F489273

General Info

Members Datasets Scaffolds Average Seq Length
1060 518 2120 301

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10083025|Ga0307406_100830252
Length 331
Sequence MTAQHSAAPGQDTREPGRARIRVGSAPDSWGVWFPDDPEQVPWQRFLDEVSACGYEWIELGPYGYLPTDPAQLSDELAARSLRVSAGTVFEHLHRPNSWDAVWRQVDDVAALTQAVGGTHVVVIPDTFRDQKTGSDVESRELTAEQWQAKTSGVDRLARAIREEYGLSIAYHPHAESHVGWQRDIERFLADTDPALVPLCLDTGHVSYYRGDNLDLIRRYPERIGYLHLKQVDPAVIDEVLEKDVTWPDAVRMNAFVEPPNGVPAYPPLFEAIEELGLDVFAIVEQDMYPCPPDQPFPIAQRTHRHIASCQLPSLQIGAPTTRATGSEVQA

Samples

Sample ID Description Type Environment
1 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
11 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
115 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
116 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
119 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
120 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
121 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
173 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
174 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
175 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
176 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
177 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
178 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
181 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
182 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
185 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
186 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
187 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
188 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
195 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
196 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
197 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
205 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
206 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
207 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
208 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
209 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
210 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
211 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
212 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
213 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
214 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
215 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
216 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
217 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
218 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
219 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
220 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
221 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
222 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
223 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
224 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
225 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
226 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
227 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
228 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
229 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
230 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
231 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
232 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
233 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
234 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
235 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
236 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
237 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
238 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
239 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
240 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
241 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
242 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
243 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
244 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
245 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
246 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
247 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
248 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
249 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
250 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
251 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
252 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
253 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
254 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
255 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
256 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
257 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
258 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
259 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
260 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
261 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
262 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
263 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
264 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
265 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
266 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
267 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
268 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
269 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
270 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
271 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
272 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
273 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
274 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
275 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
276 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
277 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
278 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
279 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
280 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
281 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
282 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
283 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
284 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
285 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
286 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
287 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
288 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
289 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
290 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
291 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
292 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
293 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
294 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
295 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
296 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
297 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
298 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
299 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
300 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
301 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
302 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
303 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
304 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
305 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
306 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
307 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
308 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
309 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
310 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
311 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
312 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
313 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
314 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
315 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
316 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
317 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
318 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
319 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
320 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
321 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
322 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
323 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
324 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
325 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
326 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
327 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
328 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
329 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
330 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
331 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
332 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
333 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
334 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
335 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
336 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
337 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
338 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
339 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
340 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
356 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
357 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
358 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
359 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
360 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
361 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
362 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
363 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
364 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
365 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
366 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
369 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
370 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
371 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
372 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
373 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
374 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
375 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
376 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
377 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
378 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
379 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
380 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
381 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
382 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
383 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
384 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
385 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
386 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
387 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
388 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
389 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
390 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
391 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
392 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
393 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
394 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
395 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
