F489266

General Info

Members Datasets Scaffolds Average Seq Length
1060 292 1060 143

Family's Representative Sequence

Representative Sequence 3300005840|Ga0068870_10315663|Ga0068870_103156632
Length 161
Sequence MWLCFLLLVVTFFVTKSLETEIDIAYTDAHIAAYPIEYIAGIDLYNAGEFHAAHDAWEERWMGEVGPKEKLFLQAMIQSAVAFHHLDIGRPGAARQMYLRAKEKFARLGTPVFMSLDLDDYQVQLDSALSWLLSVADPRELAMPEINPPKIRLLPRVYEFD

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
97 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
98 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
192 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
193 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
194 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
195 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
200 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
201 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
202 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
203 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
204 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
210 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
211 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
212 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
213 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
216 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
217 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
218 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
219 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
220 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
221 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
222 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
223 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
224 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
235 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
236 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
237 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
238 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
239 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
240 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
241 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
242 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
243 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
246 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
247 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
248 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
249 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
250 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
251 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
252 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
253 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
254 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
255 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
256 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
257 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
258 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
259 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
260 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
261 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
262 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
263 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
264 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
265 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
266 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
267 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
268 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
269 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
270 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
271 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
272 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
273 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
274 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
275 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
276 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
277 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
278 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
279 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
280 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
281 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
282 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
283 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
284 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
285 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
286 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
287 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
288 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
289 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
290 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
291 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
292 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.26
Rhizosphere 97.64
Stem 0
Stem Tuber 0
Unclassified 0.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1874972 2162886007 Bacteria 915
2 SwRhRL2b_contig_983262 2162886007 Bacteria 872
3 CNAas_1001022 3300000532 Unclassified 2584
4 LJNas_1024266 3300000546 Unclassified 648
5 JGI24749J21850_1023508 3300002076 Unclassified 876
6 JGI24751J29686_10000107 3300002459 Bacteria 44982
7 JGI25406J46586_10022414 3300003203 Bacteria 2517
8 JGI25406J46586_10026276 3300003203 Bacteria 2247
9 rootL2_10229176 3300003322 Unclassified 1785
10 Ga0065714_10064435 3300005288 Bacteria 121919
11 Ga0065714_10485774 3300005288 Unclassified 532
12 Ga0065704_10002076 3300005289 Bacteria 7544
13 Ga0065704_10140109 3300005289 Bacteria 1526
14 Ga0065704_10201753 3300005289 Bacteria 1143
15 Ga0065704_10237409 3300005289 Bacteria 1018
16 Ga0065704_10393606 3300005289 Unclassified 759
17 Ga0065704_10620604 3300005289 Unclassified 597
18 Ga0065712_10000118 3300005290 Bacteria 121959
19 Ga0065712_10002294 3300005290 Unclassified 4858
20 Ga0065712_10005369 3300005290 Bacteria 3175
21 Ga0065712_10005863 3300005290 Bacteria 3316
22 Ga0065712_10018041 3300005290 Unclassified 1666
23 Ga0065712_10073348 3300005290 Unclassified 4421
24 Ga0065715_10007562 3300005293 Unclassified 2934
25 Ga0065715_10015929 3300005293 Bacteria 2146
26 Ga0065715_10089159 3300005293 Bacteria 13317
27 Ga0065715_10090332 3300005293 Bacteria 7197
28 Ga0065715_10099361 3300005293 Bacteria 3373
29 Ga0065715_10100976 3300005293 Unclassified 3248
30 Ga0065715_10110229 3300005293 Bacteria 2630
31 Ga0065715_10123838 3300005293 Unclassified 2168
32 Ga0065715_10206344 3300005293 Bacteria 1320
33 Ga0065715_10260587 3300005293 Bacteria 1139
34 Ga0065715_10282463 3300005293 Unclassified 1083
35 Ga0065715_10310441 3300005293 Bacteria 1022
36 Ga0065715_10399621 3300005293 Unclassified 883
37 Ga0065715_10584042 3300005293 Unclassified 718
38 Ga0065715_10779036 3300005293 Unclassified 618
39 Ga0065707_10001813 3300005295 Bacteria 12883
40 Ga0065707_10138063 3300005295 Unclassified 1811
41 Ga0065707_10144234 3300005295 Unclassified 1733
42 Ga0065707_10253448 3300005295 Bacteria 1112
43 Ga0065707_10340592 3300005295 Unclassified 908
44 Ga0065707_10398166 3300005295 Bacteria 856
45 Ga0070676_10090439 3300005328 Bacteria 1874
46 Ga0070676_10223646 3300005328 Unclassified 1244
47 Ga0070676_10250226 3300005328 Bacteria 1182
48 Ga0070676_10361062 3300005328 Bacteria 1001
