F489336

General Info

Members Datasets Scaffolds Average Seq Length
1063 316 2127 209

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_517578_c1|nmdc:mga0n895_517578_c1_288_962
Length 224
Sequence MGAAPFIATAAQTRQSQENEMFDQIRPYDPLTSENAALVLIDHQVGLMTGVRDYSTGELKHNVVALAKAAKALKLPIVATTTARDSMWGPTFPELVVALPGVQIIDRSSVNAFDDTRVAQATGRKKLIFAGISLEVCAAFPAITAVGKGYSAYVAVDASGTFSETKRQVGLLRMLQAGVIVSDYATLMVEILKDNARPEAGAVYGTIDMPWAKLVGQIAQAYGK

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
12 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
85 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
86 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
105 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
106 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
107 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
108 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
113 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
116 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
121 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
124 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
136 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
137 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
138 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
139 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
140 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
141 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
142 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
143 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
144 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
145 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
146 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
148 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
150 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
152 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
155 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
211 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
212 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
213 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
221 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
222 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
223 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
224 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
225 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
226 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
227 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
228 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
229 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
230 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
231 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
232 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
233 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
234 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
235 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
236 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
237 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
238 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
239 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
240 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
241 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
242 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
243 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
244 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
245 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
246 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
247 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
248 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
249 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
250 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
251 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
252 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
253 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
254 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
255 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
256 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
257 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
258 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
259 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
260 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
261 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
262 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
263 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
264 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
265 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
266 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
267 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
268 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
269 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
270 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
271 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
272 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
273 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
274 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
275 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
276 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
277 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
278 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
279 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
280 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
281 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
282 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
283 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
284 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
285 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
286 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
287 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
288 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
289 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
290 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
291 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
292 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
293 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
294 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
295 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
296 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
297 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
298 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
299 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
300 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
301 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
302 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
303 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
304 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
305 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
306 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
307 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
308 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
309 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
310 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
311 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
312 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
313 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
314 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
315 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
316 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0.75
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.11
Nodule 0.38
Rhizoplane 5.93
Rhizosphere 85.51
Stem 0
Stem Tuber 0
Unclassified 6.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_517578_c1 3300050512 Bacteria 1201
2 JGI25162J39368_1001022 3300002737 Bacteria 17340
3 JGI25150J39212_1000044 3300002774 Bacteria 83125
4 JGI25150J39212_1000132 3300002774 Bacteria 41803
5 JGI25159J45721_1016594 3300002987 Bacteria 1563
6 JGI25151J46595_10021401 3300003187 Bacteria 2706
7 JGI25165J46597_1000276 3300003214 Bacteria 66076
8 JGI25153J46596_10000043 3300003215 Bacteria 156407
9 JGI25153J46596_10000265 3300003215 Bacteria 41811
10 rootH1_10042237 3300003316 Bacteria 2968
11 rootH1_10016176 3300003316 Bacteria 26999
12 rootH1_10016176 3300003323 Bacteria 2806
13 rootH1_10077686 3300003323 Bacteria 3548
14 JGI25160J50197_1032623 3300003354 Bacteria 1320
15 JGI25407J50210_10054340 3300003373 Bacteria 1012
16 JGI25404J52841_10028741 3300003659 Bacteria 1193
17 Ga0055526_1008793 3300003771 Bacteria 4971
18 Ga0055526_1043098 3300003771 Bacteria 1103
19 Ga0055537_1000553 3300003773 Bacteria 21212
20 Ga0055524_1000017 3300003775 Bacteria 235608
21 Ga0055536_1000393 3300003781 Bacteria 31775
22 Ga0055530_10009972 3300003791 Bacteria 3574
23 Ga0055540_1041615 3300003792 Bacteria 988
24 Ga0055531_10000805 3300003794 Bacteria 26002
25 Ga0055531_10002275 3300003794 Bacteria 12993
26 JGI25405J52794_10001047 3300003911 Bacteria 4401
27 Ga0065165_1001283 3300005262 Bacteria 28362
28 Ga0065165_1011885 3300005262 Bacteria 3585
29 Ga0065704_10105882 3300005289 Bacteria 2098
30 Ga0065712_10001241 3300005290 Bacteria 6376
31 Ga0065712_10295978 3300005290 Bacteria 869
32 Ga0065715_10095973 3300005293 Bacteria 3970
33 Ga0065715_10150025 3300005293 Bacteria 1740
34 Ga0065715_10300473 3300005293 Bacteria 1042
35 Ga0065715_10344713 3300005293 Bacteria 961
36 Ga0065707_10066515 3300005295 Bacteria 975
37 Ga0065707_10084964 3300005295 Bacteria 6594
38 Ga0070666_10040482 3300005335 Bacteria 3111
39 Ga0070682_100003792 3300005337 Bacteria 8402
40 Ga0070682_100080519 3300005337 Unclassified 2106
41 Ga0070682_100598915 3300005337 Bacteria 870
42 Ga0068868_100201975 3300005338 Bacteria 1657
43 Ga0068868_101277302 3300005338 Bacteria 681
44 Ga0070660_100023777 3300005339 Unclassified 4541
45 Ga0070689_100018067 3300005340 Bacteria 5188
46 Ga0070689_100027619 3300005340 Bacteria 4279
47 Ga0070691_10009813 3300005341 Bacteria 4366
48 Ga0070691_10017350 3300005341 Unclassified 3312
49 Ga0070687_100017106 3300005343 Bacteria 3326
50 Ga0070661_100288636 3300005344 Bacteria 1274
51 Ga0070668_100019648 3300005347 Bacteria 5086
52 Ga0070668_100414151 3300005347 Bacteria 1153
53 Ga0070668_100514818 3300005347 Bacteria 1037
54 Ga0070668_100836728 3300005347 Bacteria 819
55 Ga0070669_100037023 3300005353 Bacteria 3538
56 Ga0070669_100120918 3300005353 Bacteria 1998
57 Ga0070669_100667130 3300005353 Bacteria 876
58 Ga0070671_100078248 3300005355 Bacteria 2764
59 Ga0070671_100492473 3300005355 Unclassified 1054
60 Ga0070671_100807460 3300005355 Bacteria 817
61 Ga0070674_100142987 3300005356 Bacteria 1798
62 Ga0070688_100042784 3300005365 Bacteria 2788
63 Ga0070688_100534970 3300005365 Bacteria 889
64 Ga0070667_100140252 3300005367 Bacteria 2116
65 Ga0070667_100141623 3300005367 Bacteria 2106