396 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
397 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
398 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
399 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
400 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
401 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
402 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
403 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
404 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
405 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
406 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
407 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
408 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
409 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
410 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
411 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
412 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
413 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
414 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
415 2643221548 Streptomyces sp. Root55 Isolate Unclassified
416 2643221578 Streptomyces sp. Root63 Isolate Unclassified
417 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
418 2643221607 Rhizobium sp. Root73 Isolate Unclassified
419 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
420 2643221647 Streptomyces sp. Root369 Isolate Unclassified
421 2643221670 Streptomyces sp. Root431 Isolate Unclassified
422 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
423 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
424 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
425 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
426 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
427 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
428 2643221714 Streptomyces sp. Root264 Isolate Unclassified
429 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
430 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
431 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
432 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
433 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
434 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
435 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
436 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
437 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
438 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
439 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
440 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
441 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
442 2808606448 Streptomyces sp. 193411 Isolate Unclassified
443 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
444 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
445 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
446 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
447 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
448 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
449 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
450 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
451 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
452 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
453 2862574272 Streptomyces sp. AcE210 Isolate Nodule
454 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
455 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
456 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
457 2867369537 Streptomyces sp. Z26 Isolate Unclassified
458 2867428634 Streptomyces sp. RP5T Isolate Unclassified
459 2867475112 Streptomyces sp. TM32 Isolate Unclassified
460 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
461 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
462 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
463 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
464 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
465 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
466 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
467 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
468 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
469 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
470 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
471 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
472 2922554459 Rhodococcus sp. 66b Isolate Unclassified
473 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
474 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
475 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
476 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
477 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
478 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
479 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
480 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
481 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
482 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
483 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
484 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
485 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
486 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
487 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
488 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
489 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
490 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
491 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
492 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
493 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
494 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
495 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
496 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
497 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
498 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
499 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
500 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
501 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
502 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
503 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
504 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
505 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
506 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
507 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
508 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
509 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
510 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
511 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
512 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
513 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
514 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
515 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
516 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
517 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
518 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.79
Metatranscriptomes 0
Isolates 13.21

Biome Distribution

Category Percentage (%)
Aerial Root 0.09
Bulb 0
Endosphere 6.7
Nodule 0.57
Rhizoplane 6.42
Rhizosphere 75.94
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307406_10083025 3300031901 Bacteria 2136
2 JGI24743J22301_10005135 3300001991 Bacteria 2171
3 JGI24738J21930_10012736 3300002075 Bacteria 1833
4 JGI24744J21845_10001322 3300002077 Bacteria 4893
5 JGI24744J21845_10004246 3300002077 Bacteria 2957
6 JGI24034J26672_10010430 3300002239 Bacteria 1380
7 JGI25406J46586_10002006 3300003203 Bacteria 9620
8 rootH1_10030847 3300003316 Bacteria 1884
9 rootH1_10039924 3300003316 Bacteria 6529
10 rootH2_10002244 3300003320 Bacteria 2298
11 rootH2_10015356 3300003320 Bacteria 7338
12 JGI25160J50197_1007423 3300003354 Bacteria 4290
13 JGI25160J50197_1019006 3300003354 Bacteria 2122
14 JGI25407J50210_10014559 3300003373 Bacteria 2027
15 JGI25404J52841_10001019 3300003659 Bacteria 4630
16 Ga0070676_10013125 3300005328 Bacteria 4538
17 Ga0070676_10199641 3300005328 Bacteria 1310
18 Ga0070690_100118651 3300005330 Bacteria 1774
19 Ga0068869_100058741 3300005334 Bacteria 2814
20 Ga0068869_100463230 3300005334 Bacteria 1053
21 Ga0070666_10329768 3300005335 Bacteria 1090
22 Ga0070682_100023784 3300005337 Bacteria 3640
23 Ga0070682_100025193 3300005337 Bacteria 3548
24 Ga0070682_100062857 3300005337 Bacteria 2352
25 Ga0070682_100069467 3300005337 Bacteria 2249
26 Ga0070682_100089163 3300005337 Bacteria 2014
27 Ga0070682_100172079 3300005337 Bacteria 1506
28 Ga0070682_100271185 3300005337 Bacteria 1233
29 Ga0068868_100021572 3300005338 Bacteria 4851
30 Ga0070660_100223742 3300005339 Bacteria 1530
31 Ga0070689_100052755 3300005340 Bacteria 3146
32 Ga0070687_100091510 3300005343 Bacteria 1684
33 Ga0070692_10086442 3300005345 Bacteria 1697
34 Ga0070668_100000258 3300005347 Bacteria 35205
35 Ga0070668_100032029 3300005347 Bacteria 4000
36 Ga0070668_100252826 3300005347 Bacteria 1463
37 Ga0070668_100331507 3300005347 Bacteria 1283
38 Ga0070669_100021773 3300005353 Bacteria 4584
39 Ga0070669_100104510 3300005353 Bacteria 2141
40 Ga0070671_100109400 3300005355 Bacteria 2321
41 Ga0070674_100014431 3300005356 Bacteria 4912
42 Ga0070673_100377266 3300005364 Bacteria 1264
43 Ga0070688_100027997 3300005365 Bacteria 3359
44 Ga0070688_100128638 3300005365 Bacteria 1705
45 Ga0070659_100063986 3300005366 Bacteria 2910
46 Ga0070659_100102195 3300005366 Bacteria 2307
47 Ga0070659_100197470 3300005366 Bacteria 1655
48 Ga0070659_100368251 3300005366 Bacteria 1208
49 Ga0070667_100000077 3300005367 Bacteria 120245
50 Ga0070667_100059707 3300005367 Bacteria 3226
51 Ga0070667_100108548 3300005367 Bacteria 2404
52 Ga0070714_100178474 3300005435 Bacteria 1931
53 Ga0070710_10003297 3300005437 Bacteria 7650
54 Ga0070710_10016525 3300005437 Bacteria 3758
55 Ga0070701_10001956 3300005438 Bacteria 7804
56 Ga0070711_100003805 3300005439 Bacteria 8861
57 Ga0070711_100013123 3300005439 Bacteria 5196
58 Ga0070700_100011281 3300005441 Bacteria 4946
59 Ga0070700_100040024 3300005441 Bacteria 2867
60 Ga0070700_100040381 3300005441 Bacteria 2856
61 Ga0070694_100331705 3300005444 Bacteria 1174
62 Ga0070708_100136177 3300005445 Bacteria 2275
63 Ga0070663_100029769 3300005455 Bacteria 3735
64 Ga0070663_100141789 3300005455 Bacteria 1835
65 Ga0070663_100155109 3300005455 Bacteria 1759
66 Ga0070678_100036168 3300005456 Bacteria 3454
67 Ga0070678_100037113 3300005456 Bacteria 3418
68 Ga0070678_100069532 3300005456 Bacteria 2629
69 Ga0070662_100014744 3300005457 Bacteria 5223
70 Ga0068867_100014648 3300005459 Bacteria 5557
71 Ga0068867_100145593 3300005459 Bacteria 1856
72 Ga0070685_10031004 3300005466 Bacteria 2983
73 Ga0070685_10205411 3300005466 Bacteria 1283
74 Ga0070706_100491982 3300005467 Unclassified 1141
75 Ga0068853_100035405 3300005539 Bacteria 4240
76 Ga0068853_100094468 3300005539 Bacteria 2635
77 Ga0068853_100107742 3300005539 Bacteria 2471
78 Ga0070695_100071099 3300005545 Bacteria 2278
79 Ga0070696_100014519 3300005546 Bacteria 5285
80 Ga0070696_100087772 3300005546 Bacteria 2209
81 Ga0070693_100014604 3300005547 Bacteria 4027
82 Ga0070665_100007324 3300005548 Bacteria 11225
83 Ga0070665_100030094 3300005548 Bacteria 5464
84 Ga0070665_100041694 3300005548 Bacteria 4615
85 Ga0070704_100032574 3300005549 Bacteria 3517
86 Ga0068855_100244810 3300005563 Bacteria 2002
87 Ga0068854_100013941 3300005578 Bacteria 5288
88 Ga0068854_100015472 3300005578 Bacteria 5055
89 Ga0068854_100237154 3300005578 Bacteria 1451
90 Ga0068854_100291283 3300005578 Bacteria 1317
91 Ga0068856_100128145 3300005614 Bacteria 2541
92 Ga0070702_100014396 3300005615 Bacteria 4012
93 Ga0070702_100107025 3300005615 Bacteria 1726
94 Ga0070702_100111447 3300005615 Bacteria 1697