49 Ga0070676_11087608 3300005328 Unclassified 604
50 Ga0070683_101073279 3300005329 Unclassified 773
51 Ga0070690_100005943 3300005330 Bacteria 6891
52 Ga0070690_100052256 3300005330 Bacteria 2611
53 Ga0070690_100080578 3300005330 Bacteria 2129
54 Ga0070690_101080185 3300005330 Unclassified 636
55 Ga0070670_100001037 3300005331 Bacteria 22003
56 Ga0070670_100006797 3300005331 Bacteria 9682
57 Ga0070670_100017767 3300005331 Bacteria 6102
58 Ga0070670_100632979 3300005331 Unclassified 959
59 Ga0070677_10488909 3300005333 Unclassified 665
60 Ga0068869_100025113 3300005334 Bacteria 4134
61 Ga0068869_100039742 3300005334 Bacteria 3360
62 Ga0068869_100107545 3300005334 Bacteria 2118
63 Ga0068869_100192963 3300005334 Unclassified 1602
64 Ga0068869_100366862 3300005334 Bacteria 1177
65 Ga0068869_100393077 3300005334 Bacteria 1139
66 Ga0068869_101906008 3300005334 Bacteria 533
67 Ga0070666_10032891 3300005335 Bacteria 3428
68 Ga0070666_10184527 3300005335 Bacteria 1464
69 Ga0070680_100016262 3300005336 Bacteria 5853
70 Ga0070680_100393408 3300005336 Unclassified 1181
71 Ga0070682_100000051 3300005337 Bacteria 123476
72 Ga0070682_100003753 3300005337 Bacteria 8445
73 Ga0070682_100006511 3300005337 Bacteria 6554
74 Ga0070682_100241834 3300005337 Unclassified 1296
75 Ga0068868_100025154 3300005338 Unclassified 4523
76 Ga0068868_100066068 3300005338 Bacteria 2875
77 Ga0068868_100074948 3300005338 Bacteria 2704
78 Ga0068868_100198035 3300005338 Bacteria 1673
79 Ga0068868_100865720 3300005338 Unclassified 819
80 Ga0070660_100089303 3300005339 Bacteria 2428
81 Ga0070689_100008505 3300005340 Bacteria 7232
82 Ga0070689_100212369 3300005340 Bacteria 1584
83 Ga0070689_100249413 3300005340 Unclassified 1464
84 Ga0070689_101057564 3300005340 Unclassified 724
85 Ga0070687_100002881 3300005343 Bacteria 6576
86 Ga0070687_100870944 3300005343 Unclassified 644
87 Ga0070661_100351779 3300005344 Unclassified 1156
88 Ga0070661_100938070 3300005344 Unclassified 716
89 Ga0070692_10060728 3300005345 Bacteria 1991
90 Ga0070692_10098348 3300005345 Unclassified 1600
91 Ga0070692_10178320 3300005345 Unclassified 1230
92 Ga0070692_10237931 3300005345 Bacteria 1084
93 Ga0070692_10268256 3300005345 Bacteria 1029
94 Ga0070692_10335894 3300005345 Bacteria 934
95 Ga0070692_10390060 3300005345 Unclassified 876
96 Ga0070692_10450274 3300005345 Unclassified 824
97 Ga0070692_10497103 3300005345 Unclassified 790
98 Ga0070692_10650010 3300005345 Bacteria 704
99 Ga0070668_100003898 3300005347 Bacteria 11016
100 Ga0070668_100314715 3300005347 Unclassified 1316
101 Ga0070669_100000729 3300005353 Bacteria 23953
102 Ga0070669_100007926 3300005353 Bacteria 7589
103 Ga0070669_100049912 3300005353 Bacteria 3056
104 Ga0070669_100056435 3300005353 Bacteria 2879
105 Ga0070669_100122299 3300005353 Unclassified 1987
106 Ga0070669_100139726 3300005353 Bacteria 1866
107 Ga0070669_100725315 3300005353 Unclassified 841
108 Ga0070669_101210195 3300005353 Bacteria 653
109 Ga0070675_100427867 3300005354 Bacteria 1184
110 Ga0070675_100482761 3300005354 Unclassified 1115
111 Ga0070675_100532517 3300005354 Unclassified 1061
112 Ga0070671_100005506 3300005355 Bacteria 10097
113 Ga0070671_100143151 3300005355 Bacteria 2018
114 Ga0070671_101374756 3300005355 Bacteria 623
115 Ga0070674_100362285 3300005356 Unclassified 1174
116 Ga0070674_100879921 3300005356 Bacteria 779
117 Ga0070673_100082896 3300005364 Unclassified 2604
118 Ga0070673_100281582 3300005364 Bacteria 1459
119 Ga0070673_100310862 3300005364 Unclassified 1390
120 Ga0070673_100464799 3300005364 Bacteria 1140
121 Ga0070673_100920831 3300005364 Unclassified 811
122 Ga0070673_101494164 3300005364 Unclassified 637
123 Ga0070673_101620656 3300005364 Bacteria 612
124 Ga0070688_100111543 3300005365 Bacteria 1819
125 Ga0070688_100649716 3300005365 Unclassified 812
126 Ga0070688_101034628 3300005365 Bacteria 654
127 Ga0070659_100025535 3300005366 Bacteria 4539
128 Ga0070659_100061476 3300005366 Bacteria 2968
129 Ga0070659_100652277 3300005366 Unclassified 907
130 Ga0070659_100665752 3300005366 Unclassified 898
131 Ga0070667_100020193 3300005367 Bacteria 5531
132 Ga0070667_100085781 3300005367 Unclassified 2701
133 Ga0070703_10013066 3300005406 Bacteria 2354
134 Ga0070703_10273453 3300005406 Unclassified 694
135 Ga0070709_10761512 3300005434 Unclassified 757
136 Ga0070701_10032396 3300005438 Unclassified 2602
137 Ga0070701_10076093 3300005438 Unclassified 1806
138 Ga0070701_10877009 3300005438 Unclassified 618
139 Ga0070701_11381406 3300005438 Unclassified 506
140 Ga0070705_100028934 3300005440 Unclassified 3040
141 Ga0070705_100046690 3300005440 Bacteria 2498
142 Ga0070705_100049793 3300005440 Unclassified 2434
143 Ga0070705_100052194 3300005440 Unclassified 2388
144 Ga0070705_100225949 3300005440 Bacteria 1299
145 Ga0070705_100318141 3300005440 Bacteria 1122
146 Ga0070705_100435808 3300005440 Unclassified 979
147 Ga0070705_100514269 3300005440 Unclassified 911
148 Ga0070700_100000092 3300005441 Bacteria 60316
149 Ga0070700_100013167 3300005441 Unclassified 4640
150 Ga0070700_100024519 3300005441 Bacteria 3542
151 Ga0070700_100035616 3300005441 Unclassified 3013
152 Ga0070700_100066629 3300005441 Bacteria 2286
153 Ga0070700_100082032 3300005441 Bacteria 2084
154 Ga0070700_100629017 3300005441 Bacteria 845
155 Ga0070694_100009639 3300005444 Bacteria 5927
156 Ga0070694_100014362 3300005444 Unclassified 4957
157 Ga0070694_100021114 3300005444 Unclassified 4158
158 Ga0070694_100030338 3300005444 Bacteria 3536
159 Ga0070694_100063279 3300005444 Unclassified 2529
160 Ga0070694_100066438 3300005444 Bacteria 2474
161 Ga0070694_100167011 3300005444 Bacteria 1619
162 Ga0070694_100220243 3300005444 Bacteria 1423
163 Ga0070694_100330415 3300005444 Unclassified 1176
164 Ga0070694_100856847 3300005444 Bacteria 748
165 Ga0070694_101269899 3300005444 Bacteria 619
166 Ga0070708_100002362 3300005445 Bacteria 14604
167 Ga0070708_100553254 3300005445 Unclassified 1085
168 Ga0070708_100826520 3300005445 Unclassified 871
169 Ga0070678_100084501 3300005456 Bacteria 2416
170 Ga0070678_100265509 3300005456 Bacteria 1445
171 Ga0070678_100459123 3300005456 Bacteria 1117
172 Ga0070678_100992586 3300005456 Unclassified 771
173 Ga0070662_100140783 3300005457 Bacteria 1869
174 Ga0070662_100172586 3300005457 Bacteria 1699
175 Ga0070662_100728486 3300005457 Unclassified 840
176 Ga0070662_101123321 3300005457 Unclassified 675
177 Ga0070681_10002322 3300005458 Bacteria 17395
178 Ga0070681_10008066 3300005458 Bacteria 10307
179 Ga0070681_10022916 3300005458 Bacteria 6276
180 Ga0070681_10230401 3300005458 Bacteria 1767
181 Ga0068867_100014031 3300005459 Bacteria 5676
182 Ga0068867_100025690 3300005459 Bacteria 4227
183 Ga0068867_100088519 3300005459 Unclassified 2346
184 Ga0068867_100252513 3300005459 Unclassified 1434
185 Ga0068867_100266958 3300005459 Unclassified 1397
186 Ga0068867_101956888 3300005459 Unclassified 553
187 Ga0070685_10293847 3300005466 Bacteria 1092
188 Ga0070685_11066855 3300005466 Bacteria 609
189 Ga0070685_11297953 3300005466 Bacteria 556
190 Ga0070706_100000097 3300005467 Bacteria 106315
191 Ga0070706_100021785 3300005467 Bacteria 5901
192 Ga0070706_100021984 3300005467 Bacteria 5874
193 Ga0070706_100090285 3300005467 Bacteria 2841
194 Ga0070706_100937058 3300005467 Unclassified 799
195 Ga0070707_100026729 3300005468 Bacteria 5482
196 Ga0070707_100208076 3300005468 Bacteria 1907
197 Ga0070707_100317534 3300005468 Bacteria 1514
198 Ga0070707_100861749 3300005468 Bacteria 870
199 Ga0070698_100003588 3300005471 Bacteria 17057
