F489291

General Info

Members Datasets Scaffolds Average Seq Length
1061 311 2122 144

Family's Representative Sequence

Representative Sequence 3300035170|Ga0373943_0306507|Ga0373943_0306507_318_842
Length 174
Sequence MPAAPLARPENRGPRFFFAVLFQLIHAAKMELDTSKWSGEGAFTQVLVDWLAKLDGVTLVRVEDAPASRSEADYNFISNELFVTFATRTVREPIRRFGILPGARTVMEKLMTVAELEQALTVLPGIGAPDYADGGMLQYLRAERIVPPYQTRGYKLVELVRIYEASSEPRALSP

Samples

Sample ID Description Type Environment
1 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
183 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
184 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
189 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
190 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
191 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
192 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
193 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
194 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
195 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
196 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
197 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
198 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
199 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
200 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
201 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
203 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
204 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
205 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
206 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
207 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
208 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
209 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
210 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
211 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
212 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
213 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
214 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
215 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
216 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
217 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
218 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
219 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
220 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
222 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
223 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
224 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
225 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
226 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
227 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
228 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
229 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
230 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
231 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
232 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
233 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
234 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
235 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
236 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
237 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
238 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
239 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
240 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
241 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
242 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
243 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
244 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
245 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
246 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
247 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
248 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
249 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
250 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
251 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
252 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
253 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
254 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
255 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
256 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
257 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
258 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
259 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
260 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
261 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
262 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
263 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
264 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
265 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
266 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
267 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
268 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
269 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
270 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
271 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
272 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
273 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
274 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
275 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
276 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
277 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
278 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
279 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
280 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
288 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
289 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
290 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
291 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
292 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
293 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
294 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
295 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
296 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
297 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
298 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
299 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
300 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
301 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
302 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
303 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
304 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
305 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
306 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
307 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
308 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
309 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
310 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
311 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.09
Nodule 0
Rhizoplane 4.9
Rhizosphere 94.63
Stem 0
Stem Tuber 0
Unclassified 35.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373943_0306507 3300035170 Unclassified 903
2 JGI24751J29686_10012579 3300002459 Bacteria 1745
3 JGI24751J29686_10044217 3300002459 Unclassified 921
4 Ga0065712_10148007 3300005290 Bacteria 1392
5 Ga0065715_10384793 3300005293 Bacteria 902
6 Ga0065707_10157319 3300005295 Bacteria 1578
7 Ga0065707_10191325 3300005295 Bacteria 1359
8 Ga0065707_10205317 3300005295 Bacteria 1291
9 Ga0065707_10319448 3300005295 Bacteria 969
10 Ga0065707_10583303 3300005295 Bacteria 685
11 Ga0070658_10483153 3300005327 Bacteria 1069
12 Ga0070676_10115767 3300005328 Unclassified 1676
13 Ga0070676_10123158 3300005328 Unclassified 1630
14 Ga0070676_10359237 3300005328 Unclassified 1003
15 Ga0070676_10696412 3300005328 Bacteria 741
16 Ga0070683_100170189 3300005329 Bacteria 2068
17 Ga0070683_100497961 3300005329 Bacteria 1164
18 Ga0070683_100627553 3300005329 Bacteria 1029
19 Ga0070683_100722234 3300005329 Bacteria 954
20 Ga0070690_100398767 3300005330 Bacteria 1010
21 Ga0070690_100435412 3300005330 Bacteria 969
22 Ga0070690_100598409 3300005330 Bacteria 837
23 Ga0070690_101297730 3300005330 Bacteria 583
24 Ga0070670_100014064 3300005331 Bacteria 6866
25 Ga0070670_100021276 3300005331 Bacteria 5581
26 Ga0070670_100185649 3300005331 Bacteria 1805
27 Ga0068869_100076880 3300005334 Bacteria 2482
28 Ga0068869_100636507 3300005334 Bacteria 904
29 Ga0068869_100659117 3300005334 Bacteria 889
30 Ga0068869_100844563 3300005334 Unclassified 790
31 Ga0070666_10045979 3300005335 Bacteria 2927
32 Ga0070666_10163928 3300005335 Unclassified 1554
33 Ga0070666_10364946 3300005335 Bacteria 1035
34 Ga0070666_10377732 3300005335 Bacteria 1017
35 Ga0070666_10627384 3300005335 Archaea 785
36 Ga0070680_100058133 3300005336 Bacteria 3162
37 Ga0070680_100285818 3300005336 Bacteria 1398
38 Ga0070680_100806518 3300005336 Unclassified 809
39 Ga0070682_100144394 3300005337 Unclassified 1626
40 Ga0068868_100012388 3300005338 Bacteria 6232
41 Ga0068868_100136074 3300005338 Unclassified 2014
42 Ga0068868_100477807 3300005338 Archaea 1088
43 Ga0070660_100006784 3300005339 Bacteria 7947
44 Ga0070660_100369439 3300005339 Unclassified 1183
45 Ga0070689_100073746 3300005340 Bacteria 2670
46 Ga0070689_100179496 3300005340 Unclassified 1719
47 Ga0070689_100223377 3300005340 Bacteria 1546
48 Ga0070689_100241364 3300005340 Unclassified 1488
49 Ga0070689_100275984 3300005340 Unclassified 1393
50 Ga0070689_100319565 3300005340 Bacteria 1296
51 Ga0070689_100962510 3300005340 Unclassified 758
52 Ga0070691_10076314 3300005341 Unclassified 1633
53 Ga0070691_10115901 3300005341 Unclassified 1344
54 Ga0070687_100240007 3300005343 Bacteria 1120
55 Ga0070687_100247144 3300005343 Bacteria 1106
56 Ga0070661_101241160 3300005344 Bacteria 624
57 Ga0070692_10086978 3300005345 Bacteria 1693
58 Ga0070668_100062476 3300005347 Unclassified 2885
59 Ga0070668_100195700 3300005347 Bacteria 1658
60 Ga0070668_101546186 3300005347 Bacteria 607
61 Ga0070669_100038575 3300005353 Bacteria 3468
62 Ga0070669_100093027 3300005353 Bacteria 2264
63 Ga0070669_100095232 3300005353 Unclassified 2238
64 Ga0070669_100127504 3300005353 Unclassified 1949
65 Ga0070669_100160722 3300005353 Unclassified 1745
66 Ga0070669_100858590 3300005353 Unclassified 774
67 Ga0070669_101056615 3300005353 Unclassified 698
68 Ga0070675_100054049 3300005354 Bacteria 3304
69 Ga0070671_100004195 3300005355 Bacteria 11396
70 Ga0070671_100163958 3300005355 Unclassified 1879
71 Ga0070671_101068052 3300005355 Bacteria 708
72 Ga0070674_100005466 3300005356 Bacteria 7340
