F489291
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1061 | 311 | 2122 | 144 |
Family's Representative Sequence
| Representative Sequence | 3300035170|Ga0373943_0306507|Ga0373943_0306507_318_842 |
| Length | 174 |
| Sequence | MPAAPLARPENRGPRFFFAVLFQLIHAAKMELDTSKWSGEGAFTQVLVDWLAKLDGVTLVRVEDAPASRSEADYNFISNELFVTFATRTVREPIRRFGILPGARTVMEKLMTVAELEQALTVLPGIGAPDYADGGMLQYLRAERIVPPYQTRGYKLVELVRIYEASSEPRALSP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 179 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 183 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 184 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 186 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 188 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 189 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 190 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 191 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 192 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 193 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 194 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 195 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 196 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 197 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 198 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 199 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 200 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 202 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 203 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 205 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 206 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 207 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 214 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 215 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 216 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 217 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 218 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 219 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 220 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 223 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 224 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 225 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 226 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 227 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 228 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 229 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 268 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 269 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 270 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 271 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 272 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 275 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 276 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 277 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 278 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 279 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 280 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 309 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.09 |
| Nodule | 0 |
| Rhizoplane | 4.9 |
| Rhizosphere | 94.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 35.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373943_0306507 | 3300035170 | Unclassified | 903 |
| 2 | JGI24751J29686_10012579 | 3300002459 | Bacteria | 1745 |
| 3 | JGI24751J29686_10044217 | 3300002459 | Unclassified | 921 |
| 4 | Ga0065712_10148007 | 3300005290 | Bacteria | 1392 |
| 5 | Ga0065715_10384793 | 3300005293 | Bacteria | 902 |
| 6 | Ga0065707_10157319 | 3300005295 | Bacteria | 1578 |
| 7 | Ga0065707_10191325 | 3300005295 | Bacteria | 1359 |
| 8 | Ga0065707_10205317 | 3300005295 | Bacteria | 1291 |
| 9 | Ga0065707_10319448 | 3300005295 | Bacteria | 969 |
| 10 | Ga0065707_10583303 | 3300005295 | Bacteria | 685 |
| 11 | Ga0070658_10483153 | 3300005327 | Bacteria | 1069 |
| 12 | Ga0070676_10115767 | 3300005328 | Unclassified | 1676 |
| 13 | Ga0070676_10123158 | 3300005328 | Unclassified | 1630 |
| 14 | Ga0070676_10359237 | 3300005328 | Unclassified | 1003 |
| 15 | Ga0070676_10696412 | 3300005328 | Bacteria | 741 |
| 16 | Ga0070683_100170189 | 3300005329 | Bacteria | 2068 |
| 17 | Ga0070683_100497961 | 3300005329 | Bacteria | 1164 |
| 18 | Ga0070683_100627553 | 3300005329 | Bacteria | 1029 |
| 19 | Ga0070683_100722234 | 3300005329 | Bacteria | 954 |
| 20 | Ga0070690_100398767 | 3300005330 | Bacteria | 1010 |
| 21 | Ga0070690_100435412 | 3300005330 | Bacteria | 969 |
| 22 | Ga0070690_100598409 | 3300005330 | Bacteria | 837 |
| 23 | Ga0070690_101297730 | 3300005330 | Bacteria | 583 |
| 24 | Ga0070670_100014064 | 3300005331 | Bacteria | 6866 |
| 25 | Ga0070670_100021276 | 3300005331 | Bacteria | 5581 |
| 26 | Ga0070670_100185649 | 3300005331 | Bacteria | 1805 |
| 27 | Ga0068869_100076880 | 3300005334 | Bacteria | 2482 |
| 28 | Ga0068869_100636507 | 3300005334 | Bacteria | 904 |
| 29 | Ga0068869_100659117 | 3300005334 | Bacteria | 889 |
| 30 | Ga0068869_100844563 | 3300005334 | Unclassified | 790 |
| 31 | Ga0070666_10045979 | 3300005335 | Bacteria | 2927 |
| 32 | Ga0070666_10163928 | 3300005335 | Unclassified | 1554 |
| 33 | Ga0070666_10364946 | 3300005335 | Bacteria | 1035 |
| 34 | Ga0070666_10377732 | 3300005335 | Bacteria | 1017 |
| 35 | Ga0070666_10627384 | 3300005335 | Archaea | 785 |
| 36 | Ga0070680_100058133 | 3300005336 | Bacteria | 3162 |
| 37 | Ga0070680_100285818 | 3300005336 | Bacteria | 1398 |
| 38 | Ga0070680_100806518 | 3300005336 | Unclassified | 809 |
| 39 | Ga0070682_100144394 | 3300005337 | Unclassified | 1626 |
| 40 | Ga0068868_100012388 | 3300005338 | Bacteria | 6232 |
| 41 | Ga0068868_100136074 | 3300005338 | Unclassified | 2014 |
| 42 | Ga0068868_100477807 | 3300005338 | Archaea | 1088 |
| 43 | Ga0070660_100006784 | 3300005339 | Bacteria | 7947 |
| 44 | Ga0070660_100369439 | 3300005339 | Unclassified | 1183 |
| 45 | Ga0070689_100073746 | 3300005340 | Bacteria | 2670 |
| 46 | Ga0070689_100179496 | 3300005340 | Unclassified | 1719 |
| 47 | Ga0070689_100223377 | 3300005340 | Bacteria | 1546 |
| 48 | Ga0070689_100241364 | 3300005340 | Unclassified | 1488 |
| 49 | Ga0070689_100275984 | 3300005340 | Unclassified | 1393 |
| 50 | Ga0070689_100319565 | 3300005340 | Bacteria | 1296 |
| 51 | Ga0070689_100962510 | 3300005340 | Unclassified | 758 |
| 52 | Ga0070691_10076314 | 3300005341 | Unclassified | 1633 |
| 53 | Ga0070691_10115901 | 3300005341 | Unclassified | 1344 |
| 54 | Ga0070687_100240007 | 3300005343 | Bacteria | 1120 |
| 55 | Ga0070687_100247144 | 3300005343 | Bacteria | 1106 |
| 56 | Ga0070661_101241160 | 3300005344 | Bacteria | 624 |
| 57 | Ga0070692_10086978 | 3300005345 | Bacteria | 1693 |
| 58 | Ga0070668_100062476 | 3300005347 | Unclassified | 2885 |
| 59 | Ga0070668_100195700 | 3300005347 | Bacteria | 1658 |
| 60 | Ga0070668_101546186 | 3300005347 | Bacteria | 607 |
| 61 | Ga0070669_100038575 | 3300005353 | Bacteria | 3468 |
| 62 | Ga0070669_100093027 | 3300005353 | Bacteria | 2264 |
| 63 | Ga0070669_100095232 | 3300005353 | Unclassified | 2238 |
| 64 | Ga0070669_100127504 | 3300005353 | Unclassified | 1949 |
| 65 | Ga0070669_100160722 | 3300005353 | Unclassified | 1745 |
| 66 | Ga0070669_100858590 | 3300005353 | Unclassified | 774 |
| 67 | Ga0070669_101056615 | 3300005353 | Unclassified | 698 |
| 68 | Ga0070675_100054049 | 3300005354 | Bacteria | 3304 |
| 69 | Ga0070671_100004195 | 3300005355 | Bacteria | 11396 |
| 70 | Ga0070671_100163958 | 3300005355 | Unclassified | 1879 |
| 71 | Ga0070671_101068052 | 3300005355 | Bacteria | 708 |
| 72 | Ga0070674_100005466 | 3300005356 | Bacteria | 7340 |
| 73 | Ga0070674_100059651 | 3300005356 | Bacteria | 2657 |
| 74 | Ga0070674_100285025 | 3300005356 | Bacteria | 1311 |
| 75 | Ga0070673_100042079 | 3300005364 | Bacteria | 3520 |
| 76 | Ga0070673_100146314 | 3300005364 | Unclassified | 1998 |
| 77 | Ga0070673_100624884 | 3300005364 | Unclassified | 984 |
| 78 | Ga0070673_101869142 | 3300005364 | Unclassified | 569 |
| 79 | Ga0070688_100106907 | 3300005365 | Bacteria | 1854 |
| 80 | Ga0070688_100581816 | 3300005365 | Bacteria | 855 |
| 81 | Ga0070659_100935297 | 3300005366 | Unclassified | 759 |
| 82 | Ga0070667_100010365 | 3300005367 | Bacteria | 7696 |
| 83 | Ga0070667_100051756 | 3300005367 | Unclassified | 3463 |
| 84 | Ga0070667_100934878 | 3300005367 | Unclassified | 808 |
| 85 | Ga0070667_101066429 | 3300005367 | Bacteria | 755 |
| 86 | Ga0070709_10173656 | 3300005434 | Unclassified | 1508 |
| 87 | Ga0070709_10236429 | 3300005434 | Bacteria | 1310 |
| 88 | Ga0070709_11254938 | 3300005434 | Unclassified | 597 |
| 89 | Ga0070709_11302775 | 3300005434 | Unclassified | 586 |
| 90 | Ga0070713_100054949 | 3300005436 | Unclassified | 3307 |
| 91 | Ga0070713_100260957 | 3300005436 | Bacteria | 1583 |
| 92 | Ga0070713_100550727 | 3300005436 | Unclassified | 1092 |
| 93 | Ga0070710_10586237 | 3300005437 | Bacteria | 774 |
| 94 | Ga0070701_10148191 | 3300005438 | Unclassified | 1349 |
| 95 | Ga0070701_10225133 | 3300005438 | Unclassified | 1120 |
| 96 | Ga0070701_10321915 | 3300005438 | Bacteria | 957 |
| 97 | Ga0070701_10384729 | 3300005438 | Unclassified | 885 |
| 98 | Ga0070701_10863493 | 3300005438 | Bacteria | 622 |
| 99 | Ga0070701_11042232 | 3300005438 | Unclassified | 573 |
| 100 | Ga0070711_100138103 | 3300005439 | Unclassified | 1824 |
| 101 | Ga0070705_100093987 | 3300005440 | Unclassified | 1876 |
| 102 | Ga0070705_100508359 | 3300005440 | Unclassified | 916 |
| 103 | Ga0070705_101164568 | 3300005440 | Bacteria | 634 |
| 104 | Ga0070705_101261350 | 3300005440 | Bacteria | 611 |
| 105 | Ga0070705_101692359 | 3300005440 | Unclassified | 534 |
| 106 | Ga0070705_101792144 | 3300005440 | Unclassified | 520 |
| 107 | Ga0070700_100107163 | 3300005441 | Unclassified | 1851 |
| 108 | Ga0070700_100932548 | 3300005441 | Bacteria | 709 |
| 109 | Ga0070694_100004344 | 3300005444 | Bacteria | 8521 |
| 110 | Ga0070694_100023096 | 3300005444 | Bacteria | 3995 |
| 111 | Ga0070708_100728358 | 3300005445 | Unclassified | 933 |
| 112 | Ga0070708_101231611 | 3300005445 | Unclassified | 700 |
| 113 | Ga0070678_100364810 | 3300005456 | Unclassified | 1245 |
| 114 | Ga0070678_100688250 | 3300005456 | Bacteria | 920 |
| 115 | Ga0070678_101020676 | 3300005456 | Unclassified | 761 |
| 116 | Ga0070662_100092251 | 3300005457 | Unclassified | 2276 |
| 117 | Ga0070662_100568652 | 3300005457 | Bacteria | 951 |
| 118 | Ga0070681_10010299 | 3300005458 | Bacteria | 9227 |
| 119 | Ga0070681_10014078 | 3300005458 | Bacteria | 7960 |
| 120 | Ga0070681_10141561 | 3300005458 | Bacteria | 2335 |
| 121 | Ga0070681_10400881 | 3300005458 | Bacteria | 1283 |
| 122 | Ga0068867_100056694 | 3300005459 | Unclassified | 2899 |
| 123 | Ga0068867_100100267 | 3300005459 | Bacteria | 2211 |
| 124 | Ga0068867_100154088 | 3300005459 | Archaea | 1807 |
| 125 | Ga0068867_100180576 | 3300005459 | Unclassified | 1678 |
| 126 | Ga0068867_100226308 | 3300005459 | Unclassified | 1510 |
| 127 | Ga0068867_100507101 | 3300005459 | Bacteria | 1038 |
| 128 | Ga0068867_101340445 | 3300005459 | Unclassified | 662 |
| 129 | Ga0068867_101922952 | 3300005459 | Unclassified | 558 |
| 130 | Ga0070706_100382871 | 3300005467 | Unclassified | 1310 |
| 131 | Ga0070706_100452983 | 3300005467 | Unclassified | 1194 |
| 132 | Ga0070706_101810106 | 3300005467 | Bacteria | 555 |
| 133 | Ga0070707_100247723 | 3300005468 | Bacteria | 1734 |
| 134 | Ga0070707_100329286 | 3300005468 | Unclassified | 1484 |
| 135 | Ga0070707_100347300 | 3300005468 | Bacteria | 1441 |
| 136 | Ga0070707_100392796 | 3300005468 | Bacteria | 1347 |
| 137 | Ga0070707_100743344 | 3300005468 | Unclassified | 944 |
| 138 | Ga0070707_100968233 | 3300005468 | Unclassified | 816 |
| 139 | Ga0070707_101886906 | 3300005468 | Bacteria | 565 |
| 140 | Ga0070698_100060950 | 3300005471 | Unclassified | 3806 |
| 141 | Ga0070698_100113779 | 3300005471 | Unclassified | 2671 |
| 142 | Ga0070698_100488280 | 3300005471 | Unclassified | 1169 |
| 143 | Ga0070698_100785113 | 3300005471 | Bacteria | 896 |
| 144 | Ga0070698_101319210 | 3300005471 | Unclassified | 672 |
| 145 | Ga0070699_100010440 | 3300005518 | Bacteria | 8037 |
| 146 | Ga0070699_100303687 | 3300005518 | Bacteria | 1432 |
| 147 | Ga0070699_100347735 | 3300005518 | Bacteria | 1335 |
| 148 | Ga0070699_100398468 | 3300005518 | Unclassified | 1244 |
| 149 | Ga0070699_100444432 | 3300005518 | Unclassified | 1175 |
| 150 | Ga0070699_100560366 | 3300005518 | Unclassified | 1040 |
| 151 | Ga0070699_102047879 | 3300005518 | Unclassified | 523 |
| 152 | Ga0070679_100028033 | 3300005530 | Bacteria | 5549 |
| 153 | Ga0070679_100122007 | 3300005530 | Bacteria | 2590 |
| 154 | Ga0070679_100235511 | 3300005530 | Bacteria | 1790 |
| 155 | Ga0070679_101816370 | 3300005530 | Bacteria | 558 |
| 156 | Ga0070684_100060632 | 3300005535 | Bacteria | 3310 |
| 157 | Ga0070697_100379311 | 3300005536 | Unclassified | 1224 |
| 158 | Ga0070697_100383805 | 3300005536 | Bacteria | 1217 |
| 159 | Ga0070697_100407559 | 3300005536 | Unclassified | 1180 |
| 160 | Ga0070697_100526661 | 3300005536 | Unclassified | 1035 |
| 161 | Ga0070697_101040936 | 3300005536 | Bacteria | 728 |