66 Ga0070703_10064253 3300005406 Bacteria 1209
67 Ga0070703_10151273 3300005406 Bacteria 872
68 Ga0070703_10160910 3300005406 Unclassified 852
69 Ga0070703_10196478 3300005406 Bacteria 789
70 Ga0070709_10004844 3300005434 Bacteria 7276
71 Ga0070714_100074415 3300005435 Bacteria 2944
72 Ga0070714_100074880 3300005435 Bacteria 2936
73 Ga0070714_100153402 3300005435 Bacteria 2078
74 Ga0070714_100839701 3300005435 Bacteria 890
75 Ga0070713_100027663 3300005436 Bacteria 4467
76 Ga0070713_100060530 3300005436 Bacteria 3165
77 Ga0070713_100080320 3300005436 Bacteria 2780
78 Ga0070713_100081033 3300005436 Bacteria 2769
79 Ga0070713_100176424 3300005436 Bacteria 1918
80 Ga0070713_100334988 3300005436 Bacteria 1401
81 Ga0070713_100446178 3300005436 Bacteria 1214
82 Ga0070713_100581494 3300005436 Bacteria 1063
83 Ga0070713_100754813 3300005436 Bacteria 931
84 Ga0070713_101282739 3300005436 Bacteria 710
85 Ga0070710_10012689 3300005437 Bacteria 4193
86 Ga0070710_10051571 3300005437 Bacteria 2310
87 Ga0070710_10066255 3300005437 Bacteria 2070
88 Ga0070710_10075010 3300005437 Bacteria 1958
89 Ga0070710_10075659 3300005437 Bacteria 1952
90 Ga0070710_10236370 3300005437 Bacteria 1169
91 Ga0070711_100001412 3300005439 Bacteria 13173
92 Ga0070711_100042018 3300005439 Bacteria 3089
93 Ga0070711_100229132 3300005439 Bacteria 1448
94 Ga0070711_100246346 3300005439 Bacteria 1400
95 Ga0070705_100079313 3300005440 Bacteria 2011
96 Ga0070705_100523006 3300005440 Bacteria 904
97 Ga0070705_100710452 3300005440 Bacteria 790
98 Ga0070694_100017290 3300005444 Bacteria 4555
99 Ga0070694_100382885 3300005444 Bacteria 1097
100 Ga0070694_100463437 3300005444 Bacteria 1003
101 Ga0070694_100508519 3300005444 Bacteria 959
102 Ga0070708_100000327 3300005445 Bacteria 35749
103 Ga0070708_100011819 3300005445 Bacteria 7104
104 Ga0070708_100024936 3300005445 Bacteria 5110
105 Ga0070708_100039861 3300005445 Bacteria 4112
106 Ga0070708_100086373 3300005445 Bacteria 2849
107 Ga0070708_100097597 3300005445 Unclassified 2686
108 Ga0070708_100124707 3300005445 Bacteria 2379
109 Ga0070708_100150992 3300005445 Bacteria 2160
110 Ga0070708_100152133 3300005445 Bacteria 2152
111 Ga0070708_100195530 3300005445 Bacteria 1892
112 Ga0070708_100198356 3300005445 Bacteria 1878
113 Ga0070708_100203302 3300005445 Bacteria 1855
114 Ga0070708_100262275 3300005445 Bacteria 1624
115 Ga0070708_100262598 3300005445 Bacteria 1623
116 Ga0070708_100332498 3300005445 Bacteria 1431
117 Ga0070708_100355751 3300005445 Bacteria 1380
118 Ga0070708_100556719 3300005445 Bacteria 1082
119 Ga0070663_100011764 3300005455 Bacteria 5508
120 Ga0070663_100016703 3300005455 Bacteria 4775
121 Ga0070678_100002534 3300005456 Bacteria 10017
122 Ga0070662_100009553 3300005457 Bacteria 6348
123 Ga0068867_100045742 3300005459 Bacteria 3211
124 Ga0070685_10064247 3300005466 Bacteria 2157
125 Ga0070706_100004540 3300005467 Bacteria 13358
126 Ga0070706_100006358 3300005467 Bacteria 11157
127 Ga0070706_100007422 3300005467 Bacteria 10282
128 Ga0070706_100009362 3300005467 Bacteria 9120
129 Ga0070706_100019204 3300005467 Bacteria 6306
130 Ga0070706_100029868 3300005467 Bacteria 5020
131 Ga0070706_100141986 3300005467 Unclassified 2241
132 Ga0070706_100157119 3300005467 Unclassified 2123
133 Ga0070706_100159878 3300005467 Bacteria 2103
134 Ga0070706_100214579 3300005467 Unclassified 1796
135 Ga0070706_100344381 3300005467 Bacteria 1390
136 Ga0070706_100643487 3300005467 Unclassified 984
137 Ga0070707_100009021 3300005468 Bacteria 9251
138 Ga0070707_100009843 3300005468 Bacteria 8896
139 Ga0070707_100018493 3300005468 Bacteria 6556
140 Ga0070707_100030862 3300005468 Bacteria 5104
141 Ga0070707_100033453 3300005468 Bacteria 4902
142 Ga0070707_100065091 3300005468 Bacteria 3501
143 Ga0070707_100126479 3300005468 Bacteria 2484
144 Ga0070707_100139495 3300005468 Bacteria 2359
145 Ga0070707_100258676 3300005468 Bacteria 1694
146 Ga0070707_100261425 3300005468 Bacteria 1684
147 Ga0070707_100373945 3300005468 Bacteria 1384
148 Ga0070707_100444884 3300005468 Bacteria 1256
149 Ga0070707_100487286 3300005468 Bacteria 1194
150 Ga0070707_100621527 3300005468 Bacteria 1043
151 Ga0070707_100675305 3300005468 Bacteria 996
152 Ga0070707_100700568 3300005468 Bacteria 976
153 Ga0070698_100008194 3300005471 Bacteria 11303
154 Ga0070698_100014041 3300005471 Bacteria 8470
155 Ga0070698_100029756 3300005471 Bacteria 5667
156 Ga0070698_100034175 3300005471 Bacteria 5266
157 Ga0070698_100054828 3300005471 Bacteria 4046
158 Ga0070698_100061029 3300005471 Bacteria 3803
159 Ga0070698_100064612 3300005471 Bacteria 3686
160 Ga0070698_100087994 3300005471 Bacteria 3091
161 Ga0070698_100089099 3300005471 Bacteria 3070
162 Ga0070698_100109669 3300005471 Unclassified 2726
163 Ga0070698_100114191 3300005471 Bacteria 2665
164 Ga0070698_100214036 3300005471 Bacteria 1861
165 Ga0070698_100303321 3300005471 Bacteria 1528
166 Ga0070698_100334536 3300005471 Bacteria 1445
167 Ga0070698_100454634 3300005471 Bacteria 1216
168 Ga0070698_100557483 3300005471 Bacteria 1085
169 Ga0070698_100868048 3300005471 Bacteria 847
170 Ga0070698_100892199 3300005471 Unclassified 834
171 Ga0070699_100004190 3300005518 Bacteria 12763
172 Ga0070699_100017176 3300005518 Bacteria 6213
173 Ga0070699_100054650 3300005518 Bacteria 3456
174 Ga0070699_100077202 3300005518 Bacteria 2899
175 Ga0070699_100078547 3300005518 Bacteria 2874
176 Ga0070699_100137897 3300005518 Bacteria 2152
177 Ga0070699_100210749 3300005518 Bacteria 1730
178 Ga0070699_100274525 3300005518 Bacteria 1509
179 Ga0070699_100347088 3300005518 Bacteria 1336
180 Ga0070699_100358408 3300005518 Bacteria 1315
181 Ga0070699_100398865 3300005518 Bacteria 1243
182 Ga0070699_100401805 3300005518 Bacteria 1239
183 Ga0070699_100453804 3300005518 Bacteria 1162
184 Ga0070699_100505170 3300005518 Bacteria 1098
185 Ga0070699_100545237 3300005518 Bacteria 1055
186 Ga0070699_100948268 3300005518 Bacteria 788
187 Ga0070697_100007293 3300005536 Bacteria 8600
188 Ga0070697_100007757 3300005536 Bacteria 8357
189 Ga0070697_100017733 3300005536 Bacteria 5608
190 Ga0070697_100032620 3300005536 Bacteria 4192
191 Ga0070697_100041917 3300005536 Bacteria 3705
192 Ga0070697_100101570 3300005536 Unclassified 2389
193 Ga0070697_100116022 3300005536 Bacteria 2236
194 Ga0070697_100131380 3300005536 Bacteria 2100
195 Ga0070697_100200865 3300005536 Bacteria 1695
196 Ga0070697_100254396 3300005536 Bacteria 1502
197 Ga0070697_100353426 3300005536 Bacteria 1269
198 Ga0070697_100385229 3300005536 Bacteria 1215
199 Ga0070697_100438865 3300005536 Bacteria 1136
200 Ga0070697_100523208 3300005536 Unclassified 1038
201 Ga0070697_100565601 3300005536 Bacteria 998
202 Ga0070697_100986311 3300005536 Bacteria 749
203 Ga0068853_100017172 3300005539 Bacteria 5971
204 Ga0068853_100231603 3300005539 Bacteria 1690
205 Ga0070672_100030559 3300005543 Bacteria 4048
206 Ga0070686_100006693 3300005544 Bacteria 6415
207 Ga0070695_100027617 3300005545 Unclassified 3517
208 Ga0070695_100027867 3300005545 Bacteria 3502
209 Ga0070695_100065982 3300005545 Bacteria 2358
210 Ga0070695_100435303 3300005545 Bacteria 1001
211 Ga0070695_100562165 3300005545 Bacteria 890
212 Ga0070695_100844889 3300005545 Bacteria 736
213 Ga0070696_100034202 3300005546 Bacteria 3495
214 Ga0070696_100036799 3300005546 Bacteria 3375
215 Ga0070696_100046895 3300005546 Bacteria 2998
216 Ga0070696_100103608 3300005546 Bacteria 2042
217 Ga0070696_100148354 3300005546 Bacteria 1719
218 Ga0070696_100181210 3300005546 Bacteria 1563
219 Ga0070696_100196543 3300005546 Bacteria 1504
220 Ga0070696_100244947 3300005546 Bacteria 1353
221 Ga0070696_100316303 3300005546 Bacteria 1200
222 Ga0070696_100528193 3300005546 Bacteria 942
223 Ga0070665_100005888 3300005548 Bacteria 12561
224 Ga0070665_100099412 3300005548 Bacteria 2913
225 Ga0070665_100488105 3300005548 Bacteria 1243
226 Ga0070665_100766005 3300005548 Unclassified 978
227 Ga0070704_100020569 3300005549 Bacteria 4258
228 Ga0070704_100022009 3300005549 Bacteria 4143
229 Ga0070704_100030427 3300005549 Bacteria 3617
230 Ga0070704_100226560 3300005549 Bacteria 1522
231 Ga0070704_100243905 3300005549 Bacteria 1472
232 Ga0070704_100265153 3300005549 Bacteria 1417
233 Ga0070704_100377307 3300005549 Bacteria 1204
234 Ga0070704_100573656 3300005549 Bacteria 988
235 Ga0070704_100596189 3300005549 Bacteria 971
236 Ga0070664_100211057 3300005564 Unclassified 1735
237 Ga0068857_100017155 3300005577 Bacteria 6341
238 Ga0068854_100011429 3300005578 Bacteria 5781
239 Ga0068854_100049570 3300005578 Bacteria 3000
240 Ga0068854_100523771 3300005578 Bacteria 1002
241 Ga0070702_100001810 3300005615 Bacteria 8892
242 Ga0068852_100012556 3300005616 Bacteria 6434
243 Ga0068859_100362090 3300005617 Bacteria 1545
244 Ga0068864_100269485 3300005618 Unclassified 1586
245 Ga0068866_10469634 3300005718 Bacteria 826
246 Ga0068861_100034650 3300005719 Bacteria 3734
247 Ga0068861_100119064 3300005719 Bacteria 2128
248 Ga0068861_100271996 3300005719 Bacteria 1455
249 Ga0068861_100475677 3300005719 Bacteria 1124
250 Ga0068863_100012142 3300005841 Bacteria 8322
251 Ga0068858_100228910 3300005842 Bacteria 1762
252 Ga0068860_100016584 3300005843 Bacteria 7184
253 Ga0068860_100892269 3300005843 Bacteria 905
254 Ga0068862_100009669 3300005844 Bacteria 7969
255 Ga0081455_10006446 3300005937 Bacteria 12576
256 Ga0081455_10010595 3300005937 Bacteria 9330
257 Ga0081455_10116873 3300005937 Bacteria 2109
258 Ga0081538_10003905 3300005981 Bacteria 13909
259 Ga0081538_10008589 3300005981 Bacteria 8643
260 Ga0081538_10012492 3300005981 Bacteria 6804
261 Ga0081538_10135447 3300005981 Bacteria 1148
262 Ga0081540_1000494 3300005983 Bacteria 38779
263 Ga0081540_1052217 3300005983 Bacteria 2015
264 Ga0081539_10061200 3300005985 Bacteria 2063
265 Ga0070717_10011227 3300006028 Bacteria 6793
266 Ga0070717_10013507 3300006028 Bacteria 6260
267 Ga0070717_10111075 3300006028 Bacteria 2338
268 Ga0070717_10111664 3300006028 Bacteria 2332
269 Ga0070717_10153964 3300006028 Bacteria 1990
270 Ga0070717_10163817 3300006028 Bacteria 1930
271 Ga0070717_10325851 3300006028 Bacteria 1369
272 Ga0070717_10470178 3300006028 Bacteria 1135
273 Ga0070717_10548576 3300006028 Unclassified 1047
274 Ga0070717_10642939 3300006028 Bacteria 963
275 Ga0070717_10906287 3300006028 Bacteria 803
276 Ga0075365_10141022 3300006038 Unclassified 1673
277 Ga0075368_10013725 3300006042 Bacteria 2979
278 Ga0075363_100000487 3300006048 Bacteria 12588
279 Ga0075364_10048714 3300006051 Bacteria 2762
280 Ga0075364_10536748 3300006051 Bacteria 800
281 Ga0070715_10019337 3300006163 Unclassified 2611
282 Ga0070715_10019458 3300006163 Bacteria 2605
283 Ga0070715_10094818 3300006163 Bacteria 1380
284 Ga0070715_10307258 3300006163 Bacteria 851
285 Ga0070716_100002178 3300006173 Bacteria 9012
286 Ga0070716_100011404 3300006173 Bacteria 4473
287 Ga0070716_100023382 3300006173 Bacteria 3277
288 Ga0070716_100086870 3300006173 Bacteria 1883
289 Ga0070716_100151142 3300006173 Bacteria 1494
290 Ga0070716_100225498 3300006173 Bacteria 1262
