 Ga0495604_0000220_45685_46938 414
144 3300047319 Ga0495674_0003517 Ga0495674_0003517_6110_7363 414
145 3300047319 Ga0495674_0004393 Ga0495674_0004393_9594_10925 414
146 3300047319 Ga0495674_0013595 Ga0495674_0013595_971_2224 414
147 3300047322 Ga0495680_0019270 Ga0495680_0019270_2353_3606 414
148 3300047323 Ga0495683_0076643 Ga0495683_0076643_326_1579 414
149 3300047443 Ga0495687_068084 Ga0495687_068084_74_1327 414
150 3300047444 Ga0495675_0010007 Ga0495675_0010007_4558_5811 414
151 3300047446 Ga0495679_000036 Ga0495679_000036_12957_14210 414
152 3300047472 Ga0495686_0104020 Ga0495686_0104020_243_1496 414
153 3300047673 Ga0495593_0008313 Ga0495593_0008313_2676_4007 414
154 3300048088 Ga0495602_0167378 Ga0495602_0167378_150_1403 414
155 3300048091 Ga0495626_0059771 Ga0495626_0059771_35_1288 414
156 3300048920 Ga0496117_0090904 Ga0496117_0090904_452_1705 414
157 3300048921 Ga0496118_0052180 Ga0496118_0052180_167_1420 414
158 3300048924 Ga0496121_0006733 Ga0496121_0006733_5815_7068 414
159 3300048929 Ga0496126_0006701 Ga0496126_0006701_3804_5069 414
160 3300049459 Ga0495678_029569 Ga0495678_029569_612_1865 414
161 3300038443 Ga0395901_0000928 Ga0395901_0000928_13713_14978 415
162 iso_pu_bacteria 2501025501 2501071499 415
163 3300046491 Ga0495584_0013417 Ga0495584_0013417_1935_3227 418
164 3300046528 Ga0495642_0018725 Ga0495642_0018725_819_2111 418
165 3300046542 Ga0495597_0001611 Ga0495597_0001611_12340_13632 418
166 3300046616 Ga0495668_0011982 Ga0495668_0011982_3172_4464 418
167 3300047320 Ga0495672_0009080 Ga0495672_0009080_1145_2437 418
168 iso_pu_bacteria 2928115317 2928119909 418
169 iso_pu_bacteria 2990196909 2990199771 418
170 3300046463 Ga0495653_0119173 Ga0495653_0119173_499_1770 419
171 3300047317 Ga0495604_0082873 Ga0495604_0082873_735_2006 419
172 3300047323 Ga0495683_0013078 Ga0495683_0013078_2304_3575 419
173 iso_pu_bacteria 2501025504 2501408349 420
174 iso_pu_bacteria 2508501125 2509131446 420
175 iso_pu_bacteria 2510065045 2510251854 420
176 iso_pu_bacteria 2510917013 2511085953 420
177 iso_pu_bacteria 2510917014 2511096089 420
178 iso_pu_bacteria 2510917015 2511103187 420
179 iso_pu_bacteria 2512047030 2512345178 420
180 iso_pu_bacteria 2513237082 2513555581 420
181 iso_pu_bacteria 2513237083 2513563475 420
182 iso_pu_bacteria 2513237151 2513961405 420
183 iso_pu_bacteria 2513237166 2514053378 420
184 iso_pu_bacteria 2515154122 2515684268 420
185 iso_pu_bacteria 2515154123 2515687463 420
186 iso_pu_bacteria 2515154189 2516022486 420
187 iso_pu_bacteria 2519103095 2519458198 420
188 iso_pu_bacteria 2526164713 2527080707 420
189 iso_pu_bacteria 2562617112 2563059283 420
190 iso_pu_bacteria 2582581311 2585294748 420
191 iso_pu_bacteria 2599185239 2599738060 420
192 iso_pu_bacteria 2599185240 2599742568 420
193 iso_pu_bacteria 2599185355 2600204686 420
194 iso_pu_bacteria 2643221645 2644253215 420
195 iso_pu_bacteria 2643221664 2644355743 420
196 iso_pu_bacteria 2675903129 2676741672 420
197 iso_pu_bacteria 2711768613 2713479783 420
198 iso_pu_bacteria 2718217991 2719640965 420
199 iso_pu_bacteria 2721755763 2723876924 420
200 iso_pu_bacteria 2738541280 2738742190 420
201 iso_pu_bacteria 2738541296 2738819043 420
202 iso_pu_bacteria 2738541297 2738828664 420
203 iso_pu_bacteria 2738541298 2738830801 420
204 iso_pu_bacteria 2738541300 2738841361 420
205 iso_pu_bacteria 2738541306 2738872327 420
206 iso_pu_bacteria 2738541357 2739152460 420
207 iso_pu_bacteria 2738543002 2739183958 420
208 iso_pu_bacteria 2738543003 2739194380 420
209 iso_pu_bacteria 2738543008 2739218928 420
210 iso_pu_bacteria 2738543018 2739272231 420
211 iso_pu_bacteria 2738543026 2739320856 420
212 iso_pu_bacteria 2738543029 2739339097 420
213 iso_pu_bacteria 2738543030 2739341275 420
214 iso_pu_bacteria 2744054900 2746088225 420
215 iso_pu_bacteria 2744054901 2746096881 420
216 iso_pu_bacteria 2791355137 2792840548 420
217 iso_pu_bacteria 2808606384 2808969967 420
218 iso_pu_bacteria 2808606390 2809005186 420
219 iso_pu_bacteria 2808606391 2809011673 420
220 iso_pu_bacteria 2808606418 2809143657 420
221 iso_pu_bacteria 2816332253 2817260350 420
222 iso_pu_bacteria 2816332256 2817278038 420
223 iso_pu_bacteria 2816332286 2817455605 420
224 iso_pu_bacteria 2818991450 2819623521 420
225 iso_pu_bacteria 2818991452 2819632876 420
226 iso_pu_bacteria 2821131069 2821132907 420
227 iso_pu_bacteria 2842324504 2842325040 420
228 iso_pu_bacteria 2842348783 2842349318 420
229 iso_pu_bacteria 2842454564 2842459939 420
230 iso_pu_bacteria 2842711865 2842714580 420
231 iso_pu_bacteria 2856287931 2856292821 420
232 iso_pu_bacteria 2857357740 2857361055 420
233 iso_pu_bacteria 2857553236 2857554732 420
234 iso_pu_bacteria 2857558681 2857563577 420
235 iso_pu_bacteria 2857564685 2857568815 420
236 iso_pu_bacteria 2863421361 2863421887 420
237 iso_pu_bacteria 2870068957 2870072171 420
238 iso_pu_bacteria 2883087390 2883088077 420
239 iso_pu_bacteria 2885270888 2885271036 420
240 iso_pu_bacteria 2900634093 2900637764 420
241 iso_pu_bacteria 2902682994 2902687376 420
242 iso_pu_bacteria 2904424332 2904427100 420
243 iso_pu_bacteria 2904564687 2904566052 420
244 iso_pu_bacteria 2904571731 2904573096 420
245 iso_pu_bacteria 2904615490 2904623602 420
246 iso_pu_bacteria 2919476304 2919480126 420
247 iso_pu_bacteria 2928108538 2928110891 420
248 iso_pu_bacteria 2928135762 2928137551 420
249 iso_pu_bacteria 2928157003 2928159532 420
250 iso_pu_bacteria 2928163908 2928164408 420
251 iso_pu_bacteria 2928170801 2928177608 420
252 iso_pu_bacteria 2928503688 2928505742 420
253 iso_pu_bacteria 2928536128 2928538382 420
254 iso_pu_bacteria 2945934425 2945937725 420
255 iso_pu_bacteria 2981990288 2981993966 420
256 iso_pu_bacteria 2990703756 2990705557 420
257 iso_pu_bacteria 639633007 639789091 420
258 iso_pu_bacteria 641736151 642424578 420
259 iso_pu_bacteria 641736154 642417917 420
260 iso_pu_bacteria 642555112 642592533 420
261 iso_pu_bacteria 642555113 642622552 420
262 iso_pu_bacteria 8003955200 8003957766 420
263 iso_pu_bacteria 8018845410 8018850321 420
264 iso_pu_bacteria 8020807995 8020808897 420
265 iso_pu_bacteria 8020938398 8020939347 420
266 iso_pu_bacteria 8020945358 8020947275 420
267 iso_pu_bacteria 8020953355 8020954429 420
268 iso_pu_bacteria 8021120328 8021122783 420
269 iso_pu_bacteria 8039098773 8039099749 420
270 iso_pu_bacteria 8040167225 8040169347 420
271 iso_pu_bacteria 8040173305 8040174949 420
272 iso_pu_bacteria 8047673197 8047674923 420
273 iso_pu_bacteria 8055266321 8055267010 420
274 iso_pu_bacteria 8055301274 8055301676 420
275 3300003751 Ga0055538_1000045 Ga0055538_100004559 421
276 3300003752 Ga0055539_1000064 Ga0055539_100006459 421
277 3300003756 Ga0055533_1000074 Ga0055533_100007459 421
278 3300003759 Ga0055525_1000092 Ga0055525_100009259 421
279 3300003841 Ga0055541_1000046 Ga0055541_100004689 421
280 3300005563 Ga0068855_100124015 Ga0068855_1001240153 421
281 3300005578 Ga0068854_100073808 Ga0068854_1000738082 421
282 3300009545 Ga0105237_10007453 Ga0105237_1000745310 421
283 3300009551 Ga0105238_10008553 Ga0105238_100085538 421
284 3300015261 Ga0182006_1001675 Ga0182006_10016752 421
285 3300022467 Ga0224712_10077390 Ga0224712_100773901 421
286 3300025224 Ga0209784_100002 Ga0209784_1000021256 421
287 3300025225 Ga0209566_100003 Ga0209566_1000031256 421
288 3300025226 Ga0209674_100004 Ga0209674_1000041256 421
289 3300025230 Ga0209563_100006 Ga0209563_1000061256 421
290 3300025253 Ga0209677_100003 Ga0209677_1000031256 421
291 3300025913 Ga0207695_10001378 Ga0207695_1000137830 421
292 3300025914 Ga0207671_10062016 Ga0207671_100620162 421
293 3300025924 Ga0207694_10005690 Ga0207694_100056908 421
294 3300025949 Ga0207667_10102192 Ga0207667_101021922 421
295 3300039447 Ga0436361_0233238 Ga0436361_0233238_5229_6503 421
296 3300041413 Ga0439465_0014195 Ga0439465_0014195_464_1762 421
297 3300041999 Ga0439433_0007872 Ga0439433_0007872_84_1382 421
298 3300047472 Ga0495686_0000051 Ga0495686_0000051_58872_60155 421