95 Ga0070702_100121378 3300005615 Bacteria 1637
96 Ga0070702_100265205 3300005615 Bacteria 1171
97 Ga0068859_100000438 3300005617 Bacteria 41832
98 Ga0068859_100042006 3300005617 Bacteria 4592
99 Ga0068859_100117895 3300005617 Bacteria 2720
100 Ga0068859_100248357 3300005617 Bacteria 1869
101 Ga0068866_10005609 3300005718 Bacteria 5194
102 Ga0068866_10005802 3300005718 Bacteria 5123
103 Ga0068866_10022932 3300005718 Bacteria 2896
104 Ga0068861_100038820 3300005719 Bacteria 3550
105 Ga0068861_100063709 3300005719 Bacteria 2834
106 Ga0068861_100139583 3300005719 Bacteria 1977
107 Ga0068863_100000777 3300005841 Bacteria 32074
108 Ga0068863_100011776 3300005841 Bacteria 8454
109 Ga0068863_100161053 3300005841 Bacteria 2150
110 Ga0068863_100173859 3300005841 Bacteria 2066
111 Ga0068858_100008639 3300005842 Bacteria 9781
112 Ga0068858_100034036 3300005842 Bacteria 4726
113 Ga0068858_100100702 3300005842 Bacteria 2694
114 Ga0068860_100000010 3300005843 Bacteria 359114
115 Ga0068860_100025586 3300005843 Bacteria 5692
116 Ga0068860_100439666 3300005843 Bacteria 1295
117 Ga0068862_100000008 3300005844 Bacteria 305510
118 Ga0068862_100030155 3300005844 Bacteria 4570
119 Ga0081455_10025168 3300005937 Bacteria 5498
120 Ga0081455_10032407 3300005937 Bacteria 4708
121 Ga0081455_10034638 3300005937 Bacteria 4522
122 Ga0081455_10067116 3300005937 Bacteria 2991
123 Ga0081455_10093426 3300005937 Bacteria 2432
124 Ga0081538_10000186 3300005981 Bacteria 68308
125 Ga0081538_10096580 3300005981 Bacteria 1505
126 Ga0081540_1001044 3300005983 Bacteria 24757
127 Ga0081540_1043683 3300005983 Bacteria 2295
128 Ga0081539_10000208 3300005985 Bacteria 136941
129 Ga0081539_10003746 3300005985 Bacteria 18071
130 Ga0075365_10006361 3300006038 Bacteria 6491
131 Ga0075365_10088968 3300006038 Bacteria 2102
132 Ga0075365_10197601 3300006038 Bacteria 1408
133 Ga0075368_10030260 3300006042 Bacteria 2096
134 Ga0075368_10035580 3300006042 Bacteria 1944
135 Ga0075363_100008072 3300006048 Bacteria 4882
136 Ga0075363_100012279 3300006048 Bacteria 4125
137 Ga0075363_100020295 3300006048 Bacteria 3331
138 Ga0075363_100032995 3300006048 Bacteria 2693
139 Ga0075363_100053836 3300006048 Bacteria 2151
140 Ga0075364_10002441 3300006051 Bacteria 10412
141 Ga0075364_10024121 3300006051 Bacteria 3858
142 Ga0075364_10051528 3300006051 Bacteria 2688
143 Ga0075364_10105783 3300006051 Bacteria 1875
144 Ga0075364_10309002 3300006051 Bacteria 1077
145 Ga0075432_10000861 3300006058 Bacteria 9564
146 Ga0075432_10013820 3300006058 Bacteria 2746
147 Ga0070715_10018460 3300006163 Bacteria 2658
148 Ga0070716_100013793 3300006173 Bacteria 4126
149 Ga0070712_100018992 3300006175 Bacteria 4474
150 Ga0070712_100021410 3300006175 Bacteria 4247
151 Ga0075367_10001716 3300006178 Bacteria 9597
152 Ga0075367_10024385 3300006178 Bacteria 3411
153 Ga0075367_10056257 3300006178 Bacteria 2336
154 Ga0075369_10000277 3300006186 Bacteria 15336
155 Ga0075369_10012034 3300006186 Bacteria 3413
156 Ga0097621_100071607 3300006237 Bacteria 2865
157 Ga0075370_10014632 3300006353 Bacteria 4189
158 Ga0075370_10017296 3300006353 Bacteria 3894
159 Ga0075370_10271461 3300006353 Bacteria 1007
160 Ga0068871_100051699 3300006358 Bacteria 3327
161 Ga0075428_100002077 3300006844 Bacteria 21610
162 Ga0075428_100011650 3300006844 Bacteria 9785
163 Ga0075428_100198703 3300006844 Bacteria 2168
164 Ga0075430_100008157 3300006846 Bacteria 8851
165 Ga0075431_100085932 3300006847 Bacteria 3247
166 Ga0075431_100661636 3300006847 Bacteria 1024
167 Ga0075434_100000386 3300006871 Bacteria 32198
168 Ga0075434_100001823 3300006871 Bacteria 18395
169 Ga0075429_100044631 3300006880 Bacteria 3855
170 Ga0068865_100004289 3300006881 Bacteria 8606
171 Ga0068865_100056712 3300006881 Bacteria 2730
172 Ga0075436_100000338 3300006914 Bacteria 29991
173 Ga0097620_100000438 3300006931 Bacteria 41832
174 Ga0097620_100042004 3300006931 Bacteria 4592
175 Ga0097620_100117893 3300006931 Bacteria 2720
176 Ga0097620_100248356 3300006931 Bacteria 1869
177 Ga0099826_10054431 3300006948 Bacteria 2656
178 Ga0099826_10060166 3300006948 Bacteria 2477
179 Ga0075435_100002397 3300007076 Bacteria 12431
180 Ga0075435_100002693 3300007076 Bacteria 11865
181 Ga0105244_10041691 3300009036 Bacteria 2378
182 Ga0105250_10008787 3300009092 Bacteria 4279
183 Ga0111539_10001835 3300009094 Bacteria 28239
184 Ga0111539_10072056 3300009094 Bacteria 4075
185 Ga0111539_10134313 3300009094 Bacteria 2897
186 Ga0111539_10294889 3300009094 Bacteria 1887
187 Ga0105245_10029615 3300009098 Bacteria 4838
188 Ga0105245_10066600 3300009098 Bacteria 3260
189 Ga0105245_10223280 3300009098 Bacteria 1819
190 Ga0105247_10004190 3300009101 Bacteria 9253
191 Ga0105247_10086458 3300009101 Bacteria 1984
192 Ga0105247_10321876 3300009101 Bacteria 1079
193 Ga0114129_10037098 3300009147 Bacteria 6881
194 Ga0114129_10096472 3300009147 Bacteria 4093
195 Ga0114129_10777883 3300009147 Bacteria 1223
196 Ga0105243_10007430 3300009148 Bacteria 8420
197 Ga0105243_10017855 3300009148 Bacteria 5366
198 Ga0105243_10023025 3300009148 Bacteria 4738
199 Ga0105243_10053826 3300009148 Bacteria 3193
200 Ga0105242_10011766 3300009176 Bacteria 6733
201 Ga0105242_10057869 3300009176 Bacteria 3176
202 Ga0105248_10000093 3300009177 Bacteria 98669
203 Ga0105248_10016994 3300009177 Bacteria 8013
204 Ga0105248_10029565 3300009177 Bacteria 6113
205 Ga0105248_10223629 3300009177 Bacteria 2119
206 Ga0105237_10064180 3300009545 Bacteria 3669
207 Ga0105237_10079500 3300009545 Bacteria 3269
208 Ga0105237_10211240 3300009545 Bacteria 1941
209 Ga0105238_10029299 3300009551 Bacteria 5608
210 Ga0105238_10260762 3300009551 Bacteria 1712
211 Ga0105249_10000019 3300009553 Bacteria 273807
212 Ga0105249_10028056 3300009553 Bacteria 5081
213 Ga0105249_10036561 3300009553 Bacteria 4455
214 Ga0105249_10140623 3300009553 Bacteria 2314
215 Ga0105033_105012 3300009986 Bacteria 1134
216 Ga0105239_10050997 3300010375 Bacteria 4537
217 Ga0105239_10222177 3300010375 Bacteria 2118
218 Ga0105239_10369296 3300010375 Bacteria 1621
219 Ga0105246_10002782 3300011119 Bacteria 10593
220 Ga0105246_10082859 3300011119 Bacteria 2290
221 Ga0105246_10126553 3300011119 Bacteria 1902
222 Ga0105246_10261548 3300011119 Bacteria 1379
223 Ga0157369_10521648 3300013105 Bacteria 1229
224 Ga0157369_10733294 3300013105 Bacteria 1017
225 Ga0157374_10012755 3300013296 Bacteria 7323
226 Ga0157378_10035989 3300013297 Bacteria 4381
227 Ga0157378_10053432 3300013297 Bacteria 3596
228 Ga0157378_10268423 3300013297 Bacteria 1640
229 Ga0163162_10009988 3300013306 Bacteria 9231
230 Ga0163162_10031792 3300013306 Bacteria 5237
231 Ga0163162_10092950 3300013306 Bacteria 3101
232 Ga0157372_10037234 3300013307 Bacteria 5364
233 Ga0157372_10044562 3300013307 Bacteria 4916
234 Ga0157372_10147659 3300013307 Bacteria 2712
235 Ga0157372_10316851 3300013307 Bacteria 1816
236 Ga0157372_10566810 3300013307 Bacteria 1324
237 Ga0157375_10026309 3300013308 Bacteria 5419
238 Ga0157375_10157551 3300013308 Bacteria 2410
239 Ga0157375_10495625 3300013308 Bacteria 1386
240 Ga0163163_10172731 3300014325 Bacteria 2208
241 Ga0163163_10205773 3300014325 Bacteria 2016
242 Ga0157380_10013449 3300014326 Bacteria 5966
243 Ga0182008_10001253 3300014497 Bacteria 17425
244 Ga0182008_10001941 3300014497 Bacteria 13349
245 Ga0157377_10096844 3300014745 Bacteria 1751
246 Ga0157379_10026709 3300014968 Bacteria 5139
247 Ga0157379_10148111 3300014968 Bacteria 2117
248 Ga0157376_10121431 3300014969 Bacteria 2316
249 Ga0182006_1054255 3300015261 Bacteria 1534
250 Ga0182007_10001202 3300015262 Bacteria 14061
251 Ga0182007_10001318 3300015262 Bacteria 13405
252 Ga0183367_1001 3300015688 Bacteria 1225545
253 Ga0183367_1006 3300015688 Bacteria 648044
254 Ga0183367_1021 3300015688 Bacteria 82913
255 Ga0163161_10018886 3300017792 Bacteria 4833
256 Ga0163161_10034890 3300017792 Bacteria 3599
257 Ga0163161_10038680 3300017792 Bacteria 3422
258 Ga0213872_10124712 3300021361 Bacteria 1137
259 Ga0213875_10012871 3300021388 Bacteria 4122
260 Ga0209758_1004873 3300025297 Bacteria 10804
261 Ga0207426_1000790 3300025302 Bacteria 34458
262 Ga0207426_1007251 3300025302 Bacteria 4669
263 Ga0207692_10034037 3300025898 Bacteria 2464
264 Ga0207642_10001150 3300025899 Bacteria 8183
265 Ga0207642_10003227 3300025899 Bacteria 5118
266 Ga0207710_10000036 3300025900 Bacteria 245176
267 Ga0207710_10004865 3300025900 Bacteria 5822
268 Ga0207688_10004821 3300025901 Bacteria 7350
269 Ga0207688_10009339 3300025901 Bacteria 5347
270 Ga0207688_10011084 3300025901 Bacteria 4904
271 Ga0207688_10011102 3300025901 Bacteria 4901
272 Ga0207680_10028654 3300025903 Bacteria 3118
273 Ga0207647_10004145 3300025904 Bacteria 10756
274 Ga0207647_10006210 3300025904 Bacteria 8709
275 Ga0207645_10024618 3300025907 Bacteria 3900
276 Ga0207643_10123462 3300025908 Bacteria 1536
277 Ga0207671_10082828 3300025914 Bacteria 2408
278 Ga0207671_10161455 3300025914 Bacteria 1736
279 Ga0207671_10182227 3300025914 Bacteria 1635
280 Ga0207693_10000907 3300025915 Bacteria 26588
281 Ga0207693_10031555 3300025915 Bacteria 4187
282 Ga0207663_10008831 3300025916 Bacteria 5296
283 Ga0207662_10169293 3300025918 Bacteria 1400
284 Ga0207657_10217836 3300025919 Bacteria 1530
285 Ga0207681_10000911 3300025923 Bacteria 19299
286 Ga0207681_10113069 3300025923 Bacteria 1979
287 Ga0207659_10094965 3300025926 Bacteria 2235
288 Ga0207687_10022173 3300025927 Bacteria 4224
289 Ga0207687_10066500 3300025927 Bacteria 2562
290 Ga0207687_10132478 3300025927 Bacteria 1881
291 Ga0207687_10194766 3300025927 Bacteria 1580
292 Ga0207687_10220284 3300025927 Bacteria 1494
293 Ga0207664_10268312 3300025929 Bacteria 1494
294 Ga0207644_10039998 3300025931 Bacteria 3312
295 Ga0207690_10024822 3300025932 Bacteria 3758
296 Ga0207706_10009858 3300025933 Bacteria 8764
297 Ga0207706_10011561 3300025933 Bacteria 8037
298 Ga0207706_10025627 3300025933 Bacteria 5283
299 Ga0207686_10014368 3300025934 Bacteria 4405
300 Ga0207686_10157011 3300025934 Bacteria 1590
301 Ga0207709_10081196 3300025935 Bacteria 2090
302 Ga0207709_10231279 3300025935 Bacteria 1339
303 Ga0207670_10153795 3300025936 Bacteria 1709
304 Ga0207670_10319645 3300025936 Bacteria 1221
305 Ga0207669_10005203 3300025937 Bacteria 5811
306 Ga0207704_10003456 3300025938 Bacteria 7181
307 Ga0207704_10017139 3300025938 Bacteria 3746
308 Ga0207665_10015075 3300025939 Bacteria 5075
309 Ga0207665_10085837 3300025939 Bacteria 2173
310 Ga0207711_10000102 3300025941 Bacteria 90198
311 Ga0207711_10053321 3300025941 Bacteria 3468
312 Ga0207689_10038617 3300025942 Bacteria 3954
313 Ga0207689_10119135 3300025942 Bacteria 2171
314 Ga0207651_10037994 3300025960 Bacteria 3159
315 Ga0207712_10000025 3300025961 Bacteria 274015
316 Ga0207712_10007451 3300025961 Bacteria 6910
317 Ga0207712_10015268 3300025961 Bacteria 4951
318 Ga0207712_10030682 3300025961 Bacteria 3616
319 Ga0207668_10000858 3300025972 Bacteria 18305
320 Ga0207668_10012838 3300025972 Bacteria 5139
321 Ga0207640_10016612 3300025981 Bacteria 4286
322 Ga0207640_10209288 3300025981 Bacteria 1484
323 Ga0207658_10000593 3300025986 Bacteria 32472
324 Ga0207658_10018718 3300025986 Bacteria 4787
325 Ga0207658_10021481 3300025986 Bacteria 4482
326 Ga0207658_10063322 3300025986 Bacteria 2771
327 Ga0207677_10004981 3300026023 Bacteria 7173
328 Ga0207703_10034863 3300026035 Bacteria 3996
329 Ga0207703_10082270 3300026035 Bacteria 2686
330 Ga0207639_10005386 3300026041 Bacteria 8652
331 Ga0207639_10018925 3300026041 Bacteria 4903
332 Ga0207639_10096026 3300026041 Bacteria 2384
333 Ga0207678_10007984 3300026067 Bacteria 9331
334 Ga0207678_10008236 3300026067 Bacteria 9187
335 Ga0207708_10020348 3300026075 Bacteria 5005
336 Ga0207708_10058034 3300026075 Bacteria 2953
337 Ga0207702_10068447 3300026078 Bacteria 3050
338 Ga0207641_10010691 3300026088 Bacteria 7528
339 Ga0207648_10019145 3300026089 Bacteria 6178
340 Ga0207648_10050267 3300026089 Bacteria 3646
341 Ga0207676_10261604 3300026095 Bacteria 1563