291 Ga0070716_100228945 3300006173 Bacteria 1253
292 Ga0070716_100241319 3300006173 Bacteria 1225
293 Ga0070716_100564528 3300006173 Bacteria 851
294 Ga0070716_100610680 3300006173 Bacteria 822
295 Ga0070712_100003950 3300006175 Bacteria 9122
296 Ga0070712_100006417 3300006175 Bacteria 7296
297 Ga0070712_100058515 3300006175 Bacteria 2711
298 Ga0070712_100059493 3300006175 Bacteria 2691
299 Ga0070712_100709512 3300006175 Bacteria 858
300 Ga0070712_100820479 3300006175 Bacteria 799
301 Ga0075367_10177329 3300006178 Bacteria 1328
302 Ga0097621_100761348 3300006237 Bacteria 895
303 Ga0075370_10011330 3300006353 Bacteria 4682
304 Ga0068871_100228670 3300006358 Bacteria 1614
305 Ga0068871_100273776 3300006358 Bacteria 1475
306 Ga0075428_100026406 3300006844 Bacteria 6429
307 Ga0075428_100027761 3300006844 Bacteria 6262
308 Ga0075428_100044754 3300006844 Bacteria 4863
309 Ga0075428_100068519 3300006844 Bacteria 3881
310 Ga0075428_100097710 3300006844 Bacteria 3201
311 Ga0075428_100099150 3300006844 Bacteria 3176
312 Ga0075428_100122741 3300006844 Bacteria 2827
313 Ga0075428_100156310 3300006844 Bacteria 2477
314 Ga0075428_100162662 3300006844 Bacteria 2422
315 Ga0075428_100192864 3300006844 Unclassified 2203
316 Ga0075428_100219793 3300006844 Bacteria 2052
317 Ga0075428_100226376 3300006844 Bacteria 2018
318 Ga0075428_100279629 3300006844 Bacteria 1796
319 Ga0075428_100353716 3300006844 Bacteria 1576
320 Ga0075428_100355340 3300006844 Bacteria 1572
321 Ga0075428_100402237 3300006844 Bacteria 1467
322 Ga0075428_100573948 3300006844 Bacteria 1205
323 Ga0075428_100778339 3300006844 Unclassified 1017
324 Ga0075430_100020140 3300006846 Bacteria 5676
325 Ga0075430_100054534 3300006846 Bacteria 3363
326 Ga0075430_100059465 3300006846 Bacteria 3213
327 Ga0075430_100278704 3300006846 Unclassified 1383
328 Ga0075430_100362592 3300006846 Bacteria 1197
329 Ga0075431_100022859 3300006847 Bacteria 6391
330 Ga0075431_100065686 3300006847 Bacteria 3746
331 Ga0075431_100287923 3300006847 Bacteria 1662
332 Ga0075431_100319715 3300006847 Bacteria 1565
333 Ga0075431_100360776 3300006847 Bacteria 1460
334 Ga0075431_100557529 3300006847 Bacteria 1133
335 Ga0075433_10001320 3300006852 Bacteria 18149
336 Ga0075433_10002036 3300006852 Bacteria 15269
337 Ga0075433_10003541 3300006852 Bacteria 12056
338 Ga0075433_10006871 3300006852 Bacteria 9017
339 Ga0075433_10010320 3300006852 Bacteria 7491
340 Ga0075433_10011565 3300006852 Bacteria 7108
341 Ga0075433_10034231 3300006852 Bacteria 4361
342 Ga0075433_10053330 3300006852 Bacteria 3525
343 Ga0075433_10076139 3300006852 Bacteria 2955
344 Ga0075433_10127900 3300006852 Bacteria 2256
345 Ga0075433_10148695 3300006852 Unclassified 2083
346 Ga0075433_10152514 3300006852 Bacteria 2055
347 Ga0075433_10194662 3300006852 Bacteria 1803
348 Ga0075433_10231520 3300006852 Bacteria 1641
349 Ga0075433_10261307 3300006852 Bacteria 1535
350 Ga0075433_10288162 3300006852 Bacteria 1454
351 Ga0075433_10459230 3300006852 Bacteria 1122
352 Ga0075433_10459672 3300006852 Bacteria 1122
353 Ga0075433_10496308 3300006852 Bacteria 1075
354 Ga0075433_10681852 3300006852 Bacteria 900
355 Ga0075433_10801193 3300006852 Unclassified 823
356 Ga0075434_100005686 3300006871 Bacteria 11379
357 Ga0075434_100007695 3300006871 Bacteria 9974
358 Ga0075434_100019749 3300006871 Bacteria 6524
359 Ga0075434_100034636 3300006871 Bacteria 4988
360 Ga0075434_100046970 3300006871 Bacteria 4284
361 Ga0075434_100057121 3300006871 Bacteria 3879
362 Ga0075434_100114024 3300006871 Bacteria 2715
363 Ga0075434_100145351 3300006871 Bacteria 2391
364 Ga0075434_100161118 3300006871 Bacteria 2263
365 Ga0075434_100210425 3300006871 Unclassified 1965
366 Ga0075434_100212061 3300006871 Bacteria 1956
367 Ga0075434_100248425 3300006871 Bacteria 1798
368 Ga0075434_100254674 3300006871 Bacteria 1774
369 Ga0075434_100278393 3300006871 Unclassified 1692
370 Ga0075434_100306409 3300006871 Bacteria 1608
371 Ga0075434_100354064 3300006871 Bacteria 1489
372 Ga0075434_100429004 3300006871 Bacteria 1343
373 Ga0075434_100495667 3300006871 Bacteria 1242
374 Ga0075434_100649057 3300006871 Bacteria 1074
375 Ga0075434_100707807 3300006871 Bacteria 1024
376 Ga0075434_100724323 3300006871 Bacteria 1012
377 Ga0075434_100747756 3300006871 Unclassified 995
378 Ga0075434_100766494 3300006871 Bacteria 981
379 Ga0075434_101076223 3300006871 Bacteria 817
380 Ga0075429_100019033 3300006880 Bacteria 5948
381 Ga0075429_100037493 3300006880 Bacteria 4220
382 Ga0075429_100049459 3300006880 Bacteria 3656
383 Ga0075429_100050141 3300006880 Bacteria 3632
384 Ga0075429_100149788 3300006880 Unclassified 2043
385 Ga0075429_100173732 3300006880 Bacteria 1887
386 Ga0075429_100256636 3300006880 Bacteria 1531
387 Ga0075429_100425021 3300006880 Unclassified 1164
388 Ga0075429_100786033 3300006880 Bacteria 834
389 Ga0068865_100183944 3300006881 Bacteria 1611
390 Ga0075436_100003400 3300006914 Bacteria 10905
391 Ga0075436_100033969 3300006914 Unclassified 3515
392 Ga0075436_100065982 3300006914 Bacteria 2501
393 Ga0075436_100067224 3300006914 Bacteria 2477
394 Ga0075436_100198226 3300006914 Bacteria 1421
395 Ga0075436_100235642 3300006914 Bacteria 1301
396 Ga0075436_100296316 3300006914 Bacteria 1158
397 Ga0075436_100665177 3300006914 Bacteria 770
398 Ga0075436_100669369 3300006914 Bacteria 768
399 Ga0075436_100856380 3300006914 Bacteria 679
400 Ga0097620_100362080 3300006931 Bacteria 1545
401 Ga0075435_100007201 3300007076 Bacteria 7913
402 Ga0075435_100013765 3300007076 Bacteria 6029
403 Ga0075435_100024448 3300007076 Bacteria 4689
404 Ga0075435_100055694 3300007076 Bacteria 3194
405 Ga0075435_100067152 3300007076 Bacteria 2919
406 Ga0075435_100071188 3300007076 Bacteria 2839
407 Ga0075435_100072577 3300007076 Bacteria 2812
408 Ga0075435_100098896 3300007076 Bacteria 2415
409 Ga0075435_100152434 3300007076 Bacteria 1944
410 Ga0075435_100164266 3300007076 Bacteria 1872
411 Ga0075435_100228569 3300007076 Bacteria 1580
412 Ga0075435_100232000 3300007076 Bacteria 1568
413 Ga0075435_100313066 3300007076 Bacteria 1343
414 Ga0075435_100403072 3300007076 Bacteria 1176
415 Ga0075435_100408508 3300007076 Bacteria 1168
416 Ga0075435_100459042 3300007076 Bacteria 1099
417 Ga0075435_100480993 3300007076 Bacteria 1072
418 Ga0075435_100585129 3300007076 Bacteria 967
419 Ga0075435_100601046 3300007076 Bacteria 954
420 Ga0075435_100893735 3300007076 Bacteria 774
421 Ga0099794_10001962 3300007265 Bacteria 7402
422 Ga0099794_10002095 3300007265 Bacteria 7253
423 Ga0099794_10020880 3300007265 Bacteria 2969
424 Ga0099794_10193834 3300007265 Bacteria 1040
425 Ga0099794_10229070 3300007265 Bacteria 956
426 Ga0099795_10225537 3300007788 Bacteria 799
427 Ga0105244_10005771 3300009036 Bacteria 8157
428 Ga0105250_10030786 3300009092 Bacteria 2157
429 Ga0105240_10663574 3300009093 Bacteria 1142
430 Ga0111539_10048581 3300009094 Bacteria 5065
431 Ga0111539_10085334 3300009094 Bacteria 3711
432 Ga0111539_10168166 3300009094 Bacteria 2562
433 Ga0111539_10203521 3300009094 Bacteria 2308
434 Ga0111539_10243809 3300009094 Bacteria 2092
435 Ga0111539_10390786 3300009094 Bacteria 1620
436 Ga0111539_10459093 3300009094 Bacteria 1483
437 Ga0111539_10486766 3300009094 Bacteria 1437
438 Ga0111539_10781032 3300009094 Unclassified 1112
439 Ga0111539_10793818 3300009094 Bacteria 1102
440 Ga0105245_10013776 3300009098 Bacteria 7042
441 Ga0105247_10038209 3300009101 Bacteria 2930
442 Ga0114129_10002492 3300009147 Bacteria 25557
443 Ga0114129_10004475 3300009147 Bacteria 19706
444 Ga0114129_10004685 3300009147 Bacteria 19321
445 Ga0114129_10007203 3300009147 Bacteria 15828
446 Ga0114129_10017425 3300009147 Bacteria 10230
447 Ga0114129_10017478 3300009147 Bacteria 10211
448 Ga0114129_10019037 3300009147 Bacteria 9779
449 Ga0114129_10021529 3300009147 Bacteria 9153
450 Ga0114129_10041514 3300009147 Bacteria 6481
451 Ga0114129_10060267 3300009147 Bacteria 5306
452 Ga0114129_10090140 3300009147 Bacteria 4251
453 Ga0114129_10118447 3300009147 Bacteria 3647
454 Ga0114129_10184200 3300009147 Bacteria 2839
455 Ga0114129_10185627 3300009147 Bacteria 2826
456 Ga0114129_10296831 3300009147 Bacteria 2155
457 Ga0114129_10359204 3300009147 Bacteria 1928
458 Ga0114129_10378370 3300009147 Unclassified 1870
459 Ga0114129_10455247 3300009147 Bacteria 1678
460 Ga0114129_10472099 3300009147 Bacteria 1642
461 Ga0114129_10483623 3300009147 Bacteria 1619
462 Ga0114129_10619674 3300009147 Bacteria 1400
463 Ga0114129_10653232 3300009147 Bacteria 1357
464 Ga0114129_10675847 3300009147 Bacteria 1330
465 Ga0114129_10727537 3300009147 Bacteria 1273
466 Ga0114129_10812272 3300009147 Bacteria 1192
467 Ga0114129_10902255 3300009147 Bacteria 1120
468 Ga0114129_11076102 3300009147 Bacteria 1008
469 Ga0114129_11078018 3300009147 Bacteria 1007
470 Ga0114129_11638466 3300009147 Bacteria 787
471 Ga0105243_10848832 3300009148 Bacteria 904
472 Ga0105241_10040941 3300009174 Bacteria 3499
473 Ga0105241_10048446 3300009174 Bacteria 3234
474 Ga0105242_10297612 3300009176 Unclassified 1471
475 Ga0105242_10593919 3300009176 Bacteria 1068
476 Ga0105242_10607719 3300009176 Bacteria 1057
477 Ga0105248_10011651 3300009177 Bacteria 9686
478 Ga0105248_10752314 3300009177 Bacteria 1100
479 Ga0105237_10000964 3300009545 Bacteria 38709
480 Ga0105237_10966098 3300009545 Bacteria 859
481 Ga0105238_10426422 3300009551 Bacteria 1321
482 Ga0105249_10268839 3300009553 Bacteria 1698
483 Ga0105249_10314419 3300009553 Bacteria 1576
484 Ga0105249_10394120 3300009553 Bacteria 1413
485 Ga0105249_11097431 3300009553 Bacteria 866
486 Ga0099796_10017097 3300010159 Bacteria 2154
487 Ga0099796_10085032 3300010159 Bacteria 1167
488 Ga0105239_10000025 3300010375 Bacteria 254049
489 Ga0105239_10090735 3300010375 Bacteria 3371
490 Ga0105239_11317040 3300010375 Bacteria 833
491 Ga0105239_11352899 3300010375 Bacteria 822
492 Ga0105246_10214239 3300011119 Unclassified 1505
493 Ga0157373_10077541 3300013100 Bacteria 2344
494 Ga0157369_10108106 3300013105 Bacteria 2958
495 Ga0157374_10241514 3300013296 Bacteria 1776
496 Ga0157378_10021295 3300013297 Bacteria 5700
497 Ga0157378_10491278 3300013297 Bacteria 1225
498 Ga0157378_10873191 3300013297 Bacteria 929
499 Ga0163162_10181078 3300013306 Bacteria 2233
500 Ga0157372_10744394 3300013307 Bacteria 1140
501 Ga0157375_10091370 3300013308 Bacteria 3106
502 Ga0157375_10266665 3300013308 Bacteria 1874
503 Ga0157375_10963889 3300013308 Bacteria 994
504 Ga0163163_10017144 3300014325 Bacteria 6748
505 Ga0163163_10986678 3300014325 Bacteria 906
506 Ga0157380_10009890 3300014326 Bacteria 6847
507 Ga0157380_10338927 3300014326 Unclassified 1402
508 Ga0157379_10312860 3300014968 Bacteria 1433
509 Ga0157379_10544289 3300014968 Unclassified 1080
510 Ga0157376_10009199 3300014969 Bacteria 7167
511 Ga0163161_11047058 3300017792 Bacteria 699
512 Ga0214544_1000424 3300021320 Bacteria 75924
513 Ga0214542_1000412 3300021321 Bacteria 75924
514 Ga0214545_1000242 3300021324 Bacteria 75924
515 Ga0214543_1000327 3300021327 Bacteria 75924
516 Ga0224572_1002353 3300024225 Bacteria 3033
517 Ga0228598_1002567 3300024227 Bacteria 3941