299 3300048912 Ga0496109_0181892 Ga0496109_0181892_534_1832 421
300 3300048913 Ga0496110_0095948 Ga0496110_0095948_1288_2586 421
301 3300048927 Ga0496124_0000007 Ga0496124_0000007_574575_575879 421
302 iso_pu_bacteria 2548876994 2550692510 421
303 iso_pu_bacteria 2818991445 2819591496 421
304 iso_pu_bacteria 2884811622 2884816588 421
305 iso_pu_bacteria 2884836552 2884837305 421
306 iso_pu_bacteria 2884852848 2884853596 421
307 iso_pu_bacteria 2896154374 2896155287 421
308 3300044901 Ga0466960_0100405 Ga0466960_0100405_56_1357 422
309 iso_pu_bacteria 2511231026 2511384505 422
310 iso_pu_bacteria 2521172590 2521557642 422
311 iso_pu_bacteria 2551306416 2553002760 422
312 iso_pu_bacteria 2765235838 2765570192 422
313 iso_pu_bacteria 2808606386 2808981532 422
314 iso_pu_bacteria 2808606415 2809129115 422
315 iso_pu_bacteria 2808606419 2809148735 422
316 iso_pu_bacteria 2818991449 2819615215 422
317 iso_pu_bacteria 2839094727 2839096866 422
318 iso_pu_bacteria 2852618963 2852621273 422
319 iso_pu_bacteria 2904439833 2904441623 422
320 iso_pu_bacteria 2904530477 2904531455 422
321 iso_pu_bacteria 2904584206 2904586905 422
322 iso_pu_bacteria 2904589729 2904593062 422
323 iso_pu_bacteria 2904601388 2904603101 422
324 iso_pu_bacteria 2919046199 2919050926 422
325 iso_pu_bacteria 2919079590 2919083887 422
326 iso_pu_bacteria 2923510766 2923510840 422
327 iso_pu_bacteria 2928130867 2928135127 422
328 iso_pu_bacteria 2643221556 2643797235 423
329 iso_pu_bacteria 2643221684 2644474223 423
330 iso_pu_bacteria 2844528606 2844531156 423
331 iso_pu_bacteria 2865014394 2865015529 423
332 iso_pu_bacteria 2881609920 2881613599 423
333 iso_pu_bacteria 2939602548 2939606175 423
334 iso_pu_bacteria 2945951305 2945952718 423
335 3300001979 JGI24740J21852_10000321 JGI24740J21852_1000032112 424
336 3300001989 JGI24739J22299_10006043 JGI24739J22299_100060433 424
337 3300002067 JGI24735J21928_10000185 JGI24735J21928_1000018520 424
338 3300002067 JGI24735J21928_10001957 JGI24735J21928_100019576 424
339 3300002067 JGI24735J21928_10004968 JGI24735J21928_100049682 424
340 3300002075 JGI24738J21930_10002074 JGI24738J21930_100020743 424
341 3300002705 JGI25156J39149_1002067 JGI25156J39149_10020675 424
342 3300002705 JGI25156J39149_1003272 JGI25156J39149_10032723 424
343 3300002774 JGI25150J39212_1005914 JGI25150J39212_10059142 424
344 3300003316 rootH1_10051707 rootH1_100517076 424
345 3300003322 rootL2_10096030 rootL2_100960302 424
346 3300003354 JGI25160J50197_1000818 JGI25160J50197_100081818 424
347 3300003574 Ga0007410J51695_1020040 Ga0007410J51695_10200401 424
348 3300003577 Ga0007416J51690_1024636 Ga0007416J51690_10246361 424
349 3300003756 Ga0055533_1001259 Ga0055533_10012595 424
350 3300003759 Ga0055525_1000008 Ga0055525_1000008497 424
351 3300003760 Ga0055527_1000493 Ga0055527_100049314 424
352 3300003760 Ga0055527_1000532 Ga0055527_100053214 424
353 3300003761 Ga0055535_1001248 Ga0055535_100124814 424
354 3300003761 Ga0055535_1001362 Ga0055535_100136214 424
355 3300003762 Ga0055542_1001239 Ga0055542_10012393 424
356 3300003763 Ga0055529_1000068 Ga0055529_10000684 424
357 3300003763 Ga0055529_1000492 Ga0055529_100049218 424
358 3300003771 Ga0055526_1000050 Ga0055526_100005034 424
359 3300003771 Ga0055526_1000266 Ga0055526_100026641 424
360 3300003775 Ga0055524_1000008 Ga0055524_1000008180 424
361 3300003790 Ga0055528_1007588 Ga0055528_10075884 424
362 3300003856 Ga0058692_1010584 Ga0058692_10105841 424
363 3300005262 Ga0065165_1001552 Ga0065165_100155218 424
364 3300005262 Ga0065165_1002547 Ga0065165_100254717 424
365 3300005339 Ga0070660_100000016 Ga0070660_10000001661 424
366 3300005339 Ga0070660_100005437 Ga0070660_1000054372 424
367 3300005366 Ga0070659_100000014 Ga0070659_10000001425 424
368 3300005366 Ga0070659_100008470 Ga0070659_1000084701 424
369 3300005455 Ga0070663_100002932 Ga0070663_1000029327 424
370 3300005563 Ga0068855_100004807 Ga0068855_1000048076 424
371 3300005563 Ga0068855_100013735 Ga0068855_1000137356 424
372 3300005563 Ga0068855_100068318 Ga0068855_1000683182 424
373 3300005616 Ga0068852_100120980 Ga0068852_1001209802 424
374 3300006871 Ga0075434_100124417 Ga0075434_1001244172 424
375 3300006948 Ga0099826_10000001 Ga0099826_10000001422 424
376 3300009011 Ga0105251_10001940 Ga0105251_100019403 424
377 3300009036 Ga0105244_10001399 Ga0105244_100013998 424
378 3300009036 Ga0105244_10006780 Ga0105244_100067806 424
379 3300009092 Ga0105250_10008806 Ga0105250_100088062 424
380 3300009093 Ga0105240_10003437 Ga0105240_1000343717 424
381 3300009093 Ga0105240_10020875 Ga0105240_100208759 424
382 3300009174 Ga0105241_10110149 Ga0105241_101101493 424
383 3300010375 Ga0105239_10012776 Ga0105239_100127763 424
384 3300013102 Ga0157371_10000060 Ga0157371_1000006072 424
385 3300013102 Ga0157371_10060213 Ga0157371_100602133 424
386 3300013104 Ga0157370_10008182 Ga0157370_100081824 424
387 3300013105 Ga0157369_10001025 Ga0157369_100010253 424
388 3300013105 Ga0157369_10002277 Ga0157369_100022772 424
389 3300013105 Ga0157369_10017044 Ga0157369_100170446 424
390 3300013296 Ga0157374_10000065 Ga0157374_1000006587 424
391 3300013307 Ga0157372_10005829 Ga0157372_100058298 424
392 3300013307 Ga0157372_10373069 Ga0157372_103730691 424
393 3300014497 Ga0182008_10017279 Ga0182008_100172793 424
394 3300015261 Ga0182006_1000029 Ga0182006_1000029195 424
395 3300015262 Ga0182007_10022643 Ga0182007_100226432 424
396 3300015265 Ga0182005_1000012 Ga0182005_1000012141 424
397 3300016635 Ga0183361_10039 Ga0183361_1003913 424
398 3300020069 Ga0197907_10094810 Ga0197907_100948101 424
399 3300020070 Ga0206356_10207775 Ga0206356_102077753 424
400 3300020076 Ga0206355_1201316 Ga0206355_12013161 424
401 3300020080 Ga0206350_10823393 Ga0206350_108233931 424
402 3300020082 Ga0206353_10857790 Ga0206353_108577909 424
403 3300021361 Ga0213872_10000078 Ga0213872_1000007825 424
404 3300022467 Ga0224712_10014477 Ga0224712_100144771 424
405 3300022467 Ga0224712_10053556 Ga0224712_100535561 424
406 3300025226 Ga0209674_100508 Ga0209674_10050817 424
407 3300025228 Ga0209672_100019 Ga0209672_100019375 424
408 3300025228 Ga0209672_100051 Ga0209672_10005174 424
409 3300025228 Ga0209672_100663 Ga0209672_1006638 424
410 3300025229 Ga0209147_100026 Ga0209147_100026375 424
411 3300025229 Ga0209147_100192 Ga0209147_10019225 424
412 3300025229 Ga0209147_100544 Ga0209147_10054416 424
413 3300025230 Ga0209563_100003 Ga0209563_1000031579 424
414 3300025242 Ga0209258_100031 Ga0209258_100031418 424
415 3300025242 Ga0209258_100358 Ga0209258_10035818 424
416 3300025245 Ga0207425_1000198 Ga0207425_10001989 424
417 3300025254 Ga0209148_1000027 Ga0209148_1000027418 424
418 3300025254 Ga0209148_1000400 Ga0209148_100040052 424
419 3300025254 Ga0209148_1001190 Ga0209148_10011905 424
420 3300025254 Ga0209148_1005336 Ga0209148_10053362 424
421 3300025256 Ga0209759_1000160 Ga0209759_10001603 424
422 3300025256 Ga0209759_1000830 Ga0209759_100083024 424
423 3300025256 Ga0209759_1005851 Ga0209759_10058514 424
424 3300025256 Ga0209759_1007134 Ga0209759_10071342 424
425 3300025263 Ga0209565_1012467 Ga0209565_10124671 424
426 3300025272 Ga0209455_1000026 Ga0209455_1000026509 424
427 3300025272 Ga0209455_1000213 Ga0209455_100021370 424
428 3300025272 Ga0209455_1000746 Ga0209455_10007463 424
429 3300025273 Ga0209673_1000201 Ga0209673_1000201125 424
430 3300025295 Ga0209564_1000002 Ga0209564_10000021049 424
431 3300025295 Ga0209564_1000007 Ga0209564_1000007397 424
432 3300025295 Ga0209564_1002172 Ga0209564_10021726 424
433 3300025295 Ga0209564_1030619 Ga0209564_10306192 424
434 3300025297 Ga0209758_1001300 Ga0209758_10013007 424
435 3300025299 Ga0209256_1000005 Ga0209256_10000051126 424
436 3300025302 Ga0207426_1000183 Ga0207426_1000183132 424
437 3300025728 Ga0207655_1010700 Ga0207655_10107003 424
438 3300025735 Ga0207713_1024483 Ga0207713_10244832 424
439 3300025904 Ga0207647_10002579 Ga0207647_100025793 424
440 3300025904 Ga0207647_10005988 Ga0207647_100059886 424
441 3300025904 Ga0207647_10013632 Ga0207647_100136322 424