200 Ga0070698_100006142 3300005471 Bacteria 13081
201 Ga0070698_100029558 3300005471 Bacteria 5690
202 Ga0070698_100040853 3300005471 Bacteria 4765
203 Ga0070699_100009745 3300005518 Bacteria 8311
204 Ga0070699_100038140 3300005518 Bacteria 4161
205 Ga0070699_100437859 3300005518 Unclassified 1184
206 Ga0070699_100502529 3300005518 Bacteria 1101
207 Ga0070699_100556264 3300005518 Bacteria 1044
208 Ga0070699_101987188 3300005518 Unclassified 532
209 Ga0070679_100082638 3300005530 Bacteria 3202
210 Ga0070684_101935542 3300005535 Unclassified 556
211 Ga0070697_100000176 3300005536 Bacteria 52306
212 Ga0070697_100026034 3300005536 Bacteria 4667
213 Ga0070697_101135558 3300005536 Bacteria 696
214 Ga0070697_101298482 3300005536 Unclassified 649
215 Ga0070697_101739318 3300005536 Unclassified 558
216 Ga0068853_100041243 3300005539 Unclassified 3941
217 Ga0068853_100051590 3300005539 Unclassified 3541
218 Ga0068853_100100877 3300005539 Bacteria 2552
219 Ga0068853_100315269 3300005539 Bacteria 1449
220 Ga0068853_100824328 3300005539 Unclassified 889
221 Ga0070672_100220655 3300005543 Bacteria 1590
222 Ga0070672_100384674 3300005543 Bacteria 1200
223 Ga0070672_100799659 3300005543 Unclassified 830
224 Ga0070672_101092064 3300005543 Bacteria 709
225 Ga0070672_101397763 3300005543 Unclassified 626
226 Ga0070686_100072686 3300005544 Unclassified 2256
227 Ga0070695_100039223 3300005545 Unclassified 2993
228 Ga0070695_100055135 3300005545 Bacteria 2561
229 Ga0070695_100083928 3300005545 Bacteria 2112
230 Ga0070695_100088960 3300005545 Bacteria 2057
231 Ga0070695_100109706 3300005545 Unclassified 1870
232 Ga0070695_100139498 3300005545 Bacteria 1679
233 Ga0070695_100141530 3300005545 Unclassified 1669
234 Ga0070695_100509117 3300005545 Unclassified 932
235 Ga0070695_100750907 3300005545 Unclassified 778
236 Ga0070696_100018228 3300005546 Bacteria 4742
237 Ga0070696_100045041 3300005546 Unclassified 3056
238 Ga0070696_100061942 3300005546 Bacteria 2618
239 Ga0070696_100192430 3300005546 Bacteria 1519
240 Ga0070696_100276096 3300005546 Bacteria 1279
241 Ga0070696_100389728 3300005546 Bacteria 1088
242 Ga0070696_100663725 3300005546 Bacteria 846
243 Ga0070696_100865349 3300005546 Unclassified 748
244 Ga0070696_100871939 3300005546 Unclassified 745
245 Ga0070696_100954400 3300005546 Unclassified 714
246 Ga0070693_100000305 3300005547 Bacteria 22777
247 Ga0070693_100043186 3300005547 Bacteria 2545
248 Ga0070693_100065843 3300005547 Bacteria 2119
249 Ga0070693_100066277 3300005547 Unclassified 2113
250 Ga0070693_100078078 3300005547 Unclassified 1966
251 Ga0070693_100406452 3300005547 Unclassified 945
252 Ga0070665_100031856 3300005548 Bacteria 5307
253 Ga0070665_100259179 3300005548 Unclassified 1740
254 Ga0070665_100366628 3300005548 Bacteria 1447
255 Ga0070704_100019639 3300005549 Unclassified 4345
256 Ga0070704_100028429 3300005549 Bacteria 3720
257 Ga0070704_100044294 3300005549 Unclassified 3091
258 Ga0070704_100087485 3300005549 Unclassified 2312
259 Ga0070704_100334979 3300005549 Bacteria 1272
260 Ga0070704_100688425 3300005549 Unclassified 906
261 Ga0070704_100759479 3300005549 Unclassified 864
262 Ga0070704_100904995 3300005549 Bacteria 794
263 Ga0070704_100910981 3300005549 Unclassified 791
264 Ga0068855_100485039 3300005563 Unclassified 1345
265 Ga0068855_102324219 3300005563 Unclassified 536
266 Ga0070664_100011220 3300005564 Bacteria 7268
267 Ga0070664_100125031 3300005564 Bacteria 2255
268 Ga0070664_100177205 3300005564 Bacteria 1893
269 Ga0070664_100192721 3300005564 Bacteria 1816
270 Ga0070664_100273588 3300005564 Unclassified 1522
271 Ga0070664_100526083 3300005564 Unclassified 1092
272 Ga0070664_100683934 3300005564 Unclassified 955
273 Ga0068857_100000277 3300005577 Bacteria 35101
274 Ga0068857_100067092 3300005577 Bacteria 3193
275 Ga0068857_100457782 3300005577 Unclassified 1193
276 Ga0068857_100614039 3300005577 Bacteria 1028
277 Ga0068857_100909935 3300005577 Bacteria 844
278 Ga0068857_101179827 3300005577 Unclassified 741
279 Ga0068857_101181049 3300005577 Unclassified 740
280 Ga0068854_100122249 3300005578 Bacteria 1978
281 Ga0068854_100130332 3300005578 Bacteria 1919
282 Ga0068854_100336664 3300005578 Unclassified 1231
283 Ga0068854_100640828 3300005578 Unclassified 911
284 Ga0068854_101356184 3300005578 Bacteria 642
285 Ga0068856_101984724 3300005614 Unclassified 592
286 Ga0070702_100003303 3300005615 Bacteria 7192
287 Ga0070702_100010068 3300005615 Bacteria 4646
288 Ga0070702_100017240 3300005615 Bacteria 3722
289 Ga0070702_100122575 3300005615 Archaea 1629
290 Ga0070702_100222670 3300005615 Unclassified 1262
291 Ga0070702_100322854 3300005615 Bacteria 1077
292 Ga0070702_100536965 3300005615 Bacteria 865
293 Ga0068852_100145754 3300005616 Unclassified 2196
294 Ga0068852_100746137 3300005616 Bacteria 991
295 Ga0068859_100032266 3300005617 Bacteria 5261
296 Ga0068859_100047921 3300005617 Bacteria 4293
297 Ga0068859_100056252 3300005617 Bacteria 3958
298 Ga0068859_100069646 3300005617 Bacteria 3553
299 Ga0068859_100076104 3300005617 Bacteria 3397
300 Ga0068859_100082256 3300005617 Bacteria 3263
301 Ga0068859_100091632 3300005617 Unclassified 3090
302 Ga0068859_100155199 3300005617 Unclassified 2366
303 Ga0068859_100197537 3300005617 Bacteria 2096
304 Ga0068859_100264536 3300005617 Unclassified 1812
305 Ga0068859_100306733 3300005617 Unclassified 1681
306 Ga0068859_100771954 3300005617 Unclassified 1049
307 Ga0068859_100918069 3300005617 Unclassified 960
308 Ga0068859_101078732 3300005617 Bacteria 883
309 Ga0068859_101447938 3300005617 Unclassified 758
310 Ga0068859_101565272 3300005617 Unclassified 728
311 Ga0068859_101594401 3300005617 Bacteria 721
312 Ga0068859_101691498 3300005617 Unclassified 699
313 Ga0068864_100001610 3300005618 Bacteria 18609
314 Ga0068864_100007660 3300005618 Bacteria 8893
315 Ga0068864_100024460 3300005618 Bacteria 5082
316 Ga0068864_100072626 3300005618 Unclassified 2999
317 Ga0068864_100109417 3300005618 Unclassified 2460
318 Ga0068864_100319606 3300005618 Bacteria 1458
319 Ga0068864_100632611 3300005618 Bacteria 1041
320 Ga0068864_100998191 3300005618 Unclassified 830
321 Ga0068864_101035380 3300005618 Bacteria 815
322 Ga0068864_101274847 3300005618 Unclassified 735
323 Ga0068864_101619725 3300005618 Bacteria 651
324 Ga0068866_10076616 3300005718 Bacteria 1784
325 Ga0068866_10113348 3300005718 Unclassified 1517
326 Ga0068866_10583330 3300005718 Unclassified 752
327 Ga0068861_100010957 3300005719 Bacteria 6300
328 Ga0068861_100028721 3300005719 Bacteria 4060
329 Ga0068861_100037632 3300005719 Bacteria 3597
330 Ga0068861_100068417 3300005719 Bacteria 2744
331 Ga0068861_100223151 3300005719 Unclassified 1594
332 Ga0068861_100497972 3300005719 Unclassified 1101
333 Ga0068861_100598295 3300005719 Unclassified 1012
334 Ga0068861_100787358 3300005719 Unclassified 891
335 Ga0068861_101047303 3300005719 Bacteria 781
336 Ga0068861_101550159 3300005719 Unclassified 651
337 Ga0068861_102058976 3300005719 Unclassified 570
338 Ga0068851_10011958 3300005834 Unclassified 4082
339 Ga0068851_10093937 3300005834 Unclassified 1583
340 Ga0068870_10000847 3300005840 Bacteria 11937
341 Ga0068870_10027719 3300005840 Bacteria 2836
342 Ga0068870_10075576 3300005840 Bacteria 1848
343 Ga0068870_10096885 3300005840 Unclassified 1659
344 Ga0068870_10133279 3300005840 Bacteria 1446
345 Ga0068870_10315663 3300005840 Bacteria 991
346 Ga0068870_10380733 3300005840 Bacteria 913
347 Ga0068870_10512172 3300005840 Unclassified 802
348 Ga0068870_10973515 3300005840 Unclassified 603