73 Ga0070674_100059651 3300005356 Bacteria 2657
74 Ga0070674_100285025 3300005356 Bacteria 1311
75 Ga0070673_100042079 3300005364 Bacteria 3520
76 Ga0070673_100146314 3300005364 Unclassified 1998
77 Ga0070673_100624884 3300005364 Unclassified 984
78 Ga0070673_101869142 3300005364 Unclassified 569
79 Ga0070688_100106907 3300005365 Bacteria 1854
80 Ga0070688_100581816 3300005365 Bacteria 855
81 Ga0070659_100935297 3300005366 Unclassified 759
82 Ga0070667_100010365 3300005367 Bacteria 7696
83 Ga0070667_100051756 3300005367 Unclassified 3463
84 Ga0070667_100934878 3300005367 Unclassified 808
85 Ga0070667_101066429 3300005367 Bacteria 755
86 Ga0070709_10173656 3300005434 Unclassified 1508
87 Ga0070709_10236429 3300005434 Bacteria 1310
88 Ga0070709_11254938 3300005434 Unclassified 597
89 Ga0070709_11302775 3300005434 Unclassified 586
90 Ga0070713_100054949 3300005436 Unclassified 3307
91 Ga0070713_100260957 3300005436 Bacteria 1583
92 Ga0070713_100550727 3300005436 Unclassified 1092
93 Ga0070710_10586237 3300005437 Bacteria 774
94 Ga0070701_10148191 3300005438 Unclassified 1349
95 Ga0070701_10225133 3300005438 Unclassified 1120
96 Ga0070701_10321915 3300005438 Bacteria 957
97 Ga0070701_10384729 3300005438 Unclassified 885
98 Ga0070701_10863493 3300005438 Bacteria 622
99 Ga0070701_11042232 3300005438 Unclassified 573
100 Ga0070711_100138103 3300005439 Unclassified 1824
101 Ga0070705_100093987 3300005440 Unclassified 1876
102 Ga0070705_100508359 3300005440 Unclassified 916
103 Ga0070705_101164568 3300005440 Bacteria 634
104 Ga0070705_101261350 3300005440 Bacteria 611
105 Ga0070705_101692359 3300005440 Unclassified 534
106 Ga0070705_101792144 3300005440 Unclassified 520
107 Ga0070700_100107163 3300005441 Unclassified 1851
108 Ga0070700_100932548 3300005441 Bacteria 709
109 Ga0070694_100004344 3300005444 Bacteria 8521
110 Ga0070694_100023096 3300005444 Bacteria 3995
111 Ga0070708_100728358 3300005445 Unclassified 933
112 Ga0070708_101231611 3300005445 Unclassified 700
113 Ga0070678_100364810 3300005456 Unclassified 1245
114 Ga0070678_100688250 3300005456 Bacteria 920
115 Ga0070678_101020676 3300005456 Unclassified 761
116 Ga0070662_100092251 3300005457 Unclassified 2276
117 Ga0070662_100568652 3300005457 Bacteria 951
118 Ga0070681_10010299 3300005458 Bacteria 9227
119 Ga0070681_10014078 3300005458 Bacteria 7960
120 Ga0070681_10141561 3300005458 Bacteria 2335
121 Ga0070681_10400881 3300005458 Bacteria 1283
122 Ga0068867_100056694 3300005459 Unclassified 2899
123 Ga0068867_100100267 3300005459 Bacteria 2211
124 Ga0068867_100154088 3300005459 Archaea 1807
125 Ga0068867_100180576 3300005459 Unclassified 1678
126 Ga0068867_100226308 3300005459 Unclassified 1510
127 Ga0068867_100507101 3300005459 Bacteria 1038
128 Ga0068867_101340445 3300005459 Unclassified 662
129 Ga0068867_101922952 3300005459 Unclassified 558
130 Ga0070706_100382871 3300005467 Unclassified 1310
131 Ga0070706_100452983 3300005467 Unclassified 1194
132 Ga0070706_101810106 3300005467 Bacteria 555
133 Ga0070707_100247723 3300005468 Bacteria 1734
134 Ga0070707_100329286 3300005468 Unclassified 1484
135 Ga0070707_100347300 3300005468 Bacteria 1441
136 Ga0070707_100392796 3300005468 Bacteria 1347
137 Ga0070707_100743344 3300005468 Unclassified 944
138 Ga0070707_100968233 3300005468 Unclassified 816
139 Ga0070707_101886906 3300005468 Bacteria 565
140 Ga0070698_100060950 3300005471 Unclassified 3806
141 Ga0070698_100113779 3300005471 Unclassified 2671
142 Ga0070698_100488280 3300005471 Unclassified 1169
143 Ga0070698_100785113 3300005471 Bacteria 896
144 Ga0070698_101319210 3300005471 Unclassified 672
145 Ga0070699_100010440 3300005518 Bacteria 8037
146 Ga0070699_100303687 3300005518 Bacteria 1432
147 Ga0070699_100347735 3300005518 Bacteria 1335
148 Ga0070699_100398468 3300005518 Unclassified 1244
149 Ga0070699_100444432 3300005518 Unclassified 1175
150 Ga0070699_100560366 3300005518 Unclassified 1040
151 Ga0070699_102047879 3300005518 Unclassified 523
152 Ga0070679_100028033 3300005530 Bacteria 5549
153 Ga0070679_100122007 3300005530 Bacteria 2590
154 Ga0070679_100235511 3300005530 Bacteria 1790
155 Ga0070679_101816370 3300005530 Bacteria 558
156 Ga0070684_100060632 3300005535 Bacteria 3310
157 Ga0070697_100379311 3300005536 Unclassified 1224
158 Ga0070697_100383805 3300005536 Bacteria 1217
159 Ga0070697_100407559 3300005536 Unclassified 1180
160 Ga0070697_100526661 3300005536 Unclassified 1035
161 Ga0070697_101040936 3300005536 Bacteria 728
162 Ga0070697_101302080 3300005536 Bacteria 648
163 Ga0068853_101641942 3300005539 Unclassified 623
164 Ga0068853_101759825 3300005539 Unclassified 601
165 Ga0070672_100157677 3300005543 Bacteria 1881
166 Ga0070672_100966908 3300005543 Bacteria 754
167 Ga0070686_100006611 3300005544 Bacteria 6452
168 Ga0070686_100013585 3300005544 Bacteria 4668
169 Ga0070686_100108606 3300005544 Unclassified 1886
170 Ga0070686_101715744 3300005544 Bacteria 533
171 Ga0070695_100012788 3300005545 Bacteria 5039
172 Ga0070695_100058392 3300005545 Bacteria 2494
173 Ga0070695_100166406 3300005545 Unclassified 1552
174 Ga0070695_100172688 3300005545 Bacteria 1526
175 Ga0070696_100023933 3300005546 Unclassified 4150
176 Ga0070696_100052270 3300005546 Bacteria 2843
177 Ga0070696_100236263 3300005546 Unclassified 1377
178 Ga0070696_100397723 3300005546 Unclassified 1077
179 Ga0070696_100420420 3300005546 Bacteria 1049
180 Ga0070693_100231650 3300005547 Unclassified 1216
181 Ga0070693_100368233 3300005547 Unclassified 988
182 Ga0070693_100654577 3300005547 Bacteria 764
183 Ga0070665_100003400 3300005548 Bacteria 17010
184 Ga0070665_100029797 3300005548 Bacteria 5491
185 Ga0070665_100418540 3300005548 Bacteria 1348
186 Ga0070704_100042320 3300005549 Unclassified 3150
187 Ga0070704_100072841 3300005549 Bacteria 2500
188 Ga0070704_100630615 3300005549 Unclassified 945
189 Ga0070704_100969227 3300005549 Unclassified 768
190 Ga0070704_100978672 3300005549 Unclassified 764
191 Ga0070704_101199414 3300005549 Bacteria 692
192 Ga0070704_101357863 3300005549 Unclassified 651
193 Ga0068855_100014919 3300005563 Bacteria 9361
194 Ga0068855_100294344 3300005563 Bacteria 1799
195 Ga0068855_100888909 3300005563 Bacteria 942
196 Ga0068855_100988297 3300005563 Bacteria 885
197 Ga0068855_101623346 3300005563 Unclassified 661
198 Ga0070664_100193513 3300005564 Bacteria 1812
199 Ga0070664_101298528 3300005564 Unclassified 687
200 Ga0068857_100048486 3300005577 Bacteria 3771
201 Ga0068854_100005725 3300005578 Bacteria 7858
202 Ga0068854_100180647 3300005578 Unclassified 1648
203 Ga0068854_100197173 3300005578 Unclassified 1581
204 Ga0068854_100219807 3300005578 Bacteria 1503
205 Ga0068854_100809193 3300005578 Bacteria 817
206 Ga0068856_100711833 3300005614 Bacteria 1024
207 Ga0070702_100106947 3300005615 Unclassified 1726
208 Ga0070702_100718114 3300005615 Bacteria 764
209 Ga0070702_101007939 3300005615 Unclassified 659
210 Ga0070702_101171008 3300005615 Archaea 618
211 Ga0068852_101204655 3300005616 Bacteria 778
212 Ga0068852_101929375 3300005616 Bacteria 613
213 Ga0068859_100188547 3300005617 Bacteria 2146
214 Ga0068859_100221482 3300005617 Bacteria 1980
215 Ga0068859_100230147 3300005617 Unclassified 1941
216 Ga0068859_100415300 3300005617 Bacteria 1442
217 Ga0068859_100734346 3300005617 Unclassified 1077
218 Ga0068859_101015345 3300005617 Unclassified 911
219 Ga0068859_101965014 3300005617 Unclassified 646
220 Ga0068864_100006744 3300005618 Bacteria 9405
221 Ga0068864_100011842 3300005618 Bacteria 7204
222 Ga0068864_100239636 3300005618 Bacteria 1680
223 Ga0068864_100443214 3300005618 Bacteria 1241
224 Ga0068864_100786665 3300005618 Unclassified 934
225 Ga0068864_101005656 3300005618 Bacteria 827
226 Ga0068866_10042802 3300005718 Bacteria 2256
227 Ga0068866_10221562 3300005718 Bacteria 1142
228 Ga0068861_100007713 3300005719 Bacteria 7389
229 Ga0068861_100072208 3300005719 Unclassified 2677
230 Ga0068861_100145379 3300005719 Unclassified 1940
231 Ga0068861_100159015 3300005719 Bacteria 1862
232 Ga0068861_100184742 3300005719 Bacteria 1738
233 Ga0068861_100511014 3300005719 Bacteria 1088
234 Ga0068861_100959728 3300005719 Unclassified 814
235 Ga0068861_101008470 3300005719 Bacteria 795
236 Ga0068861_101102824 3300005719 Bacteria 763
237 Ga0068851_10728692 3300005834 Unclassified 612
238 Ga0068870_11084789 3300005840 Unclassified 575
239 Ga0068863_100017724 3300005841 Bacteria 6816
240 Ga0068863_100126316 3300005841 Unclassified 2440
241 Ga0068863_100141939 3300005841 Unclassified 2296
242 Ga0068863_100209767 3300005841 Bacteria 1876
243 Ga0068863_100236135 3300005841 Unclassified 1764
244 Ga0068863_100672399 3300005841 Bacteria 1028
245 Ga0068863_100672492 3300005841 Bacteria 1028
246 Ga0068863_101633720 3300005841 Bacteria 654
247 Ga0068858_100002279 3300005842 Bacteria 19420
248 Ga0068858_100003439 3300005842 Bacteria 15721
249 Ga0068858_100022626 3300005842 Bacteria 5862
250 Ga0068858_100025883 3300005842 Bacteria 5457
251 Ga0068858_100045471 3300005842 Bacteria 4069
252 Ga0068858_100094059 3300005842 Bacteria 2791
253 Ga0068858_100102033 3300005842 Unclassified 2676
254 Ga0068858_100134456 3300005842 Bacteria 2320
255 Ga0068858_100144733 3300005842 Bacteria 2232
256 Ga0068858_100532310 3300005842 Bacteria 1137
257 Ga0068858_102070735 3300005842 Unclassified 563
258 Ga0068860_100125490 3300005843 Unclassified 2460
259 Ga0068860_100166159 3300005843 Bacteria 2130
260 Ga0068860_100393463 3300005843 Unclassified 1370
261 Ga0068862_100069275 3300005844 Unclassified 3045
262 Ga0068862_100072471 3300005844 Bacteria 2975
263 Ga0068862_100091597 3300005844 Unclassified 2648
264 Ga0068862_100111158 3300005844 Bacteria 2405
265 Ga0068862_100808132 3300005844 Unclassified 916
266 Ga0068862_100914818 3300005844 Bacteria 863
267 Ga0068862_100977494 3300005844 Unclassified 836
268 Ga0081455_10057985 3300005937 Bacteria 3279
269 Ga0081455_10124172 3300005937 Bacteria 2029
270 Ga0070717_10009863 3300006028 Bacteria 7194
271 Ga0070717_10999146 3300006028 Unclassified 762
272 Ga0070717_11211134 3300006028 Unclassified 687
273 Ga0070717_12058992 3300006028 Unclassified 514
274 Ga0070715_10309767 3300006163 Unclassified 848
275 Ga0070715_10620796 3300006163 Bacteria 636
276 Ga0070716_100123408 3300006173 Bacteria 1625
277 Ga0070716_100158268 3300006173 Bacteria 1465
278 Ga0070716_101039599 3300006173 Unclassified 650
279 Ga0070712_100357281 3300006175 Bacteria 1197
280 Ga0070712_100728801 3300006175 Bacteria 847
281 Ga0097621_100000820 3300006237 Bacteria 21967
282 Ga0097621_100005002 3300006237 Bacteria 9295
283 Ga0097621_100009536 3300006237 Bacteria 7051
284 Ga0097621_100035429 3300006237 Bacteria 3988
285 Ga0097621_100040671 3300006237 Unclassified 3739
286 Ga0097621_100161021 3300006237 Bacteria 1929
287 Ga0097621_100216579 3300006237 Archaea 1667
288 Ga0097621_100316530 3300006237 Bacteria 1381
289 Ga0097621_101689039 3300006237 Bacteria 603
290 Ga0068871_100000748 3300006358 Bacteria 22005