442 3300025904 Ga0207647_10014941 Ga0207647_100149411 424
443 3300025904 Ga0207647_10021360 Ga0207647_100213603 424
444 3300025909 Ga0207705_10000909 Ga0207705_100009096 424
445 3300025909 Ga0207705_10068844 Ga0207705_100688442 424
446 3300025911 Ga0207654_10020282 Ga0207654_100202822 424
447 3300025913 Ga0207695_10003550 Ga0207695_100035505 424
448 3300025913 Ga0207695_10022439 Ga0207695_100224394 424
449 3300025914 Ga0207671_10018507 Ga0207671_100185072 424
450 3300025919 Ga0207657_10000001 Ga0207657_10000001396 424
451 3300025919 Ga0207657_10011207 Ga0207657_100112072 424
452 3300025919 Ga0207657_10162278 Ga0207657_101622782 424
453 3300025924 Ga0207694_10005502 Ga0207694_100055023 424
454 3300025932 Ga0207690_10000006 Ga0207690_10000006258 424
455 3300025932 Ga0207690_10062100 Ga0207690_100621002 424
456 3300025934 Ga0207686_10106992 Ga0207686_101069922 424
457 3300025942 Ga0207689_10256758 Ga0207689_102567582 424
458 3300025949 Ga0207667_10005385 Ga0207667_100053856 424
459 3300025949 Ga0207667_10009859 Ga0207667_100098597 424
460 3300025949 Ga0207667_10023435 Ga0207667_100234357 424
461 3300026067 Ga0207678_10000640 Ga0207678_1000064018 424
462 3300026142 Ga0207698_10136833 Ga0207698_101368332 424
463 3300027312 Ga0209371_1000202 Ga0209371_100020249 424
464 3300027312 Ga0209371_1006356 Ga0209371_10063563 424
465 3300027666 Ga0209282_1000001 Ga0209282_10000011560 424
466 3300028800 Ga0265338_10000183 Ga0265338_1000018340 424
467 3300028800 Ga0265338_10001296 Ga0265338_100012969 424
468 3300030500 Ga0268256_1000189 Ga0268256_100018934 424
469 3300030500 Ga0268256_1007934 Ga0268256_10079342 424
470 3300031711 Ga0265314_10045322 Ga0265314_100453223 424
471 3300031911 Ga0307412_10000008 Ga0307412_10000008405 424
472 3300031911 Ga0307412_10016506 Ga0307412_100165062 424
473 3300037312 Ga0395899_0000041 Ga0395899_0000041_137945_139231 424
474 3300037312 Ga0395899_0001045 Ga0395899_0001045_9457_10749 424
475 3300037312 Ga0395899_0001913 Ga0395899_0001913_6017_7309 424
476 3300037312 Ga0395899_0005775 Ga0395899_0005775_7524_8810 424
477 3300037312 Ga0395899_0013914 Ga0395899_0013914_4772_6064 424
478 3300037312 Ga0395899_0027231 Ga0395899_0027231_2485_3771 424
479 3300037418 Ga0395900_0000065 Ga0395900_0000065_181811_183103 424
480 3300037418 Ga0395900_0000077 Ga0395900_0000077_148683_149969 424
481 3300037418 Ga0395900_0000097 Ga0395900_0000097_43928_45214 424
482 3300037418 Ga0395900_0001188 Ga0395900_0001188_17062_18354 424
483 3300037418 Ga0395900_0003753 Ga0395900_0003753_6045_7337 424
484 3300037418 Ga0395900_0024334 Ga0395900_0024334_3069_4361 424
485 3300037418 Ga0395900_0038860 Ga0395900_0038860_152_1444 424
486 3300037418 Ga0395900_0065140 Ga0395900_0065140_1457_2749 424
487 3300037418 Ga0395900_0192157 Ga0395900_0192157_478_1764 424
488 3300037466 Ga0395898_0000220 Ga0395898_0000220_7188_8474 424
489 3300037466 Ga0395898_0000359 Ga0395898_0000359_74323_75609 424
490 3300037466 Ga0395898_0002178 Ga0395898_0002178_8946_10238 424
491 3300037466 Ga0395898_0021459 Ga0395898_0021459_3130_4416 424
492 3300037466 Ga0395898_0297620 Ga0395898_0297620_235_1527 424
493 3300037471 Ga0395905_0000185 Ga0395905_0000185_33209_34495 424
494 3300037471 Ga0395905_0009767 Ga0395905_0009767_1889_3181 424
495 3300037471 Ga0395905_0026588 Ga0395905_0026588_3206_4498 424
496 3300037471 Ga0395905_0099536 Ga0395905_0099536_452_1744 424
497 3300038443 Ga0395901_0000011 Ga0395901_0000011_141316_142602 424
498 3300038443 Ga0395901_0000085 Ga0395901_0000085_17521_18807 424
499 3300038443 Ga0395901_0000639 Ga0395901_0000639_32679_33971 424
500 3300038443 Ga0395901_0001168 Ga0395901_0001168_13741_15033 424
501 3300038443 Ga0395901_0001807 Ga0395901_0001807_7509_8795 424
502 3300038443 Ga0395901_0100600 Ga0395901_0100600_212_1504 424
503 3300039447 Ga0436361_0081046 Ga0436361_0081046_34937_36220 424
504 3300039447 Ga0436361_0461069 Ga0436361_0461069_82_1368 424
505 3300039447 Ga0436361_1068465 Ga0436361_1068465_1036_2322 424
506 3300042005 Ga0439448_0000397 Ga0439448_0000397_7899_9185 424
507 3300042012 Ga0439455_0006374 Ga0439455_0006374_1031_2323 424
508 3300042115 Ga0450911_003740 Ga0450911_003740_712_2004 424
509 3300044656 Ga0466969_0003870 Ga0466969_0003870_6498_7784 424
510 3300044656 Ga0466969_0011061 Ga0466969_0011061_3299_4585 424
511 3300044656 Ga0466969_0075275 Ga0466969_0075275_266_1558 424
512 3300044658 Ga0466972_0032058 Ga0466972_0032058_550_1836 424
513 3300044666 Ga0466977_0156671 Ga0466977_0156671_129_1415 424
514 3300044683 Ga0466965_0012256 Ga0466965_0012256_1763_3055 424
515 3300044683 Ga0466965_0014090 Ga0466965_0014090_1784_3076 424
516 3300044683 Ga0466965_0016894 Ga0466965_0016894_1735_3027 424
517 3300044684 Ga0466966_0000002 Ga0466966_0000002_341546_342832 424
518 3300044684 Ga0466966_0003020 Ga0466966_0003020_2355_3647 424
519 3300044684 Ga0466966_0019301 Ga0466966_0019301_2203_3489 424
520 3300044684 Ga0466966_0029417 Ga0466966_0029417_652_1938 424
521 3300044693 Ga0466961_0000061 Ga0466961_0000061_16227_17513 424
522 3300044693 Ga0466961_0058701 Ga0466961_0058701_802_2088 424
523 3300044693 Ga0466961_0088868 Ga0466961_0088868_17_1303 424
524 3300044694 Ga0466963_0003013 Ga0466963_0003013_6001_7287 424
525 3300044694 Ga0466963_0037902 Ga0466963_0037902_1499_2785 424
526 3300044706 Ga0466964_0001523 Ga0466964_0001523_6463_7755 424
527 3300044719 Ga0466971_0008015 Ga0466971_0008015_1702_2988 424
528 3300044735 Ga0466968_0005763 Ga0466968_0005763_737_2029 424
529 3300044842 Ga0466957_0000075 Ga0466957_0000075_7042_8334 424
530 3300044842 Ga0466957_0002815 Ga0466957_0002815_1152_2438 424
531 3300044842 Ga0466957_0022510 Ga0466957_0022510_1866_3158 424
532 3300044842 Ga0466957_0046544 Ga0466957_0046544_866_2152 424
533 3300045049 Ga0466959_0009742 Ga0466959_0009742_3426_4712 424
534 3300045049 Ga0466959_0039385 Ga0466959_0039385_1889_3175 424
535 3300045049 Ga0466959_0052406 Ga0466959_0052406_757_2049 424
536 3300045051 Ga0451576_0018798 Ga0451576_0018798_1294_2595 424
537 3300045836 Ga0466958_0002064 Ga0466958_0002064_2144_3430 424
538 3300045836 Ga0466958_0020934 Ga0466958_0020934_2152_3438 424
539 3300045836 Ga0466958_0027882 Ga0466958_0027882_527_1813 424
540 3300045836 Ga0466958_0108779 Ga0466958_0108779_318_1604 424
541 3300046452 Ga0495617_000001 Ga0495617_000001_439730_441022 424
542 3300046452 Ga0495617_000021 Ga0495617_000021_61926_63209 424
543 3300046453 Ga0495627_000007 Ga0495627_000007_48457_49740 424
544 3300046453 Ga0495627_000026 Ga0495627_000026_48750_50042 424
545 3300046454 Ga0495592_0028762 Ga0495592_0028762_2124_3410 424
546 3300046454 Ga0495592_0034333 Ga0495592_0034333_919_2205 424
547 3300046455 Ga0495603_0032716 Ga0495603_0032716_658_1950 424
548 3300046457 Ga0495590_0000010 Ga0495590_0000010_158374_159657 424
549 3300046457 Ga0495590_0000028 Ga0495590_0000028_68537_69829 424
550 3300046457 Ga0495590_0000083 Ga0495590_0000083_57623_58927 424
551 3300046457 Ga0495590_0000820 Ga0495590_0000820_1357_2649 424
552 3300046458 Ga0495591_000038 Ga0495591_000038_72259_73551 424
553 3300046459 Ga0495629_0005983 Ga0495629_0005983_5258_6544 424
554 3300046459 Ga0495629_0007935 Ga0495629_0007935_2529_3815 424
555 3300046459 Ga0495629_0012236 Ga0495629_0012236_2721_4007 424
556 3300046459 Ga0495629_0021233 Ga0495629_0021233_83_1375 424
557 3300046460 Ga0495638_0000157 Ga0495638_0000157_26197_27480 424
558 3300046461 Ga0495641_0030934 Ga0495641_0030934_1056_2342 424
559 3300046462 Ga0495651_0026578 Ga0495651_0026578_2769_4055 424
560 3300046463 Ga0495653_0000010 Ga0495653_0000010_91675_92958 424
561 3300046463 Ga0495653_0001720 Ga0495653_0001720_4520_5806 424
562 3300046463 Ga0495653_0004899 Ga0495653_0004899_3316_4620 424
563 3300046463 Ga0495653_0005296 Ga0495653_0005296_7323_8609 424
564 3300046463 Ga0495653_0010674 Ga0495653_0010674_2203_3489 424
565 3300046463 Ga0495653_0014076 Ga0495653_0014076_837_2129 424
566 3300046463 Ga0495653_0034739 Ga0495653_0034739_192_1496 424
567 3300046471 Ga0495650_0000085 Ga0495650_0000085_189868_191160 424