518 Ga0228598_1016185 3300024227 Bacteria 1472
519 Ga0209437_100023 3300025233 Bacteria 614195
520 Ga0207425_1000037 3300025245 Bacteria 224645
521 Ga0207425_1000047 3300025245 Bacteria 189158
522 Ga0209129_1000378 3300025258 Bacteria 36183
523 Ga0209129_1000480 3300025258 Bacteria 29248
524 Ga0209233_1000062 3300025261 Bacteria 399685
525 Ga0209565_1000062 3300025263 Bacteria 184007
526 Ga0209565_1002595 3300025263 Bacteria 6408
527 Ga0209565_1037884 3300025263 Bacteria 910
528 Ga0209130_1000318 3300025284 Bacteria 56545
529 Ga0209676_1000291 3300025292 Bacteria 102996
530 Ga0209676_1001816 3300025292 Bacteria 17808
531 Ga0209025_1000117 3300025294 Bacteria 215073
532 Ga0209025_1000150 3300025294 Bacteria 172834
533 Ga0209025_1045233 3300025294 Bacteria 1828
534 Ga0209564_1002021 3300025295 Bacteria 17638
535 Ga0209564_1013326 3300025295 Bacteria 3505
536 Ga0209564_1020233 3300025295 Bacteria 2447
537 Ga0209758_1000009 3300025297 Bacteria 1123483
538 Ga0209758_1000103 3300025297 Bacteria 223968
539 Ga0209758_1001241 3300025297 Bacteria 31750
540 Ga0209050_1000327 3300025298 Bacteria 95283
541 Ga0209050_1002490 3300025298 Bacteria 15572
542 Ga0209050_1003020 3300025298 Bacteria 13031
543 Ga0209256_1000018 3300025299 Bacteria 568467
544 Ga0207426_1000512 3300025302 Bacteria 56516
545 Ga0207426_1001703 3300025302 Bacteria 16900
546 Ga0207426_1030352 3300025302 Bacteria 1773
547 Ga0209051_1017824 3300025303 Bacteria 3161
548 Ga0209257_1000345 3300025304 Bacteria 96513
549 Ga0209257_1001353 3300025304 Bacteria 29628
550 Ga0207653_10055869 3300025885 Bacteria 1323
551 Ga0207692_10042639 3300025898 Bacteria 2254
552 Ga0207692_10072078 3300025898 Bacteria 1824
553 Ga0207692_10651571 3300025898 Bacteria 680
554 Ga0207642_10371252 3300025899 Bacteria 849
555 Ga0207688_10008540 3300025901 Bacteria 5574
556 Ga0207647_10008876 3300025904 Bacteria 7170
557 Ga0207685_10007770 3300025905 Bacteria 3012
558 Ga0207685_10030721 3300025905 Bacteria 1916
559 Ga0207685_10037116 3300025905 Bacteria 1792
560 Ga0207685_10063917 3300025905 Bacteria 1468
561 Ga0207685_10161923 3300025905 Bacteria 1022
562 Ga0207699_10076719 3300025906 Bacteria 2059
563 Ga0207699_10087391 3300025906 Bacteria 1949
564 Ga0207699_10090359 3300025906 Bacteria 1921
565 Ga0207699_10592016 3300025906 Bacteria 807
566 Ga0207645_10031716 3300025907 Bacteria 3398
567 Ga0207645_10285027 3300025907 Bacteria 1097
568 Ga0207684_10000181 3300025910 Bacteria 101122
569 Ga0207684_10000507 3300025910 Bacteria 48732
570 Ga0207684_10000684 3300025910 Bacteria 40135
571 Ga0207684_10003189 3300025910 Bacteria 16104
572 Ga0207684_10005711 3300025910 Bacteria 11427
573 Ga0207684_10007743 3300025910 Bacteria 9619
574 Ga0207684_10013300 3300025910 Bacteria 7119
575 Ga0207684_10019354 3300025910 Bacteria 5825
576 Ga0207684_10026415 3300025910 Bacteria 4949
577 Ga0207684_10027978 3300025910 Bacteria 4802
578 Ga0207684_10074280 3300025910 Bacteria 2888
579 Ga0207684_10079262 3300025910 Bacteria 2794
580 Ga0207684_10084698 3300025910 Bacteria 2700
581 Ga0207684_10085947 3300025910 Bacteria 2679
582 Ga0207684_10113533 3300025910 Bacteria 2319
583 Ga0207684_10116903 3300025910 Bacteria 2285
584 Ga0207684_10144603 3300025910 Bacteria 2045
585 Ga0207684_10150699 3300025910 Bacteria 2001
586 Ga0207684_10193612 3300025910 Unclassified 1754
587 Ga0207684_10481299 3300025910 Bacteria 1065
588 Ga0207684_10498204 3300025910 Bacteria 1044
589 Ga0207684_10550516 3300025910 Bacteria 987
590 Ga0207684_10626499 3300025910 Bacteria 917
591 Ga0207654_10044067 3300025911 Bacteria 2532
592 Ga0207695_10000347 3300025913 Bacteria 107013
593 Ga0207671_10001460 3300025914 Bacteria 27305
594 Ga0207693_10000898 3300025915 Bacteria 26695
595 Ga0207693_10006516 3300025915 Bacteria 9662
596 Ga0207693_10008253 3300025915 Bacteria 8527
597 Ga0207693_10037532 3300025915 Bacteria 3819
598 Ga0207693_10095563 3300025915 Bacteria 2330
599 Ga0207693_10689661 3300025915 Bacteria 792
600 Ga0207663_10001824 3300025916 Bacteria 10047
601 Ga0207663_10017487 3300025916 Bacteria 3996
602 Ga0207663_10027262 3300025916 Bacteria 3327
603 Ga0207663_10105923 3300025916 Unclassified 1899
604 Ga0207663_10145373 3300025916 Bacteria 1657
605 Ga0207663_10267973 3300025916 Bacteria 1264
606 Ga0207662_10040450 3300025918 Bacteria 2741
607 Ga0207657_10009972 3300025919 Bacteria 9507
608 Ga0207646_10000165 3300025922 Bacteria 89540
609 Ga0207646_10000663 3300025922 Bacteria 44694
610 Ga0207646_10006466 3300025922 Bacteria 12098
611 Ga0207646_10006994 3300025922 Bacteria 11555
612 Ga0207646_10008284 3300025922 Bacteria 10435
613 Ga0207646_10011592 3300025922 Bacteria 8523
614 Ga0207646_10015133 3300025922 Bacteria 7298
615 Ga0207646_10021846 3300025922 Bacteria 5905
616 Ga0207646_10029826 3300025922 Bacteria 4952
617 Ga0207646_10030282 3300025922 Bacteria 4908
618 Ga0207646_10059603 3300025922 Bacteria 3409
619 Ga0207646_10084655 3300025922 Bacteria 2837
620 Ga0207646_10205860 3300025922 Bacteria 1777
621 Ga0207646_10497438 3300025922 Bacteria 1099
622 Ga0207646_10527683 3300025922 Bacteria 1063
623 Ga0207646_10666228 3300025922 Bacteria 932
624 Ga0207646_10804948 3300025922 Bacteria 837
625 Ga0207681_10026959 3300025923 Bacteria 3711
626 Ga0207681_10059934 3300025923 Bacteria 2610
627 Ga0207681_10419507 3300025923 Unclassified 1084
628 Ga0207694_10331642 3300025924 Bacteria 1257
629 Ga0207650_10083604 3300025925 Bacteria 2425
630 Ga0207659_10288409 3300025926 Bacteria 1344
631 Ga0207687_10142857 3300025927 Bacteria 1818
632 Ga0207700_10036148 3300025928 Bacteria 3564
633 Ga0207700_10084701 3300025928 Bacteria 2486
634 Ga0207700_10151733 3300025928 Bacteria 1915
635 Ga0207700_10186891 3300025928 Bacteria 1739
636 Ga0207700_10224733 3300025928 Bacteria 1593
637 Ga0207700_10775811 3300025928 Bacteria 857
638 Ga0207664_10086255 3300025929 Bacteria 2564
639 Ga0207664_10189227 3300025929 Bacteria 1771
640 Ga0207664_10685140 3300025929 Unclassified 922
641 Ga0207664_10903034 3300025929 Bacteria 793
642 Ga0207644_10067356 3300025931 Bacteria 2609
643 Ga0207644_10729361 3300025931 Bacteria 827
644 Ga0207706_10028247 3300025933 Bacteria 5010
645 Ga0207706_10406090 3300025933 Bacteria 1181
646 Ga0207706_10430626 3300025933 Unclassified 1142
647 Ga0207686_10361276 3300025934 Bacteria 1096
648 Ga0207709_10134917 3300025935 Bacteria 1688
649 Ga0207670_10019485 3300025936 Bacteria 4146
650 Ga0207670_10099245 3300025936 Bacteria 2077
651 Ga0207669_10130770 3300025937 Bacteria 1724
652 Ga0207704_10184947 3300025938 Bacteria 1509
653 Ga0207704_10879087 3300025938 Bacteria 753
654 Ga0207665_10000887 3300025939 Bacteria 20188
655 Ga0207665_10014732 3300025939 Bacteria 5143
656 Ga0207665_10045875 3300025939 Bacteria 2927
657 Ga0207665_10051130 3300025939 Unclassified 2781
658 Ga0207665_10059603 3300025939 Bacteria 2584
659 Ga0207665_10119703 3300025939 Bacteria 1859
660 Ga0207665_10121938 3300025939 Bacteria 1842
661 Ga0207665_10262680 3300025939 Bacteria 1279
662 Ga0207665_10306822 3300025939 Bacteria 1188
663 Ga0207665_10395603 3300025939 Bacteria 1051
664 Ga0207691_10360324 3300025940 Bacteria 1243
665 Ga0207711_10050722 3300025941 Bacteria 3552
666 Ga0207711_10744232 3300025941 Bacteria 914
667 Ga0207679_10357158 3300025945 Bacteria 1275
668 Ga0207679_10665272 3300025945 Bacteria 943
669 Ga0207667_10679476 3300025949 Bacteria 1033
670 Ga0207712_10189122 3300025961 Bacteria 1624
671 Ga0207712_10377086 3300025961 Bacteria 1186
672 Ga0207668_10017069 3300025972 Bacteria 4541
673 Ga0207668_10534655 3300025972 Unclassified 1013
674 Ga0207668_10826589 3300025972 Bacteria 821
675 Ga0207640_10031502 3300025981 Bacteria 3277
676 Ga0207640_10137884 3300025981 Bacteria 1774
677 Ga0207640_10270490 3300025981 Bacteria 1329
678 Ga0207658_10232312 3300025986 Bacteria 1558
679 Ga0207658_10300761 3300025986 Bacteria 1382
680 Ga0207658_10446389 3300025986 Bacteria 1144
681 Ga0207677_10266446 3300026023 Bacteria 1399
682 Ga0207677_10492097 3300026023 Bacteria 1059
683 Ga0207703_10176207 3300026035 Bacteria 1884
684 Ga0207639_10357378 3300026041 Bacteria 1306
685 Ga0207639_10719125 3300026041 Bacteria 927
686 Ga0207678_10002089 3300026067 Bacteria 18095
687 Ga0207678_10011677 3300026067 Bacteria 7713
688 Ga0207708_10015629 3300026075 Bacteria 5693
689 Ga0207708_10147078 3300026075 Bacteria 1852
690 Ga0207641_10009040 3300026088 Bacteria 8232
691 Ga0207648_10037907 3300026089 Bacteria 4243
692 Ga0207648_10043366 3300026089 Bacteria 3949
693 Ga0207648_10220721 3300026089 Bacteria 1685
694 Ga0207676_11060287 3300026095 Unclassified 800
695 Ga0207674_10018861 3300026116 Bacteria 7482
696 Ga0207675_100072478 3300026118 Bacteria 3222
697 Ga0207675_100203694 3300026118 Bacteria 1901
698 Ga0207675_100469956 3300026118 Bacteria 1248
699 Ga0207675_100577786 3300026118 Bacteria 1125
700 Ga0207675_101038825 3300026118 Bacteria 838
701 Ga0207683_10006916 3300026121 Bacteria 9711
702 Ga0207683_11175321 3300026121 Bacteria 711
703 Ga0207698_11125597 3300026142 Bacteria 798
704 Ga0209588_1000024 3300027671 Bacteria 86158
705 Ga0209588_1004440 3300027671 Bacteria 3954
706 Ga0209813_10123432 3300027866 Bacteria 904
707 Ga0207428_10016868 3300027907 Bacteria 6276
708 Ga0207428_10065007 3300027907 Bacteria 2879
709 Ga0265356_1000449 3300028017 Bacteria 7523
710 Ga0268266_10002394 3300028379 Bacteria 20226
711 Ga0268266_10031920 3300028379 Bacteria 4475
712 Ga0268266_10569836 3300028379 Unclassified 1086
713 Ga0268265_10086808 3300028380 Bacteria 2488
714 Ga0268264_10040316 3300028381 Bacteria 3859
715 Ga0268264_10111426 3300028381 Bacteria 2397
716 Ga0268264_10193494 3300028381 Unclassified 1855
717 Ga0268264_11025120 3300028381 Bacteria 832
718 Ga0265762_1001022 3300030760 Bacteria 5025
719 Ga0265762_1002005 3300030760 Bacteria 3707
720 Ga0265763_1000002 3300030763 Bacteria 10269
721 Ga0265763_1007364 3300030763 Bacteria 964
722 Ga0265773_1002492 3300031018 Bacteria 1121
723 Ga0265760_10001288 3300031090 Bacteria 7325
724 Ga0265760_10109242 3300031090 Bacteria 880
725 Ga0307510_10275516 3300033180 Bacteria 1156
726 Ga0373950_0016769 3300034818 Bacteria 1256
727 Ga0373926_0075173 3300035083 Bacteria 1245
728 Ga0373926_0216179 3300035083 Bacteria 739
729 Ga0373940_0125668 3300035088 Bacteria 799
730 Ga0373951_0064816 3300035091 Bacteria 921
731 Ga0373951_0122752 3300035091 Bacteria 708
732 Ga0373931_0575102 3300035691 Bacteria 734
733 Ga0373931_0609514 3300035691 Bacteria 714
734 Ga0373927_0053694 3300035695 Bacteria 2607
735 Ga0373927_0552959 3300035695 Bacteria 761
736 Ga0373947_0186141 3300035725 Bacteria 1354
737 Ga0373937_0041832 3300036401 Bacteria 4181
738 Ga0372808_025127 3300036459 Bacteria 855
739 Ga0395900_0112472 3300037418 Bacteria 2796
740 Ga0400483_083970 3300039062 Bacteria 12648
741 Ga0400483_108458 3300039062 Bacteria 2257
742 Ga0451577_0153436 3300042876 Bacteria 2072
743 Ga0453683_0000258 3300044673 Bacteria 69739
744 Ga0453683_0006130 3300044673 Bacteria 8285
745 Ga0453683_0011802 3300044673 Bacteria 5751
746 Ga0453683_0032817 3300044673 Bacteria 3273
747 Ga0453683_0080866 3300044673 Bacteria 2035