| 162 | Ga0070697_101302080 | 3300005536 | Bacteria | 648 |
| 163 | Ga0068853_101641942 | 3300005539 | Unclassified | 623 |
| 164 | Ga0068853_101759825 | 3300005539 | Unclassified | 601 |
| 165 | Ga0070672_100157677 | 3300005543 | Bacteria | 1881 |
| 166 | Ga0070672_100966908 | 3300005543 | Bacteria | 754 |
| 167 | Ga0070686_100006611 | 3300005544 | Bacteria | 6452 |
| 168 | Ga0070686_100013585 | 3300005544 | Bacteria | 4668 |
| 169 | Ga0070686_100108606 | 3300005544 | Unclassified | 1886 |
| 170 | Ga0070686_101715744 | 3300005544 | Bacteria | 533 |
| 171 | Ga0070695_100012788 | 3300005545 | Bacteria | 5039 |
| 172 | Ga0070695_100058392 | 3300005545 | Bacteria | 2494 |
| 173 | Ga0070695_100166406 | 3300005545 | Unclassified | 1552 |
| 174 | Ga0070695_100172688 | 3300005545 | Bacteria | 1526 |
| 175 | Ga0070696_100023933 | 3300005546 | Unclassified | 4150 |
| 176 | Ga0070696_100052270 | 3300005546 | Bacteria | 2843 |
| 177 | Ga0070696_100236263 | 3300005546 | Unclassified | 1377 |
| 178 | Ga0070696_100397723 | 3300005546 | Unclassified | 1077 |
| 179 | Ga0070696_100420420 | 3300005546 | Bacteria | 1049 |
| 180 | Ga0070693_100231650 | 3300005547 | Unclassified | 1216 |
| 181 | Ga0070693_100368233 | 3300005547 | Unclassified | 988 |
| 182 | Ga0070693_100654577 | 3300005547 | Bacteria | 764 |
| 183 | Ga0070665_100003400 | 3300005548 | Bacteria | 17010 |
| 184 | Ga0070665_100029797 | 3300005548 | Bacteria | 5491 |
| 185 | Ga0070665_100418540 | 3300005548 | Bacteria | 1348 |
| 186 | Ga0070704_100042320 | 3300005549 | Unclassified | 3150 |
| 187 | Ga0070704_100072841 | 3300005549 | Bacteria | 2500 |
| 188 | Ga0070704_100630615 | 3300005549 | Unclassified | 945 |
| 189 | Ga0070704_100969227 | 3300005549 | Unclassified | 768 |
| 190 | Ga0070704_100978672 | 3300005549 | Unclassified | 764 |
| 191 | Ga0070704_101199414 | 3300005549 | Bacteria | 692 |
| 192 | Ga0070704_101357863 | 3300005549 | Unclassified | 651 |
| 193 | Ga0068855_100014919 | 3300005563 | Bacteria | 9361 |
| 194 | Ga0068855_100294344 | 3300005563 | Bacteria | 1799 |
| 195 | Ga0068855_100888909 | 3300005563 | Bacteria | 942 |
| 196 | Ga0068855_100988297 | 3300005563 | Bacteria | 885 |
| 197 | Ga0068855_101623346 | 3300005563 | Unclassified | 661 |
| 198 | Ga0070664_100193513 | 3300005564 | Bacteria | 1812 |
| 199 | Ga0070664_101298528 | 3300005564 | Unclassified | 687 |
| 200 | Ga0068857_100048486 | 3300005577 | Bacteria | 3771 |
| 201 | Ga0068854_100005725 | 3300005578 | Bacteria | 7858 |
| 202 | Ga0068854_100180647 | 3300005578 | Unclassified | 1648 |
| 203 | Ga0068854_100197173 | 3300005578 | Unclassified | 1581 |
| 204 | Ga0068854_100219807 | 3300005578 | Bacteria | 1503 |
| 205 | Ga0068854_100809193 | 3300005578 | Bacteria | 817 |
| 206 | Ga0068856_100711833 | 3300005614 | Bacteria | 1024 |
| 207 | Ga0070702_100106947 | 3300005615 | Unclassified | 1726 |
| 208 | Ga0070702_100718114 | 3300005615 | Bacteria | 764 |
| 209 | Ga0070702_101007939 | 3300005615 | Unclassified | 659 |
| 210 | Ga0070702_101171008 | 3300005615 | Archaea | 618 |
| 211 | Ga0068852_101204655 | 3300005616 | Bacteria | 778 |
| 212 | Ga0068852_101929375 | 3300005616 | Bacteria | 613 |
| 213 | Ga0068859_100188547 | 3300005617 | Bacteria | 2146 |
| 214 | Ga0068859_100221482 | 3300005617 | Bacteria | 1980 |
| 215 | Ga0068859_100230147 | 3300005617 | Unclassified | 1941 |
| 216 | Ga0068859_100415300 | 3300005617 | Bacteria | 1442 |
| 217 | Ga0068859_100734346 | 3300005617 | Unclassified | 1077 |
| 218 | Ga0068859_101015345 | 3300005617 | Unclassified | 911 |
| 219 | Ga0068859_101965014 | 3300005617 | Unclassified | 646 |
| 220 | Ga0068864_100006744 | 3300005618 | Bacteria | 9405 |
| 221 | Ga0068864_100011842 | 3300005618 | Bacteria | 7204 |
| 222 | Ga0068864_100239636 | 3300005618 | Bacteria | 1680 |
| 223 | Ga0068864_100443214 | 3300005618 | Bacteria | 1241 |
| 224 | Ga0068864_100786665 | 3300005618 | Unclassified | 934 |
| 225 | Ga0068864_101005656 | 3300005618 | Bacteria | 827 |
| 226 | Ga0068866_10042802 | 3300005718 | Bacteria | 2256 |
| 227 | Ga0068866_10221562 | 3300005718 | Bacteria | 1142 |
| 228 | Ga0068861_100007713 | 3300005719 | Bacteria | 7389 |
| 229 | Ga0068861_100072208 | 3300005719 | Unclassified | 2677 |
| 230 | Ga0068861_100145379 | 3300005719 | Unclassified | 1940 |
| 231 | Ga0068861_100159015 | 3300005719 | Bacteria | 1862 |
| 232 | Ga0068861_100184742 | 3300005719 | Bacteria | 1738 |
| 233 | Ga0068861_100511014 | 3300005719 | Bacteria | 1088 |
| 234 | Ga0068861_100959728 | 3300005719 | Unclassified | 814 |
| 235 | Ga0068861_101008470 | 3300005719 | Bacteria | 795 |
| 236 | Ga0068861_101102824 | 3300005719 | Bacteria | 763 |
| 237 | Ga0068851_10728692 | 3300005834 | Unclassified | 612 |
| 238 | Ga0068870_11084789 | 3300005840 | Unclassified | 575 |
| 239 | Ga0068863_100017724 | 3300005841 | Bacteria | 6816 |
| 240 | Ga0068863_100126316 | 3300005841 | Unclassified | 2440 |
| 241 | Ga0068863_100141939 | 3300005841 | Unclassified | 2296 |
| 242 | Ga0068863_100209767 | 3300005841 | Bacteria | 1876 |
| 243 | Ga0068863_100236135 | 3300005841 | Unclassified | 1764 |
| 244 | Ga0068863_100672399 | 3300005841 | Bacteria | 1028 |
| 245 | Ga0068863_100672492 | 3300005841 | Bacteria | 1028 |
| 246 | Ga0068863_101633720 | 3300005841 | Bacteria | 654 |
| 247 | Ga0068858_100002279 | 3300005842 | Bacteria | 19420 |
| 248 | Ga0068858_100003439 | 3300005842 | Bacteria | 15721 |
| 249 | Ga0068858_100022626 | 3300005842 | Bacteria | 5862 |
| 250 | Ga0068858_100025883 | 3300005842 | Bacteria | 5457 |
| 251 | Ga0068858_100045471 | 3300005842 | Bacteria | 4069 |
| 252 | Ga0068858_100094059 | 3300005842 | Bacteria | 2791 |
| 253 | Ga0068858_100102033 | 3300005842 | Unclassified | 2676 |
| 254 | Ga0068858_100134456 | 3300005842 | Bacteria | 2320 |
| 255 | Ga0068858_100144733 | 3300005842 | Bacteria | 2232 |
| 256 | Ga0068858_100532310 | 3300005842 | Bacteria | 1137 |
| 257 | Ga0068858_102070735 | 3300005842 | Unclassified | 563 |
| 258 | Ga0068860_100125490 | 3300005843 | Unclassified | 2460 |
| 259 | Ga0068860_100166159 | 3300005843 | Bacteria | 2130 |
| 260 | Ga0068860_100393463 | 3300005843 | Unclassified | 1370 |
| 261 | Ga0068862_100069275 | 3300005844 | Unclassified | 3045 |
| 262 | Ga0068862_100072471 | 3300005844 | Bacteria | 2975 |
| 263 | Ga0068862_100091597 | 3300005844 | Unclassified | 2648 |
| 264 | Ga0068862_100111158 | 3300005844 | Bacteria | 2405 |
| 265 | Ga0068862_100808132 | 3300005844 | Unclassified | 916 |
| 266 | Ga0068862_100914818 | 3300005844 | Bacteria | 863 |
| 267 | Ga0068862_100977494 | 3300005844 | Unclassified | 836 |
| 268 | Ga0081455_10057985 | 3300005937 | Bacteria | 3279 |
| 269 | Ga0081455_10124172 | 3300005937 | Bacteria | 2029 |
| 270 | Ga0070717_10009863 | 3300006028 | Bacteria | 7194 |
| 271 | Ga0070717_10999146 | 3300006028 | Unclassified | 762 |
| 272 | Ga0070717_11211134 | 3300006028 | Unclassified | 687 |
| 273 | Ga0070717_12058992 | 3300006028 | Unclassified | 514 |
| 274 | Ga0070715_10309767 | 3300006163 | Unclassified | 848 |
| 275 | Ga0070715_10620796 | 3300006163 | Bacteria | 636 |
| 276 | Ga0070716_100123408 | 3300006173 | Bacteria | 1625 |
| 277 | Ga0070716_100158268 | 3300006173 | Bacteria | 1465 |
| 278 | Ga0070716_101039599 | 3300006173 | Unclassified | 650 |
| 279 | Ga0070712_100357281 | 3300006175 | Bacteria | 1197 |
| 280 | Ga0070712_100728801 | 3300006175 | Bacteria | 847 |
| 281 | Ga0097621_100000820 | 3300006237 | Bacteria | 21967 |
| 282 | Ga0097621_100005002 | 3300006237 | Bacteria | 9295 |
| 283 | Ga0097621_100009536 | 3300006237 | Bacteria | 7051 |
| 284 | Ga0097621_100035429 | 3300006237 | Bacteria | 3988 |
| 285 | Ga0097621_100040671 | 3300006237 | Unclassified | 3739 |
| 286 | Ga0097621_100161021 | 3300006237 | Bacteria | 1929 |
| 287 | Ga0097621_100216579 | 3300006237 | Archaea | 1667 |
| 288 | Ga0097621_100316530 | 3300006237 | Bacteria | 1381 |
| 289 | Ga0097621_101689039 | 3300006237 | Bacteria | 603 |
| 290 | Ga0068871_100000748 | 3300006358 | Bacteria | 22005 |
| 291 | Ga0068871_100002816 | 3300006358 | Bacteria | 11897 |
| 292 | Ga0068871_100018174 | 3300006358 | Bacteria | 5338 |
| 293 | Ga0068871_100088922 | 3300006358 | Bacteria | 2571 |
| 294 | Ga0068871_100118351 | 3300006358 | Archaea | 2235 |
| 295 | Ga0068871_100154706 | 3300006358 | Unclassified | 1957 |
| 296 | Ga0068871_100270927 | 3300006358 | Unclassified | 1483 |
| 297 | Ga0068871_100309726 | 3300006358 | Bacteria | 1388 |
| 298 | Ga0075428_100240518 | 3300006844 | Bacteria | 1953 |
| 299 | Ga0075428_100278263 | 3300006844 | Bacteria | 1800 |
| 300 | Ga0075428_100411728 | 3300006844 | Bacteria | 1449 |
| 301 | Ga0075428_100856617 | 3300006844 | Bacteria | 965 |
| 302 | Ga0075428_100862597 | 3300006844 | Bacteria | 961 |
| 303 | Ga0075428_102164687 | 3300006844 | Unclassified | 574 |
| 304 | Ga0075431_100077474 | 3300006847 | Bacteria | 3432 |
| 305 | Ga0075431_100833204 | 3300006847 | Unclassified | 894 |
| 306 | Ga0075433_10015271 | 3300006852 | Bacteria | 6294 |
| 307 | Ga0075433_10042431 | 3300006852 | Bacteria | 3946 |
| 308 | Ga0075433_10071915 | 3300006852 | Bacteria | 3040 |
| 309 | Ga0075433_10075099 | 3300006852 | Bacteria | 2974 |
| 310 | Ga0075433_10236125 | 3300006852 | Bacteria | 1623 |
| 311 | Ga0075433_10249633 | 3300006852 | Unclassified | 1574 |
| 312 | Ga0075433_10414343 | 3300006852 | Unclassified | 1188 |
| 313 | Ga0075433_10799686 | 3300006852 | Unclassified | 824 |
| 314 | Ga0075433_10833779 | 3300006852 | Bacteria | 805 |
| 315 | Ga0075433_11361885 | 3300006852 | Bacteria | 614 |
| 316 | Ga0075434_100000100 | 3300006871 | Bacteria | 48123 |
| 317 | Ga0075434_100004020 | 3300006871 | Bacteria | 13178 |
| 318 | Ga0075434_100006986 | 3300006871 | Archaea | 10407 |
| 319 | Ga0075434_100051226 | 3300006871 | Bacteria | 4102 |
| 320 | Ga0075434_100112820 | 3300006871 | Bacteria | 2730 |
| 321 | Ga0075434_100293748 | 3300006871 | Bacteria | 1645 |
| 322 | Ga0075434_100329905 | 3300006871 | Bacteria | 1546 |
| 323 | Ga0075434_100343684 | 3300006871 | Bacteria | 1513 |
| 324 | Ga0075434_100423840 | 3300006871 | Bacteria | 1352 |
| 325 | Ga0075434_100573130 | 3300006871 | Bacteria | 1148 |
| 326 | Ga0075434_100684850 | 3300006871 | Bacteria | 1043 |
| 327 | Ga0075434_101302169 | 3300006871 | Unclassified | 737 |
| 328 | Ga0075434_101936419 | 3300006871 | Unclassified | 595 |
| 329 | Ga0075429_100026083 | 3300006880 | Bacteria | 5072 |
| 330 | Ga0075429_100474132 | 3300006880 | Bacteria | 1097 |
| 331 | Ga0075429_101848373 | 3300006880 | Unclassified | 524 |
| 332 | Ga0068865_100020287 | 3300006881 | Bacteria | 4310 |
| 333 | Ga0068865_100037266 | 3300006881 | Bacteria | 3282 |
| 334 | Ga0068865_100094204 | 3300006881 | Bacteria | 2179 |
| 335 | Ga0068865_100235185 | 3300006881 | Bacteria | 1439 |
| 336 | Ga0068865_100312826 | 3300006881 | Unclassified | 1261 |
| 337 | Ga0068865_100459989 | 3300006881 | Bacteria | 1054 |
| 338 | Ga0068865_101492256 | 3300006881 | Unclassified | 605 |
| 339 | Ga0075436_100000583 | 3300006914 | Bacteria | 23900 |
| 340 | Ga0075436_100018863 | 3300006914 | Bacteria | 4723 |
| 341 | Ga0075436_100040832 | 3300006914 | Bacteria | 3201 |
| 342 | Ga0075436_100141437 | 3300006914 | Bacteria | 1691 |
| 343 | Ga0075436_100173725 | 3300006914 | Bacteria | 1521 |
| 344 | Ga0097620_100188556 | 3300006931 | Bacteria | 2146 |
| 345 | Ga0097620_100221473 | 3300006931 | Bacteria | 1980 |
| 346 | Ga0097620_100230129 | 3300006931 | Unclassified | 1941 |
| 347 | Ga0097620_100415286 | 3300006931 | Bacteria | 1442 |
| 348 | Ga0097620_100734260 | 3300006931 | Unclassified | 1077 |
| 349 | Ga0097620_101015273 | 3300006931 | Unclassified | 911 |
| 350 | Ga0097620_101964372 | 3300006931 | Unclassified | 646 |
| 351 | Ga0075435_100000192 | 3300007076 | Bacteria | 36826 |
| 352 | Ga0075435_100007103 | 3300007076 | Bacteria | 7952 |
| 353 | Ga0075435_100016305 | 3300007076 | Bacteria | 5600 |
| 354 | Ga0075435_100025830 | 3300007076 | Bacteria | 4576 |
| 355 | Ga0075435_100063427 | 3300007076 | Bacteria | 3001 |
| 356 | Ga0075435_100119349 | 3300007076 | Bacteria | 2199 |
| 357 | Ga0075435_100123981 | 3300007076 | Bacteria | 2158 |
| 358 | Ga0075435_100155884 | 3300007076 | Bacteria | 1921 |
| 359 | Ga0075435_100201230 | 3300007076 | Bacteria | 1688 |
| 360 | Ga0105240_10029106 | 3300009093 | Bacteria | 7203 |
| 361 | Ga0105240_10066975 | 3300009093 | Bacteria | 4453 |
| 362 | Ga0105240_10495260 | 3300009093 | Bacteria | 1360 |
| 363 | Ga0105240_10927187 | 3300009093 | Unclassified | 935 |
| 364 | Ga0111539_10011403 | 3300009094 | Bacteria | 11157 |
| 365 | Ga0111539_10015361 | 3300009094 | Bacteria | 9533 |
| 366 | Ga0111539_10062811 | 3300009094 | Unclassified | 4395 |
| 367 | Ga0111539_10182296 | 3300009094 | Bacteria | 2452 |
| 368 | Ga0111539_10369566 | 3300009094 | Unclassified | 1669 |
| 369 | Ga0111539_10507836 | 3300009094 | Bacteria | 1404 |
| 370 | Ga0111539_10990817 | 3300009094 | Bacteria | 977 |
| 371 | Ga0111539_11451358 | 3300009094 | Unclassified | 796 |
| 372 | Ga0105245_10005304 | 3300009098 | Bacteria | 11325 |
| 373 | Ga0105245_10010561 | 3300009098 | Bacteria | 8034 |
| 374 | Ga0105245_10124385 | 3300009098 | Bacteria | 2412 |
| 375 | Ga0105245_10232315 | 3300009098 | Bacteria | 1784 |
| 376 | Ga0105245_10601176 | 3300009098 | Unclassified | 1126 |
| 377 | Ga0105245_10780122 | 3300009098 | Unclassified | 993 |