291 Ga0068871_100002816 3300006358 Bacteria 11897
292 Ga0068871_100018174 3300006358 Bacteria 5338
293 Ga0068871_100088922 3300006358 Bacteria 2571
294 Ga0068871_100118351 3300006358 Archaea 2235
295 Ga0068871_100154706 3300006358 Unclassified 1957
296 Ga0068871_100270927 3300006358 Unclassified 1483
297 Ga0068871_100309726 3300006358 Bacteria 1388
298 Ga0075428_100240518 3300006844 Bacteria 1953
299 Ga0075428_100278263 3300006844 Bacteria 1800
300 Ga0075428_100411728 3300006844 Bacteria 1449
301 Ga0075428_100856617 3300006844 Bacteria 965
302 Ga0075428_100862597 3300006844 Bacteria 961
303 Ga0075428_102164687 3300006844 Unclassified 574
304 Ga0075431_100077474 3300006847 Bacteria 3432
305 Ga0075431_100833204 3300006847 Unclassified 894
306 Ga0075433_10015271 3300006852 Bacteria 6294
307 Ga0075433_10042431 3300006852 Bacteria 3946
308 Ga0075433_10071915 3300006852 Bacteria 3040
309 Ga0075433_10075099 3300006852 Bacteria 2974
310 Ga0075433_10236125 3300006852 Bacteria 1623
311 Ga0075433_10249633 3300006852 Unclassified 1574
312 Ga0075433_10414343 3300006852 Unclassified 1188
313 Ga0075433_10799686 3300006852 Unclassified 824
314 Ga0075433_10833779 3300006852 Bacteria 805
315 Ga0075433_11361885 3300006852 Bacteria 614
316 Ga0075434_100000100 3300006871 Bacteria 48123
317 Ga0075434_100004020 3300006871 Bacteria 13178
318 Ga0075434_100006986 3300006871 Archaea 10407
319 Ga0075434_100051226 3300006871 Bacteria 4102
320 Ga0075434_100112820 3300006871 Bacteria 2730
321 Ga0075434_100293748 3300006871 Bacteria 1645
322 Ga0075434_100329905 3300006871 Bacteria 1546
323 Ga0075434_100343684 3300006871 Bacteria 1513
324 Ga0075434_100423840 3300006871 Bacteria 1352
325 Ga0075434_100573130 3300006871 Bacteria 1148
326 Ga0075434_100684850 3300006871 Bacteria 1043
327 Ga0075434_101302169 3300006871 Unclassified 737
328 Ga0075434_101936419 3300006871 Unclassified 595
329 Ga0075429_100026083 3300006880 Bacteria 5072
330 Ga0075429_100474132 3300006880 Bacteria 1097
331 Ga0075429_101848373 3300006880 Unclassified 524
332 Ga0068865_100020287 3300006881 Bacteria 4310
333 Ga0068865_100037266 3300006881 Bacteria 3282
334 Ga0068865_100094204 3300006881 Bacteria 2179
335 Ga0068865_100235185 3300006881 Bacteria 1439
336 Ga0068865_100312826 3300006881 Unclassified 1261
337 Ga0068865_100459989 3300006881 Bacteria 1054
338 Ga0068865_101492256 3300006881 Unclassified 605
339 Ga0075436_100000583 3300006914 Bacteria 23900
340 Ga0075436_100018863 3300006914 Bacteria 4723
341 Ga0075436_100040832 3300006914 Bacteria 3201
342 Ga0075436_100141437 3300006914 Bacteria 1691
343 Ga0075436_100173725 3300006914 Bacteria 1521
344 Ga0097620_100188556 3300006931 Bacteria 2146
345 Ga0097620_100221473 3300006931 Bacteria 1980
346 Ga0097620_100230129 3300006931 Unclassified 1941
347 Ga0097620_100415286 3300006931 Bacteria 1442
348 Ga0097620_100734260 3300006931 Unclassified 1077
349 Ga0097620_101015273 3300006931 Unclassified 911
350 Ga0097620_101964372 3300006931 Unclassified 646
351 Ga0075435_100000192 3300007076 Bacteria 36826
352 Ga0075435_100007103 3300007076 Bacteria 7952
353 Ga0075435_100016305 3300007076 Bacteria 5600
354 Ga0075435_100025830 3300007076 Bacteria 4576
355 Ga0075435_100063427 3300007076 Bacteria 3001
356 Ga0075435_100119349 3300007076 Bacteria 2199
357 Ga0075435_100123981 3300007076 Bacteria 2158
358 Ga0075435_100155884 3300007076 Bacteria 1921
359 Ga0075435_100201230 3300007076 Bacteria 1688
360 Ga0105240_10029106 3300009093 Bacteria 7203
361 Ga0105240_10066975 3300009093 Bacteria 4453
362 Ga0105240_10495260 3300009093 Bacteria 1360
363 Ga0105240_10927187 3300009093 Unclassified 935
364 Ga0111539_10011403 3300009094 Bacteria 11157
365 Ga0111539_10015361 3300009094 Bacteria 9533
366 Ga0111539_10062811 3300009094 Unclassified 4395
367 Ga0111539_10182296 3300009094 Bacteria 2452
368 Ga0111539_10369566 3300009094 Unclassified 1669
369 Ga0111539_10507836 3300009094 Bacteria 1404
370 Ga0111539_10990817 3300009094 Bacteria 977
371 Ga0111539_11451358 3300009094 Unclassified 796
372 Ga0105245_10005304 3300009098 Bacteria 11325
373 Ga0105245_10010561 3300009098 Bacteria 8034
374 Ga0105245_10124385 3300009098 Bacteria 2412
375 Ga0105245_10232315 3300009098 Bacteria 1784
376 Ga0105245_10601176 3300009098 Unclassified 1126
377 Ga0105245_10780122 3300009098 Unclassified 993
378 Ga0105245_11055130 3300009098 Bacteria 858
379 Ga0105245_12248610 3300009098 Bacteria 599
380 Ga0105245_12334424 3300009098 Unclassified 588
381 Ga0105247_10004860 3300009101 Bacteria 8548
382 Ga0105247_10006654 3300009101 Bacteria 7134
383 Ga0105247_10034357 3300009101 Bacteria 3088
384 Ga0114129_10000434 3300009147 Bacteria 49632
385 Ga0114129_10000838 3300009147 Bacteria 39812
386 Ga0114129_10004177 3300009147 Bacteria 20401
387 Ga0114129_10015556 3300009147 Bacteria 10816
388 Ga0114129_10019544 3300009147 Bacteria 9646
389 Ga0114129_10040311 3300009147 Bacteria 6583
390 Ga0114129_10052291 3300009147 Bacteria 5733
391 Ga0114129_10061477 3300009147 Bacteria 5248
392 Ga0114129_10062016 3300009147 Bacteria 5224
393 Ga0114129_10091898 3300009147 Bacteria 4204
394 Ga0114129_10191674 3300009147 Bacteria 2775
395 Ga0114129_10252054 3300009147 Bacteria 2369
396 Ga0114129_10861628 3300009147 Bacteria 1151
397 Ga0114129_12342538 3300009147 Unclassified 640
398 Ga0114129_12424115 3300009147 Bacteria 628
399 Ga0114129_12630587 3300009147 Unclassified 600
400 Ga0105243_10033405 3300009148 Bacteria 3978
401 Ga0105243_10681586 3300009148 Unclassified 1000
402 Ga0105243_10739125 3300009148 Bacteria 963
403 Ga0105243_11496322 3300009148 Bacteria 699
404 Ga0105241_10032306 3300009174 Bacteria 3923
405 Ga0105241_10487507 3300009174 Bacteria 1097
406 Ga0105241_11084236 3300009174 Unclassified 753
407 Ga0105241_11125116 3300009174 Unclassified 740
408 Ga0105242_10001523 3300009176 Bacteria 18223
409 Ga0105242_10011154 3300009176 Bacteria 6906
410 Ga0105242_10111093 3300009176 Bacteria 2336
411 Ga0105242_10379118 3300009176 Bacteria 1314
412 Ga0105242_10387834 3300009176 Unclassified 1300
413 Ga0105242_10612737 3300009176 Unclassified 1053
414 Ga0105242_11019638 3300009176 Bacteria 837
415 Ga0105242_11080264 3300009176 Bacteria 815
416 Ga0105242_11554003 3300009176 Bacteria 694
417 Ga0105242_11929180 3300009176 Bacteria 631
418 Ga0105242_12069696 3300009176 Unclassified 613
419 Ga0105242_12241515 3300009176 Bacteria 592
420 Ga0105248_10011220 3300009177 Bacteria 9883
421 Ga0105248_10024458 3300009177 Bacteria 6715
422 Ga0105248_10034945 3300009177 Bacteria 5624
423 Ga0105248_10070797 3300009177 Bacteria 3917
424 Ga0105248_10082604 3300009177 Bacteria 3613
425 Ga0105248_10103052 3300009177 Unclassified 3216
426 Ga0105248_10125913 3300009177 Unclassified 2890
427 Ga0105248_10373424 3300009177 Unclassified 1605
428 Ga0105248_10373690 3300009177 Archaea 1605
429 Ga0105248_10773355 3300009177 Bacteria 1084
430 Ga0105248_11003177 3300009177 Bacteria 943
431 Ga0105248_11925938 3300009177 Unclassified 671
432 Ga0105248_12329100 3300009177 Unclassified 610
433 Ga0105248_12480521 3300009177 Unclassified 591
434 Ga0105248_12924663 3300009177 Bacteria 544
435 Ga0105248_13424067 3300009177 Unclassified 504
436 Ga0105237_10421814 3300009545 Unclassified 1340
437 Ga0105238_10260967 3300009551 Bacteria 1712
438 Ga0105238_10370125 3300009551 Bacteria 1423
439 Ga0105238_10881749 3300009551 Bacteria 913
440 Ga0105238_11513352 3300009551 Bacteria 700
441 Ga0105238_12915864 3300009551 Unclassified 514
442 Ga0105249_10039811 3300009553 Unclassified 4267
443 Ga0105249_10161993 3300009553 Bacteria 2162
444 Ga0105249_10311915 3300009553 Bacteria 1582
445 Ga0105249_10333963 3300009553 Bacteria 1530
446 Ga0105249_10538632 3300009553 Bacteria 1217
447 Ga0105249_10561680 3300009553 Unclassified 1193
448 Ga0105249_10748160 3300009553 Unclassified 1039
449 Ga0105249_11108411 3300009553 Bacteria 862
450 Ga0105249_12404106 3300009553 Bacteria 599
451 Ga0105239_10540500 3300010375 Bacteria 1327
452 Ga0105239_11362000 3300010375 Unclassified 819
453 Ga0105239_11903031 3300010375 Unclassified 690
454 Ga0105246_10070511 3300011119 Bacteria 2458
455 Ga0105246_10705161 3300011119 Bacteria 885
456 Ga0105246_11477501 3300011119 Unclassified 637
457 Ga0157374_10036699 3300013296 Bacteria 4492
458 Ga0157374_10208635 3300013296 Bacteria 1915
459 Ga0157374_10326843 3300013296 Unclassified 1521
460 Ga0157374_11361256 3300013296 Unclassified 732
461 Ga0157374_12609231 3300013296 Unclassified 533
462 Ga0157378_10001160 3300013297 Bacteria 23959
463 Ga0157378_10141189 3300013297 Bacteria 2237
464 Ga0157378_10636010 3300013297 Archaea 1081
465 Ga0157378_10896417 3300013297 Bacteria 917
466 Ga0157378_12948179 3300013297 Unclassified 528
467 Ga0163162_10144917 3300013306 Unclassified 2490
468 Ga0163162_10314476 3300013306 Bacteria 1699
469 Ga0163162_10901804 3300013306 Bacteria 997
470 Ga0163162_10995844 3300013306 Bacteria 947
471 Ga0157372_10659370 3300013307 Bacteria 1218
472 Ga0157375_10088757 3300013308 Bacteria 3147
473 Ga0157375_10097638 3300013308 Unclassified 3013
474 Ga0157375_10265595 3300013308 Bacteria 1878
475 Ga0157375_10567047 3300013308 Bacteria 1296
476 Ga0157375_10630466 3300013308 Unclassified 1229
477 Ga0157375_11008924 3300013308 Bacteria 972
478 Ga0157375_11707655 3300013308 Bacteria 745
479 Ga0163163_10038701 3300014325 Bacteria 4648
480 Ga0163163_10049610 3300014325 Bacteria 4131
481 Ga0163163_10108997 3300014325 Bacteria 2797
482 Ga0163163_10121049 3300014325 Bacteria 2651
483 Ga0163163_12030112 3300014325 Unclassified 635
484 Ga0157380_10079520 3300014326 Bacteria 2678
485 Ga0157380_10304614 3300014326 Unclassified 1469
486 Ga0157380_10484185 3300014326 Bacteria 1197
487 Ga0157380_11406570 3300014326 Bacteria 748
488 Ga0157377_10489469 3300014745 Unclassified 857
489 Ga0157379_10015940 3300014968 Bacteria 6606
490 Ga0157379_10088415 3300014968 Unclassified 2779
491 Ga0157379_10132422 3300014968 Unclassified 2244
492 Ga0157379_10142940 3300014968 Bacteria 2157
493 Ga0157379_10649103 3300014968 Unclassified 988
494 Ga0157376_10030995 3300014969 Bacteria 4277
495 Ga0157376_10079775 3300014969 Bacteria 2806
496 Ga0157376_10085578 3300014969 Bacteria 2716
497 Ga0157376_10091892 3300014969 Bacteria 2630
498 Ga0157376_10092097 3300014969 Unclassified 2627
499 Ga0157376_10125833 3300014969 Bacteria 2279
500 Ga0157376_10273682 3300014969 Unclassified 1587
501 Ga0157376_10306414 3300014969 Bacteria 1505
502 Ga0157376_10592927 3300014969 Bacteria 1102
503 Ga0157376_10963530 3300014969 Archaea 874
504 Ga0157376_11061441 3300014969 Bacteria 835
505 Ga0182007_10335037 3300015262 Bacteria 564
506 Ga0163161_10348502 3300017792 Archaea 1177
507 Ga0163161_10633112 3300017792 Bacteria 885
508 Ga0207697_10052914 3300025315 Bacteria 1681
509 Ga0207692_10602337 3300025898 Bacteria 706
510 Ga0207642_10026124 3300025899 Bacteria 2373
511 Ga0207642_10111777 3300025899 Bacteria 1392