748 Ga0453683_0150096 3300044673 Bacteria 1472
749 Ga0453683_0234905 3300044673 Bacteria 1167
750 Ga0453683_0329663 3300044673 Bacteria 979
751 Ga0453684_0046569 3300044712 Bacteria 5766
752 Ga0453684_0320630 3300044712 Bacteria 1755
753 Ga0453684_0378649 3300044712 Bacteria 1590
754 Ga0466968_0097739 3300044735 Bacteria 1308
755 Ga0451576_0033734 3300045051 Bacteria 5439
756 Ga0451576_0055389 3300045051 Bacteria 4149
757 Ga0451576_0108565 3300045051 Bacteria 2887
758 Ga0495590_0041523 3300046457 Bacteria 1604
759 Ga0495629_0243094 3300046459 Bacteria 1239
760 Ga0495651_0394046 3300046462 Unclassified 905
761 Ga0495580_0078824 3300046472 Bacteria 2298
762 Ga0495580_0141575 3300046472 Bacteria 1667
763 Ga0495582_0367625 3300046473 Bacteria 828
764 Ga0495605_0000749 3300046474 Bacteria 23822
765 Ga0495605_0269777 3300046474 Bacteria 725
766 Ga0495664_0173357 3300046477 Bacteria 1308
767 Ga0495584_0037238 3300046491 Bacteria 2458
768 Ga0495584_0042612 3300046491 Bacteria 2291
769 Ga0495594_0137711 3300046499 Bacteria 1384
770 Ga0495606_0009794 3300046507 Bacteria 8052
771 Ga0495608_0067086 3300046511 Bacteria 2348
772 Ga0495618_0042290 3300046514 Bacteria 2872
773 Ga0495628_0242951 3300046516 Bacteria 1346
774 Ga0495630_0098949 3300046517 Bacteria 2206
775 Ga0495630_0565111 3300046517 Bacteria 872
776 Ga0495631_0116266 3300046518 Bacteria 1150
777 Ga0495632_0206032 3300046519 Bacteria 894
778 Ga0495663_0206691 3300046525 Bacteria 687
779 Ga0495642_0154502 3300046528 Bacteria 994
780 Ga0495665_0157712 3300046531 Bacteria 1183
781 Ga0495640_0056854 3300046533 Bacteria 2671
782 Ga0495609_0190288 3300046538 Bacteria 861
783 Ga0495645_0067270 3300046543 Bacteria 2587
784 Ga0495633_0142795 3300046558 Bacteria 1107
785 Ga0495634_0040100 3300046642 Bacteria 3187
786 Ga0495635_0630366 3300046663 Bacteria 698
787 Ga0495635_0651942 3300046663 Unclassified 685
788 Ga0495659_0053397 3300046664 Bacteria 1477
789 Ga0495659_0162846 3300046664 Bacteria 901
790 Ga0495599_0089005 3300046678 Bacteria 1927
791 Ga0495646_0339900 3300046680 Bacteria 788
792 Ga0495669_0359874 3300046684 Bacteria 704
793 Ga0495613_0202390 3300046689 Bacteria 1399
794 Ga0495613_0217992 3300046689 Bacteria 1340
795 Ga0495624_0385143 3300046690 Bacteria 842
796 Ga0495624_0482935 3300046690 Bacteria 742
797 Ga0495670_0399061 3300046691 Bacteria 743
798 Ga0495660_0220296 3300046810 Bacteria 895
799 Ga0495660_0282831 3300046810 Bacteria 758
800 Ga0495581_0082110 3300047315 Bacteria 1867
801 Ga0495636_0178267 3300047318 Bacteria 963
802 Ga0495636_0250903 3300047318 Bacteria 818
803 Ga0495674_0064432 3300047319 Bacteria 3186
804 Ga0495674_0085525 3300047319 Bacteria 2701
805 Ga0495672_0364999 3300047320 Bacteria 667
806 Ga0495673_0067809 3300047469 Bacteria 1509
807 Ga0495684_0037983 3300047471 Bacteria 3693
808 Ga0496100_0007168 3300048903 Bacteria 6125
809 Ga0496100_0390539 3300048903 Bacteria 1058
810 Ga0496101_0224338 3300048904 Bacteria 1459
811 Ga0496101_0597398 3300048904 Bacteria 873
812 Ga0496102_0141169 3300048905 Unclassified 2259
813 Ga0496102_0175044 3300048905 Bacteria 2020
814 Ga0496102_0193307 3300048905 Bacteria 1918
815 Ga0496102_0199132 3300048905 Unclassified 1888
816 Ga0496102_0956093 3300048905 Unclassified 778
817 Ga0496104_0000339 3300048907 Bacteria 41808
818 Ga0496104_0008489 3300048907 Bacteria 9135
819 Ga0496104_0034057 3300048907 Bacteria 4748
820 Ga0496104_0050418 3300048907 Bacteria 3928
821 Ga0496104_0076052 3300048907 Bacteria 3197
822 Ga0496105_0002897 3300048908 Bacteria 12589
823 Ga0496105_0006320 3300048908 Bacteria 9101
824 Ga0496105_0111260 3300048908 Bacteria 2260
825 Ga0496106_0037970 3300048909 Bacteria 3603
826 Ga0496106_0385457 3300048909 Bacteria 1126
827 Ga0496106_0626156 3300048909 Unclassified 861
828 Ga0496107_0032183 3300048910 Bacteria 3747
829 Ga0496107_0393475 3300048910 Bacteria 1031
830 Ga0496107_0765576 3300048910 Bacteria 708
831 Ga0496107_0817709 3300048910 Bacteria 682
832 Ga0496108_0033772 3300048911 Bacteria 4249
833 Ga0496108_0040429 3300048911 Bacteria 3887
834 Ga0496108_0395786 3300048911 Bacteria 1207
835 Ga0496108_0880321 3300048911 Bacteria 769
836 Ga0496108_0901547 3300048911 Bacteria 759
837 Ga0496109_0000191 3300048912 Bacteria 61025
838 Ga0496109_0077982 3300048912 Bacteria 3049
839 Ga0496109_0109696 3300048912 Bacteria 2565
840 Ga0496110_0014344 3300048913 Bacteria 6575
841 Ga0496110_0063097 3300048913 Bacteria 3273
842 Ga0496110_0093278 3300048913 Bacteria 2695
843 Ga0496110_1062316 3300048913 Bacteria 717
844 Ga0496111_0016400 3300048914 Bacteria 5103
845 Ga0496111_0089040 3300048914 Bacteria 2260
846 Ga0496111_0145166 3300048914 Bacteria 1759
847 Ga0496112_0081626 3300048915 Bacteria 3197
848 Ga0496112_0296383 3300048915 Unclassified 1563
849 Ga0496112_0547969 3300048915 Bacteria 1090
850 Ga0496113_0071636 3300048916 Bacteria 2636
851 Ga0496113_0089240 3300048916 Bacteria 2372
852 Ga0496113_0193187 3300048916 Bacteria 1616
853 Ga0496113_0298504 3300048916 Bacteria 1290
854 Ga0496113_0389564 3300048916 Bacteria 1118
855 Ga0496113_0470367 3300048916 Bacteria 1010
856 Ga0496114_0000527 3300048917 Bacteria 28173
857 Ga0496114_0058277 3300048917 Bacteria 3225
858 Ga0496114_0349343 3300048917 Bacteria 1308
859 Ga0496115_0020011 3300048918 Bacteria 5157
860 Ga0496115_0028961 3300048918 Unclassified 4345
861 Ga0496115_0080307 3300048918 Bacteria 2655
862 Ga0496115_0096450 3300048918 Bacteria 2421
863 Ga0496115_0100313 3300048918 Bacteria 2373
864 Ga0496115_0132347 3300048918 Bacteria 2056
865 Ga0496115_0138419 3300048918 Bacteria 2008
866 Ga0496115_0148030 3300048918 Bacteria 1938
867 Ga0496115_0260607 3300048918 Bacteria 1426
868 Ga0496115_0295940 3300048918 Bacteria 1327
869 Ga0496115_0500395 3300048918 Bacteria 977
870 Ga0496115_0694642 3300048918 Bacteria 800
871 Ga0496117_0010943 3300048920 Bacteria 8176
872 Ga0496118_0009623 3300048921 Bacteria 9727
873 Ga0496118_0082947 3300048921 Bacteria 2243
874 Ga0496119_0072377 3300048922 Bacteria 2014
875 Ga0496121_0000245 3300048924 Bacteria 116316
876 Ga0496121_0011345 3300048924 Bacteria 9909
877 Ga0496122_0000043 3300048925 Bacteria 280333
878 Ga0496123_0000090 3300048926 Bacteria 179735
879 Ga0496123_0114209 3300048926 Bacteria 1536
880 Ga0496123_0160171 3300048926 Bacteria 1201
881 Ga0496125_0051918 3300048928 Bacteria 3377
882 Ga0496126_0005254 3300048929 Bacteria 14879
883 Ga0496126_0040027 3300048929 Bacteria 4346
884 Ga0496126_0137305 3300048929 Bacteria 2108
885 Ga0496126_0439338 3300048929 Bacteria 1052
886 nmdc:mga00v17_339830_c1 3300050491 Bacteria 976
887 nmdc:mga0yw44_128213_c1 3300050492 Unclassified 1640
888 nmdc:mga0k408_169626_c1 3300050493 Bacteria 1301
889 nmdc:mga07m45_7474_c1 3300050496 Bacteria 5586
890 nmdc:mga05p37_103593_c2 3300050507 Bacteria 3069
891 nmdc:mga05p37_10_c1 3300050507 Bacteria 113461
892 nmdc:mga05p37_11608_c1 3300050507 Bacteria 10498
893 nmdc:mga05p37_116479_c1 3300050507 Bacteria 2559
894 nmdc:mga05p37_1238_c1 3300050507 Bacteria 29628
895 nmdc:mga05p37_1315154_c1 3300050507 Bacteria 736
896 nmdc:mga05p37_13336_c1 3300050507 Bacteria 9846
897 nmdc:mga05p37_13888_c1 3300050507 Bacteria 9652
898 nmdc:mga05p37_155369_c1 3300050507 Bacteria 2796
899 nmdc:mga05p37_169056_c1 3300050507 Bacteria 2667
900 nmdc:mga05p37_208979_c1 3300050507 Bacteria 2360
901 nmdc:mga05p37_21714_c1 3300050507 Bacteria 7776
902 nmdc:mga05p37_2264_c1 3300050507 Bacteria 22435
903 nmdc:mga05p37_260198_c1 3300050507 Bacteria 2077
904 nmdc:mga05p37_284012_c1 3300050507 Bacteria 1973
905 nmdc:mga05p37_29334_c1 3300050507 Bacteria 6714
906 nmdc:mga05p37_2985_c1 3300050507 Bacteria 19650
907 nmdc:mga05p37_308166_c1 3300050507 Bacteria 1878
908 nmdc:mga05p37_352059_c1 3300050507 Bacteria 1734
909 nmdc:mga05p37_352769_c1 3300050507 Bacteria 1732
910 nmdc:mga05p37_37533_c1 3300050507 Bacteria 5941
911 nmdc:mga05p37_38691_c1 3300050507 Bacteria 5853
912 nmdc:mga05p37_441644_c1 3300050507 Bacteria 1509
913 nmdc:mga05p37_461039_c1 3300050507 Unclassified 1469
914 nmdc:mga05p37_491_c1 3300050507 Bacteria 43356
915 nmdc:mga05p37_511488_c1 3300050507 Bacteria 1376
916 nmdc:mga05p37_527792_c1 3300050507 Bacteria 912
917 nmdc:mga05p37_554389_c1 3300050507 Bacteria 1307
918 nmdc:mga05p37_58271_c1 3300050507 Bacteria 4757
919 nmdc:mga05p37_708888_c1 3300050507 Bacteria 1116
920 nmdc:mga05p37_720571_c1 3300050507 Bacteria 1105
921 nmdc:mga05p37_79_c1 3300050507 Bacteria 85182
922 nmdc:mga05p37_876178_c1 3300050507 Bacteria 971
923 nmdc:mga05p37_991_c1 3300050507 Bacteria 32378
924 nmdc:mga09592_11547_c1 3300050508 Bacteria 7185
925 nmdc:mga09592_14031_c1 3300050508 Bacteria 6541
926 nmdc:mga09592_170190_c1 3300050508 Bacteria 1884
927 nmdc:mga09592_172832_c1 3300050508 Bacteria 1868
928 nmdc:mga09592_256747_c1 3300050508 Unclassified 1515
929 nmdc:mga09592_305656_c1 3300050508 Bacteria 1379
930 nmdc:mga09592_370636_c1 3300050508 Bacteria 1238
931 nmdc:mga09592_433519_c1 3300050508 Bacteria 1135
932 nmdc:mga09592_507597_c1 3300050508 Bacteria 1038
933 nmdc:mga09592_687080_c1 3300050508 Unclassified 872
934 nmdc:mga09592_75905_c1 3300050508 Bacteria 2858
935 nmdc:mga0qj67_339787_c1 3300050509 Bacteria 1214
936 nmdc:mga0qj67_35067_c1 3300050509 Bacteria 3922
937 nmdc:mga0qj67_377543_c1 3300050509 Unclassified 1145
938 nmdc:mga0qj67_413768_c1 3300050509 Bacteria 1087
939 nmdc:mga0qj67_487064_c1 3300050509 Bacteria 992
940 nmdc:mga0qj67_52444_c1 3300050509 Bacteria 3228
941 nmdc:mga0qj67_7248_c1 3300050509 Bacteria 8193
942 nmdc:mga06r32_101683_c1 3300050510 Bacteria 2821
943 nmdc:mga06r32_176367_c1 3300050510 Bacteria 2122
944 nmdc:mga06r32_176801_c1 3300050510 Bacteria 2119
945 nmdc:mga06r32_202958_c1 3300050510 Bacteria 1970
946 nmdc:mga06r32_21017_c1 3300050510 Bacteria 6021
947 nmdc:mga06r32_283685_c1 3300050510 Bacteria 1643
948 nmdc:mga06r32_312514_c1 3300050510 Bacteria 1557
949 nmdc:mga06r32_354590_c1 3300050510 Bacteria 1451
950 nmdc:mga06r32_45076_c1 3300050510 Bacteria 4202
951 nmdc:mga06r32_653011_c1 3300050510 Bacteria 1020
952 nmdc:mga06r32_6852_c1 3300050510 Bacteria 10241
953 nmdc:mga08y16_1318648_c1 3300050511 Bacteria 688
954 nmdc:mga08y16_200287_c1 3300050511 Bacteria 2069
955 nmdc:mga08y16_463068_c1 3300050511 Unclassified 1292
956 nmdc:mga08y16_572158_c1 3300050511 Bacteria 1141
957 nmdc:mga08y16_594252_c1 3300050511 Bacteria 1116
958 nmdc:mga08y16_741248_c1 3300050511 Unclassified 979
959 nmdc:mga08y16_78900_c1 3300050511 Bacteria 3432
960 nmdc:mga08y16_872464_c1 3300050511 Bacteria 888
961 nmdc:mga08y16_89545_c1 3300050511 Bacteria 3207
962 nmdc:mga08y16_9772_c1 3300050511 Bacteria 10075
963 nmdc:mga0n895_10664_c1 3300050512 Bacteria 8138
964 nmdc:mga0n895_1123_c1 3300050512 Bacteria 19550
965 nmdc:mga0n895_127369_c1 3300050512 Bacteria 2570
966 nmdc:mga0n895_129603_c1 3300050512 Bacteria 2547
967 nmdc:mga0n895_1338814_c1 3300050512 Bacteria 686
968 nmdc:mga0n895_172180_c1 3300050512 Bacteria 2197
969 nmdc:mga0n895_177204_c1 3300050512 Bacteria 2163
970 nmdc:mga0n895_194258_c1 3300050512 Bacteria 2061
971 nmdc:mga0n895_22284_c1 3300050512 Bacteria 5939