342 Ga0207676_10375334 3300026095 Bacteria 1322
343 Ga0207675_100004805 3300026118 Bacteria 13013
344 Ga0207675_100017465 3300026118 Bacteria 6697
345 Ga0207683_10002324 3300026121 Bacteria 16678
346 Ga0207683_10022246 3300026121 Bacteria 5440
347 Ga0207683_10118424 3300026121 Bacteria 2376
348 Ga0207683_10214896 3300026121 Bacteria 1751
349 Ga0207698_10073838 3300026142 Bacteria 2717
350 Ga0207698_10308578 3300026142 Bacteria 1476
351 Ga0207698_10326190 3300026142 Bacteria 1440
352 Ga0209282_1052640 3300027666 Bacteria 2322
353 Ga0207428_10001237 3300027907 Bacteria 27357
354 Ga0207428_10009580 3300027907 Bacteria 8675
355 Ga0207428_10102957 3300027907 Bacteria 2204
356 Ga0268266_10013583 3300028379 Bacteria 7014
357 Ga0268266_10034979 3300028379 Bacteria 4273
358 Ga0268266_10078584 3300028379 Bacteria 2871
359 Ga0268266_10549082 3300028379 Bacteria 1107
360 Ga0268265_10000007 3300028380 Bacteria 431817
361 Ga0268265_10013185 3300028380 Bacteria 5615
362 Ga0268265_10193758 3300028380 Bacteria 1757
363 Ga0268264_10000007 3300028381 Bacteria 815790
364 Ga0268264_10024292 3300028381 Bacteria 4948
365 Ga0268264_10252950 3300028381 Bacteria 1638
366 Ga0268264_10258421 3300028381 Bacteria 1621
367 Ga0268264_10384548 3300028381 Bacteria 1345
368 Ga0307517_10004208 3300028786 Bacteria 22182
369 Ga0307515_10000046 3300028794 Bacteria 293319
370 Ga0307515_10034314 3300028794 Bacteria 8314
371 Ga0307515_10106091 3300028794 Bacteria 3337
372 Ga0307515_10150583 3300028794 Bacteria 2434
373 Ga0268256_1020506 3300030500 Bacteria 1781
374 Ga0307511_10002260 3300030521 Bacteria 20135
375 Ga0307511_10049337 3300030521 Bacteria 3409
376 Ga0307511_10155770 3300030521 Bacteria 1297
377 Ga0307512_10043807 3300030522 Bacteria 3686
378 Ga0307513_10015302 3300031456 Bacteria 9306
379 Ga0307513_10019716 3300031456 Bacteria 8016
380 Ga0307509_10039748 3300031507 Bacteria 5122
381 Ga0307509_10193474 3300031507 Bacteria 1881
382 Ga0307408_100025439 3300031548 Bacteria 4055
383 Ga0307508_10005047 3300031616 Bacteria 12676
384 Ga0307508_10012343 3300031616 Bacteria 7811
385 Ga0307508_10015165 3300031616 Bacteria 7023
386 Ga0307508_10023014 3300031616 Bacteria 5660
387 Ga0307508_10130526 3300031616 Bacteria 2116
388 Ga0307514_10003992 3300031649 Bacteria 13772
389 Ga0307514_10069990 3300031649 Bacteria 2636
390 Ga0307514_10079829 3300031649 Bacteria 2423
391 Ga0307516_10014667 3300031730 Bacteria 8280
392 Ga0307405_10010297 3300031731 Bacteria 4835
393 Ga0307405_10011336 3300031731 Bacteria 4666
394 Ga0307405_10050903 3300031731 Bacteria 2568
395 Ga0307413_10006809 3300031824 Bacteria 5252
396 Ga0307413_10027077 3300031824 Bacteria 3170
397 Ga0307413_10094073 3300031824 Bacteria 1961
398 Ga0307413_10133366 3300031824 Bacteria 1704
399 Ga0307518_10048604 3300031838 Bacteria 3084
400 Ga0307410_10000186 3300031852 Bacteria 22976
401 Ga0307410_10004749 3300031852 Bacteria 7083
402 Ga0307410_10006417 3300031852 Bacteria 6344
403 Ga0307410_10006476 3300031852 Bacteria 6322
404 Ga0307410_10014259 3300031852 Bacteria 4670
405 Ga0307410_10373282 3300031852 Bacteria 1146
406 Ga0307406_10000071 3300031901 Bacteria 56611
407 Ga0307406_10008812 3300031901 Bacteria 5638
408 Ga0307406_10015056 3300031901 Bacteria 4466
409 Ga0307406_10090558 3300031901 Bacteria 2058
410 Ga0307407_10004883 3300031903 Bacteria 5754
411 Ga0307407_10023459 3300031903 Bacteria 3220
412 Ga0307407_10051314 3300031903 Bacteria 2364
413 Ga0307407_10064946 3300031903 Bacteria 2147
414 Ga0307407_10089121 3300031903 Bacteria 1886
415 Ga0307407_10194601 3300031903 Bacteria 1354
416 Ga0307407_10240326 3300031903 Bacteria 1235
417 Ga0307412_10292644 3300031911 Bacteria 1283
418 Ga0307409_100000106 3300031995 Bacteria 30264
419 Ga0307409_100002886 3300031995 Bacteria 9115
420 Ga0307409_100003055 3300031995 Bacteria 8948
421 Ga0307409_100024232 3300031995 Bacteria 4227
422 Ga0307409_100029134 3300031995 Bacteria 3946
423 Ga0307409_100076346 3300031995 Bacteria 2686
424 Ga0307409_100210805 3300031995 Bacteria 1746
425 Ga0307409_100280006 3300031995 Bacteria 1541
426 Ga0307416_100000850 3300032002 Bacteria 16062
427 Ga0307416_100017280 3300032002 Bacteria 5041
428 Ga0307416_100049737 3300032002 Bacteria 3335
429 Ga0307416_100066381 3300032002 Bacteria 2970
430 Ga0307416_100176833 3300032002 Bacteria 1995
431 Ga0307416_100229361 3300032002 Bacteria 1789
432 Ga0307416_100443581 3300032002 Bacteria 1349
433 Ga0307414_10010360 3300032004 Bacteria 5405
434 Ga0307414_10020775 3300032004 Bacteria 4101
435 Ga0307414_10026408 3300032004 Bacteria 3737
436 Ga0307414_10081940 3300032004 Bacteria 2364
437 Ga0307414_10083907 3300032004 Bacteria 2341
438 Ga0307414_10184653 3300032004 Bacteria 1681
439 Ga0307414_10218668 3300032004 Bacteria 1562
440 Ga0307411_10009357 3300032005 Bacteria 5146
441 Ga0307411_10011519 3300032005 Bacteria 4778
442 Ga0307411_10042548 3300032005 Bacteria 2899
443 Ga0307411_10098100 3300032005 Bacteria 2064
444 Ga0307415_100002560 3300032126 Bacteria 9096
445 Ga0307415_100005844 3300032126 Bacteria 6579
446 Ga0307415_100013305 3300032126 Bacteria 4798
447 Ga0307415_100021903 3300032126 Bacteria 3936
448 Ga0307415_100060321 3300032126 Bacteria 2621
449 Ga0307415_100160352 3300032126 Bacteria 1742
450 Ga0307415_100306451 3300032126 Bacteria 1318
451 Ga0307507_10014232 3300033179 Bacteria 9511
452 Ga0307507_10015481 3300033179 Bacteria 8966
453 Ga0307507_10208544 3300033179 Bacteria 1337
454 Ga0307510_10158611 3300033180 Bacteria 1864
455 Ga0373940_0037846 3300035088 Bacteria 1315
456 Ga0373931_0039646 3300035691 Bacteria 2468
457 Ga0373925_0196960 3300037068 Bacteria 1601
458 Ga0395900_0083875 3300037418 Bacteria 3274
459 Ga0395900_0256237 3300037418 Bacteria 1749
460 Ga0395900_0319301 3300037418 Bacteria 1534
461 Ga0395898_0015241 3300037466 Bacteria 7891
462 Ga0395898_0042453 3300037466 Bacteria 4486
463 Ga0395898_0073677 3300037466 Bacteria 3299
464 Ga0395905_0421335 3300037471 Bacteria 1231
465 Ga0436364_0370574 3300037853 Bacteria 6351
466 Ga0436364_1016041 3300037853 Bacteria 1583
467 Ga0436365_0664968 3300039437 Bacteria 3008
468 Ga0436361_0713294 3300039447 Bacteria 6790
469 Ga0439436_0007597 3300041404 Bacteria 3336
470 Ga0439436_0024059 3300041404 Bacteria 1799
471 Ga0439461_0000622 3300041410 Bacteria 5113
472 Ga0439466_0010203 3300041411 Bacteria 3493
473 Ga0439465_0004933 3300041413 Bacteria 4288
474 Ga0451795_0177854 3300041456 Bacteria 5771
475 Ga0451853_0186994 3300041512 Bacteria 3429
476 Ga0439431_0004964 3300041997 Bacteria 2931
477 Ga0439433_0001850 3300041999 Bacteria 4416
478 Ga0439448_0007193 3300042005 Bacteria 3218
479 Ga0439448_0018547 3300042005 Bacteria 2134
480 Ga0439449_0002442 3300042007 Bacteria 7266
481 Ga0439449_0003409 3300042007 Bacteria 6184
482 Ga0439449_0033212 3300042007 Bacteria 1922
483 Ga0439449_0040692 3300042007 Bacteria 1728
484 Ga0439455_0003289 3300042012 Bacteria 3066
485 Ga0439455_0006433 3300042012 Bacteria 2438
486 Ga0439455_0028684 3300042012 Bacteria 1372
487 Ga0439457_000977 3300042014 Bacteria 8596
488 Ga0439457_002741 3300042014 Bacteria 4951
489 Ga0439462_0002522 3300042015 Bacteria 4266
490 Ga0450894_002382 3300042131 Bacteria 2533
491 Ga0450900_002018 3300042136 Bacteria 2092
492 Ga0450903_000575 3300042138 Bacteria 7531
493 Ga0450903_001095 3300042138 Bacteria 5155
494 Ga0439458_0000722 3300042157 Bacteria 8508
495 Ga0439434_0003247 3300042435 Bacteria 4771
496 Ga0439434_0045611 3300042435 Bacteria 1352
497 Ga0439440_0013027 3300042993 Bacteria 1777
498 Ga0466969_0045354 3300044656 Bacteria 2183
499 Ga0466972_0001755 3300044658 Bacteria 10637
500 Ga0466972_0002060 3300044658 Bacteria 9850
501 Ga0466972_0011100 3300044658 Bacteria 4521
502 Ga0466972_0020443 3300044658 Bacteria 3308
503 Ga0466972_0039617 3300044658 Bacteria 2299
504 Ga0466972_0057811 3300044658 Bacteria 1862
505 Ga0466972_0127922 3300044658 Bacteria 1197
506 Ga0466965_0000288 3300044683 Bacteria 16687
507 Ga0466965_0000502 3300044683 Bacteria 13930
508 Ga0466965_0126935 3300044683 Bacteria 1320
509 Ga0466966_0002830 3300044684 Bacteria 11416
510 Ga0466966_0004237 3300044684 Bacteria 9467
511 Ga0466966_0258692 3300044684 Bacteria 1048
512 Ga0466961_0054195 3300044693 Bacteria 2558
513 Ga0466963_0001177 3300044694 Bacteria 13738
514 Ga0466963_0008746 3300044694 Bacteria 6080
515 Ga0466963_0057579 3300044694 Bacteria 2588
516 Ga0466964_0001884 3300044706 Bacteria 7323
517 Ga0466971_0003539 3300044719 Bacteria 6674
518 Ga0466971_0007148 3300044719 Bacteria 4859
519 Ga0466971_0025437 3300044719 Bacteria 2644
520 Ga0466970_0005387 3300044765 Bacteria 6349
521 Ga0466970_0008602 3300044765 Bacteria 5141
522 Ga0466970_0010797 3300044765 Bacteria 4644
523 Ga0466970_0025003 3300044765 Bacteria 3125
524 Ga0466970_0037802 3300044765 Bacteria 2560
525 Ga0466970_0160682 3300044765 Bacteria 1242
526 Ga0466957_0009571 3300044842 Bacteria 5534
527 Ga0466957_0025969 3300044842 Bacteria 3473
528 Ga0466957_0040330 3300044842 Bacteria 2819
529 Ga0466957_0063553 3300044842 Bacteria 2269
530 Ga0466957_0090970 3300044842 Bacteria 1912
531 Ga0466960_0000313 3300044901 Bacteria 16642
532 Ga0466960_0001508 3300044901 Bacteria 8476
533 Ga0466960_0016305 3300044901 Bacteria 3219
534 Ga0466960_0090547 3300044901 Bacteria 1558
535 Ga0466959_0008657 3300045049 Bacteria 7203
536 Ga0466958_0001015 3300045836 Bacteria 12747
537 Ga0466958_0243816 3300045836 Bacteria 1148
538 Ga0466967_0000412 3300045976 Bacteria 20240
539 Ga0466967_0017691 3300045976 Bacteria 5670
540 Ga0466967_0053051 3300045976 Bacteria 3563
541 Ga0466967_0061221 3300045976 Bacteria 3339
542 Ga0466967_0090540 3300045976 Bacteria 2779
543 Ga0466967_0125089 3300045976 Bacteria 2381
544 Ga0466967_0349201 3300045976 Bacteria 1431
545 Ga0466967_0496111 3300045976 Bacteria 1198
546 Ga0495617_025457 3300046452 Bacteria 1994
547 Ga0495627_017353 3300046453 Bacteria 2448
548 Ga0495592_0088282 3300046454 Bacteria 2229
549 Ga0495603_0007354 3300046455 Bacteria 6624
550 Ga0495603_0009121 3300046455 Bacteria 5997
551 Ga0495603_0019345 3300046455 Bacteria 4121
552 Ga0495603_0033670 3300046455 Bacteria 3082
553 Ga0495603_0058650 3300046455 Bacteria 2275
554 Ga0495590_0048739 3300046457 Bacteria 1478
555 Ga0495629_0001933 3300046459 Bacteria 16145
556 Ga0495629_0011063 3300046459 Bacteria 6556
557 Ga0495629_0012494 3300046459 Bacteria 6150
558 Ga0495629_0015172 3300046459 Bacteria 5536
559 Ga0495629_0072468 3300046459 Bacteria 2404
560 Ga0495629_0136970 3300046459 Bacteria 1704
561 Ga0495638_0008024 3300046460 Bacteria 7519
562 Ga0495638_0008071 3300046460 Bacteria 7494
563 Ga0495638_0026620 3300046460 Bacteria 3747
564 Ga0495638_0183262 3300046460 Bacteria 1193
565 Ga0495651_0001558 3300046462 Bacteria 17724
566 Ga0495605_0003611 3300046474 Bacteria 9178
567 Ga0495639_0014741 3300046475 Bacteria 3387
568 Ga0495662_0000305 3300046476 Bacteria 21349
569 Ga0495662_0016026 3300046476 Bacteria 3636
570 Ga0495662_0090269 3300046476 Bacteria 1493
571 Ga0495664_0067571 3300046477 Bacteria 2132
572 Ga0495664_0146605 3300046477 Bacteria 1431
573 Ga0495585_0088955 3300046492 Bacteria 1665
574 Ga0495594_0003881 3300046499 Bacteria 7687
575 Ga0495594_0024219 3300046499 Bacteria 3258
576 Ga0495594_0121465 3300046499 Bacteria 1477
577 Ga0495594_0148271 3300046499 Bacteria 1331
578 Ga0495607_0020887 3300046501 Bacteria 4128
579 Ga0495607_0069572 3300046501 Bacteria 1969
580 Ga0495583_0020416 3300046506 Bacteria 3432
581 Ga0495583_0031590 3300046506 Bacteria 2565
582 Ga0495583_0050471 3300046506 Bacteria 1901
583 Ga0495606_0007016 3300046507 Bacteria 10221
584 Ga0495606_0007166 3300046507 Bacteria 10066
585 Ga0495606_0029891 3300046507 Bacteria 3818
586 Ga0495610_0046548 3300046512 Bacteria 2139
587 Ga0495610_0122337 3300046512 Bacteria 1139
588 Ga0495616_0001426 3300046513 Bacteria 16636
589 Ga0495616_0030023 3300046513 Bacteria 2862
590 Ga0495618_0017879 3300046514 Bacteria 4351
591 Ga0495618_0059889 3300046514 Bacteria 2413