349 Ga0068863_100071411 3300005841 Bacteria 3284
350 Ga0068863_100125851 3300005841 Bacteria 2445
351 Ga0068863_100130818 3300005841 Archaea 2396
352 Ga0068863_100133583 3300005841 Bacteria 2370
353 Ga0068863_100612072 3300005841 Unclassified 1079
354 Ga0068863_100787577 3300005841 Bacteria 948
355 Ga0068863_102645650 3300005841 Unclassified 511
356 Ga0068858_100052748 3300005842 Unclassified 3763
357 Ga0068858_100072879 3300005842 Unclassified 3187
358 Ga0068858_100083895 3300005842 Unclassified 2963
359 Ga0068858_100150078 3300005842 Unclassified 2191
360 Ga0068858_100265803 3300005842 Bacteria 1631
361 Ga0068858_100313763 3300005842 Unclassified 1497
362 Ga0068858_100489751 3300005842 Bacteria 1187
363 Ga0068858_100502341 3300005842 Bacteria 1172
364 Ga0068858_101426488 3300005842 Unclassified 682
365 Ga0068860_100047159 3300005843 Bacteria 4107
366 Ga0068860_100061511 3300005843 Unclassified 3567
367 Ga0068860_100076808 3300005843 Unclassified 3176
368 Ga0068860_100095569 3300005843 Unclassified 2833
369 Ga0068860_100099306 3300005843 Unclassified 2776
370 Ga0068860_100130106 3300005843 Bacteria 2415
371 Ga0068860_100156914 3300005843 Bacteria 2193
372 Ga0068860_100164402 3300005843 Unclassified 2141
373 Ga0068860_100182651 3300005843 Unclassified 2027
374 Ga0068860_100769004 3300005843 Unclassified 975
375 Ga0068862_100135621 3300005844 Bacteria 2181
376 Ga0068862_100574056 3300005844 Bacteria 1079
377 Ga0068862_100577106 3300005844 Unclassified 1077
378 Ga0068862_101205650 3300005844 Bacteria 755
379 Ga0068862_101261050 3300005844 Unclassified 739
380 Ga0068862_101720658 3300005844 Bacteria 635
381 Ga0068862_102255382 3300005844 Unclassified 556
382 Ga0081539_10000067 3300005985 Bacteria 246361
383 Ga0081539_10003247 3300005985 Bacteria 20448
384 Ga0081539_10029095 3300005985 Unclassified 3461
385 Ga0075432_10456860 3300006058 Bacteria 561
386 Ga0070716_101387873 3300006173 Unclassified 571
387 Ga0097621_100001354 3300006237 Bacteria 16867
388 Ga0097621_100001882 3300006237 Bacteria 14354
389 Ga0097621_100015727 3300006237 Bacteria 5701
390 Ga0097621_100743033 3300006237 Bacteria 906
391 Ga0068871_100003285 3300006358 Bacteria 11094
392 Ga0068871_100021215 3300006358 Unclassified 4989
393 Ga0068871_100565083 3300006358 Bacteria 1031
394 Ga0075428_100070337 3300006844 Bacteria 3826
395 Ga0075428_100424178 3300006844 Unclassified 1425
396 Ga0075428_100548643 3300006844 Unclassified 1236
397 Ga0075430_100181848 3300006846 Bacteria 1749
398 Ga0075430_101249432 3300006846 Unclassified 611
399 Ga0075431_100158837 3300006847 Bacteria 2325
400 Ga0075431_100463168 3300006847 Bacteria 1262
401 Ga0075433_10032308 3300006852 Bacteria 4483
402 Ga0075433_10065599 3300006852 Unclassified 3184
403 Ga0075433_10090500 3300006852 Bacteria 2705
404 Ga0075433_10123122 3300006852 Unclassified 2304
405 Ga0075433_10160708 3300006852 Unclassified 1999
406 Ga0075433_10212242 3300006852 Bacteria 1720
407 Ga0075433_10371980 3300006852 Unclassified 1262
408 Ga0075433_10637907 3300006852 Unclassified 934
409 Ga0075433_11272307 3300006852 Unclassified 638
410 Ga0075433_11821727 3300006852 Unclassified 523
411 Ga0075434_100054566 3300006871 Unclassified 3970
412 Ga0075434_100058548 3300006871 Bacteria 3829
413 Ga0075434_100539414 3300006871 Bacteria 1186
414 Ga0075434_100837926 3300006871 Bacteria 935
415 Ga0075434_101713228 3300006871 Bacteria 636
416 Ga0075434_101725128 3300006871 Unclassified 634
417 Ga0075434_101755485 3300006871 Unclassified 628
418 Ga0075434_102356380 3300006871 Unclassified 535
419 Ga0075429_100059945 3300006880 Bacteria 3316
420 Ga0075429_100248149 3300006880 Bacteria 1559
421 Ga0075429_100852102 3300006880 Unclassified 798
422 Ga0068865_100022198 3300006881 Bacteria 4136
423 Ga0068865_100384022 3300006881 Unclassified 1146
424 Ga0068865_100447858 3300006881 Bacteria 1067
425 Ga0068865_100720682 3300006881 Unclassified 854
426 Ga0068865_101366598 3300006881 Unclassified 631
427 Ga0068865_101715957 3300006881 Unclassified 566
428 Ga0075436_100013635 3300006914 Bacteria 5568
429 Ga0097620_100032266 3300006931 Bacteria 5261
430 Ga0097620_100047919 3300006931 Bacteria 4293
431 Ga0097620_100056252 3300006931 Bacteria 3958
432 Ga0097620_100069647 3300006931 Bacteria 3553
433 Ga0097620_100076103 3300006931 Bacteria 3397
434 Ga0097620_100082258 3300006931 Bacteria 3263
435 Ga0097620_100091625 3300006931 Unclassified 3090
436 Ga0097620_100136599 3300006931 Unclassified 2525
437 Ga0097620_100155198 3300006931 Unclassified 2366
438 Ga0097620_100197537 3300006931 Bacteria 2096
439 Ga0097620_100264532 3300006931 Unclassified 1812
440 Ga0097620_100306736 3300006931 Unclassified 1681
441 Ga0097620_100771979 3300006931 Unclassified 1049
442 Ga0097620_100918037 3300006931 Unclassified 960
443 Ga0097620_101078761 3300006931 Bacteria 883
444 Ga0097620_101447394 3300006931 Unclassified 758
445 Ga0097620_101565646 3300006931 Unclassified 728
446 Ga0097620_101691512 3300006931 Unclassified 699
447 Ga0075435_100029269 3300007076 Bacteria 4322
448 Ga0099794_10586380 3300007265 Unclassified 590
449 Ga0105251_10457182 3300009011 Bacteria 592
450 Ga0105250_10135033 3300009092 Unclassified 1020
451 Ga0105240_10036772 3300009093 Bacteria 6296
452 Ga0105240_12003630 3300009093 Unclassified 602
453 Ga0111539_10001469 3300009094 Bacteria 31496
454 Ga0111539_10007977 3300009094 Bacteria 13504
455 Ga0111539_10010383 3300009094 Bacteria 11722
456 Ga0111539_10167162 3300009094 Unclassified 2571
457 Ga0111539_10545040 3300009094 Unclassified 1351
458 Ga0105245_10092553 3300009098 Bacteria 2784
459 Ga0105245_10280029 3300009098 Unclassified 1629
460 Ga0105245_10441515 3300009098 Bacteria 1308
461 Ga0105245_10886280 3300009098 Unclassified 933
462 Ga0105245_11306987 3300009098 Bacteria 774
463 Ga0105247_10013105 3300009101 Bacteria 4974
464 Ga0105247_10017782 3300009101 Unclassified 4263
465 Ga0105247_10020829 3300009101 Bacteria 3944
466 Ga0105247_10868129 3300009101 Unclassified 694
467 Ga0105247_11727951 3300009101 Unclassified 518
468 Ga0114129_10026332 3300009147 Bacteria 8236
469 Ga0114129_10030702 3300009147 Bacteria 7601
470 Ga0114129_10053343 3300009147 Bacteria 5671
471 Ga0114129_10058691 3300009147 Bacteria 5382
472 Ga0114129_10140117 3300009147 Bacteria 3316
473 Ga0114129_10225919 3300009147 Bacteria 2523
474 Ga0114129_10329266 3300009147 Bacteria 2029
475 Ga0114129_10996248 3300009147 Bacteria 1056
476 Ga0114129_11138347 3300009147 Unclassified 975
477 Ga0114129_11180585 3300009147 Bacteria 954
478 Ga0105243_10003775 3300009148 Bacteria 12142
479 Ga0105243_10061092 3300009148 Unclassified 3012
480 Ga0105243_10122873 3300009148 Bacteria 2192
481 Ga0105243_10429077 3300009148 Bacteria 1235
482 Ga0105243_10790024 3300009148 Unclassified 934
483 Ga0105243_10825810 3300009148 Unclassified 916
484 Ga0105243_10942561 3300009148 Bacteria 862
485 Ga0105243_11761155 3300009148 Unclassified 650
486 Ga0105243_11953724 3300009148 Bacteria 620
487 Ga0105241_10070093 3300009174 Bacteria 2719
488 Ga0105241_10281017 3300009174 Bacteria 1422
489 Ga0105241_10282215 3300009174 Unclassified 1419
490 Ga0105241_10409882 3300009174 Unclassified 1191
491 Ga0105241_10574385 3300009174 Bacteria 1015
492 Ga0105241_10677885 3300009174 Unclassified 939
493 Ga0105241_10834251 3300009174 Bacteria 851
494 Ga0105241_11006207 3300009174 Unclassified 780
495 Ga0105241_11303056 3300009174 Bacteria 692
496 Ga0105242_10088270 3300009176 Unclassified 2605
497 Ga0105242_10244232 3300009176 Bacteria 1615
498 Ga0105242_11577363 3300009176 Unclassified 689