512 Ga0207642_10312885 3300025899 Unclassified 914
513 Ga0207642_10383916 3300025899 Unclassified 837
514 Ga0207710_10017973 3300025900 Bacteria 3004
515 Ga0207710_10075354 3300025900 Bacteria 1555
516 Ga0207710_10525000 3300025900 Bacteria 615
517 Ga0207680_10011678 3300025903 Bacteria 4447
518 Ga0207680_10123690 3300025903 Bacteria 1695
519 Ga0207680_10160753 3300025903 Bacteria 1506
520 Ga0207680_10875921 3300025903 Bacteria 644
521 Ga0207699_10091475 3300025906 Unclassified 1911
522 Ga0207699_10242651 3300025906 Bacteria 1238
523 Ga0207699_10360033 3300025906 Bacteria 1028
524 Ga0207645_10020833 3300025907 Bacteria 4284
525 Ga0207645_10384673 3300025907 Bacteria 942
526 Ga0207645_10528983 3300025907 Bacteria 799
527 Ga0207643_10348451 3300025908 Unclassified 929
528 Ga0207705_10158596 3300025909 Bacteria 1699
529 Ga0207684_10715320 3300025910 Unclassified 850
530 Ga0207684_10730527 3300025910 Bacteria 840
531 Ga0207684_11339566 3300025910 Unclassified 588
532 Ga0207684_11356257 3300025910 Bacteria 584
533 Ga0207654_10037434 3300025911 Bacteria 2716
534 Ga0207654_10300282 3300025911 Unclassified 1092
535 Ga0207654_10693321 3300025911 Unclassified 731
536 Ga0207654_11029606 3300025911 Bacteria 599
537 Ga0207707_10006194 3300025912 Bacteria 10451
538 Ga0207707_10110485 3300025912 Bacteria 2403
539 Ga0207707_10198464 3300025912 Unclassified 1750
540 Ga0207707_10229937 3300025912 Bacteria 1614
541 Ga0207695_10605823 3300025913 Unclassified 976
542 Ga0207695_11209789 3300025913 Bacteria 636
543 Ga0207693_10343741 3300025915 Bacteria 1168
544 Ga0207693_10588544 3300025915 Bacteria 866
545 Ga0207663_10067706 3300025916 Bacteria 2291
546 Ga0207663_10071745 3300025916 Unclassified 2236
547 Ga0207663_10258189 3300025916 Unclassified 1286
548 Ga0207663_11643864 3300025916 Unclassified 517
549 Ga0207660_10147421 3300025917 Bacteria 1805
550 Ga0207660_10564312 3300025917 Bacteria 926
551 Ga0207660_10700828 3300025917 Unclassified 826
552 Ga0207662_10013435 3300025918 Bacteria 4580
553 Ga0207662_10169621 3300025918 Unclassified 1399
554 Ga0207657_10000779 3300025919 Bacteria 33835
555 Ga0207652_10126022 3300025921 Unclassified 2281
556 Ga0207652_10386118 3300025921 Bacteria 1264
557 Ga0207652_10471860 3300025921 Unclassified 1130
558 Ga0207646_10043338 3300025922 Bacteria 4042
559 Ga0207646_10154449 3300025922 Bacteria 2070
560 Ga0207646_10187640 3300025922 Bacteria 1867
561 Ga0207646_10561260 3300025922 Unclassified 1026
562 Ga0207646_10638702 3300025922 Unclassified 954
563 Ga0207646_10856339 3300025922 Unclassified 808
564 Ga0207646_11179821 3300025922 Unclassified 672
565 Ga0207646_11454957 3300025922 Unclassified 595
566 Ga0207681_10006864 3300025923 Bacteria 6983
567 Ga0207681_10043714 3300025923 Bacteria 3000
568 Ga0207681_10073061 3300025923 Unclassified 2398
569 Ga0207681_10146677 3300025923 Unclassified 1764
570 Ga0207681_10150128 3300025923 Unclassified 1745
571 Ga0207681_10679338 3300025923 Unclassified 855
572 Ga0207681_10744373 3300025923 Bacteria 817
573 Ga0207681_10883398 3300025923 Bacteria 748
574 Ga0207694_10337496 3300025924 Unclassified 1246
575 Ga0207694_10407911 3300025924 Unclassified 1130
576 Ga0207694_10599050 3300025924 Bacteria 927
577 Ga0207650_10038154 3300025925 Unclassified 3506
578 Ga0207650_10069075 3300025925 Bacteria 2654
579 Ga0207650_11191152 3300025925 Unclassified 648
580 Ga0207650_11303171 3300025925 Unclassified 618
581 Ga0207659_10717915 3300025926 Unclassified 856
582 Ga0207687_10043764 3300025927 Bacteria 3086
583 Ga0207687_10062389 3300025927 Bacteria 2635
584 Ga0207687_10072422 3300025927 Unclassified 2465
585 Ga0207687_10396406 3300025927 Unclassified 1134
586 Ga0207687_10528461 3300025927 Bacteria 987
587 Ga0207687_10635658 3300025927 Unclassified 902
588 Ga0207700_10210461 3300025928 Bacteria 1644
589 Ga0207664_10185984 3300025929 Bacteria 1786
590 Ga0207644_10029295 3300025931 Bacteria 3818
591 Ga0207690_10814548 3300025932 Unclassified 772
592 Ga0207706_10173511 3300025933 Bacteria 1894
593 Ga0207706_10593905 3300025933 Bacteria 951
594 Ga0207706_10616808 3300025933 Bacteria 931
595 Ga0207686_10010868 3300025934 Bacteria 4965
596 Ga0207686_10015491 3300025934 Bacteria 4264
597 Ga0207686_10085792 3300025934 Bacteria 2066
598 Ga0207686_10187590 3300025934 Bacteria 1471
599 Ga0207686_10376717 3300025934 Bacteria 1075
600 Ga0207686_10693843 3300025934 Bacteria 809
601 Ga0207686_10977489 3300025934 Unclassified 686
602 Ga0207709_10068291 3300025935 Unclassified 2246
603 Ga0207709_10144060 3300025935 Bacteria 1642
604 Ga0207709_11512560 3300025935 Bacteria 557
605 Ga0207670_10088621 3300025936 Unclassified 2183
606 Ga0207670_10120844 3300025936 Bacteria 1904
607 Ga0207670_10134549 3300025936 Unclassified 1816
608 Ga0207670_10168595 3300025936 Bacteria 1640
609 Ga0207670_10210137 3300025936 Unclassified 1484
610 Ga0207670_10521001 3300025936 Bacteria 968
611 Ga0207669_10052164 3300025937 Bacteria 2455
612 Ga0207669_10357591 3300025937 Unclassified 1130
613 Ga0207669_10431816 3300025937 Unclassified 1039
614 Ga0207669_11014260 3300025937 Bacteria 698
615 Ga0207704_10019536 3300025938 Bacteria 3561
616 Ga0207704_10026253 3300025938 Bacteria 3193
617 Ga0207704_10116127 3300025938 Unclassified 1820
618 Ga0207704_10228136 3300025938 Unclassified 1383
619 Ga0207704_10416772 3300025938 Bacteria 1064
620 Ga0207704_10809041 3300025938 Unclassified 783
621 Ga0207665_10436366 3300025939 Unclassified 1003
622 Ga0207691_10045534 3300025940 Bacteria 4032
623 Ga0207691_10354092 3300025940 Bacteria 1256
624 Ga0207691_10372867 3300025940 Unclassified 1219
625 Ga0207691_11022346 3300025940 Unclassified 689
626 Ga0207711_10008949 3300025941 Bacteria 8370
627 Ga0207711_10080290 3300025941 Bacteria 2849
628 Ga0207711_10153540 3300025941 Bacteria 2079
629 Ga0207711_10373103 3300025941 Bacteria 1323
630 Ga0207711_10595343 3300025941 Bacteria 1032
631 Ga0207711_10625645 3300025941 Bacteria 1004
632 Ga0207711_11144350 3300025941 Bacteria 719
633 Ga0207689_10270546 3300025942 Bacteria 1407
634 Ga0207689_10298220 3300025942 Archaea 1336
635 Ga0207689_10327773 3300025942 Bacteria 1271
636 Ga0207689_10363062 3300025942 Unclassified 1204
637 Ga0207661_10427847 3300025944 Bacteria 1203
638 Ga0207661_10716112 3300025944 Bacteria 921
639 Ga0207661_11932448 3300025944 Bacteria 536
640 Ga0207679_10637855 3300025945 Unclassified 963
641 Ga0207679_11674956 3300025945 Unclassified 582
642 Ga0207667_10067017 3300025949 Bacteria 3740
643 Ga0207667_11233625 3300025949 Bacteria 726
644 Ga0207667_11770240 3300025949 Unclassified 583
645 Ga0207651_10027217 3300025960 Bacteria 3588
646 Ga0207651_10660653 3300025960 Unclassified 918
647 Ga0207651_11538515 3300025960 Unclassified 599
648 Ga0207712_10061732 3300025961 Bacteria 2661
649 Ga0207712_10131352 3300025961 Bacteria 1909
650 Ga0207712_10171490 3300025961 Bacteria 1696
651 Ga0207712_10353745 3300025961 Unclassified 1222
652 Ga0207712_10374165 3300025961 Bacteria 1190
653 Ga0207712_10420628 3300025961 Unclassified 1127
654 Ga0207668_10203238 3300025972 Bacteria 1579
655 Ga0207668_10258593 3300025972 Unclassified 1417
656 Ga0207668_11006235 3300025972 Unclassified 745
657 Ga0207640_10008160 3300025981 Bacteria 5800
658 Ga0207640_10162521 3300025981 Archaea 1654
659 Ga0207640_10205546 3300025981 Bacteria 1496
660 Ga0207640_10242832 3300025981 Bacteria 1393
661 Ga0207640_10273067 3300025981 Bacteria 1324
662 Ga0207640_10736401 3300025981 Unclassified 849
663 Ga0207640_11058162 3300025981 Bacteria 716
664 Ga0207658_10032776 3300025986 Bacteria 3701
665 Ga0207658_10226416 3300025986 Unclassified 1576
666 Ga0207658_10467504 3300025986 Unclassified 1119
667 Ga0207677_10014296 3300026023 Unclassified 4631
668 Ga0207677_10111962 3300026023 Unclassified 2034
669 Ga0207677_10218920 3300026023 Unclassified 1526
670 Ga0207677_10303698 3300026023 Unclassified 1319
671 Ga0207677_11414909 3300026023 Unclassified 641
672 Ga0207703_10002624 3300026035 Bacteria 15514
673 Ga0207703_10009543 3300026035 Bacteria 7616
674 Ga0207703_10012767 3300026035 Bacteria 6549
675 Ga0207703_10017991 3300026035 Bacteria 5519
676 Ga0207703_10094838 3300026035 Bacteria 2516
677 Ga0207703_10145654 3300026035 Bacteria 2060
678 Ga0207703_10182392 3300026035 Bacteria 1853
679 Ga0207703_10294448 3300026035 Bacteria 1478
680 Ga0207703_10436146 3300026035 Bacteria 1221
681 Ga0207703_10468546 3300026035 Unclassified 1179
682 Ga0207703_10916667 3300026035 Bacteria 839
683 Ga0207639_10981557 3300026041 Unclassified 791
684 Ga0207678_10322100 3300026067 Bacteria 1330
685 Ga0207678_10561462 3300026067 Bacteria 999
686 Ga0207708_10011994 3300026075 Bacteria 6457
687 Ga0207708_10069702 3300026075 Unclassified 2692
688 Ga0207708_11944470 3300026075 Unclassified 515
689 Ga0207702_10221233 3300026078 Bacteria 1764
690 Ga0207641_10000431 3300026088 Bacteria 48383
691 Ga0207641_10061731 3300026088 Bacteria 3197
692 Ga0207641_10119650 3300026088 Unclassified 2348
693 Ga0207641_10478989 3300026088 Unclassified 1206
694 Ga0207641_10558391 3300026088 Bacteria 1117
695 Ga0207641_10614722 3300026088 Bacteria 1065
696 Ga0207641_11127048 3300026088 Unclassified 783
697 Ga0207648_10039267 3300026089 Bacteria 4163
698 Ga0207648_10039354 3300026089 Bacteria 4158
699 Ga0207648_10090480 3300026089 Bacteria 2674
700 Ga0207648_10145411 3300026089 Bacteria 2091
701 Ga0207648_10171174 3300026089 Bacteria 1920
702 Ga0207648_10373104 3300026089 Bacteria 1289
703 Ga0207648_10375418 3300026089 Unclassified 1285
704 Ga0207648_10533835 3300026089 Unclassified 1076
705 Ga0207676_10010449 3300026095 Bacteria 6611
706 Ga0207676_10046046 3300026095 Bacteria 3373
707 Ga0207676_10459544 3300026095 Bacteria 1202
708 Ga0207676_10769504 3300026095 Unclassified 937
709 Ga0207676_11050227 3300026095 Bacteria 804
710 Ga0207676_11276912 3300026095 Bacteria 729
711 Ga0207674_10075381 3300026116 Bacteria 3383
712 Ga0207674_10549242 3300026116 Unclassified 1116
713 Ga0207675_100000451 3300026118 Bacteria 39879
714 Ga0207675_100023793 3300026118 Bacteria 5700
715 Ga0207675_100091896 3300026118 Bacteria 2854
716 Ga0207675_100097464 3300026118 Bacteria 2769
717 Ga0207675_100109946 3300026118 Bacteria 2601
718 Ga0207675_100369060 3300026118 Bacteria 1409
719 Ga0207675_100382164 3300026118 Archaea 1385
720 Ga0207675_100630923 3300026118 Bacteria 1077
721 Ga0207675_100685086 3300026118 Bacteria 1033
722 Ga0207683_10345997 3300026121 Unclassified 1364
723 Ga0207683_10486360 3300026121 Bacteria 1139
724 Ga0207683_10769344 3300026121 Unclassified 893
725 Ga0207683_10788125 3300026121 Bacteria 882
726 Ga0207698_10761856 3300026142 Unclassified 968
727 Ga0207698_10869643 3300026142 Bacteria 907
728 Ga0207428_10027043 3300027907 Bacteria 4778
729 Ga0207428_10028926 3300027907 Unclassified 4599
730 Ga0268266_10017418 3300028379 Bacteria 6127
731 Ga0268266_10134496 3300028379 Bacteria 2213
732 Ga0268266_10220479 3300028379 Bacteria 1743