972 nmdc:mga0n895_233540_c1 3300050512 Bacteria 1867
973 nmdc:mga0n895_266001_c1 3300050512 Bacteria 1740
974 nmdc:mga0n895_31868_c1 3300050512 Bacteria 5053
975 nmdc:mga0n895_332683_c1 3300050512 Bacteria 1539
976 nmdc:mga0n895_344847_c1 3300050512 Bacteria 1509
977 nmdc:mga0n895_368247_c1 3300050512 Bacteria 1455
978 nmdc:mga0n895_39905_c1 3300050512 Bacteria 4559
979 nmdc:mga0n895_403302_c1 3300050512 Bacteria 1383
980 nmdc:mga0n895_42084_c1 3300050512 Bacteria 4444
981 nmdc:mga0n895_453875_c1 3300050512 Unclassified 1294
982 nmdc:mga0n895_482075_c1 3300050512 Bacteria 1251
983 nmdc:mga0n895_486897_c1 3300050512 Bacteria 1244
984 nmdc:mga0n895_585369_c1 3300050512 Bacteria 1119
985 nmdc:mga0n895_623932_c1 3300050512 Bacteria 1079
986 nmdc:mga0n895_645233_c1 3300050512 Bacteria 1058
987 nmdc:mga0n895_700_c1 3300050512 Bacteria 23549
988 nmdc:mga0n895_716247_c1 3300050512 Bacteria 996
989 nmdc:mga0n895_86186_c1 3300050512 Bacteria 3137
990 nmdc:mga0n895_97034_c1 3300050512 Unclassified 2953
991 nmdc:mga0rr50_124979_c1 3300050513 Bacteria 2053
992 nmdc:mga0rr50_1261_c1 3300050513 Bacteria 13788
993 nmdc:mga0rr50_129763_c1 3300050513 Bacteria 2017
994 nmdc:mga0rr50_154421_c1 3300050513 Bacteria 1858
995 nmdc:mga0rr50_162833_c1 3300050513 Bacteria 1812
996 nmdc:mga0rr50_189173_c1 3300050513 Bacteria 1686
997 nmdc:mga0rr50_198472_c1 3300050513 Bacteria 1648
998 nmdc:mga0rr50_255069_c1 3300050513 Bacteria 1458
999 nmdc:mga0rr50_2634_c1 3300050513 Bacteria 10164
1000 nmdc:mga0rr50_29527_c1 3300050513 Bacteria 3869
1001 nmdc:mga0rr50_30672_c1 3300050513 Bacteria 3810
1002 nmdc:mga0rr50_328189_c1 3300050513 Bacteria 1284
1003 nmdc:mga0rr50_339854_c1 3300050513 Bacteria 1261
1004 nmdc:mga0rr50_404737_c1 3300050513 Bacteria 1153
1005 nmdc:mga0rr50_411500_c1 3300050513 Unclassified 1143
1006 nmdc:mga0rr50_418565_c1 3300050513 Bacteria 1133
1007 nmdc:mga0rr50_420213_c1 3300050513 Bacteria 1131
1008 nmdc:mga0rr50_4367_c1 3300050513 Bacteria 8304
1009 nmdc:mga0rr50_5505_c1 3300050513 Bacteria 7562
1010 nmdc:mga0rr50_573584_c1 3300050513 Bacteria 961
1011 nmdc:mga0rr50_589072_c1 3300050513 Bacteria 948
1012 nmdc:mga0rr50_68445_c1 3300050513 Bacteria 2360
1013 nmdc:mga0rr50_753288_c1 3300050513 Bacteria 831
1014 nmdc:mga0rr50_9648_c1 3300050513 Bacteria 6084
1015 nmdc:mga08x19_13343_c1 3300050514 Bacteria 4965
1016 nmdc:mga08x19_1479_c1 3300050514 Bacteria 14556
1017 nmdc:mga08x19_148088_c1 3300050514 Bacteria 1588
1018 nmdc:mga08x19_193062_c1 3300050514 Bacteria 1394
1019 nmdc:mga08x19_204887_c1 3300050514 Bacteria 1353
1020 nmdc:mga08x19_219599_c1 3300050514 Bacteria 1306
1021 nmdc:mga08x19_220521_c1 3300050514 Bacteria 1303
1022 nmdc:mga08x19_225258_c1 3300050514 Bacteria 1289
1023 nmdc:mga08x19_232105_c1 3300050514 Bacteria 1270
1024 nmdc:mga08x19_256775_c1 3300050514 Bacteria 1207
1025 nmdc:mga08x19_272945_c1 3300050514 Bacteria 1170
1026 nmdc:mga08x19_3476_c1 3300050514 Bacteria 9387
1027 nmdc:mga08x19_450771_c1 3300050514 Unclassified 906
1028 nmdc:mga08x19_45717_c1 3300050514 Bacteria 2798
1029 nmdc:mga08x19_633567_c1 3300050514 Bacteria 758
1030 nmdc:mga08x19_8_c1 3300050514 Bacteria 427794
1031 nmdc:mga0a205_143966_c1 3300050515 Bacteria 2284
1032 nmdc:mga0a205_152988_c1 3300050515 Bacteria 2206
1033 nmdc:mga0a205_173009_c1 3300050515 Bacteria 2055
1034 nmdc:mga0a205_18021_c1 3300050515 Bacteria 6631
1035 nmdc:mga0a205_187531_c1 3300050515 Bacteria 1961
1036 nmdc:mga0a205_19381_c1 3300050515 Bacteria 6412
1037 nmdc:mga0a205_204353_c1 3300050515 Bacteria 1865
1038 nmdc:mga0a205_222345_c1 3300050515 Bacteria 1773
1039 nmdc:mga0a205_241335_c1 3300050515 Bacteria 1688
1040 nmdc:mga0a205_285366_c1 3300050515 Bacteria 1526
1041 nmdc:mga0a205_3019_c1 3300050515 Bacteria 14915
1042 nmdc:mga0a205_302010_c1 3300050515 Bacteria 1474
1043 nmdc:mga0a205_343167_c1 3300050515 Bacteria 1362
1044 nmdc:mga0a205_3796_c2 3300050515 Bacteria 12079
1045 nmdc:mga0a205_42037_c1 3300050515 Bacteria 4404
1046 nmdc:mga0a205_42924_c1 3300050515 Bacteria 4359
1047 nmdc:mga0a205_443829_c1 3300050515 Bacteria 1158
1048 nmdc:mga0a205_457504_c1 3300050515 Unclassified 1136
1049 nmdc:mga0a205_4777_c1 3300050515 Bacteria 12170
1050 nmdc:mga0a205_488759_c1 3300050515 Bacteria 1088
1051 nmdc:mga0a205_54934_c1 3300050515 Bacteria 3846
1052 nmdc:mga0a205_598624_c1 3300050515 Bacteria 956
1053 nmdc:mga0a205_659212_c1 3300050515 Bacteria 898
1054 nmdc:mga0a205_6966_c1 3300050515 Bacteria 10226
1055 nmdc:mga0a205_704444_c1 3300050515 Bacteria 859
1056 nmdc:mga0a205_758506_c1 3300050515 Bacteria 819
1057 nmdc:mga0a205_76307_c1 3300050515 Bacteria 3239
1058 nmdc:mga0a205_88431_c1 3300050515 Bacteria 2994
1059 nmdc:mga0sz30_310680_c1 3300050516 Unclassified 703
1060 Ga0495601_0125076 3300053077 Bacteria 1672
1061 Ga0495612_0102120 3300053078 Unclassified 1222
1062 Ga0495595_0107367 3300053084 Bacteria 1351
1063 Ga0495619_0050521 3300053085 Bacteria 2745
1064 Ga0500618_001429 3300053125 Bacteria 10652
1065 nmdc:mga0n895_517578_c1
1066 JGI25162J39368_1001022
1067 JGI25150J39212_1000044
1068 JGI25150J39212_1000132
1069 JGI25159J45721_1016594
1070 JGI25151J46595_10021401
1071 JGI25165J46597_1000276
1072 JGI25153J46596_10000043
1073 JGI25153J46596_10000265
1074 rootH1_10042237
1075 rootH1_10016176
1076 rootH1_10077686
1077 JGI25160J50197_1032623
1078 JGI25407J50210_10054340
1079 JGI25404J52841_10028741
1080 Ga0055526_1008793
1081 Ga0055526_1043098
1082 Ga0055537_1000553
1083 Ga0055524_1000017
1084 Ga0055536_1000393
1085 Ga0055530_10009972
1086 Ga0055540_1041615
1087 Ga0055531_10000805
1088 Ga0055531_10002275
1089 JGI25405J52794_10001047
1090 Ga0065165_1001283
1091 Ga0065165_1011885
1092 Ga0065704_10105882
1093 Ga0065712_10001241
1094 Ga0065712_10295978
1095 Ga0065715_10095973
1096 Ga0065715_10150025
1097 Ga0065715_10300473
1098 Ga0065715_10344713
1099 Ga0065707_10066515
1100 Ga0065707_10084964
1101 Ga0070666_10040482
1102 Ga0070682_100003792
1103 Ga0070682_100080519
1104 Ga0070682_100598915
1105 Ga0068868_100201975
1106 Ga0068868_101277302
1107 Ga0070660_100023777
1108 Ga0070689_100018067
1109 Ga0070689_100027619
1110 Ga0070691_10009813
1111 Ga0070691_10017350
1112 Ga0070687_100017106
1113 Ga0070661_100288636
1114 Ga0070668_100019648
1115 Ga0070668_100414151
1116 Ga0070668_100514818
1117 Ga0070668_100836728
1118 Ga0070669_100037023
1119 Ga0070669_100120918
1120 Ga0070669_100667130
1121 Ga0070671_100078248
1122 Ga0070671_100492473
1123 Ga0070671_100807460
1124 Ga0070674_100142987
1125 Ga0070688_100042784
1126 Ga0070688_100534970
1127 Ga0070667_100140252
1128 Ga0070667_100141623
1129 Ga0070703_10064253
1130 Ga0070703_10151273
1131 Ga0070703_10160910
1132 Ga0070703_10196478
1133 Ga0070709_10004844
1134 Ga0070714_100074415
1135 Ga0070714_100074880
1136 Ga0070714_100153402
1137 Ga0070714_100839701
1138 Ga0070713_100027663
1139 Ga0070713_100060530
1140 Ga0070713_100080320
1141 Ga0070713_100081033
1142 Ga0070713_100176424
1143 Ga0070713_100334988
1144 Ga0070713_100446178
1145 Ga0070713_100581494
1146 Ga0070713_100754813
1147 Ga0070713_101282739
1148 Ga0070710_10012689
1149 Ga0070710_10051571
1150 Ga0070710_10066255
1151 Ga0070710_10075010
1152 Ga0070710_10075659
1153 Ga0070710_10236370
1154 Ga0070711_100001412
1155 Ga0070711_100042018
1156 Ga0070711_100229132
1157 Ga0070711_100246346
1158 Ga0070705_100079313
1159 Ga0070705_100523006
1160 Ga0070705_100710452
1161 Ga0070694_100017290
1162 Ga0070694_100382885
1163 Ga0070694_100463437
1164 Ga0070694_100508519
1165 Ga0070708_100000327
1166 Ga0070708_100011819
1167 Ga0070708_100024936
1168 Ga0070708_100039861
1169 Ga0070708_100086373
1170 Ga0070708_100097597
1171 Ga0070708_100124707
1172 Ga0070708_100150992
1173 Ga0070708_100152133
1174 Ga0070708_100195530
1175 Ga0070708_100198356
1176 Ga0070708_100203302
1177 Ga0070708_100262275
1178 Ga0070708_100262598
1179 Ga0070708_100332498
1180 Ga0070708_100355751
1181 Ga0070708_100556719
1182 Ga0070663_100011764
1183 Ga0070663_100016703
1184 Ga0070678_100002534
1185 Ga0070662_100009553
1186 Ga0068867_100045742
1187 Ga0070685_10064247
1188 Ga0070706_100004540
1189 Ga0070706_100006358
1190 Ga0070706_100007422
1191 Ga0070706_100009362
1192 Ga0070706_100019204
1193 Ga0070706_100029868
1194 Ga0070706_100141986
1195 Ga0070706_100157119
1196 Ga0070706_100159878
1197 Ga0070706_100214579
1198 Ga0070706_100344381
1199 Ga0070706_100643487
1200 Ga0070707_100009021
1201 Ga0070707_100009843
1202 Ga0070707_100018493
1203 Ga0070707_100030862
1204 Ga0070707_100033453
1205 Ga0070707_100065091
1206 Ga0070707_100126479
1207 Ga0070707_100139495
1208 Ga0070707_100258676
1209 Ga0070707_100261425
1210 Ga0070707_100373945
1211 Ga0070707_100444884
1212 Ga0070707_100487286
1213 Ga0070707_100621527
1214 Ga0070707_100675305
1215 Ga0070707_100700568
1216 Ga0070698_100008194
1217 Ga0070698_100014041
1218 Ga0070698_100029756
1219 Ga0070698_100034175
1220 Ga0070698_100054828
1221 Ga0070698_100061029
1222 Ga0070698_100064612
1223 Ga0070698_100087994
1224 Ga0070698_100089099
1225 Ga0070698_100109669
1226 Ga0070698_100114191
1227 Ga0070698_100214036
1228 Ga0070698_100303321
1229 Ga0070698_100334536
1230 Ga0070698_100454634
1231 Ga0070698_100557483
1232 Ga0070698_100868048
1233 Ga0070698_100892199
1234 Ga0070699_100004190
1235 Ga0070699_100017176
1236 Ga0070699_100054650
1237 Ga0070699_100077202
1238 Ga0070699_100078547
1239 Ga0070699_100137897
1240 Ga0070699_100210749
1241 Ga0070699_100274525
1242 Ga0070699_100347088
1243 Ga0070699_100358408
1244 Ga0070699_100398865
1245 Ga0070699_100401805
1246 Ga0070699_100453804
1247 Ga0070699_100505170
1248 Ga0070699_100545237
1249 Ga0070699_100948268
1250 Ga0070697_100007293
1251 Ga0070697_100007757
1252 Ga0070697_100017733
1253 Ga0070697_100032620
1254 Ga0070697_100041917
1255 Ga0070697_100101570
1256 Ga0070697_100116022
1257 Ga0070697_100131380
1258 Ga0070697_100200865
1259 Ga0070697_100254396
1260 Ga0070697_100353426
1261 Ga0070697_100385229
1262 Ga0070697_100438865
1263 Ga0070697_100523208
1264 Ga0070697_100565601
1265 Ga0070697_100986311
1266 Ga0068853_100017172
1267 Ga0068853_100231603
1268 Ga0070672_100030559
1269 Ga0070686_100006693
1270 Ga0070695_100027617
1271 Ga0070695_100027867
1272 Ga0070695_100065982
1273 Ga0070695_100435303
1274 Ga0070695_100562165
1275 Ga0070695_100844889
1276 Ga0070696_100034202
1277 Ga0070696_100036799
1278 Ga0070696_100046895
1279 Ga0070696_100103608
1280 Ga0070696_100148354
1281 Ga0070696_100181210
1282 Ga0070696_100196543
1283 Ga0070696_100244947
1284 Ga0070696_100316303
1285 Ga0070696_100528193
1286 Ga0070665_100005888
1287 Ga0070665_100099412
1288 Ga0070665_100488105
1289 Ga0070665_100766005
1290 Ga0070704_100020569
1291 Ga0070704_100022009
1292 Ga0070704_100030427
1293 Ga0070704_100226560
1294 Ga0070704_100243905
1295 Ga0070704_100265153
1296 Ga0070704_100377307
1297 Ga0070704_100573656
1298 Ga0070704_100596189
1299 Ga0070664_100211057
1300 Ga0068857_100017155
1301 Ga0068854_100011429
1302 Ga0068854_100049570
1303 Ga0068854_100523771
1304 Ga0070702_100001810
1305 Ga0068852_100012556
1306 Ga0068859_100362090
1307 Ga0068864_100269485