499 Ga0105242_12133979 3300009176 Bacteria 605
500 Ga0105248_10001663 3300009177 Bacteria 24717
501 Ga0105248_10012918 3300009177 Bacteria 9206
502 Ga0105248_10077288 3300009177 Bacteria 3742
503 Ga0105248_10087616 3300009177 Bacteria 3504
504 Ga0105248_10274483 3300009177 Unclassified 1898
505 Ga0105248_10351329 3300009177 Unclassified 1660
506 Ga0105248_10428889 3300009177 Unclassified 1489
507 Ga0105248_13260840 3300009177 Unclassified 516
508 Ga0105237_10004213 3300009545 Bacteria 16744
509 Ga0105237_10051585 3300009545 Bacteria 4132
510 Ga0105237_10117960 3300009545 Unclassified 2647
511 Ga0105237_10528877 3300009545 Unclassified 1186
512 Ga0105238_10009780 3300009551 Bacteria 9600
513 Ga0105238_10064038 3300009551 Unclassified 3677
514 Ga0105238_10674264 3300009551 Bacteria 1045
515 Ga0105249_10001351 3300009553 Bacteria 21430
516 Ga0105249_10019365 3300009553 Bacteria 6071
517 Ga0105249_10066785 3300009553 Unclassified 3312
518 Ga0105249_10167824 3300009553 Bacteria 2126
519 Ga0105249_10254620 3300009553 Unclassified 1742
520 Ga0105249_10492621 3300009553 Unclassified 1270
521 Ga0105249_11065361 3300009553 Unclassified 878
522 Ga0105249_11168156 3300009553 Bacteria 840
523 Ga0105249_11321613 3300009553 Unclassified 793
524 Ga0105249_12125146 3300009553 Unclassified 634
525 Ga0105239_10081369 3300010375 Bacteria 3565
526 Ga0105239_10684171 3300010375 Unclassified 1172
527 Ga0105239_10749224 3300010375 Bacteria 1118
528 Ga0105239_12145922 3300010375 Unclassified 649
529 Ga0105239_12212756 3300010375 Bacteria 639
530 Ga0105246_10031719 3300011119 Bacteria 3498
531 Ga0105246_10074102 3300011119 Bacteria 2405
532 Ga0105246_10121618 3300011119 Bacteria 1935
533 Ga0105246_10159825 3300011119 Bacteria 1715
534 Ga0105246_10162642 3300011119 Unclassified 1702
535 Ga0105246_10294988 3300011119 Bacteria 1306
536 Ga0105246_10563003 3300011119 Unclassified 979
537 Ga0105246_11814357 3300011119 Unclassified 583
538 Ga0105246_11858765 3300011119 Bacteria 577
539 Ga0157327_1042121 3300012512 Unclassified 618
540 Ga0157373_10033443 3300013100 Unclassified 3699
541 Ga0157373_10107041 3300013100 Bacteria 1966
542 Ga0157373_10288513 3300013100 Bacteria 1164
543 Ga0157373_10836311 3300013100 Bacteria 680
544 Ga0157371_10256321 3300013102 Bacteria 1260
545 Ga0157371_11448912 3300013102 Unclassified 534
546 Ga0157374_10007848 3300013296 Bacteria 9112
547 Ga0157374_10512560 3300013296 Bacteria 1205
548 Ga0157374_10822191 3300013296 Unclassified 945
549 Ga0157378_10010711 3300013297 Bacteria 8016
550 Ga0157378_10049326 3300013297 Unclassified 3745
551 Ga0157378_10109696 3300013297 Bacteria 2528
552 Ga0157378_10336898 3300013297 Bacteria 1470
553 Ga0157378_10675609 3300013297 Bacteria 1050
554 Ga0163162_10001516 3300013306 Bacteria 21633
555 Ga0163162_10002329 3300013306 Bacteria 17822
556 Ga0163162_10005889 3300013306 Bacteria 11859
557 Ga0163162_10011561 3300013306 Bacteria 8612
558 Ga0163162_10037774 3300013306 Bacteria 4820
559 Ga0163162_10049352 3300013306 Unclassified 4218
560 Ga0163162_10085592 3300013306 Bacteria 3230
561 Ga0163162_10670436 3300013306 Unclassified 1160
562 Ga0163162_13026378 3300013306 Bacteria 540
563 Ga0157372_10025429 3300013307 Bacteria 6437
564 Ga0157372_10037304 3300013307 Bacteria 5360
565 Ga0157372_10058402 3300013307 Bacteria 4312
566 Ga0157372_10857264 3300013307 Bacteria 1054
567 Ga0157375_10005360 3300013308 Bacteria 11147
568 Ga0157375_10009563 3300013308 Bacteria 8511
569 Ga0157375_10240685 3300013308 Unclassified 1969
570 Ga0157375_10409195 3300013308 Bacteria 1523
571 Ga0157375_10474186 3300013308 Bacteria 1416
572 Ga0157375_10724946 3300013308 Bacteria 1147
573 Ga0157375_10910626 3300013308 Unclassified 1023
574 Ga0157375_10938039 3300013308 Bacteria 1008
575 Ga0157375_11760246 3300013308 Bacteria 734
576 Ga0157375_11931294 3300013308 Unclassified 701
577 Ga0157375_11955979 3300013308 Unclassified 696
578 Ga0163163_10000183 3300014325 Bacteria 64505
579 Ga0163163_10010501 3300014325 Bacteria 8331
580 Ga0163163_10043868 3300014325 Unclassified 4386
581 Ga0163163_10045314 3300014325 Unclassified 4316
582 Ga0163163_10075029 3300014325 Bacteria 3375
583 Ga0163163_10179947 3300014325 Unclassified 2161
584 Ga0163163_10181782 3300014325 Bacteria 2150
585 Ga0163163_10248392 3300014325 Unclassified 1830
586 Ga0163163_10578035 3300014325 Bacteria 1187
587 Ga0163163_10766215 3300014325 Unclassified 1028
588 Ga0163163_10793545 3300014325 Unclassified 1010
589 Ga0163163_11474052 3300014325 Unclassified 742
590 Ga0163163_13182301 3300014325 Unclassified 512
591 Ga0157380_10031735 3300014326 Unclassified 4058
592 Ga0157380_10033357 3300014326 Unclassified 3964
593 Ga0157380_10103104 3300014326 Bacteria 2380
594 Ga0157380_10125972 3300014326 Bacteria 2177
595 Ga0157380_10143609 3300014326 Unclassified 2054
596 Ga0157380_10523085 3300014326 Archaea 1157
597 Ga0157380_10963826 3300014326 Bacteria 884
598 Ga0157380_11121094 3300014326 Unclassified 827
599 Ga0157380_11338208 3300014326 Bacteria 765
600 Ga0157377_10022694 3300014745 Unclassified 3318
601 Ga0157377_10103750 3300014745 Unclassified 1699
602 Ga0157377_10580414 3300014745 Unclassified 796
603 Ga0157379_10120996 3300014968 Unclassified 2354
604 Ga0157379_10142071 3300014968 Bacteria 2164
605 Ga0157379_10225193 3300014968 Unclassified 1700
606 Ga0157379_10449365 3300014968 Unclassified 1189
607 Ga0157379_10589394 3300014968 Unclassified 1037
608 Ga0157379_10712097 3300014968 Bacteria 943
609 Ga0157379_10748913 3300014968 Unclassified 920
610 Ga0157376_10011208 3300014969 Bacteria 6597
611 Ga0157376_10125147 3300014969 Bacteria 2285
612 Ga0182007_10225337 3300015262 Bacteria 664
613 Ga0163161_10028642 3300017792 Unclassified 3956
614 Ga0163161_10640796 3300017792 Unclassified 880
615 Ga0207697_10299817 3300025315 Unclassified 713
616 Ga0207697_10383768 3300025315 Bacteria 624
617 Ga0207653_10010901 3300025885 Unclassified 2836
618 Ga0207653_10243206 3300025885 Unclassified 688
619 Ga0207682_10199156 3300025893 Bacteria 920
620 Ga0207682_10549013 3300025893 Bacteria 546
621 Ga0207642_10158567 3300025899 Bacteria 1212
622 Ga0207710_10003825 3300025900 Bacteria 6649
623 Ga0207710_10434115 3300025900 Unclassified 677
624 Ga0207688_10821881 3300025901 Unclassified 589
625 Ga0207680_10013632 3300025903 Unclassified 4182
626 Ga0207680_10419302 3300025903 Unclassified 948
627 Ga0207647_10000502 3300025904 Bacteria 31375
628 Ga0207647_10132344 3300025904 Unclassified 1465
629 Ga0207647_10167431 3300025904 Bacteria 1280
630 Ga0207699_10658590 3300025906 Unclassified 765
631 Ga0207645_10119803 3300025907 Unclassified 1708
632 Ga0207645_10406137 3300025907 Bacteria 916
633 Ga0207645_10527368 3300025907 Unclassified 800
634 Ga0207643_10000882 3300025908 Bacteria 18068
635 Ga0207643_10017495 3300025908 Bacteria 3920
636 Ga0207643_10027010 3300025908 Bacteria 3182
637 Ga0207643_10091750 3300025908 Bacteria 1772
638 Ga0207643_10106872 3300025908 Bacteria 1645
639 Ga0207643_10159023 3300025908 Unclassified 1358
640 Ga0207643_10217564 3300025908 Bacteria 1168
641 Ga0207643_10697011 3300025908 Unclassified 656
642 Ga0207684_10000023 3300025910 Bacteria 334838
643 Ga0207684_10005029 3300025910 Bacteria 12326
644 Ga0207684_10043569 3300025910 Bacteria 3805
645 Ga0207684_10418384 3300025910 Bacteria 1152
646 Ga0207654_10002853 3300025911 Bacteria 8764
647 Ga0207654_10077227 3300025911 Unclassified 1996
648 Ga0207654_10126422 3300025911 Unclassified 1612
649 Ga0207654_10235228 3300025911 Bacteria 1222
650 Ga0207654_10607803 3300025911 Bacteria 781