733 Ga0268265_10006219 3300028380 Bacteria 8091
734 Ga0268265_10072450 3300028380 Unclassified 2687
735 Ga0268265_10116068 3300028380 Bacteria 2196
736 Ga0268265_10329188 3300028380 Unclassified 1387
737 Ga0268265_10360436 3300028380 Bacteria 1331
738 Ga0268265_10729509 3300028380 Unclassified 960
739 Ga0268264_10010017 3300028381 Bacteria 7848
740 Ga0268264_10052316 3300028381 Bacteria 3405
741 Ga0268264_10196853 3300028381 Unclassified 1841
742 Ga0268264_10343458 3300028381 Unclassified 1419
743 Ga0268264_10473224 3300028381 Bacteria 1217
744 Ga0268264_10878800 3300028381 Unclassified 899
745 Ga0268264_12107419 3300028381 Unclassified 572
746 Ga0265336_10036910 3300028666 Bacteria 1504
747 Ga0307511_10176907 3300030521 Unclassified 1159
748 Ga0265332_10066482 3300031238 Unclassified 1538
749 Ga0307408_100271106 3300031548 Unclassified 1409
750 Ga0265314_10182069 3300031711 Bacteria 1258
751 Ga0307416_100159382 3300032002 Unclassified 2083
752 Ga0307416_101510812 3300032002 Bacteria 777
753 Ga0307416_102227940 3300032002 Unclassified 649
754 Ga0373930_0001025 3300034816 Bacteria 4023
755 Ga0373948_0000373 3300034817 Bacteria 5512
756 Ga0373950_0000439 3300034818 Bacteria 5085
757 Ga0373958_0000173 3300034819 Bacteria 7331
758 Ga0373959_0001608 3300034820 Bacteria 3596
759 Ga0373959_0071576 3300034820 Unclassified 785
760 Ga0373959_0144825 3300034820 Unclassified 597
761 Ga0373926_0329028 3300035083 Unclassified 598
762 Ga0373926_0441988 3300035083 Bacteria 516
763 Ga0373928_0007057 3300035084 Unclassified 2165
764 Ga0373929_0042093 3300035085 Bacteria 1018
765 Ga0373934_0120797 3300035086 Unclassified 1066
766 Ga0373934_0221941 3300035086 Bacteria 780
767 Ga0373949_0008821 3300035090 Bacteria 2205
768 Ga0373949_0071268 3300035090 Bacteria 911
769 Ga0373951_0001298 3300035091 Bacteria 6595
770 Ga0373952_0000050 3300035092 Bacteria 14460
771 Ga0373932_0000603 3300035112 Bacteria 10893
772 Ga0373936_0169584 3300035113 Bacteria 954
773 Ga0373939_0000156 3300035114 Bacteria 19023
774 Ga0373939_0292021 3300035114 Bacteria 647
775 Ga0373941_0000433 3300035115 Bacteria 8301
776 Ga0373941_0164279 3300035115 Bacteria 823
777 Ga0373945_0025007 3300035116 Unclassified 2072
778 Ga0373945_0220194 3300035116 Bacteria 794
779 Ga0373953_0286486 3300035117 Unclassified 718
780 Ga0373954_0661335 3300035118 Unclassified 518
781 Ga0373956_0342241 3300035119 Unclassified 713
782 Ga0373956_0350852 3300035119 Unclassified 703
783 Ga0373960_0000998 3300035121 Bacteria 6078
784 Ga0373943_0035898 3300035170 Bacteria 2372
785 Ga0373943_0129533 3300035170 Bacteria 1349
786 Ga0373946_0004665 3300035171 Bacteria 4920
787 Ga0373946_0583527 3300035171 Bacteria 579
788 Ga0373955_0004533 3300035172 Bacteria 6156
789 Ga0373955_0072855 3300035172 Bacteria 1925
790 Ga0373955_0478032 3300035172 Unclassified 760
791 Ga0373955_0588153 3300035172 Unclassified 681
792 Ga0373955_0620118 3300035172 Unclassified 663
793 Ga0373942_0002127 3300035207 Bacteria 4905
794 Ga0373961_0002123 3300035241 Bacteria 5259
795 Ga0373961_0121940 3300035241 Bacteria 865
796 Ga0373961_0124021 3300035241 Bacteria 859
797 Ga0373962_0000316 3300035242 Bacteria 10486
798 Ga0373962_0115701 3300035242 Bacteria 850
799 Ga0373924_0289929 3300035410 Unclassified 726
800 Ga0373931_0000411 3300035691 Bacteria 17541
801 Ga0373931_0254505 3300035691 Bacteria 1069
802 Ga0373931_1021763 3300035691 Bacteria 560
803 Ga0373931_1301281 3300035691 Bacteria 500
804 Ga0373935_0306490 3300035692 Unclassified 1124
805 Ga0373927_0875987 3300035695 Unclassified 593
806 Ga0373933_0108709 3300035724 Bacteria 1728
807 Ga0373933_0177633 3300035724 Bacteria 1357
808 Ga0373933_0718955 3300035724 Unclassified 657
809 Ga0373947_0011952 3300035725 Bacteria 4974
810 Ga0373937_0102381 3300036401 Bacteria 2659
811 Ga0373937_0289905 3300036401 Unclassified 1546
812 Ga0373937_0338632 3300036401 Unclassified 1424
813 Ga0373937_0465146 3300036401 Unclassified 1201
814 Ga0373937_0552941 3300036401 Bacteria 1093
815 Ga0373937_0697287 3300036401 Bacteria 962
816 Ga0373937_0740509 3300036401 Unclassified 930
817 Ga0373937_0999142 3300036401 Unclassified 785
818 Ga0373937_1125816 3300036401 Unclassified 734
819 Ga0373937_1169834 3300036401 Unclassified 718
820 Ga0373937_1209411 3300036401 Bacteria 704
821 Ga0373925_0000987 3300037068 Bacteria 25925
822 Ga0373925_0057437 3300037068 Bacteria 2916
823 Ga0373925_0157527 3300037068 Unclassified 1787
824 Ga0373925_0267622 3300037068 Bacteria 1374
825 Ga0395901_0743187 3300038443 Bacteria 975
826 Ga0436365_0084194 3300039437 Unclassified 1438
827 Ga0436365_0238160 3300039437 Bacteria 1143
828 Ga0451853_2674977 3300041512 Unclassified 1085
829 Ga0451577_0051538 3300042876 Bacteria 3674
830 Ga0451577_0379089 3300042876 Unclassified 1283
831 Ga0453684_0017739 3300044712 Bacteria 10993
832 Ga0453684_0857849 3300044712 Unclassified 975
833 Ga0451576_0007440 3300045051 Bacteria 13087
834 Ga0451576_0162502 3300045051 Bacteria 2331
835 Ga0451576_0343295 3300045051 Bacteria 1563
836 Ga0451576_0607892 3300045051 Bacteria 1149
837 Ga0451576_0721975 3300045051 Bacteria 1047
838 Ga0466967_1574666 3300045976 Bacteria 654
839 Ga0495592_0012201 3300046454 Bacteria 6521
840 Ga0495641_0226491 3300046461 Unclassified 839
841 Ga0495651_0073293 3300046462 Archaea 2600
842 Ga0495653_0730978 3300046463 Unclassified 599
843 Ga0495580_0189503 3300046472 Unclassified 1419
844 Ga0495582_0083522 3300046473 Bacteria 1775
845 Ga0495582_0900727 3300046473 Unclassified 511
846 Ga0495639_0274548 3300046475 Unclassified 837
847 Ga0495664_0249261 3300046477 Unclassified 1074
848 Ga0495664_0656574 3300046477 Unclassified 621
849 Ga0495608_0005369 3300046511 Bacteria 9155
850 Ga0495618_0094139 3300046514 Unclassified 1916
851 Ga0495618_0137210 3300046514 Unclassified 1565
852 Ga0495628_0059757 3300046516 Unclassified 2992
853 Ga0495628_0065349 3300046516 Bacteria 2846
854 Ga0495628_0073643 3300046516 Bacteria 2661
855 Ga0495628_0175127 3300046516 Unclassified 1625
856 Ga0495628_0449592 3300046516 Unclassified 936
857 Ga0495630_0185860 3300046517 Bacteria 1585
858 Ga0495630_0745802 3300046517 Unclassified 748
859 Ga0495652_0043146 3300046529 Bacteria 3887
860 Ga0495640_0275408 3300046533 Unclassified 1049
861 Ga0495640_0327921 3300046533 Bacteria 947
862 Ga0495640_0690988 3300046533 Unclassified 612
863 Ga0495586_0063016 3300046535 Unclassified 2019
864 Ga0495587_0247319 3300046536 Unclassified 1003
865 Ga0495621_0089921 3300046539 Unclassified 1156
866 Ga0495645_0011724 3300046543 Bacteria 6173
867 Ga0495645_0282263 3300046543 Unclassified 1091
868 Ga0495645_0500379 3300046543 Unclassified 760
869 Ga0495634_0199656 3300046642 Bacteria 1243
870 Ga0495634_0251840 3300046642 Bacteria 1080
871 Ga0495635_0099387 3300046663 Bacteria 1989
872 Ga0495635_0611694 3300046663 Unclassified 711
873 Ga0495659_0199978 3300046664 Bacteria 819
874 Ga0495659_0238645 3300046664 Unclassified 755
875 Ga0495657_0133806 3300046675 Unclassified 1551
876 Ga0495599_0136744 3300046678 Unclassified 1521
877 Ga0495599_0205621 3300046678 Bacteria 1209
878 Ga0495623_0136538 3300046679 Bacteria 1463
879 Ga0495623_0630804 3300046679 Unclassified 554
880 Ga0495647_0059355 3300046681 Unclassified 1506
881 Ga0495647_0167242 3300046681 Unclassified 951
882 Ga0495647_0294229 3300046681 Unclassified 731
883 Ga0495658_0008380 3300046683 Bacteria 5121
884 Ga0495658_0059892 3300046683 Bacteria 2182
885 Ga0495658_0082336 3300046683 Bacteria 1891
886 Ga0495658_0182438 3300046683 Unclassified 1303
887 Ga0495658_0260413 3300046683 Bacteria 1092
888 Ga0495658_0591440 3300046683 Bacteria 711
889 Ga0495669_0099799 3300046684 Bacteria 1348
890 Ga0495613_0003872 3300046689 Bacteria 11197
891 Ga0495613_0407509 3300046689 Bacteria 927
892 Ga0495600_0173676 3300046809 Bacteria 1390
893 Ga0495581_0649665 3300047315 Bacteria 610
894 Ga0495604_0857854 3300047317 Unclassified 569
895 Ga0495674_0051920 3300047319 Unclassified 3612
896 Ga0495674_0088764 3300047319 Bacteria 2644
897 Ga0495676_0523271 3300047321 Bacteria 777
898 Ga0495680_0284169 3300047322 Unclassified 1165
899 Ga0495684_0000048 3300047471 Bacteria 89243
900 Ga0495684_0118638 3300047471 Unclassified 1994
901 Ga0495602_0042503 3300048088 Unclassified 4141
902 Ga0495602_0381360 3300048088 Bacteria 1010
903 Ga0496100_0006242 3300048903 Bacteria 6488
904 Ga0496101_0000568 3300048904 Bacteria 22606
905 Ga0496102_0028151 3300048905 Bacteria 5021
906 Ga0496102_0272778 3300048905 Bacteria 1595
907 Ga0496102_0398631 3300048905 Unclassified 1294
908 Ga0496102_0431283 3300048905 Bacteria 1238
909 Ga0496102_0454865 3300048905 Bacteria 1201
910 Ga0496102_0500096 3300048905 Bacteria 1138
911 Ga0496102_0931147 3300048905 Bacteria 790
912 Ga0496104_0007988 3300048907 Bacteria 9381
913 Ga0496104_0011911 3300048907 Bacteria 7801
914 Ga0496104_0106270 3300048907 Unclassified 2690
915 Ga0496105_0020589 3300048908 Bacteria 5332
916 Ga0496105_0221111 3300048908 Bacteria 1542
917 Ga0496105_0756948 3300048908 Bacteria 741
918 Ga0496106_0109049 3300048909 Bacteria 2154
919 Ga0496106_0205250 3300048909 Unclassified 1569
920 Ga0496107_0153272 3300048910 Unclassified 1705
921 Ga0496107_0479762 3300048910 Bacteria 923
922 Ga0496107_0531596 3300048910 Bacteria 871
923 Ga0496108_0016941 3300048911 Bacteria 5956
924 Ga0496108_0262892 3300048911 Bacteria 1502
925 Ga0496108_0326148 3300048911 Bacteria 1339
926 Ga0496109_0040181 3300048912 Bacteria 4236
927 Ga0496109_0175026 3300048912 Bacteria 2014
928 Ga0496109_0266525 3300048912 Unclassified 1614
929 Ga0496109_1026918 3300048912 Bacteria 762
930 Ga0496110_0035448 3300048913 Bacteria 4328
931 Ga0496110_1501628 3300048913 Unclassified 584
932 Ga0496111_0237034 3300048914 Unclassified 1355
933 Ga0496111_0737796 3300048914 Unclassified 715
934 Ga0496112_0019763 3300048915 Bacteria 6368
935 Ga0496112_0075966 3300048915 Bacteria 3323
936 Ga0496112_0107372 3300048915 Bacteria 2761
937 Ga0496112_0196445 3300048915 Unclassified 1978
938 Ga0496112_0262404 3300048915 Bacteria 1677
939 Ga0496112_0281626 3300048915 Bacteria 1610
940 Ga0496112_0442508 3300048915 Bacteria 1238
941 Ga0496112_0523581 3300048915 Bacteria 1120
942 Ga0496112_1079419 3300048915 Unclassified 721
943 Ga0496113_0021085 3300048916 Bacteria 4593
944 Ga0496113_0080583 3300048916 Bacteria 2494
945 Ga0496113_0781848 3300048916 Bacteria 759
946 Ga0496113_1050705 3300048916 Bacteria 640
947 Ga0496113_1509650 3300048916 Bacteria 518
948 Ga0496114_0048279 3300048917 Bacteria 3541
949 Ga0496114_0159689 3300048917 Unclassified 1959
950 Ga0496114_0161096 3300048917 Unclassified 1951
951 Ga0496114_0204813 3300048917 Unclassified 1729
952 Ga0496114_0327955 3300048917 Bacteria 1353
953 Ga0496115_0328621 3300048918 Bacteria 1250
954 Ga0496115_0407622 3300048918 Unclassified 1102
955 Ga0501033_1018427 3300049570 Unclassified 553
956 Ga0501036_0054613 3300049572 Bacteria 3384
957 Ga0501038_0245814 3300049574 Unclassified 1419