| 378 | Ga0105245_11055130 | 3300009098 | Bacteria | 858 |
| 379 | Ga0105245_12248610 | 3300009098 | Bacteria | 599 |
| 380 | Ga0105245_12334424 | 3300009098 | Unclassified | 588 |
| 381 | Ga0105247_10004860 | 3300009101 | Bacteria | 8548 |
| 382 | Ga0105247_10006654 | 3300009101 | Bacteria | 7134 |
| 383 | Ga0105247_10034357 | 3300009101 | Bacteria | 3088 |
| 384 | Ga0114129_10000434 | 3300009147 | Bacteria | 49632 |
| 385 | Ga0114129_10000838 | 3300009147 | Bacteria | 39812 |
| 386 | Ga0114129_10004177 | 3300009147 | Bacteria | 20401 |
| 387 | Ga0114129_10015556 | 3300009147 | Bacteria | 10816 |
| 388 | Ga0114129_10019544 | 3300009147 | Bacteria | 9646 |
| 389 | Ga0114129_10040311 | 3300009147 | Bacteria | 6583 |
| 390 | Ga0114129_10052291 | 3300009147 | Bacteria | 5733 |
| 391 | Ga0114129_10061477 | 3300009147 | Bacteria | 5248 |
| 392 | Ga0114129_10062016 | 3300009147 | Bacteria | 5224 |
| 393 | Ga0114129_10091898 | 3300009147 | Bacteria | 4204 |
| 394 | Ga0114129_10191674 | 3300009147 | Bacteria | 2775 |
| 395 | Ga0114129_10252054 | 3300009147 | Bacteria | 2369 |
| 396 | Ga0114129_10861628 | 3300009147 | Bacteria | 1151 |
| 397 | Ga0114129_12342538 | 3300009147 | Unclassified | 640 |
| 398 | Ga0114129_12424115 | 3300009147 | Bacteria | 628 |
| 399 | Ga0114129_12630587 | 3300009147 | Unclassified | 600 |
| 400 | Ga0105243_10033405 | 3300009148 | Bacteria | 3978 |
| 401 | Ga0105243_10681586 | 3300009148 | Unclassified | 1000 |
| 402 | Ga0105243_10739125 | 3300009148 | Bacteria | 963 |
| 403 | Ga0105243_11496322 | 3300009148 | Bacteria | 699 |
| 404 | Ga0105241_10032306 | 3300009174 | Bacteria | 3923 |
| 405 | Ga0105241_10487507 | 3300009174 | Bacteria | 1097 |
| 406 | Ga0105241_11084236 | 3300009174 | Unclassified | 753 |
| 407 | Ga0105241_11125116 | 3300009174 | Unclassified | 740 |
| 408 | Ga0105242_10001523 | 3300009176 | Bacteria | 18223 |
| 409 | Ga0105242_10011154 | 3300009176 | Bacteria | 6906 |
| 410 | Ga0105242_10111093 | 3300009176 | Bacteria | 2336 |
| 411 | Ga0105242_10379118 | 3300009176 | Bacteria | 1314 |
| 412 | Ga0105242_10387834 | 3300009176 | Unclassified | 1300 |
| 413 | Ga0105242_10612737 | 3300009176 | Unclassified | 1053 |
| 414 | Ga0105242_11019638 | 3300009176 | Bacteria | 837 |
| 415 | Ga0105242_11080264 | 3300009176 | Bacteria | 815 |
| 416 | Ga0105242_11554003 | 3300009176 | Bacteria | 694 |
| 417 | Ga0105242_11929180 | 3300009176 | Bacteria | 631 |
| 418 | Ga0105242_12069696 | 3300009176 | Unclassified | 613 |
| 419 | Ga0105242_12241515 | 3300009176 | Bacteria | 592 |
| 420 | Ga0105248_10011220 | 3300009177 | Bacteria | 9883 |
| 421 | Ga0105248_10024458 | 3300009177 | Bacteria | 6715 |
| 422 | Ga0105248_10034945 | 3300009177 | Bacteria | 5624 |
| 423 | Ga0105248_10070797 | 3300009177 | Bacteria | 3917 |
| 424 | Ga0105248_10082604 | 3300009177 | Bacteria | 3613 |
| 425 | Ga0105248_10103052 | 3300009177 | Unclassified | 3216 |
| 426 | Ga0105248_10125913 | 3300009177 | Unclassified | 2890 |
| 427 | Ga0105248_10373424 | 3300009177 | Unclassified | 1605 |
| 428 | Ga0105248_10373690 | 3300009177 | Archaea | 1605 |
| 429 | Ga0105248_10773355 | 3300009177 | Bacteria | 1084 |
| 430 | Ga0105248_11003177 | 3300009177 | Bacteria | 943 |
| 431 | Ga0105248_11925938 | 3300009177 | Unclassified | 671 |
| 432 | Ga0105248_12329100 | 3300009177 | Unclassified | 610 |
| 433 | Ga0105248_12480521 | 3300009177 | Unclassified | 591 |
| 434 | Ga0105248_12924663 | 3300009177 | Bacteria | 544 |
| 435 | Ga0105248_13424067 | 3300009177 | Unclassified | 504 |
| 436 | Ga0105237_10421814 | 3300009545 | Unclassified | 1340 |
| 437 | Ga0105238_10260967 | 3300009551 | Bacteria | 1712 |
| 438 | Ga0105238_10370125 | 3300009551 | Bacteria | 1423 |
| 439 | Ga0105238_10881749 | 3300009551 | Bacteria | 913 |
| 440 | Ga0105238_11513352 | 3300009551 | Bacteria | 700 |
| 441 | Ga0105238_12915864 | 3300009551 | Unclassified | 514 |
| 442 | Ga0105249_10039811 | 3300009553 | Unclassified | 4267 |
| 443 | Ga0105249_10161993 | 3300009553 | Bacteria | 2162 |
| 444 | Ga0105249_10311915 | 3300009553 | Bacteria | 1582 |
| 445 | Ga0105249_10333963 | 3300009553 | Bacteria | 1530 |
| 446 | Ga0105249_10538632 | 3300009553 | Bacteria | 1217 |
| 447 | Ga0105249_10561680 | 3300009553 | Unclassified | 1193 |
| 448 | Ga0105249_10748160 | 3300009553 | Unclassified | 1039 |
| 449 | Ga0105249_11108411 | 3300009553 | Bacteria | 862 |
| 450 | Ga0105249_12404106 | 3300009553 | Bacteria | 599 |
| 451 | Ga0105239_10540500 | 3300010375 | Bacteria | 1327 |
| 452 | Ga0105239_11362000 | 3300010375 | Unclassified | 819 |
| 453 | Ga0105239_11903031 | 3300010375 | Unclassified | 690 |
| 454 | Ga0105246_10070511 | 3300011119 | Bacteria | 2458 |
| 455 | Ga0105246_10705161 | 3300011119 | Bacteria | 885 |
| 456 | Ga0105246_11477501 | 3300011119 | Unclassified | 637 |
| 457 | Ga0157374_10036699 | 3300013296 | Bacteria | 4492 |
| 458 | Ga0157374_10208635 | 3300013296 | Bacteria | 1915 |
| 459 | Ga0157374_10326843 | 3300013296 | Unclassified | 1521 |
| 460 | Ga0157374_11361256 | 3300013296 | Unclassified | 732 |
| 461 | Ga0157374_12609231 | 3300013296 | Unclassified | 533 |
| 462 | Ga0157378_10001160 | 3300013297 | Bacteria | 23959 |
| 463 | Ga0157378_10141189 | 3300013297 | Bacteria | 2237 |
| 464 | Ga0157378_10636010 | 3300013297 | Archaea | 1081 |
| 465 | Ga0157378_10896417 | 3300013297 | Bacteria | 917 |
| 466 | Ga0157378_12948179 | 3300013297 | Unclassified | 528 |
| 467 | Ga0163162_10144917 | 3300013306 | Unclassified | 2490 |
| 468 | Ga0163162_10314476 | 3300013306 | Bacteria | 1699 |
| 469 | Ga0163162_10901804 | 3300013306 | Bacteria | 997 |
| 470 | Ga0163162_10995844 | 3300013306 | Bacteria | 947 |
| 471 | Ga0157372_10659370 | 3300013307 | Bacteria | 1218 |
| 472 | Ga0157375_10088757 | 3300013308 | Bacteria | 3147 |
| 473 | Ga0157375_10097638 | 3300013308 | Unclassified | 3013 |
| 474 | Ga0157375_10265595 | 3300013308 | Bacteria | 1878 |
| 475 | Ga0157375_10567047 | 3300013308 | Bacteria | 1296 |
| 476 | Ga0157375_10630466 | 3300013308 | Unclassified | 1229 |
| 477 | Ga0157375_11008924 | 3300013308 | Bacteria | 972 |
| 478 | Ga0157375_11707655 | 3300013308 | Bacteria | 745 |
| 479 | Ga0163163_10038701 | 3300014325 | Bacteria | 4648 |
| 480 | Ga0163163_10049610 | 3300014325 | Bacteria | 4131 |
| 481 | Ga0163163_10108997 | 3300014325 | Bacteria | 2797 |
| 482 | Ga0163163_10121049 | 3300014325 | Bacteria | 2651 |
| 483 | Ga0163163_12030112 | 3300014325 | Unclassified | 635 |
| 484 | Ga0157380_10079520 | 3300014326 | Bacteria | 2678 |
| 485 | Ga0157380_10304614 | 3300014326 | Unclassified | 1469 |
| 486 | Ga0157380_10484185 | 3300014326 | Bacteria | 1197 |
| 487 | Ga0157380_11406570 | 3300014326 | Bacteria | 748 |
| 488 | Ga0157377_10489469 | 3300014745 | Unclassified | 857 |
| 489 | Ga0157379_10015940 | 3300014968 | Bacteria | 6606 |
| 490 | Ga0157379_10088415 | 3300014968 | Unclassified | 2779 |
| 491 | Ga0157379_10132422 | 3300014968 | Unclassified | 2244 |
| 492 | Ga0157379_10142940 | 3300014968 | Bacteria | 2157 |
| 493 | Ga0157379_10649103 | 3300014968 | Unclassified | 988 |
| 494 | Ga0157376_10030995 | 3300014969 | Bacteria | 4277 |
| 495 | Ga0157376_10079775 | 3300014969 | Bacteria | 2806 |
| 496 | Ga0157376_10085578 | 3300014969 | Bacteria | 2716 |
| 497 | Ga0157376_10091892 | 3300014969 | Bacteria | 2630 |
| 498 | Ga0157376_10092097 | 3300014969 | Unclassified | 2627 |
| 499 | Ga0157376_10125833 | 3300014969 | Bacteria | 2279 |
| 500 | Ga0157376_10273682 | 3300014969 | Unclassified | 1587 |
| 501 | Ga0157376_10306414 | 3300014969 | Bacteria | 1505 |
| 502 | Ga0157376_10592927 | 3300014969 | Bacteria | 1102 |
| 503 | Ga0157376_10963530 | 3300014969 | Archaea | 874 |
| 504 | Ga0157376_11061441 | 3300014969 | Bacteria | 835 |
| 505 | Ga0182007_10335037 | 3300015262 | Bacteria | 564 |
| 506 | Ga0163161_10348502 | 3300017792 | Archaea | 1177 |
| 507 | Ga0163161_10633112 | 3300017792 | Bacteria | 885 |
| 508 | Ga0207697_10052914 | 3300025315 | Bacteria | 1681 |
| 509 | Ga0207692_10602337 | 3300025898 | Bacteria | 706 |
| 510 | Ga0207642_10026124 | 3300025899 | Bacteria | 2373 |
| 511 | Ga0207642_10111777 | 3300025899 | Bacteria | 1392 |
| 512 | Ga0207642_10312885 | 3300025899 | Unclassified | 914 |
| 513 | Ga0207642_10383916 | 3300025899 | Unclassified | 837 |
| 514 | Ga0207710_10017973 | 3300025900 | Bacteria | 3004 |
| 515 | Ga0207710_10075354 | 3300025900 | Bacteria | 1555 |
| 516 | Ga0207710_10525000 | 3300025900 | Bacteria | 615 |
| 517 | Ga0207680_10011678 | 3300025903 | Bacteria | 4447 |
| 518 | Ga0207680_10123690 | 3300025903 | Bacteria | 1695 |
| 519 | Ga0207680_10160753 | 3300025903 | Bacteria | 1506 |
| 520 | Ga0207680_10875921 | 3300025903 | Bacteria | 644 |
| 521 | Ga0207699_10091475 | 3300025906 | Unclassified | 1911 |
| 522 | Ga0207699_10242651 | 3300025906 | Bacteria | 1238 |
| 523 | Ga0207699_10360033 | 3300025906 | Bacteria | 1028 |
| 524 | Ga0207645_10020833 | 3300025907 | Bacteria | 4284 |
| 525 | Ga0207645_10384673 | 3300025907 | Bacteria | 942 |
| 526 | Ga0207645_10528983 | 3300025907 | Bacteria | 799 |
| 527 | Ga0207643_10348451 | 3300025908 | Unclassified | 929 |
| 528 | Ga0207705_10158596 | 3300025909 | Bacteria | 1699 |
| 529 | Ga0207684_10715320 | 3300025910 | Unclassified | 850 |
| 530 | Ga0207684_10730527 | 3300025910 | Bacteria | 840 |
| 531 | Ga0207684_11339566 | 3300025910 | Unclassified | 588 |
| 532 | Ga0207684_11356257 | 3300025910 | Bacteria | 584 |
| 533 | Ga0207654_10037434 | 3300025911 | Bacteria | 2716 |
| 534 | Ga0207654_10300282 | 3300025911 | Unclassified | 1092 |
| 535 | Ga0207654_10693321 | 3300025911 | Unclassified | 731 |
| 536 | Ga0207654_11029606 | 3300025911 | Bacteria | 599 |
| 537 | Ga0207707_10006194 | 3300025912 | Bacteria | 10451 |
| 538 | Ga0207707_10110485 | 3300025912 | Bacteria | 2403 |
| 539 | Ga0207707_10198464 | 3300025912 | Unclassified | 1750 |
| 540 | Ga0207707_10229937 | 3300025912 | Bacteria | 1614 |
| 541 | Ga0207695_10605823 | 3300025913 | Unclassified | 976 |
| 542 | Ga0207695_11209789 | 3300025913 | Bacteria | 636 |
| 543 | Ga0207693_10343741 | 3300025915 | Bacteria | 1168 |
| 544 | Ga0207693_10588544 | 3300025915 | Bacteria | 866 |
| 545 | Ga0207663_10067706 | 3300025916 | Bacteria | 2291 |
| 546 | Ga0207663_10071745 | 3300025916 | Unclassified | 2236 |
| 547 | Ga0207663_10258189 | 3300025916 | Unclassified | 1286 |
| 548 | Ga0207663_11643864 | 3300025916 | Unclassified | 517 |
| 549 | Ga0207660_10147421 | 3300025917 | Bacteria | 1805 |
| 550 | Ga0207660_10564312 | 3300025917 | Bacteria | 926 |
| 551 | Ga0207660_10700828 | 3300025917 | Unclassified | 826 |
| 552 | Ga0207662_10013435 | 3300025918 | Bacteria | 4580 |
| 553 | Ga0207662_10169621 | 3300025918 | Unclassified | 1399 |
| 554 | Ga0207657_10000779 | 3300025919 | Bacteria | 33835 |
| 555 | Ga0207652_10126022 | 3300025921 | Unclassified | 2281 |
| 556 | Ga0207652_10386118 | 3300025921 | Bacteria | 1264 |
| 557 | Ga0207652_10471860 | 3300025921 | Unclassified | 1130 |
| 558 | Ga0207646_10043338 | 3300025922 | Bacteria | 4042 |
| 559 | Ga0207646_10154449 | 3300025922 | Bacteria | 2070 |
| 560 | Ga0207646_10187640 | 3300025922 | Bacteria | 1867 |
| 561 | Ga0207646_10561260 | 3300025922 | Unclassified | 1026 |
| 562 | Ga0207646_10638702 | 3300025922 | Unclassified | 954 |
| 563 | Ga0207646_10856339 | 3300025922 | Unclassified | 808 |
| 564 | Ga0207646_11179821 | 3300025922 | Unclassified | 672 |
| 565 | Ga0207646_11454957 | 3300025922 | Unclassified | 595 |
| 566 | Ga0207681_10006864 | 3300025923 | Bacteria | 6983 |
| 567 | Ga0207681_10043714 | 3300025923 | Bacteria | 3000 |
| 568 | Ga0207681_10073061 | 3300025923 | Unclassified | 2398 |
| 569 | Ga0207681_10146677 | 3300025923 | Unclassified | 1764 |
| 570 | Ga0207681_10150128 | 3300025923 | Unclassified | 1745 |
| 571 | Ga0207681_10679338 | 3300025923 | Unclassified | 855 |
| 572 | Ga0207681_10744373 | 3300025923 | Bacteria | 817 |
| 573 | Ga0207681_10883398 | 3300025923 | Bacteria | 748 |
| 574 | Ga0207694_10337496 | 3300025924 | Unclassified | 1246 |
| 575 | Ga0207694_10407911 | 3300025924 | Unclassified | 1130 |
| 576 | Ga0207694_10599050 | 3300025924 | Bacteria | 927 |
| 577 | Ga0207650_10038154 | 3300025925 | Unclassified | 3506 |
| 578 | Ga0207650_10069075 | 3300025925 | Bacteria | 2654 |
| 579 | Ga0207650_11191152 | 3300025925 | Unclassified | 648 |
| 580 | Ga0207650_11303171 | 3300025925 | Unclassified | 618 |
| 581 | Ga0207659_10717915 | 3300025926 | Unclassified | 856 |
| 582 | Ga0207687_10043764 | 3300025927 | Bacteria | 3086 |
| 583 | Ga0207687_10062389 | 3300025927 | Bacteria | 2635 |
| 584 | Ga0207687_10072422 | 3300025927 | Unclassified | 2465 |
| 585 | Ga0207687_10396406 | 3300025927 | Unclassified | 1134 |
| 586 | Ga0207687_10528461 | 3300025927 | Bacteria | 987 |
| 587 | Ga0207687_10635658 | 3300025927 | Unclassified | 902 |
| 588 | Ga0207700_10210461 | 3300025928 | Bacteria | 1644 |
| 589 | Ga0207664_10185984 | 3300025929 | Bacteria | 1786 |
| 590 | Ga0207644_10029295 | 3300025931 | Bacteria | 3818 |
| 591 | Ga0207690_10814548 | 3300025932 | Unclassified | 772 |
| 592 | Ga0207706_10173511 | 3300025933 | Bacteria | 1894 |
| 593 | Ga0207706_10593905 | 3300025933 | Bacteria | 951 |
| 594 | Ga0207706_10616808 | 3300025933 | Bacteria | 931 |
| 595 | Ga0207686_10010868 | 3300025934 | Bacteria | 4965 |