651 Ga0207707_10003187 3300025912 Bacteria 14567
652 Ga0207707_10023481 3300025912 Bacteria 5394
653 Ga0207695_10064972 3300025913 Unclassified 3753
654 Ga0207695_11233643 3300025913 Unclassified 628
655 Ga0207671_10006170 3300025914 Bacteria 10770
656 Ga0207671_10058480 3300025914 Unclassified 2858
657 Ga0207671_10098612 3300025914 Unclassified 2210
658 Ga0207671_10177748 3300025914 Unclassified 1655
659 Ga0207671_10598881 3300025914 Bacteria 878
660 Ga0207660_10327480 3300025917 Unclassified 1224
661 Ga0207660_11400909 3300025917 Unclassified 566
662 Ga0207662_10003999 3300025918 Bacteria 7682
663 Ga0207662_10008041 3300025918 Bacteria 5756
664 Ga0207662_10385984 3300025918 Bacteria 947
665 Ga0207662_10613566 3300025918 Unclassified 758
666 Ga0207649_10035097 3300025920 Bacteria 3011
667 Ga0207649_10460819 3300025920 Bacteria 961
668 Ga0207652_10130898 3300025921 Bacteria 2238
669 Ga0207652_10741916 3300025921 Unclassified 874
670 Ga0207646_10029914 3300025922 Bacteria 4944
671 Ga0207646_10200587 3300025922 Bacteria 1802
672 Ga0207646_10572822 3300025922 Bacteria 1014
673 Ga0207646_10599873 3300025922 Unclassified 988
674 Ga0207681_10000428 3300025923 Bacteria 29304
675 Ga0207681_10058913 3300025923 Bacteria 2631
676 Ga0207681_10155173 3300025923 Unclassified 1720
677 Ga0207681_10282414 3300025923 Unclassified 1307
678 Ga0207681_10354506 3300025923 Bacteria 1175
679 Ga0207681_10479387 3300025923 Bacteria 1016
680 Ga0207681_10606531 3300025923 Unclassified 905
681 Ga0207681_10804014 3300025923 Unclassified 785
682 Ga0207681_11231990 3300025923 Unclassified 629
683 Ga0207694_10032355 3300025924 Unclassified 4003
684 Ga0207694_10899313 3300025924 Unclassified 749
685 Ga0207650_10000001 3300025925 Bacteria 1545726
686 Ga0207650_10001704 3300025925 Bacteria 15617
687 Ga0207650_10063733 3300025925 Bacteria 2757
688 Ga0207650_10216831 3300025925 Bacteria 1539
689 Ga0207650_10557791 3300025925 Bacteria 961
690 Ga0207650_10641149 3300025925 Bacteria 895
691 Ga0207650_10687307 3300025925 Unclassified 864
692 Ga0207650_10943325 3300025925 Bacteria 733
693 Ga0207650_11320080 3300025925 Unclassified 614
694 Ga0207659_10128702 3300025926 Bacteria 1951
695 Ga0207659_10172431 3300025926 Bacteria 1707
696 Ga0207659_10232456 3300025926 Unclassified 1488
697 Ga0207659_10237442 3300025926 Bacteria 1473
698 Ga0207659_10476543 3300025926 Unclassified 1054
699 Ga0207659_10707251 3300025926 Bacteria 863
700 Ga0207687_10805985 3300025927 Bacteria 801
701 Ga0207687_10946317 3300025927 Bacteria 738
702 Ga0207687_11534639 3300025927 Unclassified 572
703 Ga0207644_10016817 3300025931 Unclassified 4927
704 Ga0207644_10175879 3300025931 Unclassified 1674
705 Ga0207644_10296843 3300025931 Bacteria 1301
706 Ga0207690_10550433 3300025932 Unclassified 938
707 Ga0207706_10119607 3300025933 Bacteria 2316
708 Ga0207706_10152083 3300025933 Bacteria 2035
709 Ga0207706_10332994 3300025933 Bacteria 1321
710 Ga0207706_10461217 3300025933 Unclassified 1099
711 Ga0207706_10743602 3300025933 Unclassified 836
712 Ga0207686_10269800 3300025934 Unclassified 1251
713 Ga0207686_10308149 3300025934 Unclassified 1178
714 Ga0207709_10009935 3300025935 Bacteria 5240
715 Ga0207709_10163778 3300025935 Unclassified 1554
716 Ga0207709_10190194 3300025935 Unclassified 1457
717 Ga0207709_10363425 3300025935 Bacteria 1096
718 Ga0207709_10501379 3300025935 Unclassified 947
719 Ga0207709_10803704 3300025935 Bacteria 759
720 Ga0207709_11385677 3300025935 Unclassified 582
721 Ga0207670_10003418 3300025936 Bacteria 8427
722 Ga0207670_10198793 3300025936 Unclassified 1522
723 Ga0207670_10253654 3300025936 Unclassified 1361
724 Ga0207670_10384688 3300025936 Bacteria 1118
725 Ga0207670_10916367 3300025936 Unclassified 735
726 Ga0207670_11044450 3300025936 Unclassified 688
727 Ga0207670_11066729 3300025936 Unclassified 681
728 Ga0207669_10147748 3300025937 Bacteria 1642
729 Ga0207704_10043235 3300025938 Bacteria 2658
730 Ga0207704_10284319 3300025938 Unclassified 1259
731 Ga0207704_10503622 3300025938 Unclassified 976
732 Ga0207704_11044273 3300025938 Unclassified 693
733 Ga0207704_11363850 3300025938 Unclassified 607
734 Ga0207691_10047107 3300025940 Bacteria 3958
735 Ga0207691_10060123 3300025940 Bacteria 3454
736 Ga0207691_10367169 3300025940 Bacteria 1230
737 Ga0207691_10927578 3300025940 Unclassified 728
738 Ga0207691_11308473 3300025940 Unclassified 598
739 Ga0207711_10013634 3300025941 Bacteria 6751
740 Ga0207711_10015352 3300025941 Bacteria 6356
741 Ga0207711_10076895 3300025941 Unclassified 2908
742 Ga0207711_10082859 3300025941 Bacteria 2804
743 Ga0207711_10184406 3300025941 Bacteria 1899
744 Ga0207711_10772195 3300025941 Bacteria 895
745 Ga0207689_10000986 3300025942 Bacteria 27294
746 Ga0207689_10033647 3300025942 Bacteria 4258
747 Ga0207689_10067771 3300025942 Unclassified 2933
748 Ga0207689_10067902 3300025942 Bacteria 2930
749 Ga0207689_10126998 3300025942 Bacteria 2098
750 Ga0207689_10320801 3300025942 Bacteria 1286
751 Ga0207689_10866498 3300025942 Bacteria 762
752 Ga0207689_10980089 3300025942 Unclassified 713
753 Ga0207661_10869739 3300025944 Unclassified 830
754 Ga0207679_10020984 3300025945 Bacteria 4420
755 Ga0207679_10241735 3300025945 Bacteria 1530
756 Ga0207679_10404006 3300025945 Unclassified 1202
757 Ga0207679_10409259 3300025945 Bacteria 1195
758 Ga0207679_10614995 3300025945 Bacteria 980
759 Ga0207679_10649428 3300025945 Unclassified 954
760 Ga0207679_10855401 3300025945 Unclassified 831
761 Ga0207667_11844196 3300025949 Unclassified 568
762 Ga0207651_10139337 3300025960 Bacteria 1871
763 Ga0207651_10215743 3300025960 Bacteria 1548
764 Ga0207651_10277461 3300025960 Unclassified 1383
765 Ga0207651_10745919 3300025960 Unclassified 865
766 Ga0207712_10000022 3300025961 Bacteria 284365
767 Ga0207712_10079374 3300025961 Bacteria 2384
768 Ga0207712_10181959 3300025961 Unclassified 1652
769 Ga0207712_10324155 3300025961 Unclassified 1272
770 Ga0207712_10409449 3300025961 Bacteria 1142
771 Ga0207712_10468011 3300025961 Unclassified 1072
772 Ga0207668_10811369 3300025972 Unclassified 829
773 Ga0207640_10047255 3300025981 Bacteria 2775
774 Ga0207640_10100036 3300025981 Bacteria 2031
775 Ga0207640_10279333 3300025981 Bacteria 1311
776 Ga0207640_10296511 3300025981 Bacteria 1277
777 Ga0207640_10743839 3300025981 Unclassified 845
778 Ga0207658_10167670 3300025986 Unclassified 1806
779 Ga0207658_10169305 3300025986 Bacteria 1798
780 Ga0207677_10009473 3300026023 Bacteria 5482
781 Ga0207677_10084605 3300026023 Bacteria 2287
782 Ga0207677_10692936 3300026023 Bacteria 903
783 Ga0207703_10064754 3300026035 Unclassified 3001
784 Ga0207703_10128217 3300026035 Unclassified 2187
785 Ga0207703_11049639 3300026035 Unclassified 782
786 Ga0207703_11066295 3300026035 Unclassified 776
787 Ga0207639_10072676 3300026041 Bacteria 2694
788 Ga0207639_10074660 3300026041 Bacteria 2663
789 Ga0207639_10154386 3300026041 Bacteria 1926
790 Ga0207678_10936053 3300026067 Unclassified 766
791 Ga0207708_10000061 3300026075 Bacteria 92741
792 Ga0207708_10003905 3300026075 Bacteria 10970
793 Ga0207708_10011771 3300026075 Bacteria 6519
794 Ga0207708_10017238 3300026075 Bacteria 5436
795 Ga0207708_10047707 3300026075 Bacteria 3260
796 Ga0207708_10079676 3300026075 Bacteria 2516
797 Ga0207708_10124313 3300026075 Unclassified 2012
798 Ga0207708_10559911 3300026075 Unclassified 965
799 Ga0207702_10177755 3300026078 Bacteria 1957
800 Ga0207641_10021456 3300026088 Bacteria 5307
801 Ga0207641_10044331 3300026088 Bacteria 3741
802 Ga0207641_10075946 3300026088 Unclassified 2903