958 Ga0501038_0322724 3300049574 Bacteria 1208
959 Ga0501040_0483316 3300049576 Bacteria 892
960 Ga0501040_1410210 3300049576 Unclassified 506
961 Ga0501042_0215160 3300049578 Bacteria 1386
962 Ga0501043_0580818 3300049579 Bacteria 830
963 Ga0501047_0939033 3300049581 Unclassified 678
964 Ga0501067_0289629 3300049583 Bacteria 912
965 Ga0501067_0481334 3300049583 Unclassified 694
966 Ga0501069_0307261 3300049585 Bacteria 931
967 Ga0501070_0455063 3300049586 Bacteria 1032
968 Ga0501071_0312005 3300049587 Bacteria 1193
969 Ga0501072_0270399 3300049588 Unclassified 1352
970 Ga0501074_0235859 3300049590 Bacteria 1302
971 Ga0501075_0012334 3300049591 Bacteria 6073
972 Ga0501075_0230492 3300049591 Bacteria 1412
973 Ga0501075_0509874 3300049591 Bacteria 918
974 Ga0501076_0300744 3300049592 Bacteria 1315
975 Ga0501083_0021015 3300049744 Bacteria 4537
976 Ga0501045_0206848 3300049824 Bacteria 1462
977 nmdc:mga05p37_1041614_c1 3300050507 Bacteria 864
978 nmdc:mga05p37_11139_c1 3300050507 Bacteria 10685
979 nmdc:mga05p37_114290_c1 3300050507 Bacteria 3318
980 nmdc:mga05p37_133487_c1 3300050507 Bacteria 3045
981 nmdc:mga05p37_162938_c1 3300050507 Bacteria 2723
982 nmdc:mga05p37_21081_c1 3300050507 Bacteria 7888
983 nmdc:mga05p37_21329_c1 3300050507 Bacteria 7843
984 nmdc:mga05p37_21681_c1 3300050507 Bacteria 7782
985 nmdc:mga05p37_26367_c1 3300050507 Bacteria 7068
986 nmdc:mga05p37_27602_c1 3300050507 Bacteria 6913
987 nmdc:mga05p37_586457_c1 3300050507 Unclassified 1261
988 nmdc:mga05p37_602696_c1 3300050507 Bacteria 1239
989 nmdc:mga05p37_901647_c1 3300050507 Unclassified 953
990 nmdc:mga09592_1612446_c1 3300050508 Bacteria 525
991 nmdc:mga09592_23225_c1 3300050508 Bacteria 5121
992 nmdc:mga06r32_166679_c1 3300050510 Bacteria 2186
993 nmdc:mga06r32_434910_c1 3300050510 Bacteria 1293
994 nmdc:mga08y16_14872_c1 3300050511 Bacteria 8183
995 nmdc:mga08y16_25097_c1 3300050511 Bacteria 6287
996 nmdc:mga08y16_411517_c1 3300050511 Bacteria 1383
997 nmdc:mga08y16_4545_c1 3300050511 Bacteria 14463
998 nmdc:mga08y16_49080_c1 3300050511 Unclassified 4417
999 nmdc:mga08y16_707011_c1 3300050511 Bacteria 1007
1000 nmdc:mga08y16_846761_c1 3300050511 Bacteria 904
1001 nmdc:mga0n895_111_c1 3300050512 Bacteria 48235
1002 nmdc:mga0n895_1544322_c1 3300050512 Unclassified 629
1003 nmdc:mga0n895_165469_c1 3300050512 Bacteria 2243
1004 nmdc:mga0n895_178403_c1 3300050512 Unclassified 2155
1005 nmdc:mga0n895_194660_c1 3300050512 Unclassified 2059
1006 nmdc:mga0n895_198225_c1 3300050512 Bacteria 2039
1007 nmdc:mga0n895_24015_c1 3300050512 Bacteria 5739
1008 nmdc:mga0n895_331102_c1 3300050512 Bacteria 1543
1009 nmdc:mga0n895_398495_c1 3300050512 Bacteria 1392
1010 nmdc:mga0n895_5089_c1 3300050512 Bacteria 10920
1011 nmdc:mga0n895_5595_c1 3300050512 Archaea 10520
1012 nmdc:mga0n895_568151_c1 3300050512 Bacteria 1139
1013 nmdc:mga0n895_891361_c1 3300050512 Bacteria 875
1014 nmdc:mga0rr50_15819_c1 3300050513 Bacteria 4990
1015 nmdc:mga0rr50_237654_c1 3300050513 Bacteria 1509
1016 nmdc:mga0rr50_28606_c1 3300050513 Bacteria 3920
1017 nmdc:mga0rr50_320502_c1 3300050513 Bacteria 1299
1018 nmdc:mga0rr50_39119_c1 3300050513 Bacteria 3438
1019 nmdc:mga0rr50_57_c1 3300050513 Bacteria 67718
1020 nmdc:mga0rr50_61256_c1 3300050513 Bacteria 2834
1021 nmdc:mga0rr50_636089_c1 3300050513 Bacteria 910
1022 nmdc:mga0rr50_757019_c1 3300050513 Bacteria 829
1023 nmdc:mga0rr50_8523_c1 3300050513 Bacteria 6386
1024 nmdc:mga08x19_159863_c1 3300050514 Bacteria 1530
1025 nmdc:mga08x19_28391_c1 3300050514 Bacteria 3504
1026 nmdc:mga08x19_426_c1 3300050514 Bacteria 28960
1027 nmdc:mga08x19_48296_c1 3300050514 Bacteria 2726
1028 nmdc:mga08x19_56202_c1 3300050514 Bacteria 2540
1029 nmdc:mga08x19_619912_c1 3300050514 Bacteria 767
1030 nmdc:mga08x19_706426_c1 3300050514 Unclassified 716
1031 nmdc:mga08x19_751684_c1 3300050514 Bacteria 692
1032 nmdc:mga08x19_89635_c1 3300050514 Bacteria 2029
1033 nmdc:mga08x19_9426_c1 3300050514 Bacteria 5847
1034 nmdc:mga0a205_198681_c1 3300050515 Bacteria 1896
1035 nmdc:mga0a205_204751_c1 3300050515 Unclassified 1863
1036 nmdc:mga0a205_45262_c1 3300050515 Bacteria 4243
1037 nmdc:mga0a205_56158_c1 3300050515 Bacteria 1632
1038 nmdc:mga0a205_72168_c1 3300050515 Bacteria 3335
1039 nmdc:mga0a205_747481_c1 3300050515 Bacteria 827
1040 nmdc:mga0a205_753681_c1 3300050515 Bacteria 822
1041 nmdc:mga0a205_790368_c1 3300050515 Unclassified 797
1042 nmdc:mga0a205_822545_c1 3300050515 Bacteria 776
1043 nmdc:mga0a205_93806_c1 3300050515 Bacteria 2900
1044 nmdc:mga0a205_94532_c1 3300050515 Bacteria 2888
1045 Ga0495601_0075643 3300053077 Bacteria 2155
1046 Ga0495601_0251258 3300053077 Bacteria 1155
1047 Ga0495601_0277871 3300053077 Unclassified 1092
1048 Ga0495601_0544148 3300053077 Unclassified 747
1049 Ga0495595_0043907 3300053084 Unclassified 2052
1050 Ga0495595_0233737 3300053084 Bacteria 919
1051 Ga0495619_0001542 3300053085 Bacteria 15176
1052 Ga0495619_0048944 3300053085 Unclassified 2786
1053 Ga0495619_0096024 3300053085 Unclassified 2012
1054 Ga0495619_0121354 3300053085 Unclassified 1792
1055 Ga0495619_0161604 3300053085 Unclassified 1547
1056 Ga0495619_0271887 3300053085 Unclassified 1174
1057 Ga0495619_0320123 3300053085 Unclassified 1074
1058 Ga0500658_0549302 3300053134 Unclassified 520
1059 Ga0501084_0112280 3300054114 Bacteria 2290
1060 Ga0501082_1230046 3300060353 Unclassified 654
1061 Ga0530510_0970841 3300061734 Unclassified 650
1062 Ga0373943_0306507
1063 JGI24751J29686_10012579
1064 JGI24751J29686_10044217
1065 Ga0065712_10148007
1066 Ga0065715_10384793
1067 Ga0065707_10157319
1068 Ga0065707_10191325
1069 Ga0065707_10205317
1070 Ga0065707_10319448
1071 Ga0065707_10583303
1072 Ga0070658_10483153
1073 Ga0070676_10115767
1074 Ga0070676_10123158
1075 Ga0070676_10359237
1076 Ga0070676_10696412
1077 Ga0070683_100170189
1078 Ga0070683_100497961
1079 Ga0070683_100627553
1080 Ga0070683_100722234
1081 Ga0070690_100398767
1082 Ga0070690_100435412
1083 Ga0070690_100598409
1084 Ga0070690_101297730
1085 Ga0070670_100014064
1086 Ga0070670_100021276
1087 Ga0070670_100185649
1088 Ga0068869_100076880
1089 Ga0068869_100636507
1090 Ga0068869_100659117
1091 Ga0068869_100844563
1092 Ga0070666_10045979
1093 Ga0070666_10163928
1094 Ga0070666_10364946
1095 Ga0070666_10377732
1096 Ga0070666_10627384
1097 Ga0070680_100058133
1098 Ga0070680_100285818
1099 Ga0070680_100806518
1100 Ga0070682_100144394
1101 Ga0068868_100012388
1102 Ga0068868_100136074
1103 Ga0068868_100477807
1104 Ga0070660_100006784
1105 Ga0070660_100369439
1106 Ga0070689_100073746
1107 Ga0070689_100179496
1108 Ga0070689_100223377
1109 Ga0070689_100241364
1110 Ga0070689_100275984
1111 Ga0070689_100319565
1112 Ga0070689_100962510
1113 Ga0070691_10076314
1114 Ga0070691_10115901
1115 Ga0070687_100240007
1116 Ga0070687_100247144
1117 Ga0070661_101241160
1118 Ga0070692_10086978
1119 Ga0070668_100062476
1120 Ga0070668_100195700
1121 Ga0070668_101546186
1122 Ga0070669_100038575
1123 Ga0070669_100093027
1124 Ga0070669_100095232
1125 Ga0070669_100127504
1126 Ga0070669_100160722
1127 Ga0070669_100858590
1128 Ga0070669_101056615
1129 Ga0070675_100054049
1130 Ga0070671_100004195
1131 Ga0070671_100163958
1132 Ga0070671_101068052
1133 Ga0070674_100005466
1134 Ga0070674_100059651
1135 Ga0070674_100285025
1136 Ga0070673_100042079
1137 Ga0070673_100146314
1138 Ga0070673_100624884
1139 Ga0070673_101869142
1140 Ga0070688_100106907
1141 Ga0070688_100581816
1142 Ga0070659_100935297
1143 Ga0070667_100010365
1144 Ga0070667_100051756
1145 Ga0070667_100934878
1146 Ga0070667_101066429
1147 Ga0070709_10173656
1148 Ga0070709_10236429
1149 Ga0070709_11254938
1150 Ga0070709_11302775
1151 Ga0070713_100054949
1152 Ga0070713_100260957
1153 Ga0070713_100550727
1154 Ga0070710_10586237
1155 Ga0070701_10148191
1156 Ga0070701_10225133
1157 Ga0070701_10321915
1158 Ga0070701_10384729
1159 Ga0070701_10863493
1160 Ga0070701_11042232
1161 Ga0070711_100138103
1162 Ga0070705_100093987
1163 Ga0070705_100508359
1164 Ga0070705_101164568
1165 Ga0070705_101261350
1166 Ga0070705_101692359
1167 Ga0070705_101792144
1168 Ga0070700_100107163
1169 Ga0070700_100932548
1170 Ga0070694_100004344
1171 Ga0070694_100023096
1172 Ga0070708_100728358
1173 Ga0070708_101231611
1174 Ga0070678_100364810
1175 Ga0070678_100688250
1176 Ga0070678_101020676
1177 Ga0070662_100092251
1178 Ga0070662_100568652
1179 Ga0070681_10010299
1180 Ga0070681_10014078
1181 Ga0070681_10141561
1182 Ga0070681_10400881
1183 Ga0068867_100056694
1184 Ga0068867_100100267
1185 Ga0068867_100154088
1186 Ga0068867_100180576
1187 Ga0068867_100226308
1188 Ga0068867_100507101
1189 Ga0068867_101340445
1190 Ga0068867_101922952
1191 Ga0070706_100382871
1192 Ga0070706_100452983
1193 Ga0070706_101810106
1194 Ga0070707_100247723
1195 Ga0070707_100329286
1196 Ga0070707_100347300
1197 Ga0070707_100392796
1198 Ga0070707_100743344
1199 Ga0070707_100968233
1200 Ga0070707_101886906
1201 Ga0070698_100060950
1202 Ga0070698_100113779
1203 Ga0070698_100488280
1204 Ga0070698_100785113
1205 Ga0070698_101319210
1206 Ga0070699_100010440
1207 Ga0070699_100303687
1208 Ga0070699_100347735
1209 Ga0070699_100398468
1210 Ga0070699_100444432
1211 Ga0070699_100560366
1212 Ga0070699_102047879
1213 Ga0070679_100028033
1214 Ga0070679_100122007
1215 Ga0070679_100235511
1216 Ga0070679_101816370
1217 Ga0070684_100060632
1218 Ga0070697_100379311
1219 Ga0070697_100383805
1220 Ga0070697_100407559
1221 Ga0070697_100526661
1222 Ga0070697_101040936
1223 Ga0070697_101302080
1224 Ga0068853_101641942
1225 Ga0068853_101759825
1226 Ga0070672_100157677
1227 Ga0070672_100966908
1228 Ga0070686_100006611
1229 Ga0070686_100013585
1230 Ga0070686_100108606
1231 Ga0070686_101715744
1232 Ga0070695_100012788
1233 Ga0070695_100058392
1234 Ga0070695_100166406
1235 Ga0070695_100172688
1236 Ga0070696_100023933
1237 Ga0070696_100052270
1238 Ga0070696_100236263
1239 Ga0070696_100397723
1240 Ga0070696_100420420
1241 Ga0070693_100231650
1242 Ga0070693_100368233
1243 Ga0070693_100654577
1244 Ga0070665_100003400
1245 Ga0070665_100029797
1246 Ga0070665_100418540
1247 Ga0070704_100042320
1248 Ga0070704_100072841
1249 Ga0070704_100630615
1250 Ga0070704_100969227
1251 Ga0070704_100978672
1252 Ga0070704_101199414
1253 Ga0070704_101357863
1254 Ga0068855_100014919
1255 Ga0068855_100294344
1256 Ga0068855_100888909
1257 Ga0068855_100988297
1258 Ga0068855_101623346
1259 Ga0070664_100193513
1260 Ga0070664_101298528
1261 Ga0068857_100048486
1262 Ga0068854_100005725
1263 Ga0068854_100180647
1264 Ga0068854_100197173
1265 Ga0068854_100219807
1266 Ga0068854_100809193
1267 Ga0068856_100711833
1268 Ga0070702_100106947
1269 Ga0070702_100718114
1270 Ga0070702_101007939
1271 Ga0070702_101171008
1272 Ga0068852_101204655
1273 Ga0068852_101929375
1274 Ga0068859_100188547
1275 Ga0068859_100221482
1276 Ga0068859_100230147
1277 Ga0068859_100415300
1278 Ga0068859_100734346
1279 Ga0068859_101015345
1280 Ga0068859_101965014
1281 Ga0068864_100006744
1282 Ga0068864_100011842