| 596 | Ga0207686_10015491 | 3300025934 | Bacteria | 4264 |
| 597 | Ga0207686_10085792 | 3300025934 | Bacteria | 2066 |
| 598 | Ga0207686_10187590 | 3300025934 | Bacteria | 1471 |
| 599 | Ga0207686_10376717 | 3300025934 | Bacteria | 1075 |
| 600 | Ga0207686_10693843 | 3300025934 | Bacteria | 809 |
| 601 | Ga0207686_10977489 | 3300025934 | Unclassified | 686 |
| 602 | Ga0207709_10068291 | 3300025935 | Unclassified | 2246 |
| 603 | Ga0207709_10144060 | 3300025935 | Bacteria | 1642 |
| 604 | Ga0207709_11512560 | 3300025935 | Bacteria | 557 |
| 605 | Ga0207670_10088621 | 3300025936 | Unclassified | 2183 |
| 606 | Ga0207670_10120844 | 3300025936 | Bacteria | 1904 |
| 607 | Ga0207670_10134549 | 3300025936 | Unclassified | 1816 |
| 608 | Ga0207670_10168595 | 3300025936 | Bacteria | 1640 |
| 609 | Ga0207670_10210137 | 3300025936 | Unclassified | 1484 |
| 610 | Ga0207670_10521001 | 3300025936 | Bacteria | 968 |
| 611 | Ga0207669_10052164 | 3300025937 | Bacteria | 2455 |
| 612 | Ga0207669_10357591 | 3300025937 | Unclassified | 1130 |
| 613 | Ga0207669_10431816 | 3300025937 | Unclassified | 1039 |
| 614 | Ga0207669_11014260 | 3300025937 | Bacteria | 698 |
| 615 | Ga0207704_10019536 | 3300025938 | Bacteria | 3561 |
| 616 | Ga0207704_10026253 | 3300025938 | Bacteria | 3193 |
| 617 | Ga0207704_10116127 | 3300025938 | Unclassified | 1820 |
| 618 | Ga0207704_10228136 | 3300025938 | Unclassified | 1383 |
| 619 | Ga0207704_10416772 | 3300025938 | Bacteria | 1064 |
| 620 | Ga0207704_10809041 | 3300025938 | Unclassified | 783 |
| 621 | Ga0207665_10436366 | 3300025939 | Unclassified | 1003 |
| 622 | Ga0207691_10045534 | 3300025940 | Bacteria | 4032 |
| 623 | Ga0207691_10354092 | 3300025940 | Bacteria | 1256 |
| 624 | Ga0207691_10372867 | 3300025940 | Unclassified | 1219 |
| 625 | Ga0207691_11022346 | 3300025940 | Unclassified | 689 |
| 626 | Ga0207711_10008949 | 3300025941 | Bacteria | 8370 |
| 627 | Ga0207711_10080290 | 3300025941 | Bacteria | 2849 |
| 628 | Ga0207711_10153540 | 3300025941 | Bacteria | 2079 |
| 629 | Ga0207711_10373103 | 3300025941 | Bacteria | 1323 |
| 630 | Ga0207711_10595343 | 3300025941 | Bacteria | 1032 |
| 631 | Ga0207711_10625645 | 3300025941 | Bacteria | 1004 |
| 632 | Ga0207711_11144350 | 3300025941 | Bacteria | 719 |
| 633 | Ga0207689_10270546 | 3300025942 | Bacteria | 1407 |
| 634 | Ga0207689_10298220 | 3300025942 | Archaea | 1336 |
| 635 | Ga0207689_10327773 | 3300025942 | Bacteria | 1271 |
| 636 | Ga0207689_10363062 | 3300025942 | Unclassified | 1204 |
| 637 | Ga0207661_10427847 | 3300025944 | Bacteria | 1203 |
| 638 | Ga0207661_10716112 | 3300025944 | Bacteria | 921 |
| 639 | Ga0207661_11932448 | 3300025944 | Bacteria | 536 |
| 640 | Ga0207679_10637855 | 3300025945 | Unclassified | 963 |
| 641 | Ga0207679_11674956 | 3300025945 | Unclassified | 582 |
| 642 | Ga0207667_10067017 | 3300025949 | Bacteria | 3740 |
| 643 | Ga0207667_11233625 | 3300025949 | Bacteria | 726 |
| 644 | Ga0207667_11770240 | 3300025949 | Unclassified | 583 |
| 645 | Ga0207651_10027217 | 3300025960 | Bacteria | 3588 |
| 646 | Ga0207651_10660653 | 3300025960 | Unclassified | 918 |
| 647 | Ga0207651_11538515 | 3300025960 | Unclassified | 599 |
| 648 | Ga0207712_10061732 | 3300025961 | Bacteria | 2661 |
| 649 | Ga0207712_10131352 | 3300025961 | Bacteria | 1909 |
| 650 | Ga0207712_10171490 | 3300025961 | Bacteria | 1696 |
| 651 | Ga0207712_10353745 | 3300025961 | Unclassified | 1222 |
| 652 | Ga0207712_10374165 | 3300025961 | Bacteria | 1190 |
| 653 | Ga0207712_10420628 | 3300025961 | Unclassified | 1127 |
| 654 | Ga0207668_10203238 | 3300025972 | Bacteria | 1579 |
| 655 | Ga0207668_10258593 | 3300025972 | Unclassified | 1417 |
| 656 | Ga0207668_11006235 | 3300025972 | Unclassified | 745 |
| 657 | Ga0207640_10008160 | 3300025981 | Bacteria | 5800 |
| 658 | Ga0207640_10162521 | 3300025981 | Archaea | 1654 |
| 659 | Ga0207640_10205546 | 3300025981 | Bacteria | 1496 |
| 660 | Ga0207640_10242832 | 3300025981 | Bacteria | 1393 |
| 661 | Ga0207640_10273067 | 3300025981 | Bacteria | 1324 |
| 662 | Ga0207640_10736401 | 3300025981 | Unclassified | 849 |
| 663 | Ga0207640_11058162 | 3300025981 | Bacteria | 716 |
| 664 | Ga0207658_10032776 | 3300025986 | Bacteria | 3701 |
| 665 | Ga0207658_10226416 | 3300025986 | Unclassified | 1576 |
| 666 | Ga0207658_10467504 | 3300025986 | Unclassified | 1119 |
| 667 | Ga0207677_10014296 | 3300026023 | Unclassified | 4631 |
| 668 | Ga0207677_10111962 | 3300026023 | Unclassified | 2034 |
| 669 | Ga0207677_10218920 | 3300026023 | Unclassified | 1526 |
| 670 | Ga0207677_10303698 | 3300026023 | Unclassified | 1319 |
| 671 | Ga0207677_11414909 | 3300026023 | Unclassified | 641 |
| 672 | Ga0207703_10002624 | 3300026035 | Bacteria | 15514 |
| 673 | Ga0207703_10009543 | 3300026035 | Bacteria | 7616 |
| 674 | Ga0207703_10012767 | 3300026035 | Bacteria | 6549 |
| 675 | Ga0207703_10017991 | 3300026035 | Bacteria | 5519 |
| 676 | Ga0207703_10094838 | 3300026035 | Bacteria | 2516 |
| 677 | Ga0207703_10145654 | 3300026035 | Bacteria | 2060 |
| 678 | Ga0207703_10182392 | 3300026035 | Bacteria | 1853 |
| 679 | Ga0207703_10294448 | 3300026035 | Bacteria | 1478 |
| 680 | Ga0207703_10436146 | 3300026035 | Bacteria | 1221 |
| 681 | Ga0207703_10468546 | 3300026035 | Unclassified | 1179 |
| 682 | Ga0207703_10916667 | 3300026035 | Bacteria | 839 |
| 683 | Ga0207639_10981557 | 3300026041 | Unclassified | 791 |
| 684 | Ga0207678_10322100 | 3300026067 | Bacteria | 1330 |
| 685 | Ga0207678_10561462 | 3300026067 | Bacteria | 999 |
| 686 | Ga0207708_10011994 | 3300026075 | Bacteria | 6457 |
| 687 | Ga0207708_10069702 | 3300026075 | Unclassified | 2692 |
| 688 | Ga0207708_11944470 | 3300026075 | Unclassified | 515 |
| 689 | Ga0207702_10221233 | 3300026078 | Bacteria | 1764 |
| 690 | Ga0207641_10000431 | 3300026088 | Bacteria | 48383 |
| 691 | Ga0207641_10061731 | 3300026088 | Bacteria | 3197 |
| 692 | Ga0207641_10119650 | 3300026088 | Unclassified | 2348 |
| 693 | Ga0207641_10478989 | 3300026088 | Unclassified | 1206 |
| 694 | Ga0207641_10558391 | 3300026088 | Bacteria | 1117 |
| 695 | Ga0207641_10614722 | 3300026088 | Bacteria | 1065 |
| 696 | Ga0207641_11127048 | 3300026088 | Unclassified | 783 |
| 697 | Ga0207648_10039267 | 3300026089 | Bacteria | 4163 |
| 698 | Ga0207648_10039354 | 3300026089 | Bacteria | 4158 |
| 699 | Ga0207648_10090480 | 3300026089 | Bacteria | 2674 |
| 700 | Ga0207648_10145411 | 3300026089 | Bacteria | 2091 |
| 701 | Ga0207648_10171174 | 3300026089 | Bacteria | 1920 |
| 702 | Ga0207648_10373104 | 3300026089 | Bacteria | 1289 |
| 703 | Ga0207648_10375418 | 3300026089 | Unclassified | 1285 |
| 704 | Ga0207648_10533835 | 3300026089 | Unclassified | 1076 |
| 705 | Ga0207676_10010449 | 3300026095 | Bacteria | 6611 |
| 706 | Ga0207676_10046046 | 3300026095 | Bacteria | 3373 |
| 707 | Ga0207676_10459544 | 3300026095 | Bacteria | 1202 |
| 708 | Ga0207676_10769504 | 3300026095 | Unclassified | 937 |
| 709 | Ga0207676_11050227 | 3300026095 | Bacteria | 804 |
| 710 | Ga0207676_11276912 | 3300026095 | Bacteria | 729 |
| 711 | Ga0207674_10075381 | 3300026116 | Bacteria | 3383 |
| 712 | Ga0207674_10549242 | 3300026116 | Unclassified | 1116 |
| 713 | Ga0207675_100000451 | 3300026118 | Bacteria | 39879 |
| 714 | Ga0207675_100023793 | 3300026118 | Bacteria | 5700 |
| 715 | Ga0207675_100091896 | 3300026118 | Bacteria | 2854 |
| 716 | Ga0207675_100097464 | 3300026118 | Bacteria | 2769 |
| 717 | Ga0207675_100109946 | 3300026118 | Bacteria | 2601 |
| 718 | Ga0207675_100369060 | 3300026118 | Bacteria | 1409 |
| 719 | Ga0207675_100382164 | 3300026118 | Archaea | 1385 |
| 720 | Ga0207675_100630923 | 3300026118 | Bacteria | 1077 |
| 721 | Ga0207675_100685086 | 3300026118 | Bacteria | 1033 |
| 722 | Ga0207683_10345997 | 3300026121 | Unclassified | 1364 |
| 723 | Ga0207683_10486360 | 3300026121 | Bacteria | 1139 |
| 724 | Ga0207683_10769344 | 3300026121 | Unclassified | 893 |
| 725 | Ga0207683_10788125 | 3300026121 | Bacteria | 882 |
| 726 | Ga0207698_10761856 | 3300026142 | Unclassified | 968 |
| 727 | Ga0207698_10869643 | 3300026142 | Bacteria | 907 |
| 728 | Ga0207428_10027043 | 3300027907 | Bacteria | 4778 |
| 729 | Ga0207428_10028926 | 3300027907 | Unclassified | 4599 |
| 730 | Ga0268266_10017418 | 3300028379 | Bacteria | 6127 |
| 731 | Ga0268266_10134496 | 3300028379 | Bacteria | 2213 |
| 732 | Ga0268266_10220479 | 3300028379 | Bacteria | 1743 |
| 733 | Ga0268265_10006219 | 3300028380 | Bacteria | 8091 |
| 734 | Ga0268265_10072450 | 3300028380 | Unclassified | 2687 |
| 735 | Ga0268265_10116068 | 3300028380 | Bacteria | 2196 |
| 736 | Ga0268265_10329188 | 3300028380 | Unclassified | 1387 |
| 737 | Ga0268265_10360436 | 3300028380 | Bacteria | 1331 |
| 738 | Ga0268265_10729509 | 3300028380 | Unclassified | 960 |
| 739 | Ga0268264_10010017 | 3300028381 | Bacteria | 7848 |
| 740 | Ga0268264_10052316 | 3300028381 | Bacteria | 3405 |
| 741 | Ga0268264_10196853 | 3300028381 | Unclassified | 1841 |
| 742 | Ga0268264_10343458 | 3300028381 | Unclassified | 1419 |
| 743 | Ga0268264_10473224 | 3300028381 | Bacteria | 1217 |
| 744 | Ga0268264_10878800 | 3300028381 | Unclassified | 899 |
| 745 | Ga0268264_12107419 | 3300028381 | Unclassified | 572 |
| 746 | Ga0265336_10036910 | 3300028666 | Bacteria | 1504 |
| 747 | Ga0307511_10176907 | 3300030521 | Unclassified | 1159 |
| 748 | Ga0265332_10066482 | 3300031238 | Unclassified | 1538 |
| 749 | Ga0307408_100271106 | 3300031548 | Unclassified | 1409 |
| 750 | Ga0265314_10182069 | 3300031711 | Bacteria | 1258 |
| 751 | Ga0307416_100159382 | 3300032002 | Unclassified | 2083 |
| 752 | Ga0307416_101510812 | 3300032002 | Bacteria | 777 |
| 753 | Ga0307416_102227940 | 3300032002 | Unclassified | 649 |
| 754 | Ga0373930_0001025 | 3300034816 | Bacteria | 4023 |
| 755 | Ga0373948_0000373 | 3300034817 | Bacteria | 5512 |
| 756 | Ga0373950_0000439 | 3300034818 | Bacteria | 5085 |
| 757 | Ga0373958_0000173 | 3300034819 | Bacteria | 7331 |
| 758 | Ga0373959_0001608 | 3300034820 | Bacteria | 3596 |
| 759 | Ga0373959_0071576 | 3300034820 | Unclassified | 785 |
| 760 | Ga0373959_0144825 | 3300034820 | Unclassified | 597 |
| 761 | Ga0373926_0329028 | 3300035083 | Unclassified | 598 |
| 762 | Ga0373926_0441988 | 3300035083 | Bacteria | 516 |
| 763 | Ga0373928_0007057 | 3300035084 | Unclassified | 2165 |
| 764 | Ga0373929_0042093 | 3300035085 | Bacteria | 1018 |
| 765 | Ga0373934_0120797 | 3300035086 | Unclassified | 1066 |
| 766 | Ga0373934_0221941 | 3300035086 | Bacteria | 780 |
| 767 | Ga0373949_0008821 | 3300035090 | Bacteria | 2205 |
| 768 | Ga0373949_0071268 | 3300035090 | Bacteria | 911 |
| 769 | Ga0373951_0001298 | 3300035091 | Bacteria | 6595 |
| 770 | Ga0373952_0000050 | 3300035092 | Bacteria | 14460 |
| 771 | Ga0373932_0000603 | 3300035112 | Bacteria | 10893 |
| 772 | Ga0373936_0169584 | 3300035113 | Bacteria | 954 |
| 773 | Ga0373939_0000156 | 3300035114 | Bacteria | 19023 |
| 774 | Ga0373939_0292021 | 3300035114 | Bacteria | 647 |
| 775 | Ga0373941_0000433 | 3300035115 | Bacteria | 8301 |
| 776 | Ga0373941_0164279 | 3300035115 | Bacteria | 823 |
| 777 | Ga0373945_0025007 | 3300035116 | Unclassified | 2072 |
| 778 | Ga0373945_0220194 | 3300035116 | Bacteria | 794 |
| 779 | Ga0373953_0286486 | 3300035117 | Unclassified | 718 |
| 780 | Ga0373954_0661335 | 3300035118 | Unclassified | 518 |
| 781 | Ga0373956_0342241 | 3300035119 | Unclassified | 713 |
| 782 | Ga0373956_0350852 | 3300035119 | Unclassified | 703 |
| 783 | Ga0373960_0000998 | 3300035121 | Bacteria | 6078 |
| 784 | Ga0373943_0035898 | 3300035170 | Bacteria | 2372 |
| 785 | Ga0373943_0129533 | 3300035170 | Bacteria | 1349 |
| 786 | Ga0373946_0004665 | 3300035171 | Bacteria | 4920 |
| 787 | Ga0373946_0583527 | 3300035171 | Bacteria | 579 |
| 788 | Ga0373955_0004533 | 3300035172 | Bacteria | 6156 |
| 789 | Ga0373955_0072855 | 3300035172 | Bacteria | 1925 |
| 790 | Ga0373955_0478032 | 3300035172 | Unclassified | 760 |
| 791 | Ga0373955_0588153 | 3300035172 | Unclassified | 681 |
| 792 | Ga0373955_0620118 | 3300035172 | Unclassified | 663 |
| 793 | Ga0373942_0002127 | 3300035207 | Bacteria | 4905 |
| 794 | Ga0373961_0002123 | 3300035241 | Bacteria | 5259 |
| 795 | Ga0373961_0121940 | 3300035241 | Bacteria | 865 |
| 796 | Ga0373961_0124021 | 3300035241 | Bacteria | 859 |
| 797 | Ga0373962_0000316 | 3300035242 | Bacteria | 10486 |
| 798 | Ga0373962_0115701 | 3300035242 | Bacteria | 850 |
| 799 | Ga0373924_0289929 | 3300035410 | Unclassified | 726 |
| 800 | Ga0373931_0000411 | 3300035691 | Bacteria | 17541 |
| 801 | Ga0373931_0254505 | 3300035691 | Bacteria | 1069 |
| 802 | Ga0373931_1021763 | 3300035691 | Bacteria | 560 |
| 803 | Ga0373931_1301281 | 3300035691 | Bacteria | 500 |
| 804 | Ga0373935_0306490 | 3300035692 | Unclassified | 1124 |
| 805 | Ga0373927_0875987 | 3300035695 | Unclassified | 593 |
| 806 | Ga0373933_0108709 | 3300035724 | Bacteria | 1728 |
| 807 | Ga0373933_0177633 | 3300035724 | Bacteria | 1357 |
| 808 | Ga0373933_0718955 | 3300035724 | Unclassified | 657 |
| 809 | Ga0373947_0011952 | 3300035725 | Bacteria | 4974 |
| 810 | Ga0373937_0102381 | 3300036401 | Bacteria | 2659 |
| 811 | Ga0373937_0289905 | 3300036401 | Unclassified | 1546 |
| 812 | Ga0373937_0338632 | 3300036401 | Unclassified | 1424 |
| 813 | Ga0373937_0465146 | 3300036401 | Unclassified | 1201 |
| 814 | Ga0373937_0552941 | 3300036401 | Bacteria | 1093 |