568 3300046471 Ga0495650_0000159 Ga0495650_0000159_112566_113849 424
569 3300046471 Ga0495650_0000194 Ga0495650_0000194_110340_111623 424
570 3300046471 Ga0495650_0000299 Ga0495650_0000299_29324_30607 424
571 3300046471 Ga0495650_0000410 Ga0495650_0000410_2596_3879 424
572 3300046471 Ga0495650_0000595 Ga0495650_0000595_15125_16408 424
573 3300046471 Ga0495650_0022964 Ga0495650_0022964_68_1351 424
574 3300046472 Ga0495580_0000291 Ga0495580_0000291_38191_39477 424
575 3300046472 Ga0495580_0002463 Ga0495580_0002463_1443_2729 424
576 3300046472 Ga0495580_0010366 Ga0495580_0010366_966_2252 424
577 3300046472 Ga0495580_0018264 Ga0495580_0018264_466_1770 424
578 3300046472 Ga0495580_0056101 Ga0495580_0056101_638_1924 424
579 3300046473 Ga0495582_0004843 Ga0495582_0004843_2782_4074 424
580 3300046473 Ga0495582_0007260 Ga0495582_0007260_3545_4831 424
581 3300046473 Ga0495582_0009445 Ga0495582_0009445_3509_4795 424
582 3300046473 Ga0495582_0011544 Ga0495582_0011544_2393_3697 424
583 3300046474 Ga0495605_0000004 Ga0495605_0000004_89602_90894 424
584 3300046474 Ga0495605_0000027 Ga0495605_0000027_149327_150610 424
585 3300046474 Ga0495605_0000160 Ga0495605_0000160_58447_59739 424
586 3300046474 Ga0495605_0003001 Ga0495605_0003001_2464_3756 424
587 3300046474 Ga0495605_0005586 Ga0495605_0005586_1618_2910 424
588 3300046475 Ga0495639_0006666 Ga0495639_0006666_3652_4935 424
589 3300046477 Ga0495664_0052460 Ga0495664_0052460_510_1796 424
590 3300046491 Ga0495584_0000234 Ga0495584_0000234_2563_3855 424
591 3300046491 Ga0495584_0000390 Ga0495584_0000390_3774_5066 424
592 3300046492 Ga0495585_0000521 Ga0495585_0000521_23873_25165 424
593 3300046492 Ga0495585_0001083 Ga0495585_0001083_3754_5037 424
594 3300046492 Ga0495585_0036248 Ga0495585_0036248_365_1657 424
595 3300046499 Ga0495594_0019212 Ga0495594_0019212_1043_2347 424
596 3300046499 Ga0495594_0039169 Ga0495594_0039169_511_1803 424
597 3300046500 Ga0495596_0000276 Ga0495596_0000276_29342_30634 424
598 3300046500 Ga0495596_0012822 Ga0495596_0012822_484_1770 424
599 3300046500 Ga0495596_0027136 Ga0495596_0027136_66_1358 424
600 3300046500 Ga0495596_0027302 Ga0495596_0027302_62_1354 424
601 3300046500 Ga0495596_0041783 Ga0495596_0041783_167_1459 424
602 3300046501 Ga0495607_0000272 Ga0495607_0000272_52348_53640 424
603 3300046501 Ga0495607_0002570 Ga0495607_0002570_8458_9750 424
604 3300046501 Ga0495607_0010437 Ga0495607_0010437_230_1522 424
605 3300046501 Ga0495607_0016076 Ga0495607_0016076_530_1813 424
606 3300046501 Ga0495607_0041184 Ga0495607_0041184_1118_2401 424
607 3300046506 Ga0495583_0000006 Ga0495583_0000006_187934_189217 424
608 3300046506 Ga0495583_0000182 Ga0495583_0000182_96913_98205 424
609 3300046506 Ga0495583_0013576 Ga0495583_0013576_1149_2441 424
610 3300046506 Ga0495583_0013600 Ga0495583_0013600_316_1608 424
611 3300046507 Ga0495606_0000088 Ga0495606_0000088_136201_137484 424
612 3300046507 Ga0495606_0000103 Ga0495606_0000103_34345_35628 424
613 3300046507 Ga0495606_0000132 Ga0495606_0000132_97599_98882 424
614 3300046507 Ga0495606_0000247 Ga0495606_0000247_75591_76874 424
615 3300046507 Ga0495606_0002709 Ga0495606_0002709_7281_8573 424
616 3300046507 Ga0495606_0005424 Ga0495606_0005424_9550_10833 424
617 3300046507 Ga0495606_0013303 Ga0495606_0013303_3110_4393 424
618 3300046507 Ga0495606_0013765 Ga0495606_0013765_3857_5191 424
619 3300046507 Ga0495606_0014367 Ga0495606_0014367_4123_5406 424
620 3300046507 Ga0495606_0049803 Ga0495606_0049803_1362_2648 424
621 3300046511 Ga0495608_0041172 Ga0495608_0041172_1079_2365 424
622 3300046512 Ga0495610_0000008 Ga0495610_0000008_84655_85938 424
623 3300046512 Ga0495610_0002900 Ga0495610_0002900_3703_4989 424
624 3300046512 Ga0495610_0004713 Ga0495610_0004713_1471_2754 424
625 3300046512 Ga0495610_0005527 Ga0495610_0005527_3642_4925 424
626 3300046512 Ga0495610_0007881 Ga0495610_0007881_5023_6306 424
627 3300046512 Ga0495610_0009532 Ga0495610_0009532_419_1702 424
628 3300046513 Ga0495616_0001024 Ga0495616_0001024_4556_5848 424
629 3300046513 Ga0495616_0002266 Ga0495616_0002266_3885_5177 424
630 3300046513 Ga0495616_0005147 Ga0495616_0005147_3072_4364 424
631 3300046514 Ga0495618_0003931 Ga0495618_0003931_3839_5125 424
632 3300046516 Ga0495628_0006279 Ga0495628_0006279_2816_4102 424
633 3300046516 Ga0495628_0047828 Ga0495628_0047828_741_2027 424
634 3300046516 Ga0495628_0084124 Ga0495628_0084124_554_1840 424
635 3300046517 Ga0495630_0005881 Ga0495630_0005881_3730_5016 424
636 3300046518 Ga0495631_0000105 Ga0495631_0000105_51263_52555 424
637 3300046518 Ga0495631_0003775 Ga0495631_0003775_2721_4013 424
638 3300046518 Ga0495631_0024157 Ga0495631_0024157_1178_2470 424
639 3300046519 Ga0495632_0000024 Ga0495632_0000024_108967_110259 424
640 3300046519 Ga0495632_0000043 Ga0495632_0000043_115320_116612 424
641 3300046519 Ga0495632_0000106 Ga0495632_0000106_7549_8841 424
642 3300046519 Ga0495632_0006661 Ga0495632_0006661_2937_4229 424
643 3300046520 Ga0495637_0000002 Ga0495637_0000002_84330_85622 424
644 3300046520 Ga0495637_0003552 Ga0495637_0003552_4562_5845 424
645 3300046520 Ga0495637_0013350 Ga0495637_0013350_1084_2367 424
646 3300046522 Ga0495643_0000022 Ga0495643_0000022_213062_214345 424
647 3300046522 Ga0495643_0000117 Ga0495643_0000117_63739_65022 424
648 3300046522 Ga0495643_0000552 Ga0495643_0000552_38963_40255 424
649 3300046522 Ga0495643_0008044 Ga0495643_0008044_4183_5475 424
650 3300046522 Ga0495643_0024905 Ga0495643_0024905_534_1826 424
651 3300046522 Ga0495643_0074302 Ga0495643_0074302_158_1450 424
652 3300046523 Ga0495644_0030135 Ga0495644_0030135_239_1531 424
653 3300046524 Ga0495648_0000022 Ga0495648_0000022_215102_216394 424
654 3300046524 Ga0495648_0000875 Ga0495648_0000875_30418_31701 424
655 3300046524 Ga0495648_0001544 Ga0495648_0001544_4962_6254 424
656 3300046524 Ga0495648_0002193 Ga0495648_0002193_2170_3462 424
657 3300046524 Ga0495648_0002666 Ga0495648_0002666_14778_16061 424
658 3300046524 Ga0495648_0004350 Ga0495648_0004350_1315_2601 424
659 3300046524 Ga0495648_0016093 Ga0495648_0016093_3268_4560 424
660 3300046524 Ga0495648_0027086 Ga0495648_0027086_135_1421 424
661 3300046526 Ga0495666_0003723 Ga0495666_0003723_5668_6960 424
662 3300046526 Ga0495666_0007129 Ga0495666_0007129_416_1702 424
663 3300046526 Ga0495666_0026377 Ga0495666_0026377_980_2266 424
664 3300046526 Ga0495666_0028271 Ga0495666_0028271_87_1391 424
665 3300046526 Ga0495666_0028744 Ga0495666_0028744_669_1955 424
666 3300046526 Ga0495666_0070065 Ga0495666_0070065_356_1642 424
667 3300046528 Ga0495642_0000001 Ga0495642_0000001_180513_181805 424
668 3300046528 Ga0495642_0000865 Ga0495642_0000865_1585_2877 424
669 3300046528 Ga0495642_0003562 Ga0495642_0003562_2287_3579 424
670 3300046528 Ga0495642_0006888 Ga0495642_0006888_933_2225 424
671 3300046529 Ga0495652_0018710 Ga0495652_0018710_598_1902 424
672 3300046529 Ga0495652_0022578 Ga0495652_0022578_3628_4914 424
673 3300046529 Ga0495652_0047350 Ga0495652_0047350_1565_2851 424
674 3300046529 Ga0495652_0110293 Ga0495652_0110293_741_2027 424
675 3300046530 Ga0495654_0000002 Ga0495654_0000002_634092_635375 424
676 3300046530 Ga0495654_0009202 Ga0495654_0009202_3618_4901 424
677 3300046530 Ga0495654_0055852 Ga0495654_0055852_316_1608 424
678 3300046531 Ga0495665_0001952 Ga0495665_0001952_2928_4232 424
679 3300046531 Ga0495665_0003338 Ga0495665_0003338_4069_5355 424
680 3300046531 Ga0495665_0007204 Ga0495665_0007204_3940_5226 424
681 3300046533 Ga0495640_0052953 Ga0495640_0052953_823_2109 424
682 3300046535 Ga0495586_0001962 Ga0495586_0001962_5414_6700 424
683 3300046535 Ga0495586_0013680 Ga0495586_0013680_1036_2328 424
684 3300046535 Ga0495586_0017444 Ga0495586_0017444_1031_2335 424
685 3300046536 Ga0495587_0002254 Ga0495587_0002254_10139_11425 424
686 3300046536 Ga0495587_0016882 Ga0495587_0016882_1092_2396 424
687 3300046538 Ga0495609_0000445 Ga0495609_0000445_15203_16495 424
688 3300046538 Ga0495609_0000554 Ga0495609_0000554_27912_29195 424