803 Ga0207641_10088733 3300026088 Bacteria 2701
804 Ga0207641_10216868 3300026088 Bacteria 1772
805 Ga0207641_10407544 3300026088 Unclassified 1306
806 Ga0207641_10751353 3300026088 Unclassified 963
807 Ga0207641_11097964 3300026088 Unclassified 794
808 Ga0207648_10001908 3300026089 Bacteria 22765
809 Ga0207648_10130644 3300026089 Unclassified 2211
810 Ga0207648_10134137 3300026089 Bacteria 2180
811 Ga0207648_11048559 3300026089 Unclassified 764
812 Ga0207648_11601862 3300026089 Unclassified 612
813 Ga0207676_10016632 3300026095 Bacteria 5327
814 Ga0207676_10030471 3300026095 Bacteria 4050
815 Ga0207676_10092309 3300026095 Bacteria 2489
816 Ga0207676_10095588 3300026095 Archaea 2451
817 Ga0207676_10174782 3300026095 Bacteria 1874
818 Ga0207676_10290512 3300026095 Unclassified 1488
819 Ga0207676_10320870 3300026095 Bacteria 1422
820 Ga0207676_10505199 3300026095 Bacteria 1148
821 Ga0207676_10598868 3300026095 Bacteria 1058
822 Ga0207676_10734979 3300026095 Bacteria 959
823 Ga0207676_10886295 3300026095 Bacteria 874
824 Ga0207676_10902602 3300026095 Bacteria 867
825 Ga0207676_10965472 3300026095 Unclassified 838
826 Ga0207676_11015304 3300026095 Unclassified 818
827 Ga0207674_10000192 3300026116 Bacteria 75255
828 Ga0207674_10062925 3300026116 Unclassified 3747
829 Ga0207674_10091041 3300026116 Unclassified 3041
830 Ga0207674_10109212 3300026116 Unclassified 2742
831 Ga0207674_10369663 3300026116 Bacteria 1386
832 Ga0207674_10844498 3300026116 Bacteria 883
833 Ga0207674_11112653 3300026116 Unclassified 759
834 Ga0207674_11655802 3300026116 Unclassified 608
835 Ga0207674_11984298 3300026116 Unclassified 547
836 Ga0207675_100014671 3300026118 Bacteria 7307
837 Ga0207675_100015208 3300026118 Bacteria 7178
838 Ga0207675_100068923 3300026118 Bacteria 3306
839 Ga0207675_100137528 3300026118 Bacteria 2319
840 Ga0207675_100151655 3300026118 Bacteria 2206
841 Ga0207675_100186991 3300026118 Bacteria 1986
842 Ga0207675_100336642 3300026118 Unclassified 1476
843 Ga0207675_100539154 3300026118 Bacteria 1165
844 Ga0207675_100625648 3300026118 Unclassified 1081
845 Ga0207675_100670158 3300026118 Unclassified 1044
846 Ga0207675_100721040 3300026118 Bacteria 1007
847 Ga0207675_100924764 3300026118 Bacteria 889
848 Ga0207675_101104144 3300026118 Bacteria 813
849 Ga0207683_10193041 3300026121 Bacteria 1849
850 Ga0207683_10249816 3300026121 Unclassified 1619
851 Ga0207683_10315731 3300026121 Unclassified 1431
852 Ga0207698_10105970 3300026142 Bacteria 2343
853 Ga0207698_10140659 3300026142 Bacteria 2079
854 Ga0207698_10308515 3300026142 Bacteria 1476
855 Ga0207698_10358001 3300026142 Bacteria 1381
856 Ga0207698_10708902 3300026142 Bacteria 1002
857 Ga0207428_10026938 3300027907 Bacteria 4789
858 Ga0207428_10071524 3300027907 Bacteria 2724
859 Ga0207428_10283238 3300027907 Unclassified 1230
860 Ga0207428_10491885 3300027907 Unclassified 891
861 Ga0268266_10075086 3300028379 Bacteria 2936
862 Ga0268266_11395527 3300028379 Unclassified 676
863 Ga0268265_10100036 3300028380 Bacteria 2339
864 Ga0268265_10135975 3300028380 Bacteria 2051
865 Ga0268265_10322505 3300028380 Bacteria 1400
866 Ga0268265_10475761 3300028380 Unclassified 1172
867 Ga0268265_10551586 3300028380 Bacteria 1094
868 Ga0268265_10756535 3300028380 Bacteria 943
869 Ga0268265_11547431 3300028380 Unclassified 667
870 Ga0268264_10006536 3300028381 Bacteria 9817
871 Ga0268264_10057568 3300028381 Unclassified 3251
872 Ga0268264_10058091 3300028381 Bacteria 3238
873 Ga0268264_10119034 3300028381 Unclassified 2325
874 Ga0268264_10177562 3300028381 Bacteria 1931
875 Ga0268264_10204039 3300028381 Unclassified 1810
876 Ga0268264_10278244 3300028381 Unclassified 1566
877 Ga0268264_10304717 3300028381 Unclassified 1501
878 Ga0268264_10743407 3300028381 Unclassified 977
879 Ga0307408_100249878 3300031548 Unclassified 1462
880 Ga0307408_100818120 3300031548 Unclassified 847
881 Ga0307405_11459476 3300031731 Unclassified 600
882 Ga0307413_10251320 3300031824 Bacteria 1312
883 Ga0307410_10409014 3300031852 Bacteria 1098
884 Ga0307412_10583142 3300031911 Unclassified 944
885 Ga0307412_11097708 3300031911 Unclassified 708
886 Ga0307409_100033275 3300031995 Unclassified 3750
887 Ga0307416_100210316 3300032002 Unclassified 1855
888 Ga0307416_100387319 3300032002 Bacteria 1430
889 Ga0307414_10238473 3300032004 Unclassified 1504
890 Ga0307414_10754802 3300032004 Unclassified 884
891 Ga0307411_10216827 3300032005 Bacteria 1482
892 Ga0307411_10677169 3300032005 Unclassified 896
893 Ga0307411_11787378 3300032005 Unclassified 570
894 Ga0307415_100155891 3300032126 Bacteria 1763
895 Ga0307415_100237548 3300032126 Unclassified 1472
896 Ga0307415_100250285 3300032126 Bacteria 1439
897 Ga0307415_100268670 3300032126 Bacteria 1396
898 Ga0373940_0219664 3300035088 Unclassified 631
899 Ga0373951_0003178 3300035091 Unclassified 4033
900 Ga0373942_0001683 3300035207 Bacteria 5610
901 Ga0373961_0256853 3300035241 Bacteria 634
902 Ga0373931_0351913 3300035691 Unclassified 922
903 Ga0373937_0076330 3300036401 Unclassified 3095
904 Ga0395900_0056945 3300037418 Bacteria 4024
905 Ga0395900_0163643 3300037418 Bacteria 2268
906 Ga0395900_0177050 3300037418 Bacteria 2169
907 Ga0395900_0338097 3300037418 Bacteria 1482
908 Ga0395900_0550887 3300037418 Unclassified 1098
909 Ga0395898_0341776 3300037466 Unclassified 1427
910 Ga0395901_0231048 3300038443 Bacteria 1931
911 Ga0395901_0428296 3300038443 Bacteria 1356
912 Ga0242419_007524 3300038698 Unclassified 804
913 Ga0439431_0099174 3300041997 Unclassified 799
914 Ga0439455_0008734 3300042012 Bacteria 2179
915 Ga0439458_0009743 3300042157 Unclassified 2139
916 Ga0451577_0910173 3300042876 Bacteria 792
917 Ga0451577_1644934 3300042876 Unclassified 566
918 Ga0451576_0845476 3300045051 Unclassified 961
919 Ga0495582_0134736 3300046473 Unclassified 1397
920 Ga0495620_0208669 3300046515 Unclassified 750
921 Ga0495663_0000123 3300046525 Bacteria 32150
922 Ga0495598_0000081 3300046537 Bacteria 15622
923 Ga0495621_0000084 3300046539 Bacteria 19306
924 Ga0495668_0083344 3300046616 Unclassified 1754
925 Ga0495625_0278567 3300046660 Bacteria 1077
926 Ga0495658_0092964 3300046683 Unclassified 1789
927 Ga0495672_0049690 3300047320 Bacteria 2481
928 Ga0495677_0238481 3300047445 Unclassified 710
929 Ga0496102_0017178 3300048905 Bacteria 6336
930 Ga0496102_0364345 3300048905 Bacteria 1361
931 Ga0496104_0466631 3300048907 Bacteria 1174
932 Ga0496104_1119724 3300048907 Bacteria 691
933 Ga0496106_0059689 3300048909 Bacteria 2890
934 Ga0496106_0083993 3300048909 Bacteria 2449
935 Ga0496108_0314066 3300048911 Unclassified 1366
936 Ga0496108_0849964 3300048911 Unclassified 785
937 Ga0496109_0588341 3300048912 Unclassified 1049
938 Ga0496109_0825548 3300048912 Unclassified 865
939 Ga0496109_1367692 3300048912 Bacteria 644
940 Ga0496110_0200101 3300048913 Bacteria 1815
941 Ga0496110_0493001 3300048913 Bacteria 1116
942 Ga0496111_0379224 3300048914 Unclassified 1046
943 Ga0496112_0124296 3300048915 Bacteria 2551
944 Ga0496112_0232018 3300048915 Unclassified 1800
945 Ga0496112_0289181 3300048915 Bacteria 1585
946 Ga0496112_0322164 3300048915 Bacteria 1490
947 Ga0496112_0353615 3300048915 Unclassified 1411
948 Ga0496112_0524628 3300048915 Unclassified 1119
949 Ga0496112_0946015 3300048915 Archaea 783
950 Ga0496112_1217422 3300048915 Bacteria 670
951 Ga0496113_0044188 3300048916 Unclassified 3300
952 Ga0496113_0085652 3300048916 Unclassified 2421
953 Ga0501290_008692 3300049513 Bacteria 1287
954 Ga0501291_006100 3300049514 Unclassified 1597