| 815 | Ga0373937_0697287 | 3300036401 | Bacteria | 962 |
| 816 | Ga0373937_0740509 | 3300036401 | Unclassified | 930 |
| 817 | Ga0373937_0999142 | 3300036401 | Unclassified | 785 |
| 818 | Ga0373937_1125816 | 3300036401 | Unclassified | 734 |
| 819 | Ga0373937_1169834 | 3300036401 | Unclassified | 718 |
| 820 | Ga0373937_1209411 | 3300036401 | Bacteria | 704 |
| 821 | Ga0373925_0000987 | 3300037068 | Bacteria | 25925 |
| 822 | Ga0373925_0057437 | 3300037068 | Bacteria | 2916 |
| 823 | Ga0373925_0157527 | 3300037068 | Unclassified | 1787 |
| 824 | Ga0373925_0267622 | 3300037068 | Bacteria | 1374 |
| 825 | Ga0395901_0743187 | 3300038443 | Bacteria | 975 |
| 826 | Ga0436365_0084194 | 3300039437 | Unclassified | 1438 |
| 827 | Ga0436365_0238160 | 3300039437 | Bacteria | 1143 |
| 828 | Ga0451853_2674977 | 3300041512 | Unclassified | 1085 |
| 829 | Ga0451577_0051538 | 3300042876 | Bacteria | 3674 |
| 830 | Ga0451577_0379089 | 3300042876 | Unclassified | 1283 |
| 831 | Ga0453684_0017739 | 3300044712 | Bacteria | 10993 |
| 832 | Ga0453684_0857849 | 3300044712 | Unclassified | 975 |
| 833 | Ga0451576_0007440 | 3300045051 | Bacteria | 13087 |
| 834 | Ga0451576_0162502 | 3300045051 | Bacteria | 2331 |
| 835 | Ga0451576_0343295 | 3300045051 | Bacteria | 1563 |
| 836 | Ga0451576_0607892 | 3300045051 | Bacteria | 1149 |
| 837 | Ga0451576_0721975 | 3300045051 | Bacteria | 1047 |
| 838 | Ga0466967_1574666 | 3300045976 | Bacteria | 654 |
| 839 | Ga0495592_0012201 | 3300046454 | Bacteria | 6521 |
| 840 | Ga0495641_0226491 | 3300046461 | Unclassified | 839 |
| 841 | Ga0495651_0073293 | 3300046462 | Archaea | 2600 |
| 842 | Ga0495653_0730978 | 3300046463 | Unclassified | 599 |
| 843 | Ga0495580_0189503 | 3300046472 | Unclassified | 1419 |
| 844 | Ga0495582_0083522 | 3300046473 | Bacteria | 1775 |
| 845 | Ga0495582_0900727 | 3300046473 | Unclassified | 511 |
| 846 | Ga0495639_0274548 | 3300046475 | Unclassified | 837 |
| 847 | Ga0495664_0249261 | 3300046477 | Unclassified | 1074 |
| 848 | Ga0495664_0656574 | 3300046477 | Unclassified | 621 |
| 849 | Ga0495608_0005369 | 3300046511 | Bacteria | 9155 |
| 850 | Ga0495618_0094139 | 3300046514 | Unclassified | 1916 |
| 851 | Ga0495618_0137210 | 3300046514 | Unclassified | 1565 |
| 852 | Ga0495628_0059757 | 3300046516 | Unclassified | 2992 |
| 853 | Ga0495628_0065349 | 3300046516 | Bacteria | 2846 |
| 854 | Ga0495628_0073643 | 3300046516 | Bacteria | 2661 |
| 855 | Ga0495628_0175127 | 3300046516 | Unclassified | 1625 |
| 856 | Ga0495628_0449592 | 3300046516 | Unclassified | 936 |
| 857 | Ga0495630_0185860 | 3300046517 | Bacteria | 1585 |
| 858 | Ga0495630_0745802 | 3300046517 | Unclassified | 748 |
| 859 | Ga0495652_0043146 | 3300046529 | Bacteria | 3887 |
| 860 | Ga0495640_0275408 | 3300046533 | Unclassified | 1049 |
| 861 | Ga0495640_0327921 | 3300046533 | Bacteria | 947 |
| 862 | Ga0495640_0690988 | 3300046533 | Unclassified | 612 |
| 863 | Ga0495586_0063016 | 3300046535 | Unclassified | 2019 |
| 864 | Ga0495587_0247319 | 3300046536 | Unclassified | 1003 |
| 865 | Ga0495621_0089921 | 3300046539 | Unclassified | 1156 |
| 866 | Ga0495645_0011724 | 3300046543 | Bacteria | 6173 |
| 867 | Ga0495645_0282263 | 3300046543 | Unclassified | 1091 |
| 868 | Ga0495645_0500379 | 3300046543 | Unclassified | 760 |
| 869 | Ga0495634_0199656 | 3300046642 | Bacteria | 1243 |
| 870 | Ga0495634_0251840 | 3300046642 | Bacteria | 1080 |
| 871 | Ga0495635_0099387 | 3300046663 | Bacteria | 1989 |
| 872 | Ga0495635_0611694 | 3300046663 | Unclassified | 711 |
| 873 | Ga0495659_0199978 | 3300046664 | Bacteria | 819 |
| 874 | Ga0495659_0238645 | 3300046664 | Unclassified | 755 |
| 875 | Ga0495657_0133806 | 3300046675 | Unclassified | 1551 |
| 876 | Ga0495599_0136744 | 3300046678 | Unclassified | 1521 |
| 877 | Ga0495599_0205621 | 3300046678 | Bacteria | 1209 |
| 878 | Ga0495623_0136538 | 3300046679 | Bacteria | 1463 |
| 879 | Ga0495623_0630804 | 3300046679 | Unclassified | 554 |
| 880 | Ga0495647_0059355 | 3300046681 | Unclassified | 1506 |
| 881 | Ga0495647_0167242 | 3300046681 | Unclassified | 951 |
| 882 | Ga0495647_0294229 | 3300046681 | Unclassified | 731 |
| 883 | Ga0495658_0008380 | 3300046683 | Bacteria | 5121 |
| 884 | Ga0495658_0059892 | 3300046683 | Bacteria | 2182 |
| 885 | Ga0495658_0082336 | 3300046683 | Bacteria | 1891 |
| 886 | Ga0495658_0182438 | 3300046683 | Unclassified | 1303 |
| 887 | Ga0495658_0260413 | 3300046683 | Bacteria | 1092 |
| 888 | Ga0495658_0591440 | 3300046683 | Bacteria | 711 |
| 889 | Ga0495669_0099799 | 3300046684 | Bacteria | 1348 |
| 890 | Ga0495613_0003872 | 3300046689 | Bacteria | 11197 |
| 891 | Ga0495613_0407509 | 3300046689 | Bacteria | 927 |
| 892 | Ga0495600_0173676 | 3300046809 | Bacteria | 1390 |
| 893 | Ga0495581_0649665 | 3300047315 | Bacteria | 610 |
| 894 | Ga0495604_0857854 | 3300047317 | Unclassified | 569 |
| 895 | Ga0495674_0051920 | 3300047319 | Unclassified | 3612 |
| 896 | Ga0495674_0088764 | 3300047319 | Bacteria | 2644 |
| 897 | Ga0495676_0523271 | 3300047321 | Bacteria | 777 |
| 898 | Ga0495680_0284169 | 3300047322 | Unclassified | 1165 |
| 899 | Ga0495684_0000048 | 3300047471 | Bacteria | 89243 |
| 900 | Ga0495684_0118638 | 3300047471 | Unclassified | 1994 |
| 901 | Ga0495602_0042503 | 3300048088 | Unclassified | 4141 |
| 902 | Ga0495602_0381360 | 3300048088 | Bacteria | 1010 |
| 903 | Ga0496100_0006242 | 3300048903 | Bacteria | 6488 |
| 904 | Ga0496101_0000568 | 3300048904 | Bacteria | 22606 |
| 905 | Ga0496102_0028151 | 3300048905 | Bacteria | 5021 |
| 906 | Ga0496102_0272778 | 3300048905 | Bacteria | 1595 |
| 907 | Ga0496102_0398631 | 3300048905 | Unclassified | 1294 |
| 908 | Ga0496102_0431283 | 3300048905 | Bacteria | 1238 |
| 909 | Ga0496102_0454865 | 3300048905 | Bacteria | 1201 |
| 910 | Ga0496102_0500096 | 3300048905 | Bacteria | 1138 |
| 911 | Ga0496102_0931147 | 3300048905 | Bacteria | 790 |
| 912 | Ga0496104_0007988 | 3300048907 | Bacteria | 9381 |
| 913 | Ga0496104_0011911 | 3300048907 | Bacteria | 7801 |
| 914 | Ga0496104_0106270 | 3300048907 | Unclassified | 2690 |
| 915 | Ga0496105_0020589 | 3300048908 | Bacteria | 5332 |
| 916 | Ga0496105_0221111 | 3300048908 | Bacteria | 1542 |
| 917 | Ga0496105_0756948 | 3300048908 | Bacteria | 741 |
| 918 | Ga0496106_0109049 | 3300048909 | Bacteria | 2154 |
| 919 | Ga0496106_0205250 | 3300048909 | Unclassified | 1569 |
| 920 | Ga0496107_0153272 | 3300048910 | Unclassified | 1705 |
| 921 | Ga0496107_0479762 | 3300048910 | Bacteria | 923 |
| 922 | Ga0496107_0531596 | 3300048910 | Bacteria | 871 |
| 923 | Ga0496108_0016941 | 3300048911 | Bacteria | 5956 |
| 924 | Ga0496108_0262892 | 3300048911 | Bacteria | 1502 |
| 925 | Ga0496108_0326148 | 3300048911 | Bacteria | 1339 |
| 926 | Ga0496109_0040181 | 3300048912 | Bacteria | 4236 |
| 927 | Ga0496109_0175026 | 3300048912 | Bacteria | 2014 |
| 928 | Ga0496109_0266525 | 3300048912 | Unclassified | 1614 |
| 929 | Ga0496109_1026918 | 3300048912 | Bacteria | 762 |
| 930 | Ga0496110_0035448 | 3300048913 | Bacteria | 4328 |
| 931 | Ga0496110_1501628 | 3300048913 | Unclassified | 584 |
| 932 | Ga0496111_0237034 | 3300048914 | Unclassified | 1355 |
| 933 | Ga0496111_0737796 | 3300048914 | Unclassified | 715 |
| 934 | Ga0496112_0019763 | 3300048915 | Bacteria | 6368 |
| 935 | Ga0496112_0075966 | 3300048915 | Bacteria | 3323 |
| 936 | Ga0496112_0107372 | 3300048915 | Bacteria | 2761 |
| 937 | Ga0496112_0196445 | 3300048915 | Unclassified | 1978 |
| 938 | Ga0496112_0262404 | 3300048915 | Bacteria | 1677 |
| 939 | Ga0496112_0281626 | 3300048915 | Bacteria | 1610 |
| 940 | Ga0496112_0442508 | 3300048915 | Bacteria | 1238 |
| 941 | Ga0496112_0523581 | 3300048915 | Bacteria | 1120 |
| 942 | Ga0496112_1079419 | 3300048915 | Unclassified | 721 |
| 943 | Ga0496113_0021085 | 3300048916 | Bacteria | 4593 |
| 944 | Ga0496113_0080583 | 3300048916 | Bacteria | 2494 |
| 945 | Ga0496113_0781848 | 3300048916 | Bacteria | 759 |
| 946 | Ga0496113_1050705 | 3300048916 | Bacteria | 640 |
| 947 | Ga0496113_1509650 | 3300048916 | Bacteria | 518 |
| 948 | Ga0496114_0048279 | 3300048917 | Bacteria | 3541 |
| 949 | Ga0496114_0159689 | 3300048917 | Unclassified | 1959 |
| 950 | Ga0496114_0161096 | 3300048917 | Unclassified | 1951 |
| 951 | Ga0496114_0204813 | 3300048917 | Unclassified | 1729 |
| 952 | Ga0496114_0327955 | 3300048917 | Bacteria | 1353 |
| 953 | Ga0496115_0328621 | 3300048918 | Bacteria | 1250 |
| 954 | Ga0496115_0407622 | 3300048918 | Unclassified | 1102 |
| 955 | Ga0501033_1018427 | 3300049570 | Unclassified | 553 |
| 956 | Ga0501036_0054613 | 3300049572 | Bacteria | 3384 |
| 957 | Ga0501038_0245814 | 3300049574 | Unclassified | 1419 |
| 958 | Ga0501038_0322724 | 3300049574 | Bacteria | 1208 |
| 959 | Ga0501040_0483316 | 3300049576 | Bacteria | 892 |
| 960 | Ga0501040_1410210 | 3300049576 | Unclassified | 506 |
| 961 | Ga0501042_0215160 | 3300049578 | Bacteria | 1386 |
| 962 | Ga0501043_0580818 | 3300049579 | Bacteria | 830 |
| 963 | Ga0501047_0939033 | 3300049581 | Unclassified | 678 |
| 964 | Ga0501067_0289629 | 3300049583 | Bacteria | 912 |
| 965 | Ga0501067_0481334 | 3300049583 | Unclassified | 694 |
| 966 | Ga0501069_0307261 | 3300049585 | Bacteria | 931 |
| 967 | Ga0501070_0455063 | 3300049586 | Bacteria | 1032 |
| 968 | Ga0501071_0312005 | 3300049587 | Bacteria | 1193 |
| 969 | Ga0501072_0270399 | 3300049588 | Unclassified | 1352 |
| 970 | Ga0501074_0235859 | 3300049590 | Bacteria | 1302 |
| 971 | Ga0501075_0012334 | 3300049591 | Bacteria | 6073 |
| 972 | Ga0501075_0230492 | 3300049591 | Bacteria | 1412 |
| 973 | Ga0501075_0509874 | 3300049591 | Bacteria | 918 |
| 974 | Ga0501076_0300744 | 3300049592 | Bacteria | 1315 |
| 975 | Ga0501083_0021015 | 3300049744 | Bacteria | 4537 |
| 976 | Ga0501045_0206848 | 3300049824 | Bacteria | 1462 |
| 977 | nmdc:mga05p37_1041614_c1 | 3300050507 | Bacteria | 864 |
| 978 | nmdc:mga05p37_11139_c1 | 3300050507 | Bacteria | 10685 |
| 979 | nmdc:mga05p37_114290_c1 | 3300050507 | Bacteria | 3318 |
| 980 | nmdc:mga05p37_133487_c1 | 3300050507 | Bacteria | 3045 |
| 981 | nmdc:mga05p37_162938_c1 | 3300050507 | Bacteria | 2723 |
| 982 | nmdc:mga05p37_21081_c1 | 3300050507 | Bacteria | 7888 |
| 983 | nmdc:mga05p37_21329_c1 | 3300050507 | Bacteria | 7843 |
| 984 | nmdc:mga05p37_21681_c1 | 3300050507 | Bacteria | 7782 |
| 985 | nmdc:mga05p37_26367_c1 | 3300050507 | Bacteria | 7068 |
| 986 | nmdc:mga05p37_27602_c1 | 3300050507 | Bacteria | 6913 |
| 987 | nmdc:mga05p37_586457_c1 | 3300050507 | Unclassified | 1261 |
| 988 | nmdc:mga05p37_602696_c1 | 3300050507 | Bacteria | 1239 |
| 989 | nmdc:mga05p37_901647_c1 | 3300050507 | Unclassified | 953 |
| 990 | nmdc:mga09592_1612446_c1 | 3300050508 | Bacteria | 525 |
| 991 | nmdc:mga09592_23225_c1 | 3300050508 | Bacteria | 5121 |
| 992 | nmdc:mga06r32_166679_c1 | 3300050510 | Bacteria | 2186 |
| 993 | nmdc:mga06r32_434910_c1 | 3300050510 | Bacteria | 1293 |
| 994 | nmdc:mga08y16_14872_c1 | 3300050511 | Bacteria | 8183 |
| 995 | nmdc:mga08y16_25097_c1 | 3300050511 | Bacteria | 6287 |
| 996 | nmdc:mga08y16_411517_c1 | 3300050511 | Bacteria | 1383 |
| 997 | nmdc:mga08y16_4545_c1 | 3300050511 | Bacteria | 14463 |
| 998 | nmdc:mga08y16_49080_c1 | 3300050511 | Unclassified | 4417 |
| 999 | nmdc:mga08y16_707011_c1 | 3300050511 | Bacteria | 1007 |
| 1000 | nmdc:mga08y16_846761_c1 | 3300050511 | Bacteria | 904 |
| 1001 | nmdc:mga0n895_111_c1 | 3300050512 | Bacteria | 48235 |
| 1002 | nmdc:mga0n895_1544322_c1 | 3300050512 | Unclassified | 629 |
| 1003 | nmdc:mga0n895_165469_c1 | 3300050512 | Bacteria | 2243 |
| 1004 | nmdc:mga0n895_178403_c1 | 3300050512 | Unclassified | 2155 |
| 1005 | nmdc:mga0n895_194660_c1 | 3300050512 | Unclassified | 2059 |
| 1006 | nmdc:mga0n895_198225_c1 | 3300050512 | Bacteria | 2039 |
| 1007 | nmdc:mga0n895_24015_c1 | 3300050512 | Bacteria | 5739 |
| 1008 | nmdc:mga0n895_331102_c1 | 3300050512 | Bacteria | 1543 |
| 1009 | nmdc:mga0n895_398495_c1 | 3300050512 | Bacteria | 1392 |
| 1010 | nmdc:mga0n895_5089_c1 | 3300050512 | Bacteria | 10920 |
| 1011 | nmdc:mga0n895_5595_c1 | 3300050512 | Archaea | 10520 |
| 1012 | nmdc:mga0n895_568151_c1 | 3300050512 | Bacteria | 1139 |
| 1013 | nmdc:mga0n895_891361_c1 | 3300050512 | Bacteria | 875 |
| 1014 | nmdc:mga0rr50_15819_c1 | 3300050513 | Bacteria | 4990 |
| 1015 | nmdc:mga0rr50_237654_c1 | 3300050513 | Bacteria | 1509 |
| 1016 | nmdc:mga0rr50_28606_c1 | 3300050513 | Bacteria | 3920 |
| 1017 | nmdc:mga0rr50_320502_c1 | 3300050513 | Bacteria | 1299 |
| 1018 | nmdc:mga0rr50_39119_c1 | 3300050513 | Bacteria | 3438 |
| 1019 | nmdc:mga0rr50_57_c1 | 3300050513 | Bacteria | 67718 |
| 1020 | nmdc:mga0rr50_61256_c1 | 3300050513 | Bacteria | 2834 |
| 1021 | nmdc:mga0rr50_636089_c1 | 3300050513 | Bacteria | 910 |
| 1022 | nmdc:mga0rr50_757019_c1 | 3300050513 | Bacteria | 829 |
| 1023 | nmdc:mga0rr50_8523_c1 | 3300050513 | Bacteria | 6386 |
| 1024 | nmdc:mga08x19_159863_c1 | 3300050514 | Bacteria | 1530 |
| 1025 | nmdc:mga08x19_28391_c1 | 3300050514 | Bacteria | 3504 |
| 1026 | nmdc:mga08x19_426_c1 | 3300050514 | Bacteria | 28960 |
| 1027 | nmdc:mga08x19_48296_c1 | 3300050514 | Bacteria | 2726 |
| 1028 | nmdc:mga08x19_56202_c1 | 3300050514 | Bacteria | 2540 |
| 1029 | nmdc:mga08x19_619912_c1 | 3300050514 | Bacteria | 767 |
| 1030 | nmdc:mga08x19_706426_c1 | 3300050514 | Unclassified | 716 |
| 1031 | nmdc:mga08x19_751684_c1 | 3300050514 | Bacteria | 692 |