689 3300046538 Ga0495609_0001464 Ga0495609_0001464_7085_8377 424
690 3300046538 Ga0495609_0003850 Ga0495609_0003850_1124_2416 424
691 3300046538 Ga0495609_0011535 Ga0495609_0011535_2596_3879 424
692 3300046542 Ga0495597_0000030 Ga0495597_0000030_93646_94938 424
693 3300046542 Ga0495597_0000070 Ga0495597_0000070_23943_25235 424
694 3300046542 Ga0495597_0000189 Ga0495597_0000189_21237_22529 424
695 3300046542 Ga0495597_0000302 Ga0495597_0000302_17457_18740 424
696 3300046542 Ga0495597_0001677 Ga0495597_0001677_2633_3916 424
697 3300046542 Ga0495597_0003633 Ga0495597_0003633_3796_5079 424
698 3300046542 Ga0495597_0042076 Ga0495597_0042076_139_1431 424
699 3300046543 Ga0495645_0007362 Ga0495645_0007362_4005_5291 424
700 3300046543 Ga0495645_0084025 Ga0495645_0084025_719_2011 424
701 3300046557 Ga0495622_0000012 Ga0495622_0000012_131705_132988 424
702 3300046557 Ga0495622_0000048 Ga0495622_0000048_28376_29659 424
703 3300046558 Ga0495633_0001106 Ga0495633_0001106_20386_21669 424
704 3300046558 Ga0495633_0001287 Ga0495633_0001287_17756_19039 424
705 3300046558 Ga0495633_0005502 Ga0495633_0005502_5585_6868 424
706 3300046558 Ga0495633_0012459 Ga0495633_0012459_83_1375 424
707 3300046558 Ga0495633_0029467 Ga0495633_0029467_441_1724 424
708 3300046615 Ga0495656_0008392 Ga0495656_0008392_1274_2566 424
709 3300046616 Ga0495668_0000036 Ga0495668_0000036_152639_153931 424
710 3300046616 Ga0495668_0000038 Ga0495668_0000038_202662_203945 424
711 3300046616 Ga0495668_0000280 Ga0495668_0000280_20190_21482 424
712 3300046616 Ga0495668_0000428 Ga0495668_0000428_16995_18278 424
713 3300046616 Ga0495668_0001093 Ga0495668_0001093_24164_25447 424
714 3300046616 Ga0495668_0001482 Ga0495668_0001482_20976_22268 424
715 3300046616 Ga0495668_0004604 Ga0495668_0004604_1738_3021 424
716 3300046616 Ga0495668_0016754 Ga0495668_0016754_2301_3593 424
717 3300046616 Ga0495668_0047721 Ga0495668_0047721_683_1975 424
718 3300046642 Ga0495634_0008649 Ga0495634_0008649_3123_4427 424
719 3300046642 Ga0495634_0025885 Ga0495634_0025885_504_1790 424
720 3300046642 Ga0495634_0070031 Ga0495634_0070031_257_1543 424
721 3300046648 Ga0495611_0000191 Ga0495611_0000191_11404_12696 424
722 3300046648 Ga0495611_0000408 Ga0495611_0000408_16886_18178 424
723 3300046660 Ga0495625_0000241 Ga0495625_0000241_11067_12350 424
724 3300046660 Ga0495625_0000745 Ga0495625_0000745_2552_3835 424
725 3300046660 Ga0495625_0012563 Ga0495625_0012563_3618_4901 424
726 3300046660 Ga0495625_0013580 Ga0495625_0013580_1912_3195 424
727 3300046660 Ga0495625_0019537 Ga0495625_0019537_1970_3262 424
728 3300046660 Ga0495625_0027228 Ga0495625_0027228_382_1674 424
729 3300046663 Ga0495635_0002476 Ga0495635_0002476_4021_5307 424
730 3300046663 Ga0495635_0022427 Ga0495635_0022427_1330_2616 424
731 3300046664 Ga0495659_0000008 Ga0495659_0000008_32450_33733 424
732 3300046665 Ga0495661_0000040 Ga0495661_0000040_148799_150091 424
733 3300046665 Ga0495661_0001097 Ga0495661_0001097_4913_6205 424
734 3300046665 Ga0495661_0001236 Ga0495661_0001236_5209_6501 424
735 3300046665 Ga0495661_0003616 Ga0495661_0003616_3935_5227 424
736 3300046665 Ga0495661_0005279 Ga0495661_0005279_5517_6809 424
737 3300046665 Ga0495661_0006401 Ga0495661_0006401_4357_5649 424
738 3300046665 Ga0495661_0007134 Ga0495661_0007134_2813_4105 424
739 3300046665 Ga0495661_0011445 Ga0495661_0011445_2361_3647 424
740 3300046665 Ga0495661_0034998 Ga0495661_0034998_549_1832 424
741 3300046665 Ga0495661_0040333 Ga0495661_0040333_1429_2721 424
742 3300046674 Ga0495588_0000052 Ga0495588_0000052_20919_22211 424
743 3300046674 Ga0495588_0008561 Ga0495588_0008561_1778_3070 424
744 3300046674 Ga0495588_0011112 Ga0495588_0011112_1622_2914 424
745 3300046674 Ga0495588_0016502 Ga0495588_0016502_1710_3014 424
746 3300046678 Ga0495599_0105737 Ga0495599_0105737_243_1529 424
747 3300046679 Ga0495623_0009910 Ga0495623_0009910_3536_4822 424
748 3300046679 Ga0495623_0043178 Ga0495623_0043178_1493_2797 424
749 3300046680 Ga0495646_0000964 Ga0495646_0000964_13412_14698 424
750 3300046680 Ga0495646_0008960 Ga0495646_0008960_2174_3460 424
751 3300046680 Ga0495646_0009760 Ga0495646_0009760_2186_3472 424
752 3300046684 Ga0495669_0000013 Ga0495669_0000013_118366_119658 424
753 3300046684 Ga0495669_0000175 Ga0495669_0000175_1518_2810 424
754 3300046684 Ga0495669_0021154 Ga0495669_0021154_1222_2514 424
755 3300046689 Ga0495613_0008181 Ga0495613_0008181_2608_3900 424
756 3300046690 Ga0495624_0009686 Ga0495624_0009686_1781_3067 424
757 3300046690 Ga0495624_0032254 Ga0495624_0032254_1493_2779 424
758 3300046692 Ga0495671_0000002 Ga0495671_0000002_692193_693476 424
759 3300046692 Ga0495671_0000155 Ga0495671_0000155_39894_41177 424
760 3300046692 Ga0495671_0000313 Ga0495671_0000313_14126_15418 424
761 3300046692 Ga0495671_0004065 Ga0495671_0004065_1606_2898 424
762 3300046692 Ga0495671_0006095 Ga0495671_0006095_4105_5397 424
763 3300046694 Ga0495649_0000085 Ga0495649_0000085_41863_43155 424
764 3300046694 Ga0495649_0002029 Ga0495649_0002029_10176_11459 424
765 3300046694 Ga0495649_0036293 Ga0495649_0036293_958_2241 424
766 3300046794 Ga0495589_0000058 Ga0495589_0000058_62088_63380 424
767 3300046794 Ga0495589_0000227 Ga0495589_0000227_32175_33467 424
768 3300046794 Ga0495589_0001047 Ga0495589_0001047_15200_16492 424
769 3300046794 Ga0495589_0020385 Ga0495589_0020385_1586_2878 424
770 3300046794 Ga0495589_0028869 Ga0495589_0028869_392_1678 424
771 3300046794 Ga0495589_0038261 Ga0495589_0038261_1100_2392 424
772 3300046809 Ga0495600_0004893 Ga0495600_0004893_5430_6716 424
773 3300046810 Ga0495660_0000050 Ga0495660_0000050_110565_111857 424
774 3300046810 Ga0495660_0000285 Ga0495660_0000285_17933_19216 424
775 3300046810 Ga0495660_0000339 Ga0495660_0000339_21252_22535 424
776 3300046810 Ga0495660_0003258 Ga0495660_0003258_6461_7744 424
777 3300046810 Ga0495660_0005819 Ga0495660_0005819_4090_5382 424
778 3300046810 Ga0495660_0016426 Ga0495660_0016426_2479_3771 424
779 3300046810 Ga0495660_0029698 Ga0495660_0029698_1765_3048 424
780 3300047315 Ga0495581_0007807 Ga0495581_0007807_1225_2511 424
781 3300047315 Ga0495581_0008391 Ga0495581_0008391_670_1956 424
782 3300047317 Ga0495604_0012680 Ga0495604_0012680_3818_5122 424
783 3300047317 Ga0495604_0016491 Ga0495604_0016491_3885_5171 424
784 3300047317 Ga0495604_0016819 Ga0495604_0016819_1653_2939 424
785 3300047317 Ga0495604_0019475 Ga0495604_0019475_490_1776 424
786 3300047317 Ga0495604_0102648 Ga0495604_0102648_628_1914 424
787 3300047319 Ga0495674_0004385 Ga0495674_0004385_1533_2819 424
788 3300047319 Ga0495674_0012988 Ga0495674_0012988_2893_4179 424
789 3300047319 Ga0495674_0030002 Ga0495674_0030002_312_1598 424
790 3300047319 Ga0495674_0036553 Ga0495674_0036553_504_1790 424
791 3300047320 Ga0495672_0000325 Ga0495672_0000325_46688_47971 424
792 3300047320 Ga0495672_0000677 Ga0495672_0000677_24690_25982 424
793 3300047320 Ga0495672_0001219 Ga0495672_0001219_16788_18071 424
794 3300047320 Ga0495672_0006470 Ga0495672_0006470_6972_8264 424
795 3300047321 Ga0495676_0000029 Ga0495676_0000029_135663_136955 424
796 3300047321 Ga0495676_0024837 Ga0495676_0024837_3814_5100 424
797 3300047321 Ga0495676_0054971 Ga0495676_0054971_1179_2465 424
798 3300047322 Ga0495680_0001059 Ga0495680_0001059_17756_19042 424
799 3300047322 Ga0495680_0005882 Ga0495680_0005882_5967_7253 424
800 3300047322 Ga0495680_0010964 Ga0495680_0010964_3666_4958 424
801 3300047322 Ga0495680_0095210 Ga0495680_0095210_556_1842 424
802 3300047323 Ga0495683_0000012 Ga0495683_0000012_162089_163381 424
803 3300047323 Ga0495683_0018236 Ga0495683_0018236_1609_2895 424
804 3300047323 Ga0495683_0029389 Ga0495683_0029389_1241_2533 424
805 3300047323 Ga0495683_0037256 Ga0495683_0037256_90_1376 424
806 3300047443 Ga0495687_000002 Ga0495687_000002_240677_241969 424
807 3300047443 Ga0495687_000003 Ga0495687_000003_418979_420271 424
808 3300047443 Ga0495687_000007 Ga0495687_000007_327257_328549 424
809 3300047443 Ga0495687_000073 Ga0495687_000073_132544_133836 424
810 3300047443 Ga0495687_000445 Ga0495687_000445_24142_25434 424