1308 Ga0068866_10469634
1309 Ga0068861_100034650
1310 Ga0068861_100119064
1311 Ga0068861_100271996
1312 Ga0068861_100475677
1313 Ga0068863_100012142
1314 Ga0068858_100228910
1315 Ga0068860_100016584
1316 Ga0068860_100892269
1317 Ga0068862_100009669
1318 Ga0081455_10006446
1319 Ga0081455_10010595
1320 Ga0081455_10116873
1321 Ga0081538_10003905
1322 Ga0081538_10008589
1323 Ga0081538_10012492
1324 Ga0081538_10135447
1325 Ga0081540_1000494
1326 Ga0081540_1052217
1327 Ga0081539_10061200
1328 Ga0070717_10011227
1329 Ga0070717_10013507
1330 Ga0070717_10111075
1331 Ga0070717_10111664
1332 Ga0070717_10153964
1333 Ga0070717_10163817
1334 Ga0070717_10325851
1335 Ga0070717_10470178
1336 Ga0070717_10548576
1337 Ga0070717_10642939
1338 Ga0070717_10906287
1339 Ga0075365_10141022
1340 Ga0075368_10013725
1341 Ga0075363_100000487
1342 Ga0075364_10048714
1343 Ga0075364_10536748
1344 Ga0070715_10019337
1345 Ga0070715_10019458
1346 Ga0070715_10094818
1347 Ga0070715_10307258
1348 Ga0070716_100002178
1349 Ga0070716_100011404
1350 Ga0070716_100023382
1351 Ga0070716_100086870
1352 Ga0070716_100151142
1353 Ga0070716_100225498
1354 Ga0070716_100228945
1355 Ga0070716_100241319
1356 Ga0070716_100564528
1357 Ga0070716_100610680
1358 Ga0070712_100003950
1359 Ga0070712_100006417
1360 Ga0070712_100058515
1361 Ga0070712_100059493
1362 Ga0070712_100709512
1363 Ga0070712_100820479
1364 Ga0075367_10177329
1365 Ga0097621_100761348
1366 Ga0075370_10011330
1367 Ga0068871_100228670
1368 Ga0068871_100273776
1369 Ga0075428_100026406
1370 Ga0075428_100027761
1371 Ga0075428_100044754
1372 Ga0075428_100068519
1373 Ga0075428_100097710
1374 Ga0075428_100099150
1375 Ga0075428_100122741
1376 Ga0075428_100156310
1377 Ga0075428_100162662
1378 Ga0075428_100192864
1379 Ga0075428_100219793
1380 Ga0075428_100226376
1381 Ga0075428_100279629
1382 Ga0075428_100353716
1383 Ga0075428_100355340
1384 Ga0075428_100402237
1385 Ga0075428_100573948
1386 Ga0075428_100778339
1387 Ga0075430_100020140
1388 Ga0075430_100054534
1389 Ga0075430_100059465
1390 Ga0075430_100278704
1391 Ga0075430_100362592
1392 Ga0075431_100022859
1393 Ga0075431_100065686
1394 Ga0075431_100287923
1395 Ga0075431_100319715
1396 Ga0075431_100360776
1397 Ga0075431_100557529
1398 Ga0075433_10001320
1399 Ga0075433_10002036
1400 Ga0075433_10003541
1401 Ga0075433_10006871
1402 Ga0075433_10010320
1403 Ga0075433_10011565
1404 Ga0075433_10034231
1405 Ga0075433_10053330
1406 Ga0075433_10076139
1407 Ga0075433_10127900
1408 Ga0075433_10148695
1409 Ga0075433_10152514
1410 Ga0075433_10194662
1411 Ga0075433_10231520
1412 Ga0075433_10261307
1413 Ga0075433_10288162
1414 Ga0075433_10459230
1415 Ga0075433_10459672
1416 Ga0075433_10496308
1417 Ga0075433_10681852
1418 Ga0075433_10801193
1419 Ga0075434_100005686
1420 Ga0075434_100007695
1421 Ga0075434_100019749
1422 Ga0075434_100034636
1423 Ga0075434_100046970
1424 Ga0075434_100057121
1425 Ga0075434_100114024
1426 Ga0075434_100145351
1427 Ga0075434_100161118
1428 Ga0075434_100210425
1429 Ga0075434_100212061
1430 Ga0075434_100248425
1431 Ga0075434_100254674
1432 Ga0075434_100278393
1433 Ga0075434_100306409
1434 Ga0075434_100354064
1435 Ga0075434_100429004
1436 Ga0075434_100495667
1437 Ga0075434_100649057
1438 Ga0075434_100707807
1439 Ga0075434_100724323
1440 Ga0075434_100747756
1441 Ga0075434_100766494
1442 Ga0075434_101076223
1443 Ga0075429_100019033
1444 Ga0075429_100037493
1445 Ga0075429_100049459
1446 Ga0075429_100050141
1447 Ga0075429_100149788
1448 Ga0075429_100173732
1449 Ga0075429_100256636
1450 Ga0075429_100425021
1451 Ga0075429_100786033
1452 Ga0068865_100183944
1453 Ga0075436_100003400
1454 Ga0075436_100033969
1455 Ga0075436_100065982
1456 Ga0075436_100067224
1457 Ga0075436_100198226
1458 Ga0075436_100235642
1459 Ga0075436_100296316
1460 Ga0075436_100665177
1461 Ga0075436_100669369
1462 Ga0075436_100856380
1463 Ga0097620_100362080
1464 Ga0075435_100007201
1465 Ga0075435_100013765
1466 Ga0075435_100024448
1467 Ga0075435_100055694
1468 Ga0075435_100067152
1469 Ga0075435_100071188
1470 Ga0075435_100072577
1471 Ga0075435_100098896
1472 Ga0075435_100152434
1473 Ga0075435_100164266
1474 Ga0075435_100228569
1475 Ga0075435_100232000
1476 Ga0075435_100313066
1477 Ga0075435_100403072
1478 Ga0075435_100408508
1479 Ga0075435_100459042
1480 Ga0075435_100480993
1481 Ga0075435_100585129
1482 Ga0075435_100601046
1483 Ga0075435_100893735
1484 Ga0099794_10001962
1485 Ga0099794_10002095
1486 Ga0099794_10020880
1487 Ga0099794_10193834
1488 Ga0099794_10229070
1489 Ga0099795_10225537
1490 Ga0105244_10005771
1491 Ga0105250_10030786
1492 Ga0105240_10663574
1493 Ga0111539_10048581
1494 Ga0111539_10085334
1495 Ga0111539_10168166
1496 Ga0111539_10203521
1497 Ga0111539_10243809
1498 Ga0111539_10390786
1499 Ga0111539_10459093
1500 Ga0111539_10486766
1501 Ga0111539_10781032
1502 Ga0111539_10793818
1503 Ga0105245_10013776
1504 Ga0105247_10038209
1505 Ga0114129_10002492
1506 Ga0114129_10004475
1507 Ga0114129_10004685
1508 Ga0114129_10007203
1509 Ga0114129_10017425
1510 Ga0114129_10017478
1511 Ga0114129_10019037
1512 Ga0114129_10021529
1513 Ga0114129_10041514
1514 Ga0114129_10060267
1515 Ga0114129_10090140
1516 Ga0114129_10118447
1517 Ga0114129_10184200
1518 Ga0114129_10185627
1519 Ga0114129_10296831
1520 Ga0114129_10359204
1521 Ga0114129_10378370
1522 Ga0114129_10455247
1523 Ga0114129_10472099
1524 Ga0114129_10483623
1525 Ga0114129_10619674
1526 Ga0114129_10653232
1527 Ga0114129_10675847
1528 Ga0114129_10727537
1529 Ga0114129_10812272
1530 Ga0114129_10902255
1531 Ga0114129_11076102
1532 Ga0114129_11078018
1533 Ga0114129_11638466
1534 Ga0105243_10848832
1535 Ga0105241_10040941
1536 Ga0105241_10048446
1537 Ga0105242_10297612
1538 Ga0105242_10593919
1539 Ga0105242_10607719
1540 Ga0105248_10011651
1541 Ga0105248_10752314
1542 Ga0105237_10000964
1543 Ga0105237_10966098
1544 Ga0105238_10426422
1545 Ga0105249_10268839
1546 Ga0105249_10314419
1547 Ga0105249_10394120
1548 Ga0105249_11097431
1549 Ga0099796_10017097
1550 Ga0099796_10085032
1551 Ga0105239_10000025
1552 Ga0105239_10090735
1553 Ga0105239_11317040
1554 Ga0105239_11352899
1555 Ga0105246_10214239
1556 Ga0157373_10077541
1557 Ga0157369_10108106
1558 Ga0157374_10241514
1559 Ga0157378_10021295
1560 Ga0157378_10491278
1561 Ga0157378_10873191
1562 Ga0163162_10181078
1563 Ga0157372_10744394
1564 Ga0157375_10091370
1565 Ga0157375_10266665
1566 Ga0157375_10963889
1567 Ga0163163_10017144
1568 Ga0163163_10986678
1569 Ga0157380_10009890
1570 Ga0157380_10338927
1571 Ga0157379_10312860
1572 Ga0157379_10544289
1573 Ga0157376_10009199
1574 Ga0163161_11047058
1575 Ga0214544_1000424
1576 Ga0214542_1000412
1577 Ga0214545_1000242
1578 Ga0214543_1000327
1579 Ga0224572_1002353
1580 Ga0228598_1002567
1581 Ga0228598_1016185
1582 Ga0209437_100023
1583 Ga0207425_1000037
1584 Ga0207425_1000047
1585 Ga0209129_1000378
1586 Ga0209129_1000480
1587 Ga0209233_1000062
1588 Ga0209565_1000062
1589 Ga0209565_1002595
1590 Ga0209565_1037884
1591 Ga0209130_1000318
1592 Ga0209676_1000291
1593 Ga0209676_1001816
1594 Ga0209025_1000117
1595 Ga0209025_1000150
1596 Ga0209025_1045233
1597 Ga0209564_1002021
1598 Ga0209564_1013326
1599 Ga0209564_1020233
1600 Ga0209758_1000009
1601 Ga0209758_1000103
1602 Ga0209758_1001241
1603 Ga0209050_1000327
1604 Ga0209050_1002490
1605 Ga0209050_1003020
1606 Ga0209256_1000018
1607 Ga0207426_1000512
1608 Ga0207426_1001703
1609 Ga0207426_1030352
1610 Ga0209051_1017824
1611 Ga0209257_1000345
1612 Ga0209257_1001353
1613 Ga0207653_10055869
1614 Ga0207692_10042639
1615 Ga0207692_10072078
1616 Ga0207692_10651571
1617 Ga0207642_10371252
1618 Ga0207688_10008540
1619 Ga0207647_10008876
1620 Ga0207685_10007770
1621 Ga0207685_10030721
1622 Ga0207685_10037116
1623 Ga0207685_10063917
1624 Ga0207685_10161923
1625 Ga0207699_10076719
1626 Ga0207699_10087391
1627 Ga0207699_10090359
1628 Ga0207699_10592016
1629 Ga0207645_10031716
1630 Ga0207645_10285027
1631 Ga0207684_10000181
1632 Ga0207684_10000507
1633 Ga0207684_10000684
1634 Ga0207684_10003189
1635 Ga0207684_10005711
1636 Ga0207684_10007743
1637 Ga0207684_10013300
1638 Ga0207684_10019354
1639 Ga0207684_10026415
1640 Ga0207684_10027978
1641 Ga0207684_10074280
1642 Ga0207684_10079262
1643 Ga0207684_10084698
1644 Ga0207684_10085947
1645 Ga0207684_10113533
1646 Ga0207684_10116903
1647 Ga0207684_10144603
1648 Ga0207684_10150699
1649 Ga0207684_10193612
1650 Ga0207684_10481299
1651 Ga0207684_10498204
1652 Ga0207684_10550516
1653 Ga0207684_10626499
1654 Ga0207654_10044067
1655 Ga0207695_10000347
1656 Ga0207671_10001460
1657 Ga0207693_10000898
1658 Ga0207693_10006516
1659 Ga0207693_10008253
1660 Ga0207693_10037532
1661 Ga0207693_10095563
1662 Ga0207693_10689661
1663 Ga0207663_10001824
1664 Ga0207663_10017487
1665 Ga0207663_10027262
1666 Ga0207663_10105923
1667 Ga0207663_10145373
1668 Ga0207663_10267973
1669 Ga0207662_10040450
1670 Ga0207657_10009972
1671 Ga0207646_10000165
1672 Ga0207646_10000663
1673 Ga0207646_10006466
1674 Ga0207646_10006994
1675 Ga0207646_10008284
1676 Ga0207646_10011592
1677 Ga0207646_10015133
1678 Ga0207646_10021846
1679 Ga0207646_10029826
1680 Ga0207646_10030282
1681 Ga0207646_10059603
1682 Ga0207646_10084655
1683 Ga0207646_10205860
1684 Ga0207646_10497438
1685 Ga0207646_10527683
1686 Ga0207646_10666228
1687 Ga0207646_10804948
1688 Ga0207681_10026959
1689 Ga0207681_10059934
1690 Ga0207681_10419507
1691 Ga0207694_10331642
1692 Ga0207650_10083604
1693 Ga0207659_10288409
1694 Ga0207687_10142857
1695 Ga0207700_10036148
1696 Ga0207700_10084701
1697 Ga0207700_10151733
1698 Ga0207700_10186891
1699 Ga0207700_10224733
1700 Ga0207700_10775811
1701 Ga0207664_10086255
1702 Ga0207664_10189227
1703 Ga0207664_10685140
1704 Ga0207664_10903034
1705 Ga0207644_10067356
1706 Ga0207644_10729361
1707 Ga0207706_10028247
1708 Ga0207706_10406090
1709 Ga0207706_10430626
1710 Ga0207686_10361276
1711 Ga0207709_10134917
1712 Ga0207670_10019485
1713 Ga0207670_10099245
1714 Ga0207669_10130770
1715 Ga0207704_10184947
1716 Ga0207704_10879087
1717 Ga0207665_10000887
1718 Ga0207665_10014732
1719 Ga0207665_10045875
1720 Ga0207665_10051130
1721 Ga0207665_10059603
1722 Ga0207665_10119703
1723 Ga0207665_10121938
1724 Ga0207665_10262680
1725 Ga0207665_10306822
1726 Ga0207665_10395603
1727 Ga0207691_10360324
1728 Ga0207711_10050722
1729 Ga0207711_10744232
1730 Ga0207679_10357158
1731 Ga0207679_10665272
1732 Ga0207667_10679476
1733 Ga0207712_10189122
1734 Ga0207712_10377086
1735 Ga0207668_10017069
1736 Ga0207668_10534655
1737 Ga0207668_10826589
1738 Ga0207640_10031502
1739 Ga0207640_10137884
1740 Ga0207640_10270490
1741 Ga0207658_10232312
1742 Ga0207658_10300761
1743 Ga0207658_10446389
1744 Ga0207677_10266446
1745 Ga0207677_10492097
1746 Ga0207703_10176207
1747 Ga0207639_10357378
1748 Ga0207639_10719125
1749 Ga0207678_10002089
1750 Ga0207678_10011677
1751 Ga0207708_10015629
1752 Ga0207708_10147078
1753 Ga0207641_10009040
1754 Ga0207648_10037907
1755 Ga0207648_10043366
1756 Ga0207648_10220721
1757 Ga0207676_11060287
1758 Ga0207674_10018861
1759 Ga0207675_100072478
1760 Ga0207675_100203694
1761 Ga0207675_100469956
1762 Ga0207675_100577786
1763 Ga0207675_101038825