592 Ga0495620_0001023 3300046515 Bacteria 17198
593 Ga0495620_0012144 3300046515 Bacteria 4464
594 Ga0495628_0090038 3300046516 Bacteria 2375
595 Ga0495628_0176393 3300046516 Bacteria 1618
596 Ga0495630_0032749 3300046517 Bacteria 3875
597 Ga0495630_0085244 3300046517 Bacteria 2385
598 Ga0495631_0005052 3300046518 Bacteria 6950
599 Ga0495643_0004195 3300046522 Bacteria 10208
600 Ga0495643_0021076 3300046522 Bacteria 3745
601 Ga0495648_0006495 3300046524 Bacteria 9535
602 Ga0495648_0073713 3300046524 Bacteria 1969
603 Ga0495648_0087811 3300046524 Bacteria 1749
604 Ga0495648_0149596 3300046524 Bacteria 1219
605 Ga0495666_0023421 3300046526 Bacteria 3053
606 Ga0495652_0104742 3300046529 Bacteria 2287
607 Ga0495652_0341063 3300046529 Bacteria 1076
608 Ga0495654_0039660 3300046530 Bacteria 2350
609 Ga0495654_0089547 3300046530 Bacteria 1430
610 Ga0495640_0259776 3300046533 Bacteria 1085
611 Ga0495586_0062897 3300046535 Bacteria 2021
612 Ga0495587_0011507 3300046536 Bacteria 5604
613 Ga0495609_0012613 3300046538 Bacteria 4007
614 Ga0495609_0018220 3300046538 Bacteria 3254
615 Ga0495621_0036286 3300046539 Bacteria 1711
616 Ga0495597_0009742 3300046542 Bacteria 4731
617 Ga0495645_0084185 3300046543 Bacteria 2278
618 Ga0495645_0129952 3300046543 Bacteria 1766
619 Ga0495622_0092011 3300046557 Bacteria 1393
620 Ga0495633_0045335 3300046558 Bacteria 2082
621 Ga0495633_0068545 3300046558 Bacteria 1656
622 Ga0495667_0223730 3300046559 Bacteria 1201
623 Ga0495656_0021881 3300046615 Bacteria 2496
624 Ga0495656_0196795 3300046615 Bacteria 998
625 Ga0495668_0000128 3300046616 Bacteria 113090
626 Ga0495668_0010814 3300046616 Bacteria 5501
627 Ga0495668_0029453 3300046616 Bacteria 3101
628 Ga0495634_0008925 3300046642 Bacteria 7425
629 Ga0495634_0084145 3300046642 Bacteria 2074
630 Ga0495611_0076347 3300046648 Bacteria 1536
631 Ga0495625_0037842 3300046660 Bacteria 3535
632 Ga0495635_0006889 3300046663 Bacteria 7940
633 Ga0495661_0035615 3300046665 Bacteria 3121
634 Ga0495661_0049946 3300046665 Bacteria 2534
635 Ga0495588_0003822 3300046674 Bacteria 6598
636 Ga0495588_0019104 3300046674 Bacteria 3353
637 Ga0495657_0006337 3300046675 Bacteria 9267
638 Ga0495657_0008870 3300046675 Bacteria 7654
639 Ga0495657_0045638 3300046675 Bacteria 2972
640 Ga0495646_0001231 3300046680 Bacteria 15030
641 Ga0495646_0035636 3300046680 Bacteria 3086
642 Ga0495658_0008137 3300046683 Bacteria 5192
643 Ga0495613_0001211 3300046689 Bacteria 19746
644 Ga0495613_0038091 3300046689 Bacteria 3564
645 Ga0495613_0047649 3300046689 Bacteria 3165
646 Ga0495613_0051651 3300046689 Bacteria 3029
647 Ga0495671_0012968 3300046692 Bacteria 4534
648 Ga0495649_0058036 3300046694 Bacteria 2086
649 Ga0495649_0130421 3300046694 Bacteria 1326
650 Ga0495649_0167204 3300046694 Bacteria 1152
651 Ga0495649_0176746 3300046694 Bacteria 1115
652 Ga0495589_0006883 3300046794 Bacteria 5976
653 Ga0495589_0011982 3300046794 Bacteria 4495
654 Ga0495589_0012127 3300046794 Bacteria 4469
655 Ga0495589_0012562 3300046794 Bacteria 4382
656 Ga0495589_0016490 3300046794 Bacteria 3798
657 Ga0495600_0032445 3300046809 Bacteria 3389
658 Ga0495600_0125174 3300046809 Bacteria 1671
659 Ga0495581_0037673 3300047315 Bacteria 2799
660 Ga0495581_0105974 3300047315 Bacteria 1634
661 Ga0495604_0000811 3300047317 Bacteria 26210
662 Ga0495636_0000665 3300047318 Bacteria 12599
663 Ga0495636_0019787 3300047318 Bacteria 2708
664 Ga0495636_0026473 3300047318 Bacteria 2359
665 Ga0495636_0033723 3300047318 Bacteria 2105
666 Ga0495636_0067816 3300047318 Bacteria 1518
667 Ga0495674_0240708 3300047319 Bacteria 1491
668 Ga0495672_0005364 3300047320 Bacteria 10195
669 Ga0495676_0009915 3300047321 Bacteria 8652
670 Ga0495676_0010110 3300047321 Bacteria 8568
671 Ga0495676_0012589 3300047321 Bacteria 7617
672 Ga0495676_0015081 3300047321 Bacteria 6899
673 Ga0495676_0023642 3300047321 Bacteria 5328
674 Ga0495676_0045065 3300047321 Bacteria 3593
675 Ga0495680_0012497 3300047322 Bacteria 7467
676 Ga0495683_0098886 3300047323 Bacteria 1405
677 Ga0495687_001148 3300047443 Bacteria 25640
678 Ga0495687_036096 3300047443 Bacteria 2215
679 Ga0495687_054907 3300047443 Bacteria 1668
680 Ga0495687_065986 3300047443 Bacteria 1471
681 Ga0495687_068286 3300047443 Bacteria 1435
682 Ga0495675_0047407 3300047444 Bacteria 2734
683 Ga0495675_0248015 3300047444 Bacteria 1070
684 Ga0495677_0016191 3300047445 Bacteria 2706
685 Ga0495685_001061 3300047447 Bacteria 8390
686 Ga0495685_001209 3300047447 Bacteria 7914
687 Ga0495685_001477 3300047447 Bacteria 7204
688 Ga0495685_004930 3300047447 Bacteria 4335
689 Ga0495685_007409 3300047447 Bacteria 3621
690 Ga0495673_0001153 3300047469 Bacteria 22442
691 Ga0495681_0048299 3300047470 Bacteria 2018
692 Ga0495681_0091638 3300047470 Bacteria 1341
693 Ga0495686_0048992 3300047472 Bacteria 2661
694 Ga0495593_0034697 3300047673 Bacteria 2742
695 Ga0495593_0204005 3300047673 Bacteria 993
696 Ga0495602_0142074 3300048088 Bacteria 1899
697 Ga0495614_0022354 3300048089 Bacteria 2729
698 Ga0495626_0059545 3300048091 Bacteria 1742
699 Ga0496100_0001703 3300048903 Bacteria 10932
700 Ga0496100_0006454 3300048903 Bacteria 6397
701 Ga0496100_0006878 3300048903 Bacteria 6228
702 Ga0496100_0028605 3300048903 Bacteria 3439
703 Ga0496100_0046275 3300048903 Bacteria 2797
704 Ga0496100_0105229 3300048903 Bacteria 1951
705 Ga0496100_0118346 3300048903 Bacteria 1851
706 Ga0496100_0285904 3300048903 Bacteria 1231
707 Ga0496101_0000030 3300048904 Bacteria 198447
708 Ga0496101_0001379 3300048904 Bacteria 14555
709 Ga0496101_0011975 3300048904 Bacteria 5778
710 Ga0496101_0072796 3300048904 Bacteria 2523
711 Ga0496102_0000001 3300048905 Bacteria 873433
712 Ga0496102_0000112 3300048905 Bacteria 116902
713 Ga0496102_0017128 3300048905 Bacteria 6344
714 Ga0496102_0062223 3300048905 Bacteria 3418
715 Ga0496102_0078104 3300048905 Bacteria 3047
716 Ga0496102_0079513 3300048905 Bacteria 3020
717 Ga0496102_0626825 3300048905 Bacteria 998
718 Ga0496103_0000003 3300048906 Bacteria 603967
719 Ga0496103_0002476 3300048906 Bacteria 11582
720 Ga0496103_0129948 3300048906 Bacteria 1608
721 Ga0496104_0137999 3300048907 Bacteria 2343
722 Ga0496104_0141043 3300048907 Bacteria 2315
723 Ga0496104_0217930 3300048907 Bacteria 1821
724 Ga0496105_0038689 3300048908 Bacteria 3930
725 Ga0496105_0065002 3300048908 Bacteria 3011
726 Ga0496106_0009358 3300048909 Bacteria 7243
727 Ga0496106_0014688 3300048909 Bacteria 5788
728 Ga0496106_0021410 3300048909 Bacteria 4801
729 Ga0496106_0021710 3300048909 Bacteria 4768
730 Ga0496106_0141029 3300048909 Bacteria 1896
731 Ga0496106_0163844 3300048909 Bacteria 1759
732 Ga0496107_0012120 3300048910 Bacteria 6013
733 Ga0496107_0027547 3300048910 Bacteria 4035
734 Ga0496107_0100178 3300048910 Bacteria 2124
735 Ga0496108_0000589 3300048911 Bacteria 28452
736 Ga0496108_0002063 3300048911 Bacteria 16082
737 Ga0496108_0012853 3300048911 Bacteria 6819
738 Ga0496108_0175780 3300048911 Bacteria 1853
739 Ga0496108_0187444 3300048911 Bacteria 1792
740 Ga0496108_0313349 3300048911 Bacteria 1367
741 Ga0496108_0524909 3300048911 Bacteria 1034
742 Ga0496109_0004292 3300048912 Bacteria 11905
743 Ga0496109_0007158 3300048912 Bacteria 9428
744 Ga0496109_0014192 3300048912 Bacteria 6928
745 Ga0496109_0068561 3300048912 Bacteria 3251
746 Ga0496109_0115824 3300048912 Bacteria 2494
747 Ga0496109_0355675 3300048912 Bacteria 1383
748 Ga0496110_0189785 3300048913 Bacteria 1866
749 Ga0496110_0256744 3300048913 Bacteria 1591
750 Ga0496111_0056368 3300048914 Bacteria 2843
751 Ga0496112_0028927 3300048915 Bacteria 5355
752 Ga0496112_0057653 3300048915 Bacteria 3824
753 Ga0496112_0105055 3300048915 Bacteria 2794
754 Ga0496112_0112943 3300048915 Bacteria 2687
755 Ga0496112_0213834 3300048915 Bacteria 1885
756 Ga0496113_0021756 3300048916 Bacteria 4528
757 Ga0496113_0043182 3300048916 Bacteria 3335
758 Ga0496113_0070881 3300048916 Bacteria 2650
759 Ga0496114_0003564 3300048917 Bacteria 11954
760 Ga0496114_0016475 3300048917 Bacteria 5957
761 Ga0496114_0160515 3300048917 Bacteria 1954
762 Ga0496114_0208575 3300048917 Unclassified 1713
763 Ga0496115_0004692 3300048918 Bacteria 9906
764 Ga0496115_0014973 3300048918 Bacteria 5879
765 Ga0496116_0000013 3300048919 Bacteria 603993
766 Ga0496116_0021964 3300048919 Bacteria 4798
767 Ga0496117_0000013 3300048920 Bacteria 603995
768 Ga0496117_0000719 3300048920 Bacteria 52226
769 Ga0496118_0000011 3300048921 Bacteria 603995
770 Ga0496118_0003063 3300048921 Bacteria 21476
771 Ga0496119_0000076 3300048922 Bacteria 143663
772 Ga0496119_0014589 3300048922 Bacteria 6129
773 Ga0496120_0001268 3300048923 Bacteria 31644
774 Ga0496120_0052426 3300048923 Bacteria 2324
775 Ga0496120_0060791 3300048923 Bacteria 2112
776 Ga0496121_0014867 3300048924 Bacteria 8209
777 Ga0496123_0029954 3300048926 Bacteria 3994
778 Ga0496124_0056202 3300048927 Bacteria 3320
779 Ga0496125_0037277 3300048928 Bacteria 4228
780 Ga0496126_0002163 3300048929 Bacteria 27351
781 Ga0495678_056138 3300049459 Bacteria 1499
782 Ga0495682_0038634 3300049460 Bacteria 1754
783 Ga0501031_0021971 3300049568 Bacteria 4157
784 Ga0501031_0084751 3300049568 Bacteria 2066
785 Ga0501031_0122287 3300049568 Bacteria 1700
786 Ga0501032_0001058 3300049569 Bacteria 21998
787 Ga0501032_0001487 3300049569 Bacteria 18697
788 Ga0501032_0025037 3300049569 Bacteria 4115
789 Ga0501033_0007160 3300049570 Bacteria 8703
790 Ga0501033_0045356 3300049570 Bacteria 3271
791 Ga0501033_0057629 3300049570 Bacteria 2870
792 Ga0501033_0232612 3300049570 Bacteria 1309
793 Ga0501034_0006804 3300049571 Bacteria 12228
794 Ga0501034_0016674 3300049571 Bacteria 7530
795 Ga0501034_0031681 3300049571 Bacteria 5371
796 Ga0501034_0046795 3300049571 Bacteria 4371
797 Ga0501034_0100512 3300049571 Bacteria 2886
798 Ga0501036_0009792 3300049572 Bacteria 7892
799 Ga0501036_0009835 3300049572 Bacteria 7874
800 Ga0501036_0017920 3300049572 Bacteria 5928
801 Ga0501036_0018504 3300049572 Bacteria 5839
802 Ga0501036_0033678 3300049572 Bacteria 4332
803 Ga0501037_0000846 3300049573 Bacteria 22835
804 Ga0501037_0003465 3300049573 Bacteria 11452
805 Ga0501037_0031766 3300049573 Bacteria 3898
806 Ga0501038_0002496 3300049574 Bacteria 17130
807 Ga0501038_0012232 3300049574 Bacteria 7836
808 Ga0501038_0018635 3300049574 Bacteria 6269
809 Ga0501038_0041961 3300049574 Bacteria 3987
810 Ga0501038_0043522 3300049574 Bacteria 3903
811 Ga0501038_0104210 3300049574 Bacteria 2357
812 Ga0501039_0000413 3300049575 Bacteria 30667
813 Ga0501039_0004087 3300049575 Bacteria 10975
814 Ga0501039_0033422 3300049575 Bacteria 3965
815 Ga0501039_0140183 3300049575 Bacteria 1899
816 Ga0501039_0222091 3300049575 Bacteria 1485
817 Ga0501040_0025389 3300049576 Bacteria 3983
818 Ga0501041_0011160 3300049577 Bacteria 5306
819 Ga0501042_0007681 3300049578 Bacteria 7079
820 Ga0501042_0022676 3300049578 Bacteria 4386
821 Ga0501043_0000710 3300049579 Bacteria 29515
822 Ga0501043_0002340 3300049579 Bacteria 16062
823 Ga0501043_0037168 3300049579 Bacteria 3830
824 Ga0501043_0076802 3300049579 Bacteria 2624
825 Ga0501046_0013365 3300049580 Bacteria 6953
826 Ga0501046_0013758 3300049580 Bacteria 6840
827 Ga0501046_0070356 3300049580 Bacteria 2720
828 Ga0501047_0019290 3300049581 Bacteria 6542
829 Ga0501047_0065802 3300049581 Bacteria 3493
830 Ga0501048_0032054 3300049582 Bacteria 3799
831 Ga0501067_0100241 3300049583 Bacteria 1609
832 Ga0501068_0008717 3300049584 Bacteria 5656
833 Ga0501068_0135296 3300049584 Bacteria 1543
834 Ga0501070_0000301 3300049586 Bacteria 45769
835 Ga0501070_0001683 3300049586 Bacteria 19591
836 Ga0501070_0154194 3300049586 Bacteria 1895
837 Ga0501070_0484822 3300049586 Bacteria 994
838 Ga0501071_0008152 3300049587 Bacteria 6910
839 Ga0501072_0010719 3300049588 Bacteria 6982
840 Ga0501073_0046919 3300049589 Bacteria 3037
841 Ga0501073_0148989 3300049589 Bacteria 1622
842 Ga0501074_0011845 3300049590 Bacteria 6341
843 Ga0501074_0031457 3300049590 Bacteria 3844