1283 Ga0068864_100239636
1284 Ga0068864_100443214
1285 Ga0068864_100786665
1286 Ga0068864_101005656
1287 Ga0068866_10042802
1288 Ga0068866_10221562
1289 Ga0068861_100007713
1290 Ga0068861_100072208
1291 Ga0068861_100145379
1292 Ga0068861_100159015
1293 Ga0068861_100184742
1294 Ga0068861_100511014
1295 Ga0068861_100959728
1296 Ga0068861_101008470
1297 Ga0068861_101102824
1298 Ga0068851_10728692
1299 Ga0068870_11084789
1300 Ga0068863_100017724
1301 Ga0068863_100126316
1302 Ga0068863_100141939
1303 Ga0068863_100209767
1304 Ga0068863_100236135
1305 Ga0068863_100672399
1306 Ga0068863_100672492
1307 Ga0068863_101633720
1308 Ga0068858_100002279
1309 Ga0068858_100003439
1310 Ga0068858_100022626
1311 Ga0068858_100025883
1312 Ga0068858_100045471
1313 Ga0068858_100094059
1314 Ga0068858_100102033
1315 Ga0068858_100134456
1316 Ga0068858_100144733
1317 Ga0068858_100532310
1318 Ga0068858_102070735
1319 Ga0068860_100125490
1320 Ga0068860_100166159
1321 Ga0068860_100393463
1322 Ga0068862_100069275
1323 Ga0068862_100072471
1324 Ga0068862_100091597
1325 Ga0068862_100111158
1326 Ga0068862_100808132
1327 Ga0068862_100914818
1328 Ga0068862_100977494
1329 Ga0081455_10057985
1330 Ga0081455_10124172
1331 Ga0070717_10009863
1332 Ga0070717_10999146
1333 Ga0070717_11211134
1334 Ga0070717_12058992
1335 Ga0070715_10309767
1336 Ga0070715_10620796
1337 Ga0070716_100123408
1338 Ga0070716_100158268
1339 Ga0070716_101039599
1340 Ga0070712_100357281
1341 Ga0070712_100728801
1342 Ga0097621_100000820
1343 Ga0097621_100005002
1344 Ga0097621_100009536
1345 Ga0097621_100035429
1346 Ga0097621_100040671
1347 Ga0097621_100161021
1348 Ga0097621_100216579
1349 Ga0097621_100316530
1350 Ga0097621_101689039
1351 Ga0068871_100000748
1352 Ga0068871_100002816
1353 Ga0068871_100018174
1354 Ga0068871_100088922
1355 Ga0068871_100118351
1356 Ga0068871_100154706
1357 Ga0068871_100270927
1358 Ga0068871_100309726
1359 Ga0075428_100240518
1360 Ga0075428_100278263
1361 Ga0075428_100411728
1362 Ga0075428_100856617
1363 Ga0075428_100862597
1364 Ga0075428_102164687
1365 Ga0075431_100077474
1366 Ga0075431_100833204
1367 Ga0075433_10015271
1368 Ga0075433_10042431
1369 Ga0075433_10071915
1370 Ga0075433_10075099
1371 Ga0075433_10236125
1372 Ga0075433_10249633
1373 Ga0075433_10414343
1374 Ga0075433_10799686
1375 Ga0075433_10833779
1376 Ga0075433_11361885
1377 Ga0075434_100000100
1378 Ga0075434_100004020
1379 Ga0075434_100006986
1380 Ga0075434_100051226
1381 Ga0075434_100112820
1382 Ga0075434_100293748
1383 Ga0075434_100329905
1384 Ga0075434_100343684
1385 Ga0075434_100423840
1386 Ga0075434_100573130
1387 Ga0075434_100684850
1388 Ga0075434_101302169
1389 Ga0075434_101936419
1390 Ga0075429_100026083
1391 Ga0075429_100474132
1392 Ga0075429_101848373
1393 Ga0068865_100020287
1394 Ga0068865_100037266
1395 Ga0068865_100094204
1396 Ga0068865_100235185
1397 Ga0068865_100312826
1398 Ga0068865_100459989
1399 Ga0068865_101492256
1400 Ga0075436_100000583
1401 Ga0075436_100018863
1402 Ga0075436_100040832
1403 Ga0075436_100141437
1404 Ga0075436_100173725
1405 Ga0097620_100188556
1406 Ga0097620_100221473
1407 Ga0097620_100230129
1408 Ga0097620_100415286
1409 Ga0097620_100734260
1410 Ga0097620_101015273
1411 Ga0097620_101964372
1412 Ga0075435_100000192
1413 Ga0075435_100007103
1414 Ga0075435_100016305
1415 Ga0075435_100025830
1416 Ga0075435_100063427
1417 Ga0075435_100119349
1418 Ga0075435_100123981
1419 Ga0075435_100155884
1420 Ga0075435_100201230
1421 Ga0105240_10029106
1422 Ga0105240_10066975
1423 Ga0105240_10495260
1424 Ga0105240_10927187
1425 Ga0111539_10011403
1426 Ga0111539_10015361
1427 Ga0111539_10062811
1428 Ga0111539_10182296
1429 Ga0111539_10369566
1430 Ga0111539_10507836
1431 Ga0111539_10990817
1432 Ga0111539_11451358
1433 Ga0105245_10005304
1434 Ga0105245_10010561
1435 Ga0105245_10124385
1436 Ga0105245_10232315
1437 Ga0105245_10601176
1438 Ga0105245_10780122
1439 Ga0105245_11055130
1440 Ga0105245_12248610
1441 Ga0105245_12334424
1442 Ga0105247_10004860
1443 Ga0105247_10006654
1444 Ga0105247_10034357
1445 Ga0114129_10000434
1446 Ga0114129_10000838
1447 Ga0114129_10004177
1448 Ga0114129_10015556
1449 Ga0114129_10019544
1450 Ga0114129_10040311
1451 Ga0114129_10052291
1452 Ga0114129_10061477
1453 Ga0114129_10062016
1454 Ga0114129_10091898
1455 Ga0114129_10191674
1456 Ga0114129_10252054
1457 Ga0114129_10861628
1458 Ga0114129_12342538
1459 Ga0114129_12424115
1460 Ga0114129_12630587
1461 Ga0105243_10033405
1462 Ga0105243_10681586
1463 Ga0105243_10739125
1464 Ga0105243_11496322
1465 Ga0105241_10032306
1466 Ga0105241_10487507
1467 Ga0105241_11084236
1468 Ga0105241_11125116
1469 Ga0105242_10001523
1470 Ga0105242_10011154
1471 Ga0105242_10111093
1472 Ga0105242_10379118
1473 Ga0105242_10387834
1474 Ga0105242_10612737
1475 Ga0105242_11019638
1476 Ga0105242_11080264
1477 Ga0105242_11554003
1478 Ga0105242_11929180
1479 Ga0105242_12069696
1480 Ga0105242_12241515
1481 Ga0105248_10011220
1482 Ga0105248_10024458
1483 Ga0105248_10034945
1484 Ga0105248_10070797
1485 Ga0105248_10082604
1486 Ga0105248_10103052
1487 Ga0105248_10125913
1488 Ga0105248_10373424
1489 Ga0105248_10373690
1490 Ga0105248_10773355
1491 Ga0105248_11003177
1492 Ga0105248_11925938
1493 Ga0105248_12329100
1494 Ga0105248_12480521
1495 Ga0105248_12924663
1496 Ga0105248_13424067
1497 Ga0105237_10421814
1498 Ga0105238_10260967
1499 Ga0105238_10370125
1500 Ga0105238_10881749
1501 Ga0105238_11513352
1502 Ga0105238_12915864
1503 Ga0105249_10039811
1504 Ga0105249_10161993
1505 Ga0105249_10311915
1506 Ga0105249_10333963
1507 Ga0105249_10538632
1508 Ga0105249_10561680
1509 Ga0105249_10748160
1510 Ga0105249_11108411
1511 Ga0105249_12404106
1512 Ga0105239_10540500
1513 Ga0105239_11362000
1514 Ga0105239_11903031
1515 Ga0105246_10070511
1516 Ga0105246_10705161
1517 Ga0105246_11477501
1518 Ga0157374_10036699
1519 Ga0157374_10208635
1520 Ga0157374_10326843
1521 Ga0157374_11361256
1522 Ga0157374_12609231
1523 Ga0157378_10001160
1524 Ga0157378_10141189
1525 Ga0157378_10636010
1526 Ga0157378_10896417
1527 Ga0157378_12948179
1528 Ga0163162_10144917
1529 Ga0163162_10314476
1530 Ga0163162_10901804
1531 Ga0163162_10995844
1532 Ga0157372_10659370
1533 Ga0157375_10088757
1534 Ga0157375_10097638
1535 Ga0157375_10265595
1536 Ga0157375_10567047
1537 Ga0157375_10630466
1538 Ga0157375_11008924
1539 Ga0157375_11707655
1540 Ga0163163_10038701
1541 Ga0163163_10049610
1542 Ga0163163_10108997
1543 Ga0163163_10121049
1544 Ga0163163_12030112
1545 Ga0157380_10079520
1546 Ga0157380_10304614
1547 Ga0157380_10484185
1548 Ga0157380_11406570
1549 Ga0157377_10489469
1550 Ga0157379_10015940
1551 Ga0157379_10088415
1552 Ga0157379_10132422
1553 Ga0157379_10142940
1554 Ga0157379_10649103
1555 Ga0157376_10030995
1556 Ga0157376_10079775
1557 Ga0157376_10085578
1558 Ga0157376_10091892
1559 Ga0157376_10092097
1560 Ga0157376_10125833
1561 Ga0157376_10273682
1562 Ga0157376_10306414
1563 Ga0157376_10592927
1564 Ga0157376_10963530
1565 Ga0157376_11061441
1566 Ga0182007_10335037
1567 Ga0163161_10348502
1568 Ga0163161_10633112
1569 Ga0207697_10052914
1570 Ga0207692_10602337
1571 Ga0207642_10026124
1572 Ga0207642_10111777
1573 Ga0207642_10312885
1574 Ga0207642_10383916
1575 Ga0207710_10017973
1576 Ga0207710_10075354
1577 Ga0207710_10525000
1578 Ga0207680_10011678
1579 Ga0207680_10123690
1580 Ga0207680_10160753
1581 Ga0207680_10875921
1582 Ga0207699_10091475
1583 Ga0207699_10242651
1584 Ga0207699_10360033
1585 Ga0207645_10020833
1586 Ga0207645_10384673
1587 Ga0207645_10528983
1588 Ga0207643_10348451
1589 Ga0207705_10158596
1590 Ga0207684_10715320
1591 Ga0207684_10730527
1592 Ga0207684_11339566
1593 Ga0207684_11356257
1594 Ga0207654_10037434
1595 Ga0207654_10300282
1596 Ga0207654_10693321
1597 Ga0207654_11029606
1598 Ga0207707_10006194
1599 Ga0207707_10110485
1600 Ga0207707_10198464
1601 Ga0207707_10229937
1602 Ga0207695_10605823
1603 Ga0207695_11209789
1604 Ga0207693_10343741
1605 Ga0207693_10588544
1606 Ga0207663_10067706
1607 Ga0207663_10071745
1608 Ga0207663_10258189
1609 Ga0207663_11643864
1610 Ga0207660_10147421
1611 Ga0207660_10564312
1612 Ga0207660_10700828
1613 Ga0207662_10013435
1614 Ga0207662_10169621
1615 Ga0207657_10000779
1616 Ga0207652_10126022
1617 Ga0207652_10386118
1618 Ga0207652_10471860
1619 Ga0207646_10043338
1620 Ga0207646_10154449
1621 Ga0207646_10187640
1622 Ga0207646_10561260
1623 Ga0207646_10638702
1624 Ga0207646_10856339
1625 Ga0207646_11179821
1626 Ga0207646_11454957
1627 Ga0207681_10006864
1628 Ga0207681_10043714
1629 Ga0207681_10073061
1630 Ga0207681_10146677
1631 Ga0207681_10150128
1632 Ga0207681_10679338
1633 Ga0207681_10744373
1634 Ga0207681_10883398
1635 Ga0207694_10337496
1636 Ga0207694_10407911
1637 Ga0207694_10599050
1638 Ga0207650_10038154
1639 Ga0207650_10069075
1640 Ga0207650_11191152
1641 Ga0207650_11303171
1642 Ga0207659_10717915
1643 Ga0207687_10043764
1644 Ga0207687_10062389
1645 Ga0207687_10072422
1646 Ga0207687_10396406
1647 Ga0207687_10528461
1648 Ga0207687_10635658
1649 Ga0207700_10210461
1650 Ga0207664_10185984
1651 Ga0207644_10029295
1652 Ga0207690_10814548
1653 Ga0207706_10173511
1654 Ga0207706_10593905
1655 Ga0207706_10616808
1656 Ga0207686_10010868
1657 Ga0207686_10015491
1658 Ga0207686_10085792
1659 Ga0207686_10187590
1660 Ga0207686_10376717
1661 Ga0207686_10693843
1662 Ga0207686_10977489
1663 Ga0207709_10068291
1664 Ga0207709_10144060
1665 Ga0207709_11512560
1666 Ga0207670_10088621
1667 Ga0207670_10120844
1668 Ga0207670_10134549
1669 Ga0207670_10168595
1670 Ga0207670_10210137
1671 Ga0207670_10521001
1672 Ga0207669_10052164
1673 Ga0207669_10357591
1674 Ga0207669_10431816
1675 Ga0207669_11014260
1676 Ga0207704_10019536
1677 Ga0207704_10026253
1678 Ga0207704_10116127
1679 Ga0207704_10228136
1680 Ga0207704_10416772
1681 Ga0207704_10809041
1682 Ga0207665_10436366
1683 Ga0207691_10045534
1684 Ga0207691_10354092
1685 Ga0207691_10372867
1686 Ga0207691_11022346
1687 Ga0207711_10008949
1688 Ga0207711_10080290
1689 Ga0207711_10153540
1690 Ga0207711_10373103
1691 Ga0207711_10595343
1692 Ga0207711_10625645
1693 Ga0207711_11144350
1694 Ga0207689_10270546
1695 Ga0207689_10298220
1696 Ga0207689_10327773
1697 Ga0207689_10363062
1698 Ga0207661_10427847
1699 Ga0207661_10716112
1700 Ga0207661_11932448
1701 Ga0207679_10637855
1702 Ga0207679_11674956
1703 Ga0207667_10067017
1704 Ga0207667_11233625
1705 Ga0207667_11770240
1706 Ga0207651_10027217
1707 Ga0207651_10660653
1708 Ga0207651_11538515
1709 Ga0207712_10061732
1710 Ga0207712_10131352
1711 Ga0207712_10171490
1712 Ga0207712_10353745
1713 Ga0207712_10374165
1714 Ga0207712_10420628
1715 Ga0207668_10203238
1716 Ga0207668_10258593
1717 Ga0207668_11006235
1718 Ga0207640_10008160
1719 Ga0207640_10162521
1720 Ga0207640_10205546
1721 Ga0207640_10242832
1722 Ga0207640_10273067
1723 Ga0207640_10736401
1724 Ga0207640_11058162
1725 Ga0207658_10032776
1726 Ga0207658_10226416
1727 Ga0207658_10467504
1728 Ga0207677_10014296
1729 Ga0207677_10111962
1730 Ga0207677_10218920