| 1032 | nmdc:mga08x19_89635_c1 | 3300050514 | Bacteria | 2029 |
| 1033 | nmdc:mga08x19_9426_c1 | 3300050514 | Bacteria | 5847 |
| 1034 | nmdc:mga0a205_198681_c1 | 3300050515 | Bacteria | 1896 |
| 1035 | nmdc:mga0a205_204751_c1 | 3300050515 | Unclassified | 1863 |
| 1036 | nmdc:mga0a205_45262_c1 | 3300050515 | Bacteria | 4243 |
| 1037 | nmdc:mga0a205_56158_c1 | 3300050515 | Bacteria | 1632 |
| 1038 | nmdc:mga0a205_72168_c1 | 3300050515 | Bacteria | 3335 |
| 1039 | nmdc:mga0a205_747481_c1 | 3300050515 | Bacteria | 827 |
| 1040 | nmdc:mga0a205_753681_c1 | 3300050515 | Bacteria | 822 |
| 1041 | nmdc:mga0a205_790368_c1 | 3300050515 | Unclassified | 797 |
| 1042 | nmdc:mga0a205_822545_c1 | 3300050515 | Bacteria | 776 |
| 1043 | nmdc:mga0a205_93806_c1 | 3300050515 | Bacteria | 2900 |
| 1044 | nmdc:mga0a205_94532_c1 | 3300050515 | Bacteria | 2888 |
| 1045 | Ga0495601_0075643 | 3300053077 | Bacteria | 2155 |
| 1046 | Ga0495601_0251258 | 3300053077 | Bacteria | 1155 |
| 1047 | Ga0495601_0277871 | 3300053077 | Unclassified | 1092 |
| 1048 | Ga0495601_0544148 | 3300053077 | Unclassified | 747 |
| 1049 | Ga0495595_0043907 | 3300053084 | Unclassified | 2052 |
| 1050 | Ga0495595_0233737 | 3300053084 | Bacteria | 919 |
| 1051 | Ga0495619_0001542 | 3300053085 | Bacteria | 15176 |
| 1052 | Ga0495619_0048944 | 3300053085 | Unclassified | 2786 |
| 1053 | Ga0495619_0096024 | 3300053085 | Unclassified | 2012 |
| 1054 | Ga0495619_0121354 | 3300053085 | Unclassified | 1792 |
| 1055 | Ga0495619_0161604 | 3300053085 | Unclassified | 1547 |
| 1056 | Ga0495619_0271887 | 3300053085 | Unclassified | 1174 |
| 1057 | Ga0495619_0320123 | 3300053085 | Unclassified | 1074 |
| 1058 | Ga0500658_0549302 | 3300053134 | Unclassified | 520 |
| 1059 | Ga0501084_0112280 | 3300054114 | Bacteria | 2290 |
| 1060 | Ga0501082_1230046 | 3300060353 | Unclassified | 654 |
| 1061 | Ga0530510_0970841 | 3300061734 | Unclassified | 650 |
| 1062 | Ga0373943_0306507 | |||
| 1063 | JGI24751J29686_10012579 | |||
| 1064 | JGI24751J29686_10044217 | |||
| 1065 | Ga0065712_10148007 | |||
| 1066 | Ga0065715_10384793 | |||
| 1067 | Ga0065707_10157319 | |||
| 1068 | Ga0065707_10191325 | |||
| 1069 | Ga0065707_10205317 | |||
| 1070 | Ga0065707_10319448 | |||
| 1071 | Ga0065707_10583303 | |||
| 1072 | Ga0070658_10483153 | |||
| 1073 | Ga0070676_10115767 | |||
| 1074 | Ga0070676_10123158 | |||
| 1075 | Ga0070676_10359237 | |||
| 1076 | Ga0070676_10696412 | |||
| 1077 | Ga0070683_100170189 | |||
| 1078 | Ga0070683_100497961 | |||
| 1079 | Ga0070683_100627553 | |||
| 1080 | Ga0070683_100722234 | |||
| 1081 | Ga0070690_100398767 | |||
| 1082 | Ga0070690_100435412 | |||
| 1083 | Ga0070690_100598409 | |||
| 1084 | Ga0070690_101297730 | |||
| 1085 | Ga0070670_100014064 | |||
| 1086 | Ga0070670_100021276 | |||
| 1087 | Ga0070670_100185649 | |||
| 1088 | Ga0068869_100076880 | |||
| 1089 | Ga0068869_100636507 | |||
| 1090 | Ga0068869_100659117 | |||
| 1091 | Ga0068869_100844563 | |||
| 1092 | Ga0070666_10045979 | |||
| 1093 | Ga0070666_10163928 | |||
| 1094 | Ga0070666_10364946 | |||
| 1095 | Ga0070666_10377732 | |||
| 1096 | Ga0070666_10627384 | |||
| 1097 | Ga0070680_100058133 | |||
| 1098 | Ga0070680_100285818 | |||
| 1099 | Ga0070680_100806518 | |||
| 1100 | Ga0070682_100144394 | |||
| 1101 | Ga0068868_100012388 | |||
| 1102 | Ga0068868_100136074 | |||
| 1103 | Ga0068868_100477807 | |||
| 1104 | Ga0070660_100006784 | |||
| 1105 | Ga0070660_100369439 | |||
| 1106 | Ga0070689_100073746 | |||
| 1107 | Ga0070689_100179496 | |||
| 1108 | Ga0070689_100223377 | |||
| 1109 | Ga0070689_100241364 | |||
| 1110 | Ga0070689_100275984 | |||
| 1111 | Ga0070689_100319565 | |||
| 1112 | Ga0070689_100962510 | |||
| 1113 | Ga0070691_10076314 | |||
| 1114 | Ga0070691_10115901 | |||
| 1115 | Ga0070687_100240007 | |||
| 1116 | Ga0070687_100247144 | |||
| 1117 | Ga0070661_101241160 | |||
| 1118 | Ga0070692_10086978 | |||
| 1119 | Ga0070668_100062476 | |||
| 1120 | Ga0070668_100195700 | |||
| 1121 | Ga0070668_101546186 | |||
| 1122 | Ga0070669_100038575 | |||
| 1123 | Ga0070669_100093027 | |||
| 1124 | Ga0070669_100095232 | |||
| 1125 | Ga0070669_100127504 | |||
| 1126 | Ga0070669_100160722 | |||
| 1127 | Ga0070669_100858590 | |||
| 1128 | Ga0070669_101056615 | |||
| 1129 | Ga0070675_100054049 | |||
| 1130 | Ga0070671_100004195 | |||
| 1131 | Ga0070671_100163958 | |||
| 1132 | Ga0070671_101068052 | |||
| 1133 | Ga0070674_100005466 | |||
| 1134 | Ga0070674_100059651 | |||
| 1135 | Ga0070674_100285025 | |||
| 1136 | Ga0070673_100042079 | |||
| 1137 | Ga0070673_100146314 | |||
| 1138 | Ga0070673_100624884 | |||
| 1139 | Ga0070673_101869142 | |||
| 1140 | Ga0070688_100106907 | |||
| 1141 | Ga0070688_100581816 | |||
| 1142 | Ga0070659_100935297 | |||
| 1143 | Ga0070667_100010365 | |||
| 1144 | Ga0070667_100051756 | |||
| 1145 | Ga0070667_100934878 | |||
| 1146 | Ga0070667_101066429 | |||
| 1147 | Ga0070709_10173656 | |||
| 1148 | Ga0070709_10236429 | |||
| 1149 | Ga0070709_11254938 | |||
| 1150 | Ga0070709_11302775 | |||
| 1151 | Ga0070713_100054949 | |||
| 1152 | Ga0070713_100260957 | |||
| 1153 | Ga0070713_100550727 | |||
| 1154 | Ga0070710_10586237 | |||
| 1155 | Ga0070701_10148191 | |||
| 1156 | Ga0070701_10225133 | |||
| 1157 | Ga0070701_10321915 | |||
| 1158 | Ga0070701_10384729 | |||
| 1159 | Ga0070701_10863493 | |||
| 1160 | Ga0070701_11042232 | |||
| 1161 | Ga0070711_100138103 | |||
| 1162 | Ga0070705_100093987 | |||
| 1163 | Ga0070705_100508359 | |||
| 1164 | Ga0070705_101164568 | |||
| 1165 | Ga0070705_101261350 | |||
| 1166 | Ga0070705_101692359 | |||
| 1167 | Ga0070705_101792144 | |||
| 1168 | Ga0070700_100107163 | |||
| 1169 | Ga0070700_100932548 | |||
| 1170 | Ga0070694_100004344 | |||
| 1171 | Ga0070694_100023096 | |||
| 1172 | Ga0070708_100728358 | |||
| 1173 | Ga0070708_101231611 | |||
| 1174 | Ga0070678_100364810 | |||
| 1175 | Ga0070678_100688250 | |||
| 1176 | Ga0070678_101020676 | |||
| 1177 | Ga0070662_100092251 | |||
| 1178 | Ga0070662_100568652 | |||
| 1179 | Ga0070681_10010299 | |||
| 1180 | Ga0070681_10014078 | |||
| 1181 | Ga0070681_10141561 | |||
| 1182 | Ga0070681_10400881 | |||
| 1183 | Ga0068867_100056694 | |||
| 1184 | Ga0068867_100100267 | |||
| 1185 | Ga0068867_100154088 | |||
| 1186 | Ga0068867_100180576 | |||
| 1187 | Ga0068867_100226308 | |||
| 1188 | Ga0068867_100507101 | |||
| 1189 | Ga0068867_101340445 | |||
| 1190 | Ga0068867_101922952 | |||
| 1191 | Ga0070706_100382871 | |||
| 1192 | Ga0070706_100452983 | |||
| 1193 | Ga0070706_101810106 | |||
| 1194 | Ga0070707_100247723 | |||
| 1195 | Ga0070707_100329286 | |||
| 1196 | Ga0070707_100347300 | |||
| 1197 | Ga0070707_100392796 | |||
| 1198 | Ga0070707_100743344 | |||
| 1199 | Ga0070707_100968233 | |||
| 1200 | Ga0070707_101886906 | |||
| 1201 | Ga0070698_100060950 | |||
| 1202 | Ga0070698_100113779 | |||
| 1203 | Ga0070698_100488280 | |||
| 1204 | Ga0070698_100785113 | |||
| 1205 | Ga0070698_101319210 | |||
| 1206 | Ga0070699_100010440 | |||
| 1207 | Ga0070699_100303687 | |||
| 1208 | Ga0070699_100347735 | |||
| 1209 | Ga0070699_100398468 | |||
| 1210 | Ga0070699_100444432 | |||
| 1211 | Ga0070699_100560366 | |||
| 1212 | Ga0070699_102047879 | |||
| 1213 | Ga0070679_100028033 | |||
| 1214 | Ga0070679_100122007 | |||
| 1215 | Ga0070679_100235511 | |||
| 1216 | Ga0070679_101816370 | |||
| 1217 | Ga0070684_100060632 | |||
| 1218 | Ga0070697_100379311 | |||
| 1219 | Ga0070697_100383805 | |||
| 1220 | Ga0070697_100407559 | |||
| 1221 | Ga0070697_100526661 | |||
| 1222 | Ga0070697_101040936 | |||
| 1223 | Ga0070697_101302080 | |||
| 1224 | Ga0068853_101641942 | |||
| 1225 | Ga0068853_101759825 | |||
| 1226 | Ga0070672_100157677 | |||
| 1227 | Ga0070672_100966908 | |||
| 1228 | Ga0070686_100006611 | |||
| 1229 | Ga0070686_100013585 | |||
| 1230 | Ga0070686_100108606 | |||
| 1231 | Ga0070686_101715744 | |||
| 1232 | Ga0070695_100012788 | |||
| 1233 | Ga0070695_100058392 | |||
| 1234 | Ga0070695_100166406 | |||
| 1235 | Ga0070695_100172688 | |||
| 1236 | Ga0070696_100023933 | |||
| 1237 | Ga0070696_100052270 | |||
| 1238 | Ga0070696_100236263 | |||
| 1239 | Ga0070696_100397723 | |||
| 1240 | Ga0070696_100420420 | |||
| 1241 | Ga0070693_100231650 | |||
| 1242 | Ga0070693_100368233 | |||
| 1243 | Ga0070693_100654577 | |||
| 1244 | Ga0070665_100003400 | |||
| 1245 | Ga0070665_100029797 | |||
| 1246 | Ga0070665_100418540 | |||
| 1247 | Ga0070704_100042320 | |||
| 1248 | Ga0070704_100072841 | |||
| 1249 | Ga0070704_100630615 | |||
| 1250 | Ga0070704_100969227 | |||
| 1251 | Ga0070704_100978672 | |||
| 1252 | Ga0070704_101199414 | |||
| 1253 | Ga0070704_101357863 | |||
| 1254 | Ga0068855_100014919 | |||
| 1255 | Ga0068855_100294344 | |||
| 1256 | Ga0068855_100888909 | |||
| 1257 | Ga0068855_100988297 | |||
| 1258 | Ga0068855_101623346 | |||
| 1259 | Ga0070664_100193513 | |||
| 1260 | Ga0070664_101298528 | |||
| 1261 | Ga0068857_100048486 | |||
| 1262 | Ga0068854_100005725 | |||
| 1263 | Ga0068854_100180647 | |||
| 1264 | Ga0068854_100197173 | |||
| 1265 | Ga0068854_100219807 | |||
| 1266 | Ga0068854_100809193 | |||
| 1267 | Ga0068856_100711833 | |||
| 1268 | Ga0070702_100106947 | |||
| 1269 | Ga0070702_100718114 | |||
| 1270 | Ga0070702_101007939 | |||
| 1271 | Ga0070702_101171008 | |||
| 1272 | Ga0068852_101204655 | |||
| 1273 | Ga0068852_101929375 | |||
| 1274 | Ga0068859_100188547 | |||
| 1275 | Ga0068859_100221482 | |||
| 1276 | Ga0068859_100230147 | |||
| 1277 | Ga0068859_100415300 | |||
| 1278 | Ga0068859_100734346 | |||
| 1279 | Ga0068859_101015345 | |||
| 1280 | Ga0068859_101965014 | |||
| 1281 | Ga0068864_100006744 | |||
| 1282 | Ga0068864_100011842 | |||
| 1283 | Ga0068864_100239636 | |||
| 1284 | Ga0068864_100443214 | |||
| 1285 | Ga0068864_100786665 | |||
| 1286 | Ga0068864_101005656 | |||
| 1287 | Ga0068866_10042802 | |||
| 1288 | Ga0068866_10221562 | |||
| 1289 | Ga0068861_100007713 | |||
| 1290 | Ga0068861_100072208 | |||
| 1291 | Ga0068861_100145379 | |||
| 1292 | Ga0068861_100159015 | |||
| 1293 | Ga0068861_100184742 | |||
| 1294 | Ga0068861_100511014 | |||
| 1295 | Ga0068861_100959728 | |||
| 1296 | Ga0068861_101008470 | |||
| 1297 | Ga0068861_101102824 | |||
| 1298 | Ga0068851_10728692 | |||
| 1299 | Ga0068870_11084789 | |||
| 1300 | Ga0068863_100017724 | |||
| 1301 | Ga0068863_100126316 | |||
| 1302 | Ga0068863_100141939 | |||
| 1303 | Ga0068863_100209767 | |||
| 1304 | Ga0068863_100236135 | |||
| 1305 | Ga0068863_100672399 | |||
| 1306 | Ga0068863_100672492 | |||
| 1307 | Ga0068863_101633720 | |||
| 1308 | Ga0068858_100002279 | |||
| 1309 | Ga0068858_100003439 | |||
| 1310 | Ga0068858_100022626 | |||
| 1311 | Ga0068858_100025883 | |||
| 1312 | Ga0068858_100045471 | |||
| 1313 | Ga0068858_100094059 | |||
| 1314 | Ga0068858_100102033 | |||
| 1315 | Ga0068858_100134456 | |||
| 1316 | Ga0068858_100144733 | |||
| 1317 | Ga0068858_100532310 | |||
| 1318 | Ga0068858_102070735 | |||
| 1319 | Ga0068860_100125490 | |||
| 1320 | Ga0068860_100166159 | |||
| 1321 | Ga0068860_100393463 | |||
| 1322 | Ga0068862_100069275 | |||
| 1323 | Ga0068862_100072471 | |||
| 1324 | Ga0068862_100091597 | |||
| 1325 | Ga0068862_100111158 | |||
| 1326 | Ga0068862_100808132 | |||
| 1327 | Ga0068862_100914818 | |||
| 1328 | Ga0068862_100977494 | |||
| 1329 | Ga0081455_10057985 | |||
| 1330 | Ga0081455_10124172 | |||
| 1331 | Ga0070717_10009863 | |||
| 1332 | Ga0070717_10999146 | |||
| 1333 | Ga0070717_11211134 | |||
| 1334 | Ga0070717_12058992 | |||
| 1335 | Ga0070715_10309767 | |||
| 1336 | Ga0070715_10620796 | |||
| 1337 | Ga0070716_100123408 | |||
| 1338 | Ga0070716_100158268 | |||
| 1339 | Ga0070716_101039599 | |||
| 1340 | Ga0070712_100357281 | |||
| 1341 | Ga0070712_100728801 | |||
| 1342 | Ga0097621_100000820 | |||
| 1343 | Ga0097621_100005002 | |||
| 1344 | Ga0097621_100009536 | |||
| 1345 | Ga0097621_100035429 | |||
| 1346 | Ga0097621_100040671 | |||
| 1347 | Ga0097621_100161021 | |||
| 1348 | Ga0097621_100216579 | |||
| 1349 | Ga0097621_100316530 | |||
| 1350 | Ga0097621_101689039 | |||
| 1351 | Ga0068871_100000748 | |||
| 1352 | Ga0068871_100002816 | |||
| 1353 | Ga0068871_100018174 | |||
| 1354 | Ga0068871_100088922 | |||
| 1355 | Ga0068871_100118351 | |||
| 1356 | Ga0068871_100154706 | |||
| 1357 | Ga0068871_100270927 | |||
| 1358 | Ga0068871_100309726 | |||
| 1359 | Ga0075428_100240518 | |||
| 1360 | Ga0075428_100278263 | |||
| 1361 | Ga0075428_100411728 | |||
| 1362 | Ga0075428_100856617 | |||
| 1363 | Ga0075428_100862597 | |||
| 1364 | Ga0075428_102164687 | |||
| 1365 | Ga0075431_100077474 | |||
| 1366 | Ga0075431_100833204 | |||
| 1367 | Ga0075433_10015271 | |||
| 1368 | Ga0075433_10042431 | |||
| 1369 | Ga0075433_10071915 | |||
| 1370 | Ga0075433_10075099 | |||
| 1371 | Ga0075433_10236125 | |||
| 1372 | Ga0075433_10249633 | |||
| 1373 | Ga0075433_10414343 | |||
| 1374 | Ga0075433_10799686 | |||
| 1375 | Ga0075433_10833779 | |||
| 1376 | Ga0075433_11361885 | |||
| 1377 | Ga0075434_100000100 | |||
| 1378 | Ga0075434_100004020 | |||
| 1379 | Ga0075434_100006986 | |||
| 1380 | Ga0075434_100051226 | |||
| 1381 | Ga0075434_100112820 | |||
| 1382 | Ga0075434_100293748 | |||
| 1383 | Ga0075434_100329905 | |||
| 1384 | Ga0075434_100343684 | |||
| 1385 | Ga0075434_100423840 | |||
| 1386 | Ga0075434_100573130 | |||
| 1387 | Ga0075434_100684850 | |||
| 1388 | Ga0075434_101302169 | |||