811 3300047443 Ga0495687_000489 Ga0495687_000489_26316_27608 424
812 3300047443 Ga0495687_001493 Ga0495687_001493_12752_14035 424
813 3300047443 Ga0495687_020518 Ga0495687_020518_70_1356 424
814 3300047444 Ga0495675_0040644 Ga0495675_0040644_377_1681 424
815 3300047444 Ga0495675_0051409 Ga0495675_0051409_920_2224 424
816 3300047445 Ga0495677_0000144 Ga0495677_0000144_17632_18924 424
817 3300047445 Ga0495677_0000152 Ga0495677_0000152_31607_32899 424
818 3300047445 Ga0495677_0001812 Ga0495677_0001812_2287_3579 424
819 3300047445 Ga0495677_0008040 Ga0495677_0008040_726_2018 424
820 3300047446 Ga0495679_000038 Ga0495679_000038_87297_88583 424
821 3300047446 Ga0495679_001340 Ga0495679_001340_4032_5318 424
822 3300047446 Ga0495679_010320 Ga0495679_010320_379_1671 424
823 3300047446 Ga0495679_019679 Ga0495679_019679_100_1386 424
824 3300047469 Ga0495673_0000005 Ga0495673_0000005_512120_513403 424
825 3300047469 Ga0495673_0000064 Ga0495673_0000064_76702_77985 424
826 3300047469 Ga0495673_0000109 Ga0495673_0000109_53961_55244 424
827 3300047469 Ga0495673_0024774 Ga0495673_0024774_304_1590 424
828 3300047469 Ga0495673_0046225 Ga0495673_0046225_295_1581 424
829 3300047470 Ga0495681_0000005 Ga0495681_0000005_124124_125416 424
830 3300047470 Ga0495681_0000555 Ga0495681_0000555_3191_4483 424
831 3300047470 Ga0495681_0004387 Ga0495681_0004387_1540_2823 424
832 3300047470 Ga0495681_0008550 Ga0495681_0008550_1969_3261 424
833 3300047471 Ga0495684_0055846 Ga0495684_0055846_454_1740 424
834 3300047472 Ga0495686_0000015 Ga0495686_0000015_102439_103731 424
835 3300047472 Ga0495686_0016243 Ga0495686_0016243_2131_3423 424
836 3300047673 Ga0495593_0001558 Ga0495593_0001558_8016_9302 424
837 3300047673 Ga0495593_0009404 Ga0495593_0009404_331_1617 424
838 3300047673 Ga0495593_0014443 Ga0495593_0014443_325_1617 424
839 3300047673 Ga0495593_0056827 Ga0495593_0056827_100_1386 424
840 3300048088 Ga0495602_0020951 Ga0495602_0020951_1150_2436 424
841 3300048088 Ga0495602_0022831 Ga0495602_0022831_775_2061 424
842 3300048088 Ga0495602_0025386 Ga0495602_0025386_1989_3275 424
843 3300048088 Ga0495602_0066735 Ga0495602_0066735_1532_2818 424
844 3300048089 Ga0495614_0005056 Ga0495614_0005056_699_1985 424
845 3300048089 Ga0495614_0037762 Ga0495614_0037762_117_1403 424
846 3300048091 Ga0495626_0000066 Ga0495626_0000066_10354_11688 424
847 3300048091 Ga0495626_0000145 Ga0495626_0000145_62088_63380 424
848 3300048091 Ga0495626_0010793 Ga0495626_0010793_709_2001 424
849 3300048091 Ga0495626_0020232 Ga0495626_0020232_492_1784 424
850 3300048904 Ga0496101_0001448 Ga0496101_0001448_4860_6146 424
851 3300048904 Ga0496101_0076508 Ga0496101_0076508_579_1871 424
852 3300048904 Ga0496101_0154564 Ga0496101_0154564_232_1524 424
853 3300048905 Ga0496102_0000033 Ga0496102_0000033_203227_204519 424
854 3300048905 Ga0496102_0108444 Ga0496102_0108444_547_1833 424
855 3300048906 Ga0496103_0001960 Ga0496103_0001960_9012_10295 424
856 3300048906 Ga0496103_0002298 Ga0496103_0002298_10567_11853 424
857 3300048907 Ga0496104_0074198 Ga0496104_0074198_1781_3067 424
858 3300048908 Ga0496105_0049200 Ga0496105_0049200_1144_2430 424
859 3300048909 Ga0496106_0000019 Ga0496106_0000019_154394_155680 424
860 3300048909 Ga0496106_0022320 Ga0496106_0022320_805_2097 424
861 3300048910 Ga0496107_0163415 Ga0496107_0163415_339_1622 424
862 3300048912 Ga0496109_0006962 Ga0496109_0006962_4038_5330 424
863 3300048913 Ga0496110_0000007 Ga0496110_0000007_51810_53102 424
864 3300048915 Ga0496112_0037713 Ga0496112_0037713_1040_2326 424
865 3300048915 Ga0496112_0063266 Ga0496112_0063266_1252_2544 424
866 3300048916 Ga0496113_0007646 Ga0496113_0007646_469_1761 424
867 3300048917 Ga0496114_0177710 Ga0496114_0177710_19_1311 424
868 3300048919 Ga0496116_0080780 Ga0496116_0080780_173_1459 424
869 3300048920 Ga0496117_0007793 Ga0496117_0007793_2980_4266 424
870 3300048920 Ga0496117_0015289 Ga0496117_0015289_5057_6343 424
871 3300048920 Ga0496117_0025869 Ga0496117_0025869_2107_3393 424
872 3300048921 Ga0496118_0004991 Ga0496118_0004991_1422_2708 424
873 3300048921 Ga0496118_0005234 Ga0496118_0005234_224_1510 424
874 3300048921 Ga0496118_0041145 Ga0496118_0041145_1202_2488 424
875 3300048921 Ga0496118_0070827 Ga0496118_0070827_29_1315 424
876 3300048924 Ga0496121_0000310 Ga0496121_0000310_18897_20183 424
877 3300048924 Ga0496121_0003570 Ga0496121_0003570_18437_19723 424
878 3300048924 Ga0496121_0007511 Ga0496121_0007511_5401_6687 424
879 3300048924 Ga0496121_0147738 Ga0496121_0147738_47_1330 424
880 3300048925 Ga0496122_0000279 Ga0496122_0000279_27441_28733 424
881 3300048925 Ga0496122_0002401 Ga0496122_0002401_9345_10637 424
882 3300048925 Ga0496122_0005248 Ga0496122_0005248_1218_2510 424
883 3300048926 Ga0496123_0000146 Ga0496123_0000146_115288_116580 424
884 3300048926 Ga0496123_0001138 Ga0496123_0001138_36129_37412 424
885 3300048926 Ga0496123_0010024 Ga0496123_0010024_1172_2464 424
886 3300048926 Ga0496123_0015195 Ga0496123_0015195_3045_4337 424
887 3300048927 Ga0496124_0002145 Ga0496124_0002145_15716_17008 424
888 3300048927 Ga0496124_0005692 Ga0496124_0005692_11912_13216 424
889 3300048927 Ga0496124_0010579 Ga0496124_0010579_5679_6971 424
890 3300048927 Ga0496124_0070548 Ga0496124_0070548_547_1848 424
891 3300048927 Ga0496124_0141287 Ga0496124_0141287_321_1613 424
892 3300048928 Ga0496125_0000938 Ga0496125_0000938_19810_21102 424
893 3300048928 Ga0496125_0050210 Ga0496125_0050210_36_1328 424
894 3300048929 Ga0496126_0000706 Ga0496126_0000706_2189_3475 424
895 3300048929 Ga0496126_0033941 Ga0496126_0033941_208_1491 424
896 3300049128 Ga0501308_000888 Ga0501308_000888_30_1322 424
897 3300049459 Ga0495678_000004 Ga0495678_000004_65739_67022 424
898 3300049459 Ga0495678_000015 Ga0495678_000015_197196_198488 424
899 3300049459 Ga0495678_000022 Ga0495678_000022_93007_94299 424
900 3300049459 Ga0495678_000103 Ga0495678_000103_21444_22727 424
901 3300049459 Ga0495678_001009 Ga0495678_001009_16482_17774 424
902 3300049459 Ga0495678_001189 Ga0495678_001189_3333_4625 424
903 3300049460 Ga0495682_0000038 Ga0495682_0000038_42361_43653 424
904 3300049460 Ga0495682_0009396 Ga0495682_0009396_251_1537 424
905 3300049460 Ga0495682_0035115 Ga0495682_0035115_281_1573 424
906 3300049581 Ga0501047_0234088 Ga0501047_0234088_287_1579 424
907 3300049679 Ga0501249_003643 Ga0501249_003643_279_1562 424
908 3300049822 Ga0501035_0000552 Ga0501035_0000552_29668_30960 424
909 3300053118 Ga0500594_0005059 Ga0500594_0005059_509_1792 424
910 3300053125 Ga0500618_000032 Ga0500618_000032_55506_56789 424
911 3300053730 Ga0500645_000991 Ga0500645_000991_14211_15506 424
912 3300061719 Ga0466962_0006514 Ga0466962_0006514_573_1859 424
913 3300061719 Ga0466962_0018488 Ga0466962_0018488_440_1726 424
914 iso_pu_bacteria 2904483920 2904487456 424
915 iso_pu_bacteria 2919527303 2919528763 424
916 3300002704 JGI25155J39150_1000080 JGI25155J39150_100008047 425
917 3300002705 JGI25156J39149_1000112 JGI25156J39149_100011241 425
918 3300002705 JGI25156J39149_1000128 JGI25156J39149_100012847 425
919 3300002738 JGI25154J39366_1000143 JGI25154J39366_100014347 425
920 3300002738 JGI25154J39366_1000228 JGI25154J39366_100022817 425
921 3300002741 JGI25157J39369_1000134 JGI25157J39369_100013447 425
922 3300003758 Ga0055532_1000101 Ga0055532_100010150 425
923 3300005563 Ga0068855_100046114 Ga0068855_1000461146 425
924 3300005614 Ga0068856_100089098 Ga0068856_1000890984 425
925 3300009093 Ga0105240_10007932 Ga0105240_1000793215 425
926 3300009551 Ga0105238_10046424 Ga0105238_100464243 425
927 3300025206 Ga0209435_100016 Ga0209435_100016262 425
928 3300025229 Ga0209147_100023 Ga0209147_10002366 425
929 3300025242 Ga0209258_100345 Ga0209258_10034557 425
930 3300025246 Ga0209646_1000033 Ga0209646_100003347 425
931 3300025250 Ga0209026_1000031 Ga0209026_100003166 425
932 3300025256 Ga0209759_1000227 Ga0209759_100022721 425
933 3300025913 Ga0207695_10017376 Ga0207695_100173763 425
934 3300025949 Ga0207667_10026316 Ga0207667_100263163 425