1764 Ga0207683_10006916
1765 Ga0207683_11175321
1766 Ga0207698_11125597
1767 Ga0209588_1000024
1768 Ga0209588_1004440
1769 Ga0209813_10123432
1770 Ga0207428_10016868
1771 Ga0207428_10065007
1772 Ga0265356_1000449
1773 Ga0268266_10002394
1774 Ga0268266_10031920
1775 Ga0268266_10569836
1776 Ga0268265_10086808
1777 Ga0268264_10040316
1778 Ga0268264_10111426
1779 Ga0268264_10193494
1780 Ga0268264_11025120
1781 Ga0265762_1001022
1782 Ga0265762_1002005
1783 Ga0265763_1000002
1784 Ga0265763_1007364
1785 Ga0265773_1002492
1786 Ga0265760_10001288
1787 Ga0265760_10109242
1788 Ga0307510_10275516
1789 Ga0373950_0016769
1790 Ga0373926_0075173
1791 Ga0373926_0216179
1792 Ga0373940_0125668
1793 Ga0373951_0064816
1794 Ga0373951_0122752
1795 Ga0373931_0575102
1796 Ga0373931_0609514
1797 Ga0373927_0053694
1798 Ga0373927_0552959
1799 Ga0373947_0186141
1800 Ga0373937_0041832
1801 Ga0372808_025127
1802 Ga0395900_0112472
1803 Ga0400483_083970
1804 Ga0400483_108458
1805 Ga0451577_0153436
1806 Ga0453683_0000258
1807 Ga0453683_0006130
1808 Ga0453683_0011802
1809 Ga0453683_0032817
1810 Ga0453683_0080866
1811 Ga0453683_0150096
1812 Ga0453683_0234905
1813 Ga0453683_0329663
1814 Ga0453684_0046569
1815 Ga0453684_0320630
1816 Ga0453684_0378649
1817 Ga0466968_0097739
1818 Ga0451576_0033734
1819 Ga0451576_0055389
1820 Ga0451576_0108565
1821 Ga0495590_0041523
1822 Ga0495629_0243094
1823 Ga0495651_0394046
1824 Ga0495580_0078824
1825 Ga0495580_0141575
1826 Ga0495582_0367625
1827 Ga0495605_0000749
1828 Ga0495605_0269777
1829 Ga0495664_0173357
1830 Ga0495584_0037238
1831 Ga0495584_0042612
1832 Ga0495594_0137711
1833 Ga0495606_0009794
1834 Ga0495608_0067086
1835 Ga0495618_0042290
1836 Ga0495628_0242951
1837 Ga0495630_0098949
1838 Ga0495630_0565111
1839 Ga0495631_0116266
1840 Ga0495632_0206032
1841 Ga0495663_0206691
1842 Ga0495642_0154502
1843 Ga0495665_0157712
1844 Ga0495640_0056854
1845 Ga0495609_0190288
1846 Ga0495645_0067270
1847 Ga0495633_0142795
1848 Ga0495634_0040100
1849 Ga0495635_0630366
1850 Ga0495635_0651942
1851 Ga0495659_0053397
1852 Ga0495659_0162846
1853 Ga0495599_0089005
1854 Ga0495646_0339900
1855 Ga0495669_0359874
1856 Ga0495613_0202390
1857 Ga0495613_0217992
1858 Ga0495624_0385143
1859 Ga0495624_0482935
1860 Ga0495670_0399061
1861 Ga0495660_0220296
1862 Ga0495660_0282831
1863 Ga0495581_0082110
1864 Ga0495636_0178267
1865 Ga0495636_0250903
1866 Ga0495674_0064432
1867 Ga0495674_0085525
1868 Ga0495672_0364999
1869 Ga0495673_0067809
1870 Ga0495684_0037983
1871 Ga0496100_0007168
1872 Ga0496100_0390539
1873 Ga0496101_0224338
1874 Ga0496101_0597398
1875 Ga0496102_0141169
1876 Ga0496102_0175044
1877 Ga0496102_0193307
1878 Ga0496102_0199132
1879 Ga0496102_0956093
1880 Ga0496104_0000339
1881 Ga0496104_0008489
1882 Ga0496104_0034057
1883 Ga0496104_0050418
1884 Ga0496104_0076052
1885 Ga0496105_0002897
1886 Ga0496105_0006320
1887 Ga0496105_0111260
1888 Ga0496106_0037970
1889 Ga0496106_0385457
1890 Ga0496106_0626156
1891 Ga0496107_0032183
1892 Ga0496107_0393475
1893 Ga0496107_0765576
1894 Ga0496107_0817709
1895 Ga0496108_0033772
1896 Ga0496108_0040429
1897 Ga0496108_0395786
1898 Ga0496108_0880321
1899 Ga0496108_0901547
1900 Ga0496109_0000191
1901 Ga0496109_0077982
1902 Ga0496109_0109696
1903 Ga0496110_0014344
1904 Ga0496110_0063097
1905 Ga0496110_0093278
1906 Ga0496110_1062316
1907 Ga0496111_0016400
1908 Ga0496111_0089040
1909 Ga0496111_0145166
1910 Ga0496112_0081626
1911 Ga0496112_0296383
1912 Ga0496112_0547969
1913 Ga0496113_0071636
1914 Ga0496113_0089240
1915 Ga0496113_0193187
1916 Ga0496113_0298504
1917 Ga0496113_0389564
1918 Ga0496113_0470367
1919 Ga0496114_0000527
1920 Ga0496114_0058277
1921 Ga0496114_0349343
1922 Ga0496115_0020011
1923 Ga0496115_0028961
1924 Ga0496115_0080307
1925 Ga0496115_0096450
1926 Ga0496115_0100313
1927 Ga0496115_0132347
1928 Ga0496115_0138419
1929 Ga0496115_0148030
1930 Ga0496115_0260607
1931 Ga0496115_0295940
1932 Ga0496115_0500395
1933 Ga0496115_0694642
1934 Ga0496117_0010943
1935 Ga0496118_0009623
1936 Ga0496118_0082947
1937 Ga0496119_0072377
1938 Ga0496121_0000245
1939 Ga0496121_0011345
1940 Ga0496122_0000043
1941 Ga0496123_0000090
1942 Ga0496123_0114209
1943 Ga0496123_0160171
1944 Ga0496125_0051918
1945 Ga0496126_0005254
1946 Ga0496126_0040027
1947 Ga0496126_0137305
1948 Ga0496126_0439338
1949 nmdc:mga00v17_339830_c1
1950 nmdc:mga0yw44_128213_c1
1951 nmdc:mga0k408_169626_c1
1952 nmdc:mga07m45_7474_c1
1953 nmdc:mga05p37_103593_c2
1954 nmdc:mga05p37_10_c1
1955 nmdc:mga05p37_11608_c1
1956 nmdc:mga05p37_116479_c1
1957 nmdc:mga05p37_1238_c1
1958 nmdc:mga05p37_1315154_c1
1959 nmdc:mga05p37_13336_c1
1960 nmdc:mga05p37_13888_c1
1961 nmdc:mga05p37_155369_c1
1962 nmdc:mga05p37_169056_c1
1963 nmdc:mga05p37_208979_c1
1964 nmdc:mga05p37_21714_c1
1965 nmdc:mga05p37_2264_c1
1966 nmdc:mga05p37_260198_c1
1967 nmdc:mga05p37_284012_c1
1968 nmdc:mga05p37_29334_c1
1969 nmdc:mga05p37_2985_c1
1970 nmdc:mga05p37_308166_c1
1971 nmdc:mga05p37_352059_c1
1972 nmdc:mga05p37_352769_c1
1973 nmdc:mga05p37_37533_c1
1974 nmdc:mga05p37_38691_c1
1975 nmdc:mga05p37_441644_c1
1976 nmdc:mga05p37_461039_c1
1977 nmdc:mga05p37_491_c1
1978 nmdc:mga05p37_511488_c1
1979 nmdc:mga05p37_527792_c1
1980 nmdc:mga05p37_554389_c1
1981 nmdc:mga05p37_58271_c1
1982 nmdc:mga05p37_708888_c1
1983 nmdc:mga05p37_720571_c1
1984 nmdc:mga05p37_79_c1
1985 nmdc:mga05p37_876178_c1
1986 nmdc:mga05p37_991_c1
1987 nmdc:mga09592_11547_c1
1988 nmdc:mga09592_14031_c1
1989 nmdc:mga09592_170190_c1
1990 nmdc:mga09592_172832_c1
1991 nmdc:mga09592_256747_c1
1992 nmdc:mga09592_305656_c1
1993 nmdc:mga09592_370636_c1
1994 nmdc:mga09592_433519_c1
1995 nmdc:mga09592_507597_c1
1996 nmdc:mga09592_687080_c1
1997 nmdc:mga09592_75905_c1
1998 nmdc:mga0qj67_339787_c1
1999 nmdc:mga0qj67_35067_c1
2000 nmdc:mga0qj67_377543_c1
2001 nmdc:mga0qj67_413768_c1
2002 nmdc:mga0qj67_487064_c1
2003 nmdc:mga0qj67_52444_c1
2004 nmdc:mga0qj67_7248_c1
2005 nmdc:mga06r32_101683_c1
2006 nmdc:mga06r32_176367_c1
2007 nmdc:mga06r32_176801_c1
2008 nmdc:mga06r32_202958_c1
2009 nmdc:mga06r32_21017_c1
2010 nmdc:mga06r32_283685_c1
2011 nmdc:mga06r32_312514_c1
2012 nmdc:mga06r32_354590_c1
2013 nmdc:mga06r32_45076_c1
2014 nmdc:mga06r32_653011_c1
2015 nmdc:mga06r32_6852_c1
2016 nmdc:mga08y16_1318648_c1
2017 nmdc:mga08y16_200287_c1
2018 nmdc:mga08y16_463068_c1
2019 nmdc:mga08y16_572158_c1
2020 nmdc:mga08y16_594252_c1
2021 nmdc:mga08y16_741248_c1
2022 nmdc:mga08y16_78900_c1
2023 nmdc:mga08y16_872464_c1
2024 nmdc:mga08y16_89545_c1
2025 nmdc:mga08y16_9772_c1
2026 nmdc:mga0n895_10664_c1
2027 nmdc:mga0n895_1123_c1
2028 nmdc:mga0n895_127369_c1
2029 nmdc:mga0n895_129603_c1
2030 nmdc:mga0n895_1338814_c1
2031 nmdc:mga0n895_172180_c1
2032 nmdc:mga0n895_177204_c1
2033 nmdc:mga0n895_194258_c1
2034 nmdc:mga0n895_22284_c1
2035 nmdc:mga0n895_233540_c1
2036 nmdc:mga0n895_266001_c1
2037 nmdc:mga0n895_31868_c1
2038 nmdc:mga0n895_332683_c1
2039 nmdc:mga0n895_344847_c1
2040 nmdc:mga0n895_368247_c1
2041 nmdc:mga0n895_39905_c1
2042 nmdc:mga0n895_403302_c1
2043 nmdc:mga0n895_42084_c1
2044 nmdc:mga0n895_453875_c1
2045 nmdc:mga0n895_482075_c1
2046 nmdc:mga0n895_486897_c1
2047 nmdc:mga0n895_585369_c1
2048 nmdc:mga0n895_623932_c1
2049 nmdc:mga0n895_645233_c1
2050 nmdc:mga0n895_700_c1
2051 nmdc:mga0n895_716247_c1
2052 nmdc:mga0n895_86186_c1
2053 nmdc:mga0n895_97034_c1
2054 nmdc:mga0rr50_124979_c1
2055 nmdc:mga0rr50_1261_c1
2056 nmdc:mga0rr50_129763_c1
2057 nmdc:mga0rr50_154421_c1
2058 nmdc:mga0rr50_162833_c1
2059 nmdc:mga0rr50_189173_c1
2060 nmdc:mga0rr50_198472_c1
2061 nmdc:mga0rr50_255069_c1
2062 nmdc:mga0rr50_2634_c1
2063 nmdc:mga0rr50_29527_c1
2064 nmdc:mga0rr50_30672_c1
2065 nmdc:mga0rr50_328189_c1
2066 nmdc:mga0rr50_339854_c1
2067 nmdc:mga0rr50_404737_c1
2068 nmdc:mga0rr50_411500_c1
2069 nmdc:mga0rr50_418565_c1
2070 nmdc:mga0rr50_420213_c1
2071 nmdc:mga0rr50_4367_c1
2072 nmdc:mga0rr50_5505_c1
2073 nmdc:mga0rr50_573584_c1
2074 nmdc:mga0rr50_589072_c1
2075 nmdc:mga0rr50_68445_c1
2076 nmdc:mga0rr50_753288_c1
2077 nmdc:mga0rr50_9648_c1
2078 nmdc:mga08x19_13343_c1
2079 nmdc:mga08x19_1479_c1
2080 nmdc:mga08x19_148088_c1
2081 nmdc:mga08x19_193062_c1
2082 nmdc:mga08x19_204887_c1
2083 nmdc:mga08x19_219599_c1
2084 nmdc:mga08x19_220521_c1
2085 nmdc:mga08x19_225258_c1
2086 nmdc:mga08x19_232105_c1
2087 nmdc:mga08x19_256775_c1
2088 nmdc:mga08x19_272945_c1
2089 nmdc:mga08x19_3476_c1
2090 nmdc:mga08x19_450771_c1
2091 nmdc:mga08x19_45717_c1
2092 nmdc:mga08x19_633567_c1
2093 nmdc:mga08x19_8_c1
2094 nmdc:mga0a205_143966_c1
2095 nmdc:mga0a205_152988_c1
2096 nmdc:mga0a205_173009_c1
2097 nmdc:mga0a205_18021_c1
2098 nmdc:mga0a205_187531_c1
2099 nmdc:mga0a205_19381_c1
2100 nmdc:mga0a205_204353_c1
2101 nmdc:mga0a205_222345_c1
2102 nmdc:mga0a205_241335_c1
2103 nmdc:mga0a205_285366_c1
2104 nmdc:mga0a205_3019_c1
2105 nmdc:mga0a205_302010_c1
2106 nmdc:mga0a205_343167_c1
2107 nmdc:mga0a205_3796_c2
2108 nmdc:mga0a205_42037_c1
2109 nmdc:mga0a205_42924_c1
2110 nmdc:mga0a205_443829_c1
2111 nmdc:mga0a205_457504_c1
2112 nmdc:mga0a205_4777_c1
2113 nmdc:mga0a205_488759_c1
2114 nmdc:mga0a205_54934_c1
2115 nmdc:mga0a205_598624_c1
2116 nmdc:mga0a205_659212_c1
2117 nmdc:mga0a205_6966_c1
2118 nmdc:mga0a205_704444_c1
2119 nmdc:mga0a205_758506_c1
2120 nmdc:mga0a205_76307_c1
2121 nmdc:mga0a205_88431_c1
2122 nmdc:mga0sz30_310680_c1
2123 Ga0495601_0125076
2124 Ga0495612_0102120
2125 Ga0495595_0107367
2126 Ga0495619_0050521
2127 Ga0500618_001429

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00857

Isochorismatase

Isochorismatase family

36

186

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b34-assembly1.cif.gz_A structure of mar1 ribonuclease from caenorhabditis elegans 0.9311 9 193
1yac-assembly1.cif.gz_A the 1.8 angstrom crystal structure of the ycac gene product from escherichia coli reveals an octameric hydrolase of unknown specificity 0.9058 8 205
4wh0-assembly1.cif.gz_A ycac from pseudomonas aeruginosa with s-mercaptocysteine active site cysteine 0.8876 8 207
4wgf-assembly1.cif.gz_C ycac from pseudomonas aeruginosa with hexane-2,5-diol and covalent acrylamide 0.8841 8 207
1yac-assembly1.cif.gz_A the 1.8 angstrom crystal structure of the ycac gene product from escherichia coli reveals an octameric hydrolase of unknown specificity 0.8762 8 205
ID Description Score Start End Superfamily
af_A0JME6_2_195_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.931 10 193 3.40.50.850
af_Q9W127_4_199_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9056 9 193 3.40.50.850
af_Q54NZ8_2_198_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8875 10 198 3.40.50.850
af_Q54RC7_3_195_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8855 9 191 3.40.50.850
4wh0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8847 8 207 3.40.50.850
ID Description Score Start End GO Terms
AF-U3U4G6-F1-model_v4 Isochorismatase hydrolase 0.9755 7 133 GO:0016787
AF-B8L5H2-F1-model_v4 Isochorismatase hydrolase (EC 3.3.2.1) 0.9741 20 161 GO:0008908
AF-A0A377Z2N5-F1-model_v4 Isochorismatase family protein 0.9739 9 163
AF-A0A447J483-F1-model_v4 deleted 0.9738 7 174
AF-A0A1H6P1D7-F1-model_v4 deleted 0.9734 8 167

Map