| 1389 | Ga0075434_101936419 | |||
| 1390 | Ga0075429_100026083 | |||
| 1391 | Ga0075429_100474132 | |||
| 1392 | Ga0075429_101848373 | |||
| 1393 | Ga0068865_100020287 | |||
| 1394 | Ga0068865_100037266 | |||
| 1395 | Ga0068865_100094204 | |||
| 1396 | Ga0068865_100235185 | |||
| 1397 | Ga0068865_100312826 | |||
| 1398 | Ga0068865_100459989 | |||
| 1399 | Ga0068865_101492256 | |||
| 1400 | Ga0075436_100000583 | |||
| 1401 | Ga0075436_100018863 | |||
| 1402 | Ga0075436_100040832 | |||
| 1403 | Ga0075436_100141437 | |||
| 1404 | Ga0075436_100173725 | |||
| 1405 | Ga0097620_100188556 | |||
| 1406 | Ga0097620_100221473 | |||
| 1407 | Ga0097620_100230129 | |||
| 1408 | Ga0097620_100415286 | |||
| 1409 | Ga0097620_100734260 | |||
| 1410 | Ga0097620_101015273 | |||
| 1411 | Ga0097620_101964372 | |||
| 1412 | Ga0075435_100000192 | |||
| 1413 | Ga0075435_100007103 | |||
| 1414 | Ga0075435_100016305 | |||
| 1415 | Ga0075435_100025830 | |||
| 1416 | Ga0075435_100063427 | |||
| 1417 | Ga0075435_100119349 | |||
| 1418 | Ga0075435_100123981 | |||
| 1419 | Ga0075435_100155884 | |||
| 1420 | Ga0075435_100201230 | |||
| 1421 | Ga0105240_10029106 | |||
| 1422 | Ga0105240_10066975 | |||
| 1423 | Ga0105240_10495260 | |||
| 1424 | Ga0105240_10927187 | |||
| 1425 | Ga0111539_10011403 | |||
| 1426 | Ga0111539_10015361 | |||
| 1427 | Ga0111539_10062811 | |||
| 1428 | Ga0111539_10182296 | |||
| 1429 | Ga0111539_10369566 | |||
| 1430 | Ga0111539_10507836 | |||
| 1431 | Ga0111539_10990817 | |||
| 1432 | Ga0111539_11451358 | |||
| 1433 | Ga0105245_10005304 | |||
| 1434 | Ga0105245_10010561 | |||
| 1435 | Ga0105245_10124385 | |||
| 1436 | Ga0105245_10232315 | |||
| 1437 | Ga0105245_10601176 | |||
| 1438 | Ga0105245_10780122 | |||
| 1439 | Ga0105245_11055130 | |||
| 1440 | Ga0105245_12248610 | |||
| 1441 | Ga0105245_12334424 | |||
| 1442 | Ga0105247_10004860 | |||
| 1443 | Ga0105247_10006654 | |||
| 1444 | Ga0105247_10034357 | |||
| 1445 | Ga0114129_10000434 | |||
| 1446 | Ga0114129_10000838 | |||
| 1447 | Ga0114129_10004177 | |||
| 1448 | Ga0114129_10015556 | |||
| 1449 | Ga0114129_10019544 | |||
| 1450 | Ga0114129_10040311 | |||
| 1451 | Ga0114129_10052291 | |||
| 1452 | Ga0114129_10061477 | |||
| 1453 | Ga0114129_10062016 | |||
| 1454 | Ga0114129_10091898 | |||
| 1455 | Ga0114129_10191674 | |||
| 1456 | Ga0114129_10252054 | |||
| 1457 | Ga0114129_10861628 | |||
| 1458 | Ga0114129_12342538 | |||
| 1459 | Ga0114129_12424115 | |||
| 1460 | Ga0114129_12630587 | |||
| 1461 | Ga0105243_10033405 | |||
| 1462 | Ga0105243_10681586 | |||
| 1463 | Ga0105243_10739125 | |||
| 1464 | Ga0105243_11496322 | |||
| 1465 | Ga0105241_10032306 | |||
| 1466 | Ga0105241_10487507 | |||
| 1467 | Ga0105241_11084236 | |||
| 1468 | Ga0105241_11125116 | |||
| 1469 | Ga0105242_10001523 | |||
| 1470 | Ga0105242_10011154 | |||
| 1471 | Ga0105242_10111093 | |||
| 1472 | Ga0105242_10379118 | |||
| 1473 | Ga0105242_10387834 | |||
| 1474 | Ga0105242_10612737 | |||
| 1475 | Ga0105242_11019638 | |||
| 1476 | Ga0105242_11080264 | |||
| 1477 | Ga0105242_11554003 | |||
| 1478 | Ga0105242_11929180 | |||
| 1479 | Ga0105242_12069696 | |||
| 1480 | Ga0105242_12241515 | |||
| 1481 | Ga0105248_10011220 | |||
| 1482 | Ga0105248_10024458 | |||
| 1483 | Ga0105248_10034945 | |||
| 1484 | Ga0105248_10070797 | |||
| 1485 | Ga0105248_10082604 | |||
| 1486 | Ga0105248_10103052 | |||
| 1487 | Ga0105248_10125913 | |||
| 1488 | Ga0105248_10373424 | |||
| 1489 | Ga0105248_10373690 | |||
| 1490 | Ga0105248_10773355 | |||
| 1491 | Ga0105248_11003177 | |||
| 1492 | Ga0105248_11925938 | |||
| 1493 | Ga0105248_12329100 | |||
| 1494 | Ga0105248_12480521 | |||
| 1495 | Ga0105248_12924663 | |||
| 1496 | Ga0105248_13424067 | |||
| 1497 | Ga0105237_10421814 | |||
| 1498 | Ga0105238_10260967 | |||
| 1499 | Ga0105238_10370125 | |||
| 1500 | Ga0105238_10881749 | |||
| 1501 | Ga0105238_11513352 | |||
| 1502 | Ga0105238_12915864 | |||
| 1503 | Ga0105249_10039811 | |||
| 1504 | Ga0105249_10161993 | |||
| 1505 | Ga0105249_10311915 | |||
| 1506 | Ga0105249_10333963 | |||
| 1507 | Ga0105249_10538632 | |||
| 1508 | Ga0105249_10561680 | |||
| 1509 | Ga0105249_10748160 | |||
| 1510 | Ga0105249_11108411 | |||
| 1511 | Ga0105249_12404106 | |||
| 1512 | Ga0105239_10540500 | |||
| 1513 | Ga0105239_11362000 | |||
| 1514 | Ga0105239_11903031 | |||
| 1515 | Ga0105246_10070511 | |||
| 1516 | Ga0105246_10705161 | |||
| 1517 | Ga0105246_11477501 | |||
| 1518 | Ga0157374_10036699 | |||
| 1519 | Ga0157374_10208635 | |||
| 1520 | Ga0157374_10326843 | |||
| 1521 | Ga0157374_11361256 | |||
| 1522 | Ga0157374_12609231 | |||
| 1523 | Ga0157378_10001160 | |||
| 1524 | Ga0157378_10141189 | |||
| 1525 | Ga0157378_10636010 | |||
| 1526 | Ga0157378_10896417 | |||
| 1527 | Ga0157378_12948179 | |||
| 1528 | Ga0163162_10144917 | |||
| 1529 | Ga0163162_10314476 | |||
| 1530 | Ga0163162_10901804 | |||
| 1531 | Ga0163162_10995844 | |||
| 1532 | Ga0157372_10659370 | |||
| 1533 | Ga0157375_10088757 | |||
| 1534 | Ga0157375_10097638 | |||
| 1535 | Ga0157375_10265595 | |||
| 1536 | Ga0157375_10567047 | |||
| 1537 | Ga0157375_10630466 | |||
| 1538 | Ga0157375_11008924 | |||
| 1539 | Ga0157375_11707655 | |||
| 1540 | Ga0163163_10038701 | |||
| 1541 | Ga0163163_10049610 | |||
| 1542 | Ga0163163_10108997 | |||
| 1543 | Ga0163163_10121049 | |||
| 1544 | Ga0163163_12030112 | |||
| 1545 | Ga0157380_10079520 | |||
| 1546 | Ga0157380_10304614 | |||
| 1547 | Ga0157380_10484185 | |||
| 1548 | Ga0157380_11406570 | |||
| 1549 | Ga0157377_10489469 | |||
| 1550 | Ga0157379_10015940 | |||
| 1551 | Ga0157379_10088415 | |||
| 1552 | Ga0157379_10132422 | |||
| 1553 | Ga0157379_10142940 | |||
| 1554 | Ga0157379_10649103 | |||
| 1555 | Ga0157376_10030995 | |||
| 1556 | Ga0157376_10079775 | |||
| 1557 | Ga0157376_10085578 | |||
| 1558 | Ga0157376_10091892 | |||
| 1559 | Ga0157376_10092097 | |||
| 1560 | Ga0157376_10125833 | |||
| 1561 | Ga0157376_10273682 | |||
| 1562 | Ga0157376_10306414 | |||
| 1563 | Ga0157376_10592927 | |||
| 1564 | Ga0157376_10963530 | |||
| 1565 | Ga0157376_11061441 | |||
| 1566 | Ga0182007_10335037 | |||
| 1567 | Ga0163161_10348502 | |||
| 1568 | Ga0163161_10633112 | |||
| 1569 | Ga0207697_10052914 | |||
| 1570 | Ga0207692_10602337 | |||
| 1571 | Ga0207642_10026124 | |||
| 1572 | Ga0207642_10111777 | |||
| 1573 | Ga0207642_10312885 | |||
| 1574 | Ga0207642_10383916 | |||
| 1575 | Ga0207710_10017973 | |||
| 1576 | Ga0207710_10075354 | |||
| 1577 | Ga0207710_10525000 | |||
| 1578 | Ga0207680_10011678 | |||
| 1579 | Ga0207680_10123690 | |||
| 1580 | Ga0207680_10160753 | |||
| 1581 | Ga0207680_10875921 | |||
| 1582 | Ga0207699_10091475 | |||
| 1583 | Ga0207699_10242651 | |||
| 1584 | Ga0207699_10360033 | |||
| 1585 | Ga0207645_10020833 | |||
| 1586 | Ga0207645_10384673 | |||
| 1587 | Ga0207645_10528983 | |||
| 1588 | Ga0207643_10348451 | |||
| 1589 | Ga0207705_10158596 | |||
| 1590 | Ga0207684_10715320 | |||
| 1591 | Ga0207684_10730527 | |||
| 1592 | Ga0207684_11339566 | |||
| 1593 | Ga0207684_11356257 | |||
| 1594 | Ga0207654_10037434 | |||
| 1595 | Ga0207654_10300282 | |||
| 1596 | Ga0207654_10693321 | |||
| 1597 | Ga0207654_11029606 | |||
| 1598 | Ga0207707_10006194 | |||
| 1599 | Ga0207707_10110485 | |||
| 1600 | Ga0207707_10198464 | |||
| 1601 | Ga0207707_10229937 | |||
| 1602 | Ga0207695_10605823 | |||
| 1603 | Ga0207695_11209789 | |||
| 1604 | Ga0207693_10343741 | |||
| 1605 | Ga0207693_10588544 | |||
| 1606 | Ga0207663_10067706 | |||
| 1607 | Ga0207663_10071745 | |||
| 1608 | Ga0207663_10258189 | |||
| 1609 | Ga0207663_11643864 | |||
| 1610 | Ga0207660_10147421 | |||
| 1611 | Ga0207660_10564312 | |||
| 1612 | Ga0207660_10700828 | |||
| 1613 | Ga0207662_10013435 | |||
| 1614 | Ga0207662_10169621 | |||
| 1615 | Ga0207657_10000779 | |||
| 1616 | Ga0207652_10126022 | |||
| 1617 | Ga0207652_10386118 | |||
| 1618 | Ga0207652_10471860 | |||
| 1619 | Ga0207646_10043338 | |||
| 1620 | Ga0207646_10154449 | |||
| 1621 | Ga0207646_10187640 | |||
| 1622 | Ga0207646_10561260 | |||
| 1623 | Ga0207646_10638702 | |||
| 1624 | Ga0207646_10856339 | |||
| 1625 | Ga0207646_11179821 | |||
| 1626 | Ga0207646_11454957 | |||
| 1627 | Ga0207681_10006864 | |||
| 1628 | Ga0207681_10043714 | |||
| 1629 | Ga0207681_10073061 | |||
| 1630 | Ga0207681_10146677 | |||
| 1631 | Ga0207681_10150128 | |||
| 1632 | Ga0207681_10679338 | |||
| 1633 | Ga0207681_10744373 | |||
| 1634 | Ga0207681_10883398 | |||
| 1635 | Ga0207694_10337496 | |||
| 1636 | Ga0207694_10407911 | |||
| 1637 | Ga0207694_10599050 | |||
| 1638 | Ga0207650_10038154 | |||
| 1639 | Ga0207650_10069075 | |||
| 1640 | Ga0207650_11191152 | |||
| 1641 | Ga0207650_11303171 | |||
| 1642 | Ga0207659_10717915 | |||
| 1643 | Ga0207687_10043764 | |||
| 1644 | Ga0207687_10062389 | |||
| 1645 | Ga0207687_10072422 | |||
| 1646 | Ga0207687_10396406 | |||
| 1647 | Ga0207687_10528461 | |||
| 1648 | Ga0207687_10635658 | |||
| 1649 | Ga0207700_10210461 | |||
| 1650 | Ga0207664_10185984 | |||
| 1651 | Ga0207644_10029295 | |||
| 1652 | Ga0207690_10814548 | |||
| 1653 | Ga0207706_10173511 | |||
| 1654 | Ga0207706_10593905 | |||
| 1655 | Ga0207706_10616808 | |||
| 1656 | Ga0207686_10010868 | |||
| 1657 | Ga0207686_10015491 | |||
| 1658 | Ga0207686_10085792 | |||
| 1659 | Ga0207686_10187590 | |||
| 1660 | Ga0207686_10376717 | |||
| 1661 | Ga0207686_10693843 | |||
| 1662 | Ga0207686_10977489 | |||
| 1663 | Ga0207709_10068291 | |||
| 1664 | Ga0207709_10144060 | |||
| 1665 | Ga0207709_11512560 | |||
| 1666 | Ga0207670_10088621 | |||
| 1667 | Ga0207670_10120844 | |||
| 1668 | Ga0207670_10134549 | |||
| 1669 | Ga0207670_10168595 | |||
| 1670 | Ga0207670_10210137 | |||
| 1671 | Ga0207670_10521001 | |||
| 1672 | Ga0207669_10052164 | |||
| 1673 | Ga0207669_10357591 | |||
| 1674 | Ga0207669_10431816 | |||
| 1675 | Ga0207669_11014260 | |||
| 1676 | Ga0207704_10019536 | |||
| 1677 | Ga0207704_10026253 | |||
| 1678 | Ga0207704_10116127 | |||
| 1679 | Ga0207704_10228136 | |||
| 1680 | Ga0207704_10416772 | |||
| 1681 | Ga0207704_10809041 | |||
| 1682 | Ga0207665_10436366 | |||
| 1683 | Ga0207691_10045534 | |||
| 1684 | Ga0207691_10354092 | |||
| 1685 | Ga0207691_10372867 | |||
| 1686 | Ga0207691_11022346 | |||
| 1687 | Ga0207711_10008949 | |||
| 1688 | Ga0207711_10080290 | |||
| 1689 | Ga0207711_10153540 | |||
| 1690 | Ga0207711_10373103 | |||
| 1691 | Ga0207711_10595343 | |||
| 1692 | Ga0207711_10625645 | |||
| 1693 | Ga0207711_11144350 | |||
| 1694 | Ga0207689_10270546 | |||
| 1695 | Ga0207689_10298220 | |||
| 1696 | Ga0207689_10327773 | |||
| 1697 | Ga0207689_10363062 | |||
| 1698 | Ga0207661_10427847 | |||
| 1699 | Ga0207661_10716112 | |||
| 1700 | Ga0207661_11932448 | |||
| 1701 | Ga0207679_10637855 | |||
| 1702 | Ga0207679_11674956 | |||
| 1703 | Ga0207667_10067017 | |||
| 1704 | Ga0207667_11233625 | |||
| 1705 | Ga0207667_11770240 | |||
| 1706 | Ga0207651_10027217 | |||
| 1707 | Ga0207651_10660653 | |||
| 1708 | Ga0207651_11538515 | |||
| 1709 | Ga0207712_10061732 | |||
| 1710 | Ga0207712_10131352 | |||
| 1711 | Ga0207712_10171490 | |||
| 1712 | Ga0207712_10353745 | |||
| 1713 | Ga0207712_10374165 | |||
| 1714 | Ga0207712_10420628 | |||
| 1715 | Ga0207668_10203238 | |||
| 1716 | Ga0207668_10258593 | |||
| 1717 | Ga0207668_11006235 | |||
| 1718 | Ga0207640_10008160 | |||
| 1719 | Ga0207640_10162521 | |||
| 1720 | Ga0207640_10205546 | |||
| 1721 | Ga0207640_10242832 | |||
| 1722 | Ga0207640_10273067 | |||
| 1723 | Ga0207640_10736401 | |||
| 1724 | Ga0207640_11058162 | |||
| 1725 | Ga0207658_10032776 | |||
| 1726 | Ga0207658_10226416 | |||
| 1727 | Ga0207658_10467504 | |||
| 1728 | Ga0207677_10014296 | |||
| 1729 | Ga0207677_10111962 | |||
| 1730 | Ga0207677_10218920 | |||
| 1731 | Ga0207677_10303698 | |||
| 1732 | Ga0207677_11414909 | |||
| 1733 | Ga0207703_10002624 | |||
| 1734 | Ga0207703_10009543 | |||
| 1735 | Ga0207703_10012767 | |||
| 1736 | Ga0207703_10017991 | |||
| 1737 | Ga0207703_10094838 | |||
| 1738 | Ga0207703_10145654 | |||
| 1739 | Ga0207703_10182392 | |||
| 1740 | Ga0207703_10294448 | |||
| 1741 | Ga0207703_10436146 | |||
| 1742 | Ga0207703_10468546 | |||
| 1743 | Ga0207703_10916667 | |||
| 1744 | Ga0207639_10981557 | |||
| 1745 | Ga0207678_10322100 | |||
| 1746 | Ga0207678_10561462 | |||
| 1747 | Ga0207708_10011994 | |||
| 1748 | Ga0207708_10069702 | |||
| 1749 | Ga0207708_11944470 | |||
| 1750 | Ga0207702_10221233 | |||
| 1751 | Ga0207641_10000431 | |||
| 1752 | Ga0207641_10061731 | |||
| 1753 | Ga0207641_10119650 | |||
| 1754 | Ga0207641_10478989 | |||
| 1755 | Ga0207641_10558391 | |||
| 1756 | Ga0207641_10614722 | |||
| 1757 | Ga0207641_11127048 | |||
| 1758 | Ga0207648_10039267 | |||
| 1759 | Ga0207648_10039354 | |||
| 1760 | Ga0207648_10090480 | |||
| 1761 | Ga0207648_10145411 | |||
| 1762 | Ga0207648_10171174 | |||
| 1763 | Ga0207648_10373104 | |||
| 1764 | Ga0207648_10375418 | |||
| 1765 | Ga0207648_10533835 | |||
| 1766 | Ga0207676_10010449 | |||
| 1767 | Ga0207676_10046046 | |||
| 1768 | Ga0207676_10459544 | |||
| 1769 | Ga0207676_10769504 | |||
| 1770 | Ga0207676_11050227 | |||
| 1771 | Ga0207676_11276912 | |||
| 1772 | Ga0207674_10075381 | |||
| 1773 | Ga0207674_10549242 | |||
| 1774 | Ga0207675_100000451 | |||
| 1775 | Ga0207675_100023793 | |||
| 1776 | Ga0207675_100091896 | |||
| 1777 | Ga0207675_100097464 | |||
| 1778 | Ga0207675_100109946 | |||
| 1779 | Ga0207675_100369060 | |||