935 3300026078 Ga0207702_10215259 Ga0207702_102152591 425
936 3300046660 Ga0495625_0001333 Ga0495625_0001333_8002_9285 425
937 3300048919 Ga0496116_0013017 Ga0496116_0013017_5167_6558 425
938 3300048925 Ga0496122_0000457 Ga0496122_0000457_15246_16637 425
939 3300048926 Ga0496123_0000321 Ga0496123_0000321_61304_62695 425
940 3300048928 Ga0496125_0000895 Ga0496125_0000895_35414_36697 425
941 3300048928 Ga0496125_0050623 Ga0496125_0050623_1208_2581 425
942 iso_pu_bacteria 2885266251 2885267637 425
943 iso_pu_bacteria 2928058823 2928062992 425
944 3300002067 JGI24735J21928_10000211 JGI24735J21928_1000021125 426
945 3300002987 JGI25159J45721_1000415 JGI25159J45721_100041516 426
946 3300003771 Ga0055526_1008612 Ga0055526_10086124 426
947 3300004801 Ga0058860_12094178 Ga0058860_120941781 426
948 3300005459 Ga0068867_100259328 Ga0068867_1002593281 426
949 3300005563 Ga0068855_100000072 Ga0068855_10000007253 426
950 3300006186 Ga0075369_10050767 Ga0075369_100507671 426
951 3300009011 Ga0105251_10003240 Ga0105251_100032408 426
952 3300009174 Ga0105241_10135866 Ga0105241_101358662 426
953 3300009551 Ga0105238_10327108 Ga0105238_103271081 426
954 3300013296 Ga0157374_10154109 Ga0157374_101541093 426
955 3300013297 Ga0157378_10304588 Ga0157378_103045881 426
956 3300020078 Ga0206352_10616037 Ga0206352_106160371 426
957 3300021361 Ga0213872_10035227 Ga0213872_100352272 426
958 3300021361 Ga0213872_10049988 Ga0213872_100499882 426
959 3300025206 Ga0209435_101536 Ga0209435_1015362 426
960 3300025949 Ga0207667_10000055 Ga0207667_10000055170 426
961 3300026089 Ga0207648_10073287 Ga0207648_100732873 426
962 3300037471 Ga0395905_0182492 Ga0395905_0182492_668_1960 426
963 3300039447 Ga0436361_0051331 Ga0436361_0051331_25680_26969 426
964 3300039447 Ga0436361_0457272 Ga0436361_0457272_4578_5879 426
965 3300046457 Ga0495590_0004307 Ga0495590_0004307_605_1897 426
966 3300046459 Ga0495629_0012487 Ga0495629_0012487_1493_2785 426
967 3300046463 Ga0495653_0114335 Ga0495653_0114335_258_1550 426
968 3300046471 Ga0495650_0001326 Ga0495650_0001326_20422_21714 426
969 3300046477 Ga0495664_0000037 Ga0495664_0000037_8201_9493 426
970 3300046507 Ga0495606_0013103 Ga0495606_0013103_1397_2686 426
971 3300046507 Ga0495606_0099810 Ga0495606_0099810_67_1359 426
972 3300046516 Ga0495628_0025525 Ga0495628_0025525_1325_2617 426
973 3300046531 Ga0495665_0035472 Ga0495665_0035472_406_1698 426
974 3300046543 Ga0495645_0095254 Ga0495645_0095254_408_1736 426
975 3300046663 Ga0495635_0174118 Ga0495635_0174118_145_1437 426
976 3300046690 Ga0495624_0011804 Ga0495624_0011804_3516_4808 426
977 3300047319 Ga0495674_0005533 Ga0495674_0005533_1213_2505 426
978 3300047320 Ga0495672_0005093 Ga0495672_0005093_8259_9587 426
979 3300047323 Ga0495683_0009313 Ga0495683_0009313_866_2158 426
980 3300047443 Ga0495687_000025 Ga0495687_000025_291299_292591 426
981 3300047472 Ga0495686_0000032 Ga0495686_0000032_85696_86988 426
982 3300048905 Ga0496102_0004637 Ga0496102_0004637_6632_7924 426
983 3300048905 Ga0496102_0106004 Ga0496102_0106004_654_1946 426
984 3300048906 Ga0496103_0002086 Ga0496103_0002086_1176_2468 426
985 3300048909 Ga0496106_0042892 Ga0496106_0042892_1160_2452 426
986 3300048915 Ga0496112_0164239 Ga0496112_0164239_326_1618 426
987 3300048917 Ga0496114_0032092 Ga0496114_0032092_1537_2829 426
988 3300048919 Ga0496116_0008917 Ga0496116_0008917_2393_3685 426
989 3300048924 Ga0496121_0010176 Ga0496121_0010176_4947_6239 426
990 3300048925 Ga0496122_0012927 Ga0496122_0012927_6833_8125 426
991 3300048929 Ga0496126_0000034 Ga0496126_0000034_70524_71816 426
992 3300048929 Ga0496126_0068323 Ga0496126_0068323_427_1719 426
993 3300059506 Ga0587085_005324 Ga0587085_005324_151_1443 426
994 3300003856 Ga0058692_1002178 Ga0058692_10021783 427
995 3300003856 Ga0058692_1011276 Ga0058692_10112762 427
996 3300005347 Ga0070668_100012227 Ga0070668_1000122273 427
997 3300009011 Ga0105251_10003354 Ga0105251_100033542 427
998 3300011119 Ga0105246_10033371 Ga0105246_100333711 427
999 3300015261 Ga0182006_1011977 Ga0182006_10119773 427
1000 3300025972 Ga0207668_10023326 Ga0207668_100233263 427
1001 3300027312 Ga0209371_1002201 Ga0209371_10022015 427
1002 3300027312 Ga0209371_1013531 Ga0209371_10135312 427
1003 3300030500 Ga0268256_1001207 Ga0268256_10012078 427
1004 3300030500 Ga0268256_1011771 Ga0268256_10117712 427
1005 3300041411 Ga0439466_0000136 Ga0439466_0000136_22988_24289 427
1006 3300042012 Ga0439455_0012221 Ga0439455_0012221_610_1914 427
1007 3300042146 Ga0450907_001052 Ga0450907_001052_1272_2573 427
1008 3300042439 Ga0439464_0005502 Ga0439464_0005502_769_2169 427
1009 3300046452 Ga0495617_015762 Ga0495617_015762_728_2029 427
1010 3300046458 Ga0495591_000007 Ga0495591_000007_245972_247273 427
1011 3300046500 Ga0495596_0005192 Ga0495596_0005192_885_2186 427
1012 3300046522 Ga0495643_0017855 Ga0495643_0017855_967_2367 427
1013 3300046524 Ga0495648_0009106 Ga0495648_0009106_5813_7213 427
1014 3300046528 Ga0495642_0001857 Ga0495642_0001857_6529_7833 427
1015 3300047320 Ga0495672_0000015 Ga0495672_0000015_102530_103831 427
1016 3300047445 Ga0495677_0037019 Ga0495677_0037019_240_1544 427
1017 3300047446 Ga0495679_004357 Ga0495679_004357_1259_2560 427
1018 3300048920 Ga0496117_0000058 Ga0496117_0000058_162419_163720 427
1019 3300048921 Ga0496118_0003177 Ga0496118_0003177_17248_18549 427
1020 3300048922 Ga0496119_0000089 Ga0496119_0000089_97871_99271 427
1021 3300048923 Ga0496120_0000117 Ga0496120_0000117_35073_36473 427
1022 3300048923 Ga0496120_0001811 Ga0496120_0001811_3876_5276 427
1023 3300048924 Ga0496121_0000205 Ga0496121_0000205_106359_107759 427
1024 3300048927 Ga0496124_0000208 Ga0496124_0000208_36502_37902 427
1025 3300048927 Ga0496124_0036217 Ga0496124_0036217_2783_4084 427
1026 3300048928 Ga0496125_0023674 Ga0496125_0023674_644_2044 427
1027 3300048929 Ga0496126_0044704 Ga0496126_0044704_1199_2500 427
1028 3300002067 JGI24735J21928_10008800 JGI24735J21928_100088003 428
1029 3300002705 JGI25156J39149_1002049 JGI25156J39149_10020496 428
1030 3300003578 Ga0006562J51391_1027748 Ga0006562J51391_10277481 428
1031 3300003756 Ga0055533_1001120 Ga0055533_10011205 428
1032 3300003758 Ga0055532_1000039 Ga0055532_10000393 428
1033 3300003760 Ga0055527_1000024 Ga0055527_10000243 428
1034 3300003761 Ga0055535_1000028 Ga0055535_10000283 428
1035 3300003762 Ga0055542_1000047 Ga0055542_1000047184 428
1036 3300003763 Ga0055529_1000054 Ga0055529_10000543 428
1037 3300009093 Ga0105240_10108247 Ga0105240_101082472 428
1038 3300025226 Ga0209674_100013 Ga0209674_100013289 428
1039 3300025228 Ga0209672_100010 Ga0209672_100010334 428
1040 3300025229 Ga0209147_100006 Ga0209147_100006334 428
1041 3300025231 Ga0207427_100524 Ga0207427_10052420 428
1042 3300025242 Ga0209258_100010 Ga0209258_100010334 428
1043 3300025254 Ga0209148_1000018 Ga0209148_1000018334 428
1044 3300025256 Ga0209759_1002634 Ga0209759_10026345 428
1045 3300025261 Ga0209233_1000135 Ga0209233_1000135190 428
1046 3300025272 Ga0209455_1000015 Ga0209455_1000015334 428
1047 3300001915 JGI24741J21665_1000401 JGI24741J21665_100040114 429
1048 3300002705 JGI25156J39149_1003825 JGI25156J39149_10038252 429
1049 3300002738 JGI25154J39366_1002015 JGI25154J39366_10020152 429
1050 3300003751 Ga0055538_1001125 Ga0055538_10011253 429
1051 3300003756 Ga0055533_1005185 Ga0055533_10051852 429
1052 3300003762 Ga0055542_1001248 Ga0055542_10012489 429
1053 3300003841 Ga0055541_1000338 Ga0055541_100033815 429
1054 3300025224 Ga0209784_100355 Ga0209784_10035521 429
1055 3300025225 Ga0209566_100206 Ga0209566_10020651 429
1056 3300025226 Ga0209674_100317 Ga0209674_10031720 429
1057 3300025246 Ga0209646_1000022 Ga0209646_100002290 429
1058 3300025253 Ga0209677_102782 Ga0209677_1027823 429
1059 3300025254 Ga0209148_1000021 Ga0209148_1000021669 429
1060 3300025256 Ga0209759_1008597 Ga0209759_10085971 429
1061 3300037471 Ga0395905_0143228 Ga0395905_0143228_492_1781 429
1062 3300044658 Ga0466972_0077901 Ga0466972_0077901_252_1541 429
1063 3300044735 Ga0466968_0003359 Ga0466968_0003359_499_1788 429