844 Ga0501076_0007496 3300049592 Bacteria 7943
845 Ga0501243_019330 3300049675 Bacteria 1116
846 Ga0501080_0025716 3300049742 Bacteria 5467
847 Ga0501083_0152710 3300049744 Bacteria 1512
848 Ga0501035_0096585 3300049822 Bacteria 2596
849 Ga0501035_0178639 3300049822 Bacteria 1830
850 Ga0501035_0181611 3300049822 Bacteria 1812
851 Ga0501044_0001741 3300049823 Bacteria 25406
852 Ga0501044_0013221 3300049823 Bacteria 8938
853 Ga0501044_0013974 3300049823 Bacteria 8673
854 Ga0501044_0066259 3300049823 Bacteria 3683
855 Ga0501044_0094263 3300049823 Bacteria 3019
856 Ga0501044_0118192 3300049823 Bacteria 2654
857 Ga0501044_0222544 3300049823 Bacteria 1837
858 Ga0501045_0020185 3300049824 Bacteria 4757
859 nmdc:mga03n38_10969_c1 3300050490 Bacteria 3359
860 nmdc:mga03n38_15033_c1 3300050490 Bacteria 2981
861 nmdc:mga03n38_188677_c1 3300050490 Bacteria 1061
862 nmdc:mga03n38_19000_c1 3300050490 Bacteria 2721
863 nmdc:mga03n38_5500_c1 3300050490 Bacteria 4319
864 nmdc:mga00v17_14060_c1 3300050491 Bacteria 4460
865 nmdc:mga00v17_151372_c1 3300050491 Bacteria 1491
866 nmdc:mga00v17_16277_c1 3300050491 Bacteria 4191
867 nmdc:mga00v17_7507_c1 3300050491 Bacteria 5820
868 nmdc:mga0yw44_207032_c1 3300050492 Bacteria 1297
869 nmdc:mga0yw44_22077_c1 3300050492 Bacteria 3562
870 nmdc:mga0yw44_339099_c1 3300050492 Bacteria 1011
871 nmdc:mga0yw44_52184_c1 3300050492 Bacteria 2478
872 nmdc:mga06z11_15221_c1 3300050494 Bacteria 3429
873 nmdc:mga06z11_39550_c1 3300050494 Bacteria 2348
874 nmdc:mga04h51_5954_c1 3300050495 Bacteria 2187
875 nmdc:mga04h51_9671_c1 3300050495 Bacteria 2624
876 nmdc:mga07m45_13721_c1 3300050496 Bacteria 4302
877 nmdc:mga07m45_146616_c1 3300050496 Bacteria 1368
878 nmdc:mga07m45_38352_c1 3300050496 Bacteria 2673
879 nmdc:mga07m45_46733_c1 3300050496 Bacteria 2432
880 nmdc:mga07m45_92094_c1 3300050496 Bacteria 1737
881 nmdc:mga05p37_3169_c1 3300050507 Bacteria 19142
882 nmdc:mga05p37_88589_c1 3300050507 Bacteria 3815
883 nmdc:mga09592_106048_c1 3300050508 Bacteria 2410
884 nmdc:mga0qj67_15554_c1 3300050509 Bacteria 5761
885 nmdc:mga06r32_403866_c1 3300050510 Unclassified 1348
886 nmdc:mga08y16_199381_c1 3300050511 Bacteria 2074
887 nmdc:mga0n895_320_c1 3300050512 Bacteria 31928
888 nmdc:mga0n895_46863_c1 3300050512 Bacteria 4225
889 nmdc:mga0rr50_25073_c1 3300050513 Bacteria 4142
890 nmdc:mga08x19_3141_c1 3300050514 Bacteria 9919
891 nmdc:mga0a205_213796_c1 3300050515 Bacteria 1816
892 nmdc:mga0a205_5899_c1 3300050515 Bacteria 11032
893 nmdc:mga0sz30_16128_c3 3300050516 Bacteria 1971
894 nmdc:mga0sz30_1724_c1 3300050516 Bacteria 7755
895 nmdc:mga0sz30_3342_c1 3300050516 Bacteria 5766
896 nmdc:mga0sz30_3484_c2 3300050516 Bacteria 3533
897 nmdc:mga0sz30_483_c1 3300050516 Bacteria 14954
898 Ga0495612_0118723 3300053078 Bacteria 1136
899 Ga0500610_0046814 3300053079 Bacteria 2247
900 Ga0495655_0012580 3300053083 Bacteria 1729
901 Ga0495655_0052742 3300053083 Bacteria 1082
902 Ga0500644_0050462 3300053088 Bacteria 1424
903 Ga0500640_044138 3300053095 Bacteria 1956
904 Ga0500660_028431 3300053100 Bacteria 2935
905 Ga0500553_088478 3300053101 Bacteria 1369
906 Ga0500553_104864 3300053101 Bacteria 1207
907 Ga0500560_079931 3300053107 Bacteria 1085
908 Ga0500580_089720 3300053113 Bacteria 1230
909 Ga0500608_055772 3300053122 Bacteria 1894
910 Ga0500618_000612 3300053125 Bacteria 21789
911 Ga0500559_0085812 3300053136 Bacteria 1436
912 Ga0500573_0191670 3300053140 Bacteria 1091
913 Ga0500616_0033532 3300053153 Bacteria 2801
914 Ga0500616_0073659 3300053153 Bacteria 1733
915 Ga0500645_000565 3300053730 Bacteria 24250
916 Ga0500645_036164 3300053730 Bacteria 1470
917 Ga0501084_0010469 3300054114 Bacteria 7665
918 Ga0466962_0021927 3300061719 Bacteria 3067
919 Ga0466962_0053549 3300061719 Bacteria 1928
920 Ga0530510_0167183 3300061734 Bacteria 1628
921 2515721523 2515154129 Bacteria 5584369
922 2516086162 2515154202 Bacteria 5471270
923 2523386742 2523231044 Bacteria 6434991
924 2547412330 2547132111 Bacteria 8013147
925 2554260022 2554235005 Bacteria 6457341
926 2566992043 2565956761 Bacteria 6601618
927 2585299880 2582581312 Bacteria 7308206
928 2585304187 2582581313 Bacteria 10042643
929 2585309201 2582581313 Bacteria 10042643
930 2585319069 2582581314 Bacteria 11452267
931 2585319810 2582581314 Bacteria 11452267
932 2616693623 2616644814 Bacteria 11555299
933 2616697702 2616644814 Bacteria 11555299
934 2616905574 2616644941 Bacteria 8510691
935 2623497875 2622736605 Bacteria 4992138
936 2643759848 2643221548 Bacteria 8053412
937 2643897991 2643221578 Bacteria 9213798
938 2643944567 2643221587 Bacteria 7586415
939 2644051420 2643221607 Bacteria 6314006
940 2644201092 2643221636 Bacteria 6583769
941 2644263217 2643221647 Bacteria 10741251
942 2644270407 2643221647 Bacteria 10741251
943 2644385505 2643221670 Bacteria 6497041
944 2644409136 2643221673 Bacteria 9196637
945 2644431465 2643221677 Bacteria 7584031
946 2644436520 2643221678 Bacteria 9540101
947 2644440920 2643221678 Bacteria 9540101
948 2644462733 2643221682 Bacteria 6743283
949 2644484324 2643221686 Bacteria 6310811
950 2644486604 2643221687 Bacteria 6500351
951 2644625635 2643221714 Bacteria 9015452
952 2644638330 2643221715 Bacteria 6671032
953 2738705949 2738541274 Bacteria 6909446
954 2739330429 2738543028 Bacteria 6917070
955 2768646986 2767802112 Bacteria 6465194
956 2776374876 2775506925 Bacteria 7237746
957 2784591994 2784132148 Bacteria 8627943
958 2785344158 2784746763 Bacteria 9783172
959 2785368738 2784746768 Bacteria 10036182
960 2785373251 2784746768 Bacteria 10036182
961 2786669845 2786546132 Bacteria 10419719
962 2786674732 2786546132 Bacteria 10419719
963 2793978115 2791355406 Bacteria 11364898
964 2804844991 2802429296 Bacteria 7227771
965 2808841409 2808606359 Bacteria 9866990
966 2808915108 2808606375 Bacteria 9466072
967 2808919975 2808606375 Bacteria 9466072
968 2809235630 2808606448 Bacteria 8656184
969 2811848376 2808606982 Bacteria 7791042
970 2812354328 2811994879 Bacteria 9313447
971 2812482855 2811994917 Bacteria 7761064
972 2819693564 2818991463 Bacteria 7948711
973 2852635948 2852635781 Bacteria 8251373
974 2862184782 2862178590 Bacteria 8583590
975 2862282994 2862281513 Bacteria 9621493
976 2862287978 2862281513 Bacteria 9621493
977 2862296635 2862290372 Bacteria 7471434
978 2862383137 2862382967 Bacteria 10317375
979 2862507678 2862507626 Bacteria 9425308
980 2862579866 2862574272 Bacteria 10567477
981 2863074827 2863067949 Bacteria 8541735
982 2863405414 2863404153 Bacteria 9672205
983 2867350104 2867346516 Bacteria 7608576
984 2867371281 2867369537 Bacteria 6501581
985 2867430009 2867428634 Bacteria 9590268
986 2867431481 2867428634 Bacteria 9590268
987 2867480495 2867475112 Bacteria 6909112
988 2873156458 2873151551 Bacteria 8625867
989 2875393889 2875391855 Bacteria 7600475
990 2877677660 2877676314 Bacteria 9512378
991 2877681775 2877676314 Bacteria 9512378
992 2902796701 2902792274 Bacteria 7270173
993 2902801728 2902799365 Bacteria 5419524
994 2902812242 2902810491 Bacteria 6794147
995 2904538555 2904535858 Bacteria 6308016
996 2912715868 2912715099 Bacteria 9460473
997 2912728916 2912723979 Bacteria 8557534
998 2912760049 2912757875 Bacteria 7940295
999 2918503938 2918501144 Bacteria 8668083
1000 2919468802 2919468124 Bacteria 9133025
1001 2922559286 2922554459 Bacteria 6683962
1002 2929216598 2929212328 Bacteria 7708288
1003 2935394594 2935390628 Bacteria 7043367
1004 2939588657 2939582691 Bacteria 7088898
1005 2946050752 2946045630 Bacteria 8527308
1006 2946071373 2946064051 Bacteria 8957905
1007 2946075342 2946072368 Bacteria 8999607
1008 2947225363 2947224130 Bacteria 9938529
1009 2954003414 2954002825 Bacteria 9173742
1010 2954382419 2954380949 Bacteria 10050426
1011 2954386922 2954380949 Bacteria 10050426
1012 2954676274 2954673503 Bacteria 9685905
1013 2954680670 2954673503 Bacteria 9685905
1014 2954683483 2954682443 Bacteria 9862841
1015 2954687895 2954682443 Bacteria 9862841
1016 2954693224 2954691527 Bacteria 10720516
1017 2954697734 2954691527 Bacteria 10720516
1018 2954704482 2954701450 Bacteria 10834262
1019 2954708321 2954701450 Bacteria 10834262
1020 2954712898 2954711539 Bacteria 10867210
1021 2954716863 2954711539 Bacteria 10867210
1022 2954722856 2954721474 Bacteria 10456478
1023 2954726811 2954721474 Bacteria 10456478
1024 2954734984 2954731030 Bacteria 10243860
1025 2954738973 2954731030 Bacteria 10243860
1026 2954741767 2954740390 Bacteria 10229294
1027 2954745734 2954740390 Bacteria 10229294
1028 2954753856 2954749733 Bacteria 10366972
1029 2954757831 2954749733 Bacteria 10366972
1030 2954760746 2954759201 Bacteria 9358192
1031 2954764708 2954759201 Bacteria 9358192
1032 2966603190 2966598605 Bacteria 7676064
1033 2984524954 2984523437 Bacteria 4508481
1034 2990065815 2990059506 Bacteria 9321252
1035 2990091159 2990088156 Bacteria 6657676
1036 2997456656 2997451912 Bacteria 8492419
1037 2997606925 2997600082 Bacteria 9896405
1038 2997608068 2997600082 Bacteria 9896405
1039 3006395457 3006393351 Bacteria 6615579
1040 3006426837 3006425503 Bacteria 6491253
1041 3006493698 3006486233 Bacteria 8157040
1042 3006494565 3006493962 Bacteria 8825450
1043 8008559665 8008558824 Bacteria 10610750
1044 8008575825 8008574985 Bacteria 7815457
1045 8023624176 8023623736 Bacteria 8593882
1046 8025418953 8025413630 Bacteria 7014048
1047 8025481752 8025478263 Bacteria 8209203
1048 8025536923 8025530807 Bacteria 8495698
1049 8047898779 8047893842 Bacteria 11723082
1050 8048131568 8048127548 Bacteria 11053136
1051 8048360140 8048356638 Bacteria 11044339
1052 8048375739 8048369669 Bacteria 11666822
1053 8048382466 8048379754 Bacteria 11877923
1054 8048409334 8048406513 Bacteria 8936924
1055 8054162900 8054160619 Bacteria 7783213
1056 8054477001 8054472261 Bacteria 7464355
1057 8056451483 8056447290 Bacteria 7680491
1058 8056672425 8056667051 Bacteria 6953971
1059 8056830184 8056829672 Bacteria 9045328
1060 8056836148 8056829672 Bacteria 9045328
1061 Ga0307406_10083025
1062 JGI24743J22301_10005135
1063 JGI24738J21930_10012736
1064 JGI24744J21845_10001322
1065 JGI24744J21845_10004246
1066 JGI24034J26672_10010430
1067 JGI25406J46586_10002006
1068 rootH1_10030847
1069 rootH1_10039924
1070 rootH2_10002244
1071 rootH2_10015356
1072 JGI25160J50197_1007423
1073 JGI25160J50197_1019006
1074 JGI25407J50210_10014559
1075 JGI25404J52841_10001019
1076 Ga0070676_10013125
1077 Ga0070676_10199641
1078 Ga0070690_100118651
1079 Ga0068869_100058741
1080 Ga0068869_100463230
1081 Ga0070666_10329768
1082 Ga0070682_100023784
1083 Ga0070682_100025193
1084 Ga0070682_100062857
1085 Ga0070682_100069467
1086 Ga0070682_100089163
1087 Ga0070682_100172079
1088 Ga0070682_100271185
1089 Ga0068868_100021572
1090 Ga0070660_100223742
1091 Ga0070689_100052755
1092 Ga0070687_100091510
1093 Ga0070692_10086442
1094 Ga0070668_100000258
1095 Ga0070668_100032029
1096 Ga0070668_100252826
1097 Ga0070668_100331507
1098 Ga0070669_100021773
1099 Ga0070669_100104510
1100 Ga0070671_100109400
1101 Ga0070674_100014431
1102 Ga0070673_100377266
1103 Ga0070688_100027997
1104 Ga0070688_100128638
1105 Ga0070659_100063986
1106 Ga0070659_100102195
1107 Ga0070659_100197470
1108 Ga0070659_100368251
1109 Ga0070667_100000077
1110 Ga0070667_100059707
1111 Ga0070667_100108548
1112 Ga0070714_100178474
1113 Ga0070710_10003297
1114 Ga0070710_10016525
1115 Ga0070701_10001956
1116 Ga0070711_100003805
1117 Ga0070711_100013123
1118 Ga0070700_100011281
1119 Ga0070700_100040024
1120 Ga0070700_100040381
1121 Ga0070694_100331705
1122 Ga0070708_100136177
1123 Ga0070663_100029769
1124 Ga0070663_100141789
1125 Ga0070663_100155109
1126 Ga0070678_100036168
1127 Ga0070678_100037113
1128 Ga0070678_100069532
1129 Ga0070662_100014744
1130 Ga0068867_100014648
1131 Ga0068867_100145593
1132 Ga0070685_10031004
1133 Ga0070685_10205411
1134 Ga0070706_100491982
1135 Ga0068853_100035405
1136 Ga0068853_100094468
1137 Ga0068853_100107742
1138 Ga0070695_100071099
1139 Ga0070696_100014519