| 1780 | Ga0207675_100382164 | |||
| 1781 | Ga0207675_100630923 | |||
| 1782 | Ga0207675_100685086 | |||
| 1783 | Ga0207683_10345997 | |||
| 1784 | Ga0207683_10486360 | |||
| 1785 | Ga0207683_10769344 | |||
| 1786 | Ga0207683_10788125 | |||
| 1787 | Ga0207698_10761856 | |||
| 1788 | Ga0207698_10869643 | |||
| 1789 | Ga0207428_10027043 | |||
| 1790 | Ga0207428_10028926 | |||
| 1791 | Ga0268266_10017418 | |||
| 1792 | Ga0268266_10134496 | |||
| 1793 | Ga0268266_10220479 | |||
| 1794 | Ga0268265_10006219 | |||
| 1795 | Ga0268265_10072450 | |||
| 1796 | Ga0268265_10116068 | |||
| 1797 | Ga0268265_10329188 | |||
| 1798 | Ga0268265_10360436 | |||
| 1799 | Ga0268265_10729509 | |||
| 1800 | Ga0268264_10010017 | |||
| 1801 | Ga0268264_10052316 | |||
| 1802 | Ga0268264_10196853 | |||
| 1803 | Ga0268264_10343458 | |||
| 1804 | Ga0268264_10473224 | |||
| 1805 | Ga0268264_10878800 | |||
| 1806 | Ga0268264_12107419 | |||
| 1807 | Ga0265336_10036910 | |||
| 1808 | Ga0307511_10176907 | |||
| 1809 | Ga0265332_10066482 | |||
| 1810 | Ga0307408_100271106 | |||
| 1811 | Ga0265314_10182069 | |||
| 1812 | Ga0307416_100159382 | |||
| 1813 | Ga0307416_101510812 | |||
| 1814 | Ga0307416_102227940 | |||
| 1815 | Ga0373930_0001025 | |||
| 1816 | Ga0373948_0000373 | |||
| 1817 | Ga0373950_0000439 | |||
| 1818 | Ga0373958_0000173 | |||
| 1819 | Ga0373959_0001608 | |||
| 1820 | Ga0373959_0071576 | |||
| 1821 | Ga0373959_0144825 | |||
| 1822 | Ga0373926_0329028 | |||
| 1823 | Ga0373926_0441988 | |||
| 1824 | Ga0373928_0007057 | |||
| 1825 | Ga0373929_0042093 | |||
| 1826 | Ga0373934_0120797 | |||
| 1827 | Ga0373934_0221941 | |||
| 1828 | Ga0373949_0008821 | |||
| 1829 | Ga0373949_0071268 | |||
| 1830 | Ga0373951_0001298 | |||
| 1831 | Ga0373952_0000050 | |||
| 1832 | Ga0373932_0000603 | |||
| 1833 | Ga0373936_0169584 | |||
| 1834 | Ga0373939_0000156 | |||
| 1835 | Ga0373939_0292021 | |||
| 1836 | Ga0373941_0000433 | |||
| 1837 | Ga0373941_0164279 | |||
| 1838 | Ga0373945_0025007 | |||
| 1839 | Ga0373945_0220194 | |||
| 1840 | Ga0373953_0286486 | |||
| 1841 | Ga0373954_0661335 | |||
| 1842 | Ga0373956_0342241 | |||
| 1843 | Ga0373956_0350852 | |||
| 1844 | Ga0373960_0000998 | |||
| 1845 | Ga0373943_0035898 | |||
| 1846 | Ga0373943_0129533 | |||
| 1847 | Ga0373946_0004665 | |||
| 1848 | Ga0373946_0583527 | |||
| 1849 | Ga0373955_0004533 | |||
| 1850 | Ga0373955_0072855 | |||
| 1851 | Ga0373955_0478032 | |||
| 1852 | Ga0373955_0588153 | |||
| 1853 | Ga0373955_0620118 | |||
| 1854 | Ga0373942_0002127 | |||
| 1855 | Ga0373961_0002123 | |||
| 1856 | Ga0373961_0121940 | |||
| 1857 | Ga0373961_0124021 | |||
| 1858 | Ga0373962_0000316 | |||
| 1859 | Ga0373962_0115701 | |||
| 1860 | Ga0373924_0289929 | |||
| 1861 | Ga0373931_0000411 | |||
| 1862 | Ga0373931_0254505 | |||
| 1863 | Ga0373931_1021763 | |||
| 1864 | Ga0373931_1301281 | |||
| 1865 | Ga0373935_0306490 | |||
| 1866 | Ga0373927_0875987 | |||
| 1867 | Ga0373933_0108709 | |||
| 1868 | Ga0373933_0177633 | |||
| 1869 | Ga0373933_0718955 | |||
| 1870 | Ga0373947_0011952 | |||
| 1871 | Ga0373937_0102381 | |||
| 1872 | Ga0373937_0289905 | |||
| 1873 | Ga0373937_0338632 | |||
| 1874 | Ga0373937_0465146 | |||
| 1875 | Ga0373937_0552941 | |||
| 1876 | Ga0373937_0697287 | |||
| 1877 | Ga0373937_0740509 | |||
| 1878 | Ga0373937_0999142 | |||
| 1879 | Ga0373937_1125816 | |||
| 1880 | Ga0373937_1169834 | |||
| 1881 | Ga0373937_1209411 | |||
| 1882 | Ga0373925_0000987 | |||
| 1883 | Ga0373925_0057437 | |||
| 1884 | Ga0373925_0157527 | |||
| 1885 | Ga0373925_0267622 | |||
| 1886 | Ga0395901_0743187 | |||
| 1887 | Ga0436365_0084194 | |||
| 1888 | Ga0436365_0238160 | |||
| 1889 | Ga0451853_2674977 | |||
| 1890 | Ga0451577_0051538 | |||
| 1891 | Ga0451577_0379089 | |||
| 1892 | Ga0453684_0017739 | |||
| 1893 | Ga0453684_0857849 | |||
| 1894 | Ga0451576_0007440 | |||
| 1895 | Ga0451576_0162502 | |||
| 1896 | Ga0451576_0343295 | |||
| 1897 | Ga0451576_0607892 | |||
| 1898 | Ga0451576_0721975 | |||
| 1899 | Ga0466967_1574666 | |||
| 1900 | Ga0495592_0012201 | |||
| 1901 | Ga0495641_0226491 | |||
| 1902 | Ga0495651_0073293 | |||
| 1903 | Ga0495653_0730978 | |||
| 1904 | Ga0495580_0189503 | |||
| 1905 | Ga0495582_0083522 | |||
| 1906 | Ga0495582_0900727 | |||
| 1907 | Ga0495639_0274548 | |||
| 1908 | Ga0495664_0249261 | |||
| 1909 | Ga0495664_0656574 | |||
| 1910 | Ga0495608_0005369 | |||
| 1911 | Ga0495618_0094139 | |||
| 1912 | Ga0495618_0137210 | |||
| 1913 | Ga0495628_0059757 | |||
| 1914 | Ga0495628_0065349 | |||
| 1915 | Ga0495628_0073643 | |||
| 1916 | Ga0495628_0175127 | |||
| 1917 | Ga0495628_0449592 | |||
| 1918 | Ga0495630_0185860 | |||
| 1919 | Ga0495630_0745802 | |||
| 1920 | Ga0495652_0043146 | |||
| 1921 | Ga0495640_0275408 | |||
| 1922 | Ga0495640_0327921 | |||
| 1923 | Ga0495640_0690988 | |||
| 1924 | Ga0495586_0063016 | |||
| 1925 | Ga0495587_0247319 | |||
| 1926 | Ga0495621_0089921 | |||
| 1927 | Ga0495645_0011724 | |||
| 1928 | Ga0495645_0282263 | |||
| 1929 | Ga0495645_0500379 | |||
| 1930 | Ga0495634_0199656 | |||
| 1931 | Ga0495634_0251840 | |||
| 1932 | Ga0495635_0099387 | |||
| 1933 | Ga0495635_0611694 | |||
| 1934 | Ga0495659_0199978 | |||
| 1935 | Ga0495659_0238645 | |||
| 1936 | Ga0495657_0133806 | |||
| 1937 | Ga0495599_0136744 | |||
| 1938 | Ga0495599_0205621 | |||
| 1939 | Ga0495623_0136538 | |||
| 1940 | Ga0495623_0630804 | |||
| 1941 | Ga0495647_0059355 | |||
| 1942 | Ga0495647_0167242 | |||
| 1943 | Ga0495647_0294229 | |||
| 1944 | Ga0495658_0008380 | |||
| 1945 | Ga0495658_0059892 | |||
| 1946 | Ga0495658_0082336 | |||
| 1947 | Ga0495658_0182438 | |||
| 1948 | Ga0495658_0260413 | |||
| 1949 | Ga0495658_0591440 | |||
| 1950 | Ga0495669_0099799 | |||
| 1951 | Ga0495613_0003872 | |||
| 1952 | Ga0495613_0407509 | |||
| 1953 | Ga0495600_0173676 | |||
| 1954 | Ga0495581_0649665 | |||
| 1955 | Ga0495604_0857854 | |||
| 1956 | Ga0495674_0051920 | |||
| 1957 | Ga0495674_0088764 | |||
| 1958 | Ga0495676_0523271 | |||
| 1959 | Ga0495680_0284169 | |||
| 1960 | Ga0495684_0000048 | |||
| 1961 | Ga0495684_0118638 | |||
| 1962 | Ga0495602_0042503 | |||
| 1963 | Ga0495602_0381360 | |||
| 1964 | Ga0496100_0006242 | |||
| 1965 | Ga0496101_0000568 | |||
| 1966 | Ga0496102_0028151 | |||
| 1967 | Ga0496102_0272778 | |||
| 1968 | Ga0496102_0398631 | |||
| 1969 | Ga0496102_0431283 | |||
| 1970 | Ga0496102_0454865 | |||
| 1971 | Ga0496102_0500096 | |||
| 1972 | Ga0496102_0931147 | |||
| 1973 | Ga0496104_0007988 | |||
| 1974 | Ga0496104_0011911 | |||
| 1975 | Ga0496104_0106270 | |||
| 1976 | Ga0496105_0020589 | |||
| 1977 | Ga0496105_0221111 | |||
| 1978 | Ga0496105_0756948 | |||
| 1979 | Ga0496106_0109049 | |||
| 1980 | Ga0496106_0205250 | |||
| 1981 | Ga0496107_0153272 | |||
| 1982 | Ga0496107_0479762 | |||
| 1983 | Ga0496107_0531596 | |||
| 1984 | Ga0496108_0016941 | |||
| 1985 | Ga0496108_0262892 | |||
| 1986 | Ga0496108_0326148 | |||
| 1987 | Ga0496109_0040181 | |||
| 1988 | Ga0496109_0175026 | |||
| 1989 | Ga0496109_0266525 | |||
| 1990 | Ga0496109_1026918 | |||
| 1991 | Ga0496110_0035448 | |||
| 1992 | Ga0496110_1501628 | |||
| 1993 | Ga0496111_0237034 | |||
| 1994 | Ga0496111_0737796 | |||
| 1995 | Ga0496112_0019763 | |||
| 1996 | Ga0496112_0075966 | |||
| 1997 | Ga0496112_0107372 | |||
| 1998 | Ga0496112_0196445 | |||
| 1999 | Ga0496112_0262404 | |||
| 2000 | Ga0496112_0281626 | |||
| 2001 | Ga0496112_0442508 | |||
| 2002 | Ga0496112_0523581 | |||
| 2003 | Ga0496112_1079419 | |||
| 2004 | Ga0496113_0021085 | |||
| 2005 | Ga0496113_0080583 | |||
| 2006 | Ga0496113_0781848 | |||
| 2007 | Ga0496113_1050705 | |||
| 2008 | Ga0496113_1509650 | |||
| 2009 | Ga0496114_0048279 | |||
| 2010 | Ga0496114_0159689 | |||
| 2011 | Ga0496114_0161096 | |||
| 2012 | Ga0496114_0204813 | |||
| 2013 | Ga0496114_0327955 | |||
| 2014 | Ga0496115_0328621 | |||
| 2015 | Ga0496115_0407622 | |||
| 2016 | Ga0501033_1018427 | |||
| 2017 | Ga0501036_0054613 | |||
| 2018 | Ga0501038_0245814 | |||
| 2019 | Ga0501038_0322724 | |||
| 2020 | Ga0501040_0483316 | |||
| 2021 | Ga0501040_1410210 | |||
| 2022 | Ga0501042_0215160 | |||
| 2023 | Ga0501043_0580818 | |||
| 2024 | Ga0501047_0939033 | |||
| 2025 | Ga0501067_0289629 | |||
| 2026 | Ga0501067_0481334 | |||
| 2027 | Ga0501069_0307261 | |||
| 2028 | Ga0501070_0455063 | |||
| 2029 | Ga0501071_0312005 | |||
| 2030 | Ga0501072_0270399 | |||
| 2031 | Ga0501074_0235859 | |||
| 2032 | Ga0501075_0012334 | |||
| 2033 | Ga0501075_0230492 | |||
| 2034 | Ga0501075_0509874 | |||
| 2035 | Ga0501076_0300744 | |||
| 2036 | Ga0501083_0021015 | |||
| 2037 | Ga0501045_0206848 | |||
| 2038 | nmdc:mga05p37_1041614_c1 | |||
| 2039 | nmdc:mga05p37_11139_c1 | |||
| 2040 | nmdc:mga05p37_114290_c1 | |||
| 2041 | nmdc:mga05p37_133487_c1 | |||
| 2042 | nmdc:mga05p37_162938_c1 | |||
| 2043 | nmdc:mga05p37_21081_c1 | |||
| 2044 | nmdc:mga05p37_21329_c1 | |||
| 2045 | nmdc:mga05p37_21681_c1 | |||
| 2046 | nmdc:mga05p37_26367_c1 | |||
| 2047 | nmdc:mga05p37_27602_c1 | |||
| 2048 | nmdc:mga05p37_586457_c1 | |||
| 2049 | nmdc:mga05p37_602696_c1 | |||
| 2050 | nmdc:mga05p37_901647_c1 | |||
| 2051 | nmdc:mga09592_1612446_c1 | |||
| 2052 | nmdc:mga09592_23225_c1 | |||
| 2053 | nmdc:mga06r32_166679_c1 | |||
| 2054 | nmdc:mga06r32_434910_c1 | |||
| 2055 | nmdc:mga08y16_14872_c1 | |||
| 2056 | nmdc:mga08y16_25097_c1 | |||
| 2057 | nmdc:mga08y16_411517_c1 | |||
| 2058 | nmdc:mga08y16_4545_c1 | |||
| 2059 | nmdc:mga08y16_49080_c1 | |||
| 2060 | nmdc:mga08y16_707011_c1 | |||
| 2061 | nmdc:mga08y16_846761_c1 | |||
| 2062 | nmdc:mga0n895_111_c1 | |||
| 2063 | nmdc:mga0n895_1544322_c1 | |||
| 2064 | nmdc:mga0n895_165469_c1 | |||
| 2065 | nmdc:mga0n895_178403_c1 | |||
| 2066 | nmdc:mga0n895_194660_c1 | |||
| 2067 | nmdc:mga0n895_198225_c1 | |||
| 2068 | nmdc:mga0n895_24015_c1 | |||
| 2069 | nmdc:mga0n895_331102_c1 | |||
| 2070 | nmdc:mga0n895_398495_c1 | |||
| 2071 | nmdc:mga0n895_5089_c1 | |||
| 2072 | nmdc:mga0n895_5595_c1 | |||
| 2073 | nmdc:mga0n895_568151_c1 | |||
| 2074 | nmdc:mga0n895_891361_c1 | |||
| 2075 | nmdc:mga0rr50_15819_c1 | |||
| 2076 | nmdc:mga0rr50_237654_c1 | |||
| 2077 | nmdc:mga0rr50_28606_c1 | |||
| 2078 | nmdc:mga0rr50_320502_c1 | |||
| 2079 | nmdc:mga0rr50_39119_c1 | |||
| 2080 | nmdc:mga0rr50_57_c1 | |||
| 2081 | nmdc:mga0rr50_61256_c1 | |||
| 2082 | nmdc:mga0rr50_636089_c1 | |||
| 2083 | nmdc:mga0rr50_757019_c1 | |||
| 2084 | nmdc:mga0rr50_8523_c1 | |||
| 2085 | nmdc:mga08x19_159863_c1 | |||
| 2086 | nmdc:mga08x19_28391_c1 | |||
| 2087 | nmdc:mga08x19_426_c1 | |||
| 2088 | nmdc:mga08x19_48296_c1 | |||
| 2089 | nmdc:mga08x19_56202_c1 | |||
| 2090 | nmdc:mga08x19_619912_c1 | |||
| 2091 | nmdc:mga08x19_706426_c1 | |||
| 2092 | nmdc:mga08x19_751684_c1 | |||
| 2093 | nmdc:mga08x19_89635_c1 | |||
| 2094 | nmdc:mga08x19_9426_c1 | |||
| 2095 | nmdc:mga0a205_198681_c1 | |||
| 2096 | nmdc:mga0a205_204751_c1 | |||
| 2097 | nmdc:mga0a205_45262_c1 | |||
| 2098 | nmdc:mga0a205_56158_c1 | |||
| 2099 | nmdc:mga0a205_72168_c1 | |||
| 2100 | nmdc:mga0a205_747481_c1 | |||
| 2101 | nmdc:mga0a205_753681_c1 | |||
| 2102 | nmdc:mga0a205_790368_c1 | |||
| 2103 | nmdc:mga0a205_822545_c1 | |||
| 2104 | nmdc:mga0a205_93806_c1 | |||
| 2105 | nmdc:mga0a205_94532_c1 | |||
| 2106 | Ga0495601_0075643 | |||
| 2107 | Ga0495601_0251258 | |||
| 2108 | Ga0495601_0277871 | |||
| 2109 | Ga0495601_0544148 | |||
| 2110 | Ga0495595_0043907 | |||
| 2111 | Ga0495595_0233737 | |||
| 2112 | Ga0495619_0001542 | |||
| 2113 | Ga0495619_0048944 | |||
| 2114 | Ga0495619_0096024 | |||
| 2115 | Ga0495619_0121354 | |||
| 2116 | Ga0495619_0161604 | |||
| 2117 | Ga0495619_0271887 | |||
| 2118 | Ga0495619_0320123 | |||
| 2119 | Ga0500658_0549302 | |||
| 2120 | Ga0501084_0112280 | |||
| 2121 | Ga0501082_1230046 | |||
| 2122 | Ga0530510_0970841 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7wg5-assembly1.cif.gz_J | cyclic electron transport supercomplex ndh-psi from arabidopsis | 0.6445 | 101 | 135 |
| 1ygu-assembly2.cif.gz_B | crystal structure of the tandem phosphatase domains of rptp cd45 with a ptyr peptide | 0.6004 | 104 | 136 |
| 6sc2-assembly1.cif.gz_F | structure of the dynein-2 complex; ift-train bound model | 0.5854 | 100 | 132 |
| 7ea3-assembly1.cif.gz_Y | intact ypt32-trappii (dimer). | 0.5845 | 107 | 142 |
| 1xeu-assembly1.cif.gz_A | crystal structure of internalin c from listeria monocytogenes | 0.5826 | 98 | 136 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8BHK6_23_124_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.7228 | 110 | 136 | 2.60.40.10 |
| af_D3ZEF7_249_359_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.673 | 112 | 136 | 2.60.40.10 |
| 4r6uC02 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.6448 | 108 | 136 | 2.60.40.10 |
| af_Q9NQ25_24_127_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.642 | 110 | 136 | 2.60.40.10 |
| af_G5EC69_181_473_3.90.190.10 | Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily | 0.633 | 103 | 142 | 3.90.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E5H216-F1-model_v4 | Uncharacterized protein | 0.9526 | 1 | 136 |
|
| AF-A0A6L7WTJ9-F1-model_v4 | Uncharacterized protein | 0.9504 | 2 | 142 |
|
| AF-A0A2E5H216-F1-model_v4 | Uncharacterized protein | 0.9393 | 1 | 136 |
|
| AF-A0A7X3TZW9-F1-model_v4 | Uncharacterized protein | 0.932 | 2 | 142 |
|
| AF-A0A7X3TZW9-F1-model_v4 | Uncharacterized protein | 0.9196 | 2 | 142 |
|