1731 Ga0207677_10303698
1732 Ga0207677_11414909
1733 Ga0207703_10002624
1734 Ga0207703_10009543
1735 Ga0207703_10012767
1736 Ga0207703_10017991
1737 Ga0207703_10094838
1738 Ga0207703_10145654
1739 Ga0207703_10182392
1740 Ga0207703_10294448
1741 Ga0207703_10436146
1742 Ga0207703_10468546
1743 Ga0207703_10916667
1744 Ga0207639_10981557
1745 Ga0207678_10322100
1746 Ga0207678_10561462
1747 Ga0207708_10011994
1748 Ga0207708_10069702
1749 Ga0207708_11944470
1750 Ga0207702_10221233
1751 Ga0207641_10000431
1752 Ga0207641_10061731
1753 Ga0207641_10119650
1754 Ga0207641_10478989
1755 Ga0207641_10558391
1756 Ga0207641_10614722
1757 Ga0207641_11127048
1758 Ga0207648_10039267
1759 Ga0207648_10039354
1760 Ga0207648_10090480
1761 Ga0207648_10145411
1762 Ga0207648_10171174
1763 Ga0207648_10373104
1764 Ga0207648_10375418
1765 Ga0207648_10533835
1766 Ga0207676_10010449
1767 Ga0207676_10046046
1768 Ga0207676_10459544
1769 Ga0207676_10769504
1770 Ga0207676_11050227
1771 Ga0207676_11276912
1772 Ga0207674_10075381
1773 Ga0207674_10549242
1774 Ga0207675_100000451
1775 Ga0207675_100023793
1776 Ga0207675_100091896
1777 Ga0207675_100097464
1778 Ga0207675_100109946
1779 Ga0207675_100369060
1780 Ga0207675_100382164
1781 Ga0207675_100630923
1782 Ga0207675_100685086
1783 Ga0207683_10345997
1784 Ga0207683_10486360
1785 Ga0207683_10769344
1786 Ga0207683_10788125
1787 Ga0207698_10761856
1788 Ga0207698_10869643
1789 Ga0207428_10027043
1790 Ga0207428_10028926
1791 Ga0268266_10017418
1792 Ga0268266_10134496
1793 Ga0268266_10220479
1794 Ga0268265_10006219
1795 Ga0268265_10072450
1796 Ga0268265_10116068
1797 Ga0268265_10329188
1798 Ga0268265_10360436
1799 Ga0268265_10729509
1800 Ga0268264_10010017
1801 Ga0268264_10052316
1802 Ga0268264_10196853
1803 Ga0268264_10343458
1804 Ga0268264_10473224
1805 Ga0268264_10878800
1806 Ga0268264_12107419
1807 Ga0265336_10036910
1808 Ga0307511_10176907
1809 Ga0265332_10066482
1810 Ga0307408_100271106
1811 Ga0265314_10182069
1812 Ga0307416_100159382
1813 Ga0307416_101510812
1814 Ga0307416_102227940
1815 Ga0373930_0001025
1816 Ga0373948_0000373
1817 Ga0373950_0000439
1818 Ga0373958_0000173
1819 Ga0373959_0001608
1820 Ga0373959_0071576
1821 Ga0373959_0144825
1822 Ga0373926_0329028
1823 Ga0373926_0441988
1824 Ga0373928_0007057
1825 Ga0373929_0042093
1826 Ga0373934_0120797
1827 Ga0373934_0221941
1828 Ga0373949_0008821
1829 Ga0373949_0071268
1830 Ga0373951_0001298
1831 Ga0373952_0000050
1832 Ga0373932_0000603
1833 Ga0373936_0169584
1834 Ga0373939_0000156
1835 Ga0373939_0292021
1836 Ga0373941_0000433
1837 Ga0373941_0164279
1838 Ga0373945_0025007
1839 Ga0373945_0220194
1840 Ga0373953_0286486
1841 Ga0373954_0661335
1842 Ga0373956_0342241
1843 Ga0373956_0350852
1844 Ga0373960_0000998
1845 Ga0373943_0035898
1846 Ga0373943_0129533
1847 Ga0373946_0004665
1848 Ga0373946_0583527
1849 Ga0373955_0004533
1850 Ga0373955_0072855
1851 Ga0373955_0478032
1852 Ga0373955_0588153
1853 Ga0373955_0620118
1854 Ga0373942_0002127
1855 Ga0373961_0002123
1856 Ga0373961_0121940
1857 Ga0373961_0124021
1858 Ga0373962_0000316
1859 Ga0373962_0115701
1860 Ga0373924_0289929
1861 Ga0373931_0000411
1862 Ga0373931_0254505
1863 Ga0373931_1021763
1864 Ga0373931_1301281
1865 Ga0373935_0306490
1866 Ga0373927_0875987
1867 Ga0373933_0108709
1868 Ga0373933_0177633
1869 Ga0373933_0718955
1870 Ga0373947_0011952
1871 Ga0373937_0102381
1872 Ga0373937_0289905
1873 Ga0373937_0338632
1874 Ga0373937_0465146
1875 Ga0373937_0552941
1876 Ga0373937_0697287
1877 Ga0373937_0740509
1878 Ga0373937_0999142
1879 Ga0373937_1125816
1880 Ga0373937_1169834
1881 Ga0373937_1209411
1882 Ga0373925_0000987
1883 Ga0373925_0057437
1884 Ga0373925_0157527
1885 Ga0373925_0267622
1886 Ga0395901_0743187
1887 Ga0436365_0084194
1888 Ga0436365_0238160
1889 Ga0451853_2674977
1890 Ga0451577_0051538
1891 Ga0451577_0379089
1892 Ga0453684_0017739
1893 Ga0453684_0857849
1894 Ga0451576_0007440
1895 Ga0451576_0162502
1896 Ga0451576_0343295
1897 Ga0451576_0607892
1898 Ga0451576_0721975
1899 Ga0466967_1574666
1900 Ga0495592_0012201
1901 Ga0495641_0226491
1902 Ga0495651_0073293
1903 Ga0495653_0730978
1904 Ga0495580_0189503
1905 Ga0495582_0083522
1906 Ga0495582_0900727
1907 Ga0495639_0274548
1908 Ga0495664_0249261
1909 Ga0495664_0656574
1910 Ga0495608_0005369
1911 Ga0495618_0094139
1912 Ga0495618_0137210
1913 Ga0495628_0059757
1914 Ga0495628_0065349
1915 Ga0495628_0073643
1916 Ga0495628_0175127
1917 Ga0495628_0449592
1918 Ga0495630_0185860
1919 Ga0495630_0745802
1920 Ga0495652_0043146
1921 Ga0495640_0275408
1922 Ga0495640_0327921
1923 Ga0495640_0690988
1924 Ga0495586_0063016
1925 Ga0495587_0247319
1926 Ga0495621_0089921
1927 Ga0495645_0011724
1928 Ga0495645_0282263
1929 Ga0495645_0500379
1930 Ga0495634_0199656
1931 Ga0495634_0251840
1932 Ga0495635_0099387
1933 Ga0495635_0611694
1934 Ga0495659_0199978
1935 Ga0495659_0238645
1936 Ga0495657_0133806
1937 Ga0495599_0136744
1938 Ga0495599_0205621
1939 Ga0495623_0136538
1940 Ga0495623_0630804
1941 Ga0495647_0059355
1942 Ga0495647_0167242
1943 Ga0495647_0294229
1944 Ga0495658_0008380
1945 Ga0495658_0059892
1946 Ga0495658_0082336
1947 Ga0495658_0182438
1948 Ga0495658_0260413
1949 Ga0495658_0591440
1950 Ga0495669_0099799
1951 Ga0495613_0003872
1952 Ga0495613_0407509
1953 Ga0495600_0173676
1954 Ga0495581_0649665
1955 Ga0495604_0857854
1956 Ga0495674_0051920
1957 Ga0495674_0088764
1958 Ga0495676_0523271
1959 Ga0495680_0284169
1960 Ga0495684_0000048
1961 Ga0495684_0118638
1962 Ga0495602_0042503
1963 Ga0495602_0381360
1964 Ga0496100_0006242
1965 Ga0496101_0000568
1966 Ga0496102_0028151
1967 Ga0496102_0272778
1968 Ga0496102_0398631
1969 Ga0496102_0431283
1970 Ga0496102_0454865
1971 Ga0496102_0500096
1972 Ga0496102_0931147
1973 Ga0496104_0007988
1974 Ga0496104_0011911
1975 Ga0496104_0106270
1976 Ga0496105_0020589
1977 Ga0496105_0221111
1978 Ga0496105_0756948
1979 Ga0496106_0109049
1980 Ga0496106_0205250
1981 Ga0496107_0153272
1982 Ga0496107_0479762
1983 Ga0496107_0531596
1984 Ga0496108_0016941
1985 Ga0496108_0262892
1986 Ga0496108_0326148
1987 Ga0496109_0040181
1988 Ga0496109_0175026
1989 Ga0496109_0266525
1990 Ga0496109_1026918
1991 Ga0496110_0035448
1992 Ga0496110_1501628
1993 Ga0496111_0237034
1994 Ga0496111_0737796
1995 Ga0496112_0019763
1996 Ga0496112_0075966
1997 Ga0496112_0107372
1998 Ga0496112_0196445
1999 Ga0496112_0262404
2000 Ga0496112_0281626
2001 Ga0496112_0442508
2002 Ga0496112_0523581
2003 Ga0496112_1079419
2004 Ga0496113_0021085
2005 Ga0496113_0080583
2006 Ga0496113_0781848
2007 Ga0496113_1050705
2008 Ga0496113_1509650
2009 Ga0496114_0048279
2010 Ga0496114_0159689
2011 Ga0496114_0161096
2012 Ga0496114_0204813
2013 Ga0496114_0327955
2014 Ga0496115_0328621
2015 Ga0496115_0407622
2016 Ga0501033_1018427
2017 Ga0501036_0054613
2018 Ga0501038_0245814
2019 Ga0501038_0322724
2020 Ga0501040_0483316
2021 Ga0501040_1410210
2022 Ga0501042_0215160
2023 Ga0501043_0580818
2024 Ga0501047_0939033
2025 Ga0501067_0289629
2026 Ga0501067_0481334
2027 Ga0501069_0307261
2028 Ga0501070_0455063
2029 Ga0501071_0312005
2030 Ga0501072_0270399
2031 Ga0501074_0235859
2032 Ga0501075_0012334
2033 Ga0501075_0230492
2034 Ga0501075_0509874
2035 Ga0501076_0300744
2036 Ga0501083_0021015
2037 Ga0501045_0206848
2038 nmdc:mga05p37_1041614_c1
2039 nmdc:mga05p37_11139_c1
2040 nmdc:mga05p37_114290_c1
2041 nmdc:mga05p37_133487_c1
2042 nmdc:mga05p37_162938_c1
2043 nmdc:mga05p37_21081_c1
2044 nmdc:mga05p37_21329_c1
2045 nmdc:mga05p37_21681_c1
2046 nmdc:mga05p37_26367_c1
2047 nmdc:mga05p37_27602_c1
2048 nmdc:mga05p37_586457_c1
2049 nmdc:mga05p37_602696_c1
2050 nmdc:mga05p37_901647_c1
2051 nmdc:mga09592_1612446_c1
2052 nmdc:mga09592_23225_c1
2053 nmdc:mga06r32_166679_c1
2054 nmdc:mga06r32_434910_c1
2055 nmdc:mga08y16_14872_c1
2056 nmdc:mga08y16_25097_c1
2057 nmdc:mga08y16_411517_c1
2058 nmdc:mga08y16_4545_c1
2059 nmdc:mga08y16_49080_c1
2060 nmdc:mga08y16_707011_c1
2061 nmdc:mga08y16_846761_c1
2062 nmdc:mga0n895_111_c1
2063 nmdc:mga0n895_1544322_c1
2064 nmdc:mga0n895_165469_c1
2065 nmdc:mga0n895_178403_c1
2066 nmdc:mga0n895_194660_c1
2067 nmdc:mga0n895_198225_c1
2068 nmdc:mga0n895_24015_c1
2069 nmdc:mga0n895_331102_c1
2070 nmdc:mga0n895_398495_c1
2071 nmdc:mga0n895_5089_c1
2072 nmdc:mga0n895_5595_c1
2073 nmdc:mga0n895_568151_c1
2074 nmdc:mga0n895_891361_c1
2075 nmdc:mga0rr50_15819_c1
2076 nmdc:mga0rr50_237654_c1
2077 nmdc:mga0rr50_28606_c1
2078 nmdc:mga0rr50_320502_c1
2079 nmdc:mga0rr50_39119_c1
2080 nmdc:mga0rr50_57_c1
2081 nmdc:mga0rr50_61256_c1
2082 nmdc:mga0rr50_636089_c1
2083 nmdc:mga0rr50_757019_c1
2084 nmdc:mga0rr50_8523_c1
2085 nmdc:mga08x19_159863_c1
2086 nmdc:mga08x19_28391_c1
2087 nmdc:mga08x19_426_c1
2088 nmdc:mga08x19_48296_c1
2089 nmdc:mga08x19_56202_c1
2090 nmdc:mga08x19_619912_c1
2091 nmdc:mga08x19_706426_c1
2092 nmdc:mga08x19_751684_c1
2093 nmdc:mga08x19_89635_c1
2094 nmdc:mga08x19_9426_c1
2095 nmdc:mga0a205_198681_c1
2096 nmdc:mga0a205_204751_c1
2097 nmdc:mga0a205_45262_c1
2098 nmdc:mga0a205_56158_c1
2099 nmdc:mga0a205_72168_c1
2100 nmdc:mga0a205_747481_c1
2101 nmdc:mga0a205_753681_c1
2102 nmdc:mga0a205_790368_c1
2103 nmdc:mga0a205_822545_c1
2104 nmdc:mga0a205_93806_c1
2105 nmdc:mga0a205_94532_c1
2106 Ga0495601_0075643
2107 Ga0495601_0251258
2108 Ga0495601_0277871
2109 Ga0495601_0544148
2110 Ga0495595_0043907
2111 Ga0495595_0233737
2112 Ga0495619_0001542
2113 Ga0495619_0048944
2114 Ga0495619_0096024
2115 Ga0495619_0121354
2116 Ga0495619_0161604
2117 Ga0495619_0271887
2118 Ga0495619_0320123
2119 Ga0500658_0549302
2120 Ga0501084_0112280
2121 Ga0501082_1230046
2122 Ga0530510_0970841

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wg5-assembly1.cif.gz_J cyclic electron transport supercomplex ndh-psi from arabidopsis 0.6445 101 135
1ygu-assembly2.cif.gz_B crystal structure of the tandem phosphatase domains of rptp cd45 with a ptyr peptide 0.6004 104 136
6sc2-assembly1.cif.gz_F structure of the dynein-2 complex; ift-train bound model 0.5854 100 132
7ea3-assembly1.cif.gz_Y intact ypt32-trappii (dimer). 0.5845 107 142
1xeu-assembly1.cif.gz_A crystal structure of internalin c from listeria monocytogenes 0.5826 98 136
ID Description Score Start End Superfamily
af_Q8BHK6_23_124_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7228 110 136 2.60.40.10
af_D3ZEF7_249_359_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.673 112 136 2.60.40.10
4r6uC02 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6448 108 136 2.60.40.10
af_Q9NQ25_24_127_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.642 110 136 2.60.40.10
af_G5EC69_181_473_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.633 103 142 3.90.190.10
ID Description Score Start End GO Terms
AF-A0A2E5H216-F1-model_v4 Uncharacterized protein 0.9526 1 136
AF-A0A6L7WTJ9-F1-model_v4 Uncharacterized protein 0.9504 2 142
AF-A0A2E5H216-F1-model_v4 Uncharacterized protein 0.9393 1 136
AF-A0A7X3TZW9-F1-model_v4 Uncharacterized protein 0.932 2 142
AF-A0A7X3TZW9-F1-model_v4 Uncharacterized protein 0.9196 2 142

Map