1140 Ga0070696_100087772
1141 Ga0070693_100014604
1142 Ga0070665_100007324
1143 Ga0070665_100030094
1144 Ga0070665_100041694
1145 Ga0070704_100032574
1146 Ga0068855_100244810
1147 Ga0068854_100013941
1148 Ga0068854_100015472
1149 Ga0068854_100237154
1150 Ga0068854_100291283
1151 Ga0068856_100128145
1152 Ga0070702_100014396
1153 Ga0070702_100107025
1154 Ga0070702_100111447
1155 Ga0070702_100121378
1156 Ga0070702_100265205
1157 Ga0068859_100000438
1158 Ga0068859_100042006
1159 Ga0068859_100117895
1160 Ga0068859_100248357
1161 Ga0068866_10005609
1162 Ga0068866_10005802
1163 Ga0068866_10022932
1164 Ga0068861_100038820
1165 Ga0068861_100063709
1166 Ga0068861_100139583
1167 Ga0068863_100000777
1168 Ga0068863_100011776
1169 Ga0068863_100161053
1170 Ga0068863_100173859
1171 Ga0068858_100008639
1172 Ga0068858_100034036
1173 Ga0068858_100100702
1174 Ga0068860_100000010
1175 Ga0068860_100025586
1176 Ga0068860_100439666
1177 Ga0068862_100000008
1178 Ga0068862_100030155
1179 Ga0081455_10025168
1180 Ga0081455_10032407
1181 Ga0081455_10034638
1182 Ga0081455_10067116
1183 Ga0081455_10093426
1184 Ga0081538_10000186
1185 Ga0081538_10096580
1186 Ga0081540_1001044
1187 Ga0081540_1043683
1188 Ga0081539_10000208
1189 Ga0081539_10003746
1190 Ga0075365_10006361
1191 Ga0075365_10088968
1192 Ga0075365_10197601
1193 Ga0075368_10030260
1194 Ga0075368_10035580
1195 Ga0075363_100008072
1196 Ga0075363_100012279
1197 Ga0075363_100020295
1198 Ga0075363_100032995
1199 Ga0075363_100053836
1200 Ga0075364_10002441
1201 Ga0075364_10024121
1202 Ga0075364_10051528
1203 Ga0075364_10105783
1204 Ga0075364_10309002
1205 Ga0075432_10000861
1206 Ga0075432_10013820
1207 Ga0070715_10018460
1208 Ga0070716_100013793
1209 Ga0070712_100018992
1210 Ga0070712_100021410
1211 Ga0075367_10001716
1212 Ga0075367_10024385
1213 Ga0075367_10056257
1214 Ga0075369_10000277
1215 Ga0075369_10012034
1216 Ga0097621_100071607
1217 Ga0075370_10014632
1218 Ga0075370_10017296
1219 Ga0075370_10271461
1220 Ga0068871_100051699
1221 Ga0075428_100002077
1222 Ga0075428_100011650
1223 Ga0075428_100198703
1224 Ga0075430_100008157
1225 Ga0075431_100085932
1226 Ga0075431_100661636
1227 Ga0075434_100000386
1228 Ga0075434_100001823
1229 Ga0075429_100044631
1230 Ga0068865_100004289
1231 Ga0068865_100056712
1232 Ga0075436_100000338
1233 Ga0097620_100000438
1234 Ga0097620_100042004
1235 Ga0097620_100117893
1236 Ga0097620_100248356
1237 Ga0099826_10054431
1238 Ga0099826_10060166
1239 Ga0075435_100002397
1240 Ga0075435_100002693
1241 Ga0105244_10041691
1242 Ga0105250_10008787
1243 Ga0111539_10001835
1244 Ga0111539_10072056
1245 Ga0111539_10134313
1246 Ga0111539_10294889
1247 Ga0105245_10029615
1248 Ga0105245_10066600
1249 Ga0105245_10223280
1250 Ga0105247_10004190
1251 Ga0105247_10086458
1252 Ga0105247_10321876
1253 Ga0114129_10037098
1254 Ga0114129_10096472
1255 Ga0114129_10777883
1256 Ga0105243_10007430
1257 Ga0105243_10017855
1258 Ga0105243_10023025
1259 Ga0105243_10053826
1260 Ga0105242_10011766
1261 Ga0105242_10057869
1262 Ga0105248_10000093
1263 Ga0105248_10016994
1264 Ga0105248_10029565
1265 Ga0105248_10223629
1266 Ga0105237_10064180
1267 Ga0105237_10079500
1268 Ga0105237_10211240
1269 Ga0105238_10029299
1270 Ga0105238_10260762
1271 Ga0105249_10000019
1272 Ga0105249_10028056
1273 Ga0105249_10036561
1274 Ga0105249_10140623
1275 Ga0105033_105012
1276 Ga0105239_10050997
1277 Ga0105239_10222177
1278 Ga0105239_10369296
1279 Ga0105246_10002782
1280 Ga0105246_10082859
1281 Ga0105246_10126553
1282 Ga0105246_10261548
1283 Ga0157369_10521648
1284 Ga0157369_10733294
1285 Ga0157374_10012755
1286 Ga0157378_10035989
1287 Ga0157378_10053432
1288 Ga0157378_10268423
1289 Ga0163162_10009988
1290 Ga0163162_10031792
1291 Ga0163162_10092950
1292 Ga0157372_10037234
1293 Ga0157372_10044562
1294 Ga0157372_10147659
1295 Ga0157372_10316851
1296 Ga0157372_10566810
1297 Ga0157375_10026309
1298 Ga0157375_10157551
1299 Ga0157375_10495625
1300 Ga0163163_10172731
1301 Ga0163163_10205773
1302 Ga0157380_10013449
1303 Ga0182008_10001253
1304 Ga0182008_10001941
1305 Ga0157377_10096844
1306 Ga0157379_10026709
1307 Ga0157379_10148111
1308 Ga0157376_10121431
1309 Ga0182006_1054255
1310 Ga0182007_10001202
1311 Ga0182007_10001318
1312 Ga0183367_1001
1313 Ga0183367_1006
1314 Ga0183367_1021
1315 Ga0163161_10018886
1316 Ga0163161_10034890
1317 Ga0163161_10038680
1318 Ga0213872_10124712
1319 Ga0213875_10012871
1320 Ga0209758_1004873
1321 Ga0207426_1000790
1322 Ga0207426_1007251
1323 Ga0207692_10034037
1324 Ga0207642_10001150
1325 Ga0207642_10003227
1326 Ga0207710_10000036
1327 Ga0207710_10004865
1328 Ga0207688_10004821
1329 Ga0207688_10009339
1330 Ga0207688_10011084
1331 Ga0207688_10011102
1332 Ga0207680_10028654
1333 Ga0207647_10004145
1334 Ga0207647_10006210
1335 Ga0207645_10024618
1336 Ga0207643_10123462
1337 Ga0207671_10082828
1338 Ga0207671_10161455
1339 Ga0207671_10182227
1340 Ga0207693_10000907
1341 Ga0207693_10031555
1342 Ga0207663_10008831
1343 Ga0207662_10169293
1344 Ga0207657_10217836
1345 Ga0207681_10000911
1346 Ga0207681_10113069
1347 Ga0207659_10094965
1348 Ga0207687_10022173
1349 Ga0207687_10066500
1350 Ga0207687_10132478
1351 Ga0207687_10194766
1352 Ga0207687_10220284
1353 Ga0207664_10268312
1354 Ga0207644_10039998
1355 Ga0207690_10024822
1356 Ga0207706_10009858
1357 Ga0207706_10011561
1358 Ga0207706_10025627
1359 Ga0207686_10014368
1360 Ga0207686_10157011
1361 Ga0207709_10081196
1362 Ga0207709_10231279
1363 Ga0207670_10153795
1364 Ga0207670_10319645
1365 Ga0207669_10005203
1366 Ga0207704_10003456
1367 Ga0207704_10017139
1368 Ga0207665_10015075
1369 Ga0207665_10085837
1370 Ga0207711_10000102
1371 Ga0207711_10053321
1372 Ga0207689_10038617
1373 Ga0207689_10119135
1374 Ga0207651_10037994
1375 Ga0207712_10000025
1376 Ga0207712_10007451
1377 Ga0207712_10015268
1378 Ga0207712_10030682
1379 Ga0207668_10000858
1380 Ga0207668_10012838
1381 Ga0207640_10016612
1382 Ga0207640_10209288
1383 Ga0207658_10000593
1384 Ga0207658_10018718
1385 Ga0207658_10021481
1386 Ga0207658_10063322
1387 Ga0207677_10004981
1388 Ga0207703_10034863
1389 Ga0207703_10082270
1390 Ga0207639_10005386
1391 Ga0207639_10018925
1392 Ga0207639_10096026
1393 Ga0207678_10007984
1394 Ga0207678_10008236
1395 Ga0207708_10020348
1396 Ga0207708_10058034
1397 Ga0207702_10068447
1398 Ga0207641_10010691
1399 Ga0207648_10019145
1400 Ga0207648_10050267
1401 Ga0207676_10261604
1402 Ga0207676_10375334
1403 Ga0207675_100004805
1404 Ga0207675_100017465
1405 Ga0207683_10002324
1406 Ga0207683_10022246
1407 Ga0207683_10118424
1408 Ga0207683_10214896
1409 Ga0207698_10073838
1410 Ga0207698_10308578
1411 Ga0207698_10326190
1412 Ga0209282_1052640
1413 Ga0207428_10001237
1414 Ga0207428_10009580
1415 Ga0207428_10102957
1416 Ga0268266_10013583
1417 Ga0268266_10034979
1418 Ga0268266_10078584
1419 Ga0268266_10549082
1420 Ga0268265_10000007
1421 Ga0268265_10013185
1422 Ga0268265_10193758
1423 Ga0268264_10000007
1424 Ga0268264_10024292
1425 Ga0268264_10252950
1426 Ga0268264_10258421
1427 Ga0268264_10384548
1428 Ga0307517_10004208
1429 Ga0307515_10000046
1430 Ga0307515_10034314
1431 Ga0307515_10106091
1432 Ga0307515_10150583
1433 Ga0268256_1020506
1434 Ga0307511_10002260
1435 Ga0307511_10049337
1436 Ga0307511_10155770
1437 Ga0307512_10043807
1438 Ga0307513_10015302
1439 Ga0307513_10019716
1440 Ga0307509_10039748
1441 Ga0307509_10193474
1442 Ga0307408_100025439
1443 Ga0307508_10005047
1444 Ga0307508_10012343
1445 Ga0307508_10015165
1446 Ga0307508_10023014
1447 Ga0307508_10130526
1448 Ga0307514_10003992
1449 Ga0307514_10069990
1450 Ga0307514_10079829
1451 Ga0307516_10014667
1452 Ga0307405_10010297
1453 Ga0307405_10011336
1454 Ga0307405_10050903
1455 Ga0307413_10006809
1456 Ga0307413_10027077
1457 Ga0307413_10094073
1458 Ga0307413_10133366
1459 Ga0307518_10048604
1460 Ga0307410_10000186
1461 Ga0307410_10004749
1462 Ga0307410_10006417
1463 Ga0307410_10006476
1464 Ga0307410_10014259
1465 Ga0307410_10373282
1466 Ga0307406_10000071
1467 Ga0307406_10008812
1468 Ga0307406_10015056
1469 Ga0307406_10090558
1470 Ga0307407_10004883
1471 Ga0307407_10023459
1472 Ga0307407_10051314
1473 Ga0307407_10064946
1474 Ga0307407_10089121
1475 Ga0307407_10194601
1476 Ga0307407_10240326
1477 Ga0307412_10292644
1478 Ga0307409_100000106
1479 Ga0307409_100002886
1480 Ga0307409_100003055
1481 Ga0307409_100024232
1482 Ga0307409_100029134
1483 Ga0307409_100076346
1484 Ga0307409_100210805
1485 Ga0307409_100280006
1486 Ga0307416_100000850
1487 Ga0307416_100017280
1488 Ga0307416_100049737
1489 Ga0307416_100066381
1490 Ga0307416_100176833
1491 Ga0307416_100229361
1492 Ga0307416_100443581
1493 Ga0307414_10010360
1494 Ga0307414_10020775
1495 Ga0307414_10026408
1496 Ga0307414_10081940
1497 Ga0307414_10083907
1498 Ga0307414_10184653
1499 Ga0307414_10218668
1500 Ga0307411_10009357
1501 Ga0307411_10011519
1502 Ga0307411_10042548
1503 Ga0307411_10098100
1504 Ga0307415_100002560
1505 Ga0307415_100005844
1506 Ga0307415_100013305
1507 Ga0307415_100021903
1508 Ga0307415_100060321
1509 Ga0307415_100160352
1510 Ga0307415_100306451
1511 Ga0307507_10014232
1512 Ga0307507_10015481
1513 Ga0307507_10208544
1514 Ga0307510_10158611
1515 Ga0373940_0037846
1516 Ga0373931_0039646
1517 Ga0373925_0196960
1518 Ga0395900_0083875
1519 Ga0395900_0256237
1520 Ga0395900_0319301
1521 Ga0395898_0015241
1522 Ga0395898_0042453
1523 Ga0395898_0073677
1524 Ga0395905_0421335
1525 Ga0436364_0370574
1526 Ga0436364_1016041
1527 Ga0436365_0664968
1528 Ga0436361_0713294
1529 Ga0439436_0007597
1530 Ga0439436_0024059
1531 Ga0439461_0000622
1532 Ga0439466_0010203
1533 Ga0439465_0004933
1534 Ga0451795_0177854
1535 Ga0451853_0186994
1536 Ga0439431_0004964
1537 Ga0439433_0001850
1538 Ga0439448_0007193
1539 Ga0439448_0018547
1540 Ga0439449_0002442
1541 Ga0439449_0003409
1542 Ga0439449_0033212
1543 Ga0439449_0040692
1544 Ga0439455_0003289
1545 Ga0439455_0006433
1546 Ga0439455_0028684
1547 Ga0439457_000977
1548 Ga0439457_002741
1549 Ga0439462_0002522
1550 Ga0450894_002382
1551 Ga0450900_002018
1552 Ga0450903_000575
1553 Ga0450903_001095
1554 Ga0439458_0000722
1555 Ga0439434_0003247
1556 Ga0439434_0045611
1557 Ga0439440_0013027
1558 Ga0466969_0045354
1559 Ga0466972_0001755
1560 Ga0466972_0002060
1561 Ga0466972_0011100
1562 Ga0466972_0020443
1563 Ga0466972_0039617
1564 Ga0466972_0057811
1565 Ga0466972_0127922
1566 Ga0466965_0000288
1567 Ga0466965_0000502
1568 Ga0466965_0126935
1569 Ga0466966_0002830
1570 Ga0466966_0004237
1571 Ga0466966_0258692
1572 Ga0466961_0054195
1573 Ga0466963_0001177
1574 Ga0466963_0008746
1575 Ga0466963_0057579
1576 Ga0466964_0001884
1577 Ga0466971_0003539
1578 Ga0466971_0007148
1579 Ga0466971_0025437
1580 Ga0466970_0005387
1581 Ga0466970_0008602
1582 Ga0466970_0010797
1583 Ga0466970_0025003
1584 Ga0466970_0037802
1585 Ga0466970_0160682
1586 Ga0466957_0009571
1587 Ga0466957_0025969
1588 Ga0466957_0040330
1589 Ga0466957_0063553
1590 Ga0466957_0090970
1591 Ga0466960_0000313
1592 Ga0466960_0001508
1593 Ga0466960_0016305
1594 Ga0466960_0090547
1595 Ga0466959_0008657
1596 Ga0466958_0001015
1597 Ga0466958_0243816
1598 Ga0466967_0000412
1599 Ga0466967_0017691
1600 Ga0466967_0053051
1601 Ga0466967_0061221
1602 Ga0466967_0090540
1603 Ga0466967_0125089
1604 Ga0466967_0349201
1605 Ga0466967_0496111
1606 Ga0495617_025457
1607 Ga0495627_017353
1608 Ga0495592_0088282
1609 Ga0495603_0007354
1610 Ga0495603_0009121
1611 Ga0495603_0019345
1612 Ga0495603_0033670
1613 Ga0495603_0058650
1614 Ga0495590_0048739
1615 Ga0495629_0001933
1616 Ga0495629_0011063
1617 Ga0495629_0012494
1618 Ga0495629_0015172
1619 Ga0495629_0072468
1620 Ga0495629_0136970
1621 Ga0495638_0008024
1622 Ga0495638_0008071
1623 Ga0495638_0026620
1624 Ga0495638_0183262
1625 Ga0495651_0001558
1626 Ga0495605_0003611
1627 Ga0495639_0014741
1628 Ga0495662_0000305
1629 Ga0495662_0016026
1630 Ga0495662_0090269
1631 Ga0495664_0067571
1632 Ga0495664_0146605
1633 Ga0495585_0088955
1634 Ga0495594_0003881
1635 Ga0495594_0024219
1636 Ga0495594_0121465
1637 Ga0495594_0148271
1638 Ga0495607_0020887