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01266

DAO

FAD dependent oxidoreductase

279

456

0.88

PF01266

DAO

FAD dependent oxidoreductase

1

277

0.88

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

1

62

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j0e-assembly1.cif.gz_B crystal structure of 3-hydroxyacyl-coa dehydrogenase from caenorhadbitis elegans in p1 space group 0.9943 2 32
4j0e-assembly1.cif.gz_A crystal structure of 3-hydroxyacyl-coa dehydrogenase from caenorhadbitis elegans in p1 space group 0.9921 2 32
7bkd-assembly1.cif.gz_a formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (heterodislfide reductase core and mobile arm in conformational state 1, composite structure) 0.9892 2 32
7o4q-assembly1.cif.gz_B-2 structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in space group c2221 (unliganded) 0.9887 2 32
7o4t-assembly1.cif.gz_A structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme with coenzyme a bound at the hydratase, thiolase active sites and possible additional binding site (coa(ech/had)) 0.9862 2 32
ID Description Score Start End Superfamily
af_I6Y4U4_173_293_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9879 2 37 3.50.50.60
af_A0A1D6LYX0_29_117_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9835 2 35 3.50.50.60
4bjyA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9833 2 32 3.50.50.60
af_Q2G041_6_109_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9797 3 31 3.50.50.60
4i58A01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9789 2 32 3.50.50.60
ID Description Score Start End GO Terms
AF-J0VQE7-F1-model_v4 deleted 0.9836 1 415
AF-A0A527HAE0-F1-model_v4 D-amino acid dehydrogenase 0.9832 1 329 GO:0005737
GO:0005886
GO:0008718
GO:0055130
AF-A0A2N3CD51-F1-model_v4 D-amino acid dehydrogenase small subunit (EC 1.4.99.6) 0.9814 1 406 GO:0005737
GO:0005886
GO:0008718
GO:0055130
AF-A0A2E5MX84-F1-model_v4 Amino acid dehydrogenase 0.9806 1 415 GO:0005737
GO:0005886
GO:0008718
GO:0055130
AF-A0A419WFR6-F1-model_v4 deleted 0.9804 1 414

Feature Viewer

pLDDT pTM Quality
92.45 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map