1639 Ga0495607_0069572
1640 Ga0495583_0020416
1641 Ga0495583_0031590
1642 Ga0495583_0050471
1643 Ga0495606_0007016
1644 Ga0495606_0007166
1645 Ga0495606_0029891
1646 Ga0495610_0046548
1647 Ga0495610_0122337
1648 Ga0495616_0001426
1649 Ga0495616_0030023
1650 Ga0495618_0017879
1651 Ga0495618_0059889
1652 Ga0495620_0001023
1653 Ga0495620_0012144
1654 Ga0495628_0090038
1655 Ga0495628_0176393
1656 Ga0495630_0032749
1657 Ga0495630_0085244
1658 Ga0495631_0005052
1659 Ga0495643_0004195
1660 Ga0495643_0021076
1661 Ga0495648_0006495
1662 Ga0495648_0073713
1663 Ga0495648_0087811
1664 Ga0495648_0149596
1665 Ga0495666_0023421
1666 Ga0495652_0104742
1667 Ga0495652_0341063
1668 Ga0495654_0039660
1669 Ga0495654_0089547
1670 Ga0495640_0259776
1671 Ga0495586_0062897
1672 Ga0495587_0011507
1673 Ga0495609_0012613
1674 Ga0495609_0018220
1675 Ga0495621_0036286
1676 Ga0495597_0009742
1677 Ga0495645_0084185
1678 Ga0495645_0129952
1679 Ga0495622_0092011
1680 Ga0495633_0045335
1681 Ga0495633_0068545
1682 Ga0495667_0223730
1683 Ga0495656_0021881
1684 Ga0495656_0196795
1685 Ga0495668_0000128
1686 Ga0495668_0010814
1687 Ga0495668_0029453
1688 Ga0495634_0008925
1689 Ga0495634_0084145
1690 Ga0495611_0076347
1691 Ga0495625_0037842
1692 Ga0495635_0006889
1693 Ga0495661_0035615
1694 Ga0495661_0049946
1695 Ga0495588_0003822
1696 Ga0495588_0019104
1697 Ga0495657_0006337
1698 Ga0495657_0008870
1699 Ga0495657_0045638
1700 Ga0495646_0001231
1701 Ga0495646_0035636
1702 Ga0495658_0008137
1703 Ga0495613_0001211
1704 Ga0495613_0038091
1705 Ga0495613_0047649
1706 Ga0495613_0051651
1707 Ga0495671_0012968
1708 Ga0495649_0058036
1709 Ga0495649_0130421
1710 Ga0495649_0167204
1711 Ga0495649_0176746
1712 Ga0495589_0006883
1713 Ga0495589_0011982
1714 Ga0495589_0012127
1715 Ga0495589_0012562
1716 Ga0495589_0016490
1717 Ga0495600_0032445
1718 Ga0495600_0125174
1719 Ga0495581_0037673
1720 Ga0495581_0105974
1721 Ga0495604_0000811
1722 Ga0495636_0000665
1723 Ga0495636_0019787
1724 Ga0495636_0026473
1725 Ga0495636_0033723
1726 Ga0495636_0067816
1727 Ga0495674_0240708
1728 Ga0495672_0005364
1729 Ga0495676_0009915
1730 Ga0495676_0010110
1731 Ga0495676_0012589
1732 Ga0495676_0015081
1733 Ga0495676_0023642
1734 Ga0495676_0045065
1735 Ga0495680_0012497
1736 Ga0495683_0098886
1737 Ga0495687_001148
1738 Ga0495687_036096
1739 Ga0495687_054907
1740 Ga0495687_065986
1741 Ga0495687_068286
1742 Ga0495675_0047407
1743 Ga0495675_0248015
1744 Ga0495677_0016191
1745 Ga0495685_001061
1746 Ga0495685_001209
1747 Ga0495685_001477
1748 Ga0495685_004930
1749 Ga0495685_007409
1750 Ga0495673_0001153
1751 Ga0495681_0048299
1752 Ga0495681_0091638
1753 Ga0495686_0048992
1754 Ga0495593_0034697
1755 Ga0495593_0204005
1756 Ga0495602_0142074
1757 Ga0495614_0022354
1758 Ga0495626_0059545
1759 Ga0496100_0001703
1760 Ga0496100_0006454
1761 Ga0496100_0006878
1762 Ga0496100_0028605
1763 Ga0496100_0046275
1764 Ga0496100_0105229
1765 Ga0496100_0118346
1766 Ga0496100_0285904
1767 Ga0496101_0000030
1768 Ga0496101_0001379
1769 Ga0496101_0011975
1770 Ga0496101_0072796
1771 Ga0496102_0000001
1772 Ga0496102_0000112
1773 Ga0496102_0017128
1774 Ga0496102_0062223
1775 Ga0496102_0078104
1776 Ga0496102_0079513
1777 Ga0496102_0626825
1778 Ga0496103_0000003
1779 Ga0496103_0002476
1780 Ga0496103_0129948
1781 Ga0496104_0137999
1782 Ga0496104_0141043
1783 Ga0496104_0217930
1784 Ga0496105_0038689
1785 Ga0496105_0065002
1786 Ga0496106_0009358
1787 Ga0496106_0014688
1788 Ga0496106_0021410
1789 Ga0496106_0021710
1790 Ga0496106_0141029
1791 Ga0496106_0163844
1792 Ga0496107_0012120
1793 Ga0496107_0027547
1794 Ga0496107_0100178
1795 Ga0496108_0000589
1796 Ga0496108_0002063
1797 Ga0496108_0012853
1798 Ga0496108_0175780
1799 Ga0496108_0187444
1800 Ga0496108_0313349
1801 Ga0496108_0524909
1802 Ga0496109_0004292
1803 Ga0496109_0007158
1804 Ga0496109_0014192
1805 Ga0496109_0068561
1806 Ga0496109_0115824
1807 Ga0496109_0355675
1808 Ga0496110_0189785
1809 Ga0496110_0256744
1810 Ga0496111_0056368
1811 Ga0496112_0028927
1812 Ga0496112_0057653
1813 Ga0496112_0105055
1814 Ga0496112_0112943
1815 Ga0496112_0213834
1816 Ga0496113_0021756
1817 Ga0496113_0043182
1818 Ga0496113_0070881
1819 Ga0496114_0003564
1820 Ga0496114_0016475
1821 Ga0496114_0160515
1822 Ga0496114_0208575
1823 Ga0496115_0004692
1824 Ga0496115_0014973
1825 Ga0496116_0000013
1826 Ga0496116_0021964
1827 Ga0496117_0000013
1828 Ga0496117_0000719
1829 Ga0496118_0000011
1830 Ga0496118_0003063
1831 Ga0496119_0000076
1832 Ga0496119_0014589
1833 Ga0496120_0001268
1834 Ga0496120_0052426
1835 Ga0496120_0060791
1836 Ga0496121_0014867
1837 Ga0496123_0029954
1838 Ga0496124_0056202
1839 Ga0496125_0037277
1840 Ga0496126_0002163
1841 Ga0495678_056138
1842 Ga0495682_0038634
1843 Ga0501031_0021971
1844 Ga0501031_0084751
1845 Ga0501031_0122287
1846 Ga0501032_0001058
1847 Ga0501032_0001487
1848 Ga0501032_0025037
1849 Ga0501033_0007160
1850 Ga0501033_0045356
1851 Ga0501033_0057629
1852 Ga0501033_0232612
1853 Ga0501034_0006804
1854 Ga0501034_0016674
1855 Ga0501034_0031681
1856 Ga0501034_0046795
1857 Ga0501034_0100512
1858 Ga0501036_0009792
1859 Ga0501036_0009835
1860 Ga0501036_0017920
1861 Ga0501036_0018504
1862 Ga0501036_0033678
1863 Ga0501037_0000846
1864 Ga0501037_0003465
1865 Ga0501037_0031766
1866 Ga0501038_0002496
1867 Ga0501038_0012232
1868 Ga0501038_0018635
1869 Ga0501038_0041961
1870 Ga0501038_0043522
1871 Ga0501038_0104210
1872 Ga0501039_0000413
1873 Ga0501039_0004087
1874 Ga0501039_0033422
1875 Ga0501039_0140183
1876 Ga0501039_0222091
1877 Ga0501040_0025389
1878 Ga0501041_0011160
1879 Ga0501042_0007681
1880 Ga0501042_0022676
1881 Ga0501043_0000710
1882 Ga0501043_0002340
1883 Ga0501043_0037168
1884 Ga0501043_0076802
1885 Ga0501046_0013365
1886 Ga0501046_0013758
1887 Ga0501046_0070356
1888 Ga0501047_0019290
1889 Ga0501047_0065802
1890 Ga0501048_0032054
1891 Ga0501067_0100241
1892 Ga0501068_0008717
1893 Ga0501068_0135296
1894 Ga0501070_0000301
1895 Ga0501070_0001683
1896 Ga0501070_0154194
1897 Ga0501070_0484822
1898 Ga0501071_0008152
1899 Ga0501072_0010719
1900 Ga0501073_0046919
1901 Ga0501073_0148989
1902 Ga0501074_0011845
1903 Ga0501074_0031457
1904 Ga0501076_0007496
1905 Ga0501243_019330
1906 Ga0501080_0025716
1907 Ga0501083_0152710
1908 Ga0501035_0096585
1909 Ga0501035_0178639
1910 Ga0501035_0181611
1911 Ga0501044_0001741
1912 Ga0501044_0013221
1913 Ga0501044_0013974
1914 Ga0501044_0066259
1915 Ga0501044_0094263
1916 Ga0501044_0118192
1917 Ga0501044_0222544
1918 Ga0501045_0020185
1919 nmdc:mga03n38_10969_c1
1920 nmdc:mga03n38_15033_c1
1921 nmdc:mga03n38_188677_c1
1922 nmdc:mga03n38_19000_c1
1923 nmdc:mga03n38_5500_c1
1924 nmdc:mga00v17_14060_c1
1925 nmdc:mga00v17_151372_c1
1926 nmdc:mga00v17_16277_c1
1927 nmdc:mga00v17_7507_c1
1928 nmdc:mga0yw44_207032_c1
1929 nmdc:mga0yw44_22077_c1
1930 nmdc:mga0yw44_339099_c1
1931 nmdc:mga0yw44_52184_c1
1932 nmdc:mga06z11_15221_c1
1933 nmdc:mga06z11_39550_c1
1934 nmdc:mga04h51_5954_c1
1935 nmdc:mga04h51_9671_c1
1936 nmdc:mga07m45_13721_c1
1937 nmdc:mga07m45_146616_c1
1938 nmdc:mga07m45_38352_c1
1939 nmdc:mga07m45_46733_c1
1940 nmdc:mga07m45_92094_c1
1941 nmdc:mga05p37_3169_c1
1942 nmdc:mga05p37_88589_c1
1943 nmdc:mga09592_106048_c1
1944 nmdc:mga0qj67_15554_c1
1945 nmdc:mga06r32_403866_c1
1946 nmdc:mga08y16_199381_c1
1947 nmdc:mga0n895_320_c1
1948 nmdc:mga0n895_46863_c1
1949 nmdc:mga0rr50_25073_c1
1950 nmdc:mga08x19_3141_c1
1951 nmdc:mga0a205_213796_c1
1952 nmdc:mga0a205_5899_c1
1953 nmdc:mga0sz30_16128_c3
1954 nmdc:mga0sz30_1724_c1
1955 nmdc:mga0sz30_3342_c1
1956 nmdc:mga0sz30_3484_c2
1957 nmdc:mga0sz30_483_c1
1958 Ga0495612_0118723
1959 Ga0500610_0046814
1960 Ga0495655_0012580
1961 Ga0495655_0052742
1962 Ga0500644_0050462
1963 Ga0500640_044138
1964 Ga0500660_028431
1965 Ga0500553_088478
1966 Ga0500553_104864
1967 Ga0500560_079931
1968 Ga0500580_089720
1969 Ga0500608_055772
1970 Ga0500618_000612
1971 Ga0500559_0085812
1972 Ga0500573_0191670
1973 Ga0500616_0033532
1974 Ga0500616_0073659
1975 Ga0500645_000565
1976 Ga0500645_036164
1977 Ga0501084_0010469
1978 Ga0466962_0021927
1979 Ga0466962_0053549
1980 Ga0530510_0167183
1981 2515721523
1982 2516086162
1983 2523386742
1984 2547412330
1985 2554260022
1986 2566992043
1987 2585299880
1988 2585304187
1989 2585309201
1990 2585319069
1991 2585319810
1992 2616693623
1993 2616697702
1994 2616905574
1995 2623497875
1996 2643759848
1997 2643897991
1998 2643944567
1999 2644051420
2000 2644201092
2001 2644263217
2002 2644270407
2003 2644385505
2004 2644409136
2005 2644431465
2006 2644436520
2007 2644440920
2008 2644462733
2009 2644484324
2010 2644486604
2011 2644625635
2012 2644638330
2013 2738705949
2014 2739330429
2015 2768646986
2016 2776374876
2017 2784591994
2018 2785344158
2019 2785368738
2020 2785373251
2021 2786669845
2022 2786674732
2023 2793978115
2024 2804844991
2025 2808841409
2026 2808915108
2027 2808919975
2028 2809235630
2029 2811848376
2030 2812354328
2031 2812482855
2032 2819693564
2033 2852635948
2034 2862184782
2035 2862282994
2036 2862287978
2037 2862296635
2038 2862383137
2039 2862507678
2040 2862579866
2041 2863074827
2042 2863405414
2043 2867350104
2044 2867371281
2045 2867430009
2046 2867431481
2047 2867480495
2048 2873156458
2049 2875393889
2050 2877677660
2051 2877681775
2052 2902796701
2053 2902801728
2054 2902812242
2055 2904538555
2056 2912715868
2057 2912728916
2058 2912760049
2059 2918503938
2060 2919468802
2061 2922559286
2062 2929216598
2063 2935394594
2064 2939588657
2065 2946050752
2066 2946071373
2067 2946075342
2068 2947225363
2069 2954003414
2070 2954382419
2071 2954386922
2072 2954676274
2073 2954680670
2074 2954683483
2075 2954687895
2076 2954693224
2077 2954697734
2078 2954704482
2079 2954708321
2080 2954712898
2081 2954716863
2082 2954722856
2083 2954726811
2084 2954734984
2085 2954738973
2086 2954741767
2087 2954745734
2088 2954753856
2089 2954757831
2090 2954760746
2091 2954764708
2092 2966603190
2093 2984524954
2094 2990065815
2095 2990091159
2096 2997456656
2097 2997606925
2098 2997608068
2099 3006395457
2100 3006426837
2101 3006493698
2102 3006494565
2103 8008559665
2104 8008575825
2105 8023624176
2106 8025418953
2107 8025481752
2108 8025536923
2109 8047898779
2110 8048131568
2111 8048360140
2112 8048375739
2113 8048382466
2114 8048409334
2115 8054162900
2116 8054477001
2117 8056451483
2118 8056672425
2119 8056830184
2120 8056836148

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

47

310

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cny-assembly2.cif.gz_B crystal structure of a putative inositol catabolism protein iole (iole, lp_3607) from lactobacillus plantarum wcfs1 at 1.85 a resolution 0.8295 3 277
3cny-assembly2.cif.gz_B crystal structure of a putative inositol catabolism protein iole (iole, lp_3607) from lactobacillus plantarum wcfs1 at 1.85 a resolution 0.7905 3 277
3wqo-assembly1.cif.gz_B crystal structure of d-tagatose 3-epimerase-like protein 0.7164 8 282
3cqh-assembly1.cif.gz_B crystal structure of l-xylulose-5-phosphate 3-epimerase ulae from the anaerobic l-ascorbate utilization pathway of escherichia coli 0.7152 8 283
3cqj-assembly1.cif.gz_B crystal structure of l-xylulose-5-phosphate 3-epimerase ulae (form b) complex with zn2+ 0.7135 7 283
ID Description Score Start End Superfamily
3cnyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.834 3 277 3.20.20.150
3cnyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7947 3 277 3.20.20.150
3lmzA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.729 1 286 3.20.20.150
af_P45541_1_270_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7169 8 281 3.20.20.150
af_P45541_1_270_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7098 8 281 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A2S8MRC4-F1-model_v4 deleted 0.9787 8 75
AF-A0A7Y5NMG5-F1-model_v4 TIM barrel protein 0.9769 165 286
AF-A0A6P0QQ53-F1-model_v4 deleted 0.9768 166 284
AF-A0A7Y5T6H7-F1-model_v4 TIM barrel protein 0.9758 1 289
AF-A0A7K3H676-F1-model_v4 TIM barrel protein 0.9746 4 285

Map