955 Ga0501291_026577 3300049514 Unclassified 954
956 Ga0501292_006230 3300049515 Unclassified 1688
957 Ga0501294_007750 3300049517 Unclassified 1039
958 Ga0501296_000186 3300049519 Bacteria 6568
959 Ga0501297_000526 3300049520 Unclassified 3450
960 Ga0501297_022777 3300049520 Bacteria 793
961 Ga0501298_007749 3300049521 Unclassified 1788
962 Ga0501299_000948 3300049522 Unclassified 3588
963 Ga0501299_006165 3300049522 Bacteria 1873
964 Ga0501299_012388 3300049522 Unclassified 1454
965 Ga0501301_018947 3300049524 Unclassified 646
966 Ga0501038_0007200 3300049574 Bacteria 10280
967 Ga0501075_0340260 3300049591 Bacteria 1143
968 Ga0501198_028644 3300049649 Unclassified 920
969 Ga0501198_068401 3300049649 Unclassified 665
970 Ga0501202_020467 3300049652 Unclassified 1315
971 Ga0501202_024105 3300049652 Unclassified 1232
972 Ga0501202_076030 3300049652 Unclassified 781
973 Ga0501206_018915 3300049653 Unclassified 973
974 Ga0501216_003648 3300049660 Unclassified 2257
975 Ga0501216_019821 3300049660 Bacteria 1170
976 Ga0501216_036119 3300049660 Unclassified 931
977 Ga0501216_037190 3300049660 Bacteria 920
978 Ga0501217_026126 3300049661 Bacteria 1409
979 Ga0501217_037540 3300049661 Bacteria 1220
980 Ga0501223_016094 3300049663 Bacteria 1479
981 Ga0501224_005508 3300049664 Bacteria 1816
982 Ga0501224_039528 3300049664 Unclassified 713
983 Ga0501230_147204 3300049667 Unclassified 533
984 Ga0501233_010910 3300049668 Unclassified 1799
985 Ga0501235_012410 3300049669 Bacteria 1874
986 Ga0501235_016418 3300049669 Unclassified 1635
987 Ga0501236_030478 3300049670 Unclassified 851
988 Ga0501236_140037 3300049670 Unclassified 505
989 Ga0501239_006013 3300049672 Bacteria 1236
990 Ga0501249_012607 3300049679 Bacteria 1788
991 Ga0501249_113967 3300049679 Unclassified 655
992 Ga0501249_116063 3300049679 Bacteria 650
993 Ga0501250_001385 3300049680 Bacteria 1978
994 Ga0501251_023260 3300049681 Unclassified 838
995 Ga0501253_021611 3300049683 Unclassified 1136
996 Ga0501260_006938 3300049689 Unclassified 1097
997 Ga0501260_007902 3300049689 Bacteria 1042
998 Ga0501260_013423 3300049689 Unclassified 845
999 Ga0501221_187444 3300049704 Unclassified 569
1000 Ga0501225_0003895 3300049705 Bacteria 4470
1001 Ga0501225_0016539 3300049705 Unclassified 2052
1002 Ga0501225_0017575 3300049705 Bacteria 1985
1003 Ga0501225_0050947 3300049705 Unclassified 1153
1004 Ga0501229_004125 3300049706 Bacteria 1759
1005 Ga0501229_019004 3300049706 Unclassified 904
1006 Ga0501234_026874 3300049707 Bacteria 924
1007 Ga0501234_082537 3300049707 Unclassified 568
1008 Ga0501245_004655 3300049708 Bacteria 1888
1009 Ga0501245_005544 3300049708 Unclassified 1750
1010 Ga0501245_055822 3300049708 Unclassified 711
1011 Ga0501263_020496 3300049760 Bacteria 887
1012 Ga0501264_004315 3300049761 Unclassified 1289
1013 Ga0501265_007485 3300049762 Unclassified 1287
1014 Ga0501268_057442 3300049765 Bacteria 765
1015 Ga0501269_017992 3300049766 Unclassified 875
1016 Ga0501271_031811 3300049768 Unclassified 655
1017 Ga0501272_007445 3300049769 Bacteria 1186
1018 Ga0501273_049801 3300049770 Unclassified 638
1019 Ga0501274_001355 3300049771 Unclassified 1865
1020 Ga0501275_084120 3300049772 Unclassified 520
1021 Ga0501278_003167 3300049774 Bacteria 1163
1022 Ga0501282_040751 3300049778 Unclassified 554
1023 Ga0501283_006164 3300049779 Unclassified 1670
1024 Ga0501283_012153 3300049779 Bacteria 1291
1025 Ga0501212_011401 3300049851 Unclassified 1280
1026 Ga0501226_013419 3300049853 Unclassified 905
1027 nmdc:mga05p37_101353_c1 3300050507 Bacteria 3546
1028 nmdc:mga05p37_1593869_c1 3300050507 Unclassified 644
1029 nmdc:mga05p37_338829_c1 3300050507 Bacteria 1774
1030 nmdc:mga05p37_368157_c1 3300050507 Bacteria 1687
1031 nmdc:mga05p37_930106_c1 3300050507 Archaea 933
1032 nmdc:mga09592_144706_c1 3300050508 Bacteria 2049
1033 nmdc:mga09592_1472985_c1 3300050508 Unclassified 555
1034 nmdc:mga0qj67_353864_c1 3300050509 Unclassified 1187
1035 nmdc:mga0qj67_48770_c1 3300050509 Bacteria 3346
1036 nmdc:mga06r32_151961_c1 3300050510 Bacteria 2294
1037 nmdc:mga06r32_70656_c1 3300050510 Bacteria 3377
1038 nmdc:mga08y16_172612_c1 3300050511 Bacteria 2246
1039 nmdc:mga08y16_436742_c1 3300050511 Bacteria 1337
1040 nmdc:mga08y16_58197_c1 3300050511 Bacteria 4038
1041 nmdc:mga08y16_844037_c1 3300050511 Unclassified 906
1042 nmdc:mga0n895_169326_c1 3300050512 Unclassified 2216
1043 nmdc:mga0n895_2218011_c1 3300050512 Unclassified 504
1044 nmdc:mga0n895_48686_c1 3300050512 Bacteria 4150
1045 nmdc:mga0rr50_24584_c1 3300050513 Bacteria 4174
1046 nmdc:mga0rr50_845755_c1 3300050513 Unclassified 780
1047 nmdc:mga08x19_3718_c1 3300050514 Bacteria 9084
1048 nmdc:mga0a205_124443_c1 3300050515 Unclassified 2478
1049 nmdc:mga0a205_231286_c1 3300050515 Unclassified 1732
1050 nmdc:mga0a205_233499_c1 3300050515 Unclassified 1722
1051 nmdc:mga0a205_240041_c1 3300050515 Bacteria 1693
1052 nmdc:mga0a205_251725_c1 3300050515 Bacteria 1646
1053 nmdc:mga0a205_267826_c1 3300050515 Bacteria 1586
1054 nmdc:mga0a205_27719_c2 3300050515 Bacteria 4446
1055 nmdc:mga0a205_610558_c1 3300050515 Unclassified 943
1056 nmdc:mga0a205_6874_c1 3300050515 Bacteria 5707
1057 nmdc:mga0a205_712717_c1 3300050515 Unclassified 853
1058 nmdc:mga0a205_991763_c1 3300050515 Unclassified 687
1059 Ga0501084_0253607 3300054114 Bacteria 1485
1060 Ga0530510_1190407 3300061734 Bacteria 584

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005337 Ga0070682_100006511 Ga0070682_1000065117 133
2 3300005338 Ga0068868_100198035 Ga0068868_1001980352 133
3 3300005345 Ga0070692_10098348 Ga0070692_100983482 133
4 3300005366 Ga0070659_100652277 Ga0070659_1006522772 133
5 3300005406 Ga0070703_10013066 Ga0070703_100130662 133
6 3300005440 Ga0070705_100435808 Ga0070705_1004358082 133
7 3300005444 Ga0070694_100063279 Ga0070694_1000632793 133
8 3300005545 Ga0070695_100109706 Ga0070695_1001097062 133
9 3300005547 Ga0070693_100000305 Ga0070693_10000030517 133
10 3300005549 Ga0070704_100044294 Ga0070704_1000442943 133
11 3300005615 Ga0070702_100222670 Ga0070702_1002226702 133
12 3300005616 Ga0068852_100145754 Ga0068852_1001457542 133
13 3300005617 Ga0068859_100032266 Ga0068859_1000322666 133
14 3300005834 Ga0068851_10011958 Ga0068851_100119583 133
15 3300005842 Ga0068858_100052748 Ga0068858_1000527484 133
16 3300006931 Ga0097620_100032266 Ga0097620_1000322662 133
17 3300009545 Ga0105237_10004213 Ga0105237_1000421312 133
18 3300025885 Ga0207653_10010901 Ga0207653_100109013 133
19 3300025904 Ga0207647_10167431 Ga0207647_101674312 133
20 3300025914 Ga0207671_10006170 Ga0207671_100061708 133
21 3300026023 Ga0207677_10084605 Ga0207677_100846053 133
22 3300026035 Ga0207703_10064754 Ga0207703_100647543 133
23 3300048916 Ga0496113_0044188 Ga0496113_0044188_2294_2728 133
24 3300003322 rootL2_10229176 rootL2_102291763 137
25 3300005337 Ga0070682_100000051 Ga0070682_10000005158 137
26 3300005364 Ga0070673_101620656 Ga0070673_1016206561 137
27 3300013308 Ga0157375_11760246 Ga0157375_117602461 137
28 3300025925 Ga0207650_10641149 Ga0207650_106411492 137
29 3300025926 Ga0207659_10128702 Ga0207659_101287022 137
30 3300025935 Ga0207709_10803704 Ga0207709_108037041 137
31 3300025960 Ga0207651_10745919 Ga0207651_107459192 137
32 3300002076 JGI24749J21850_1023508 JGI24749J21850_10235082 138
33 3300002459 JGI24751J29686_10000107 JGI24751J29686_100001075 138
34 3300003203 JGI25406J46586_10026276 JGI25406J46586_100262763 138
35 3300005289 Ga0065704_10393606 Ga0065704_103936062 138
36 3300005290 Ga0065712_10002294 Ga0065712_100022944 138
37 3300005293 Ga0065715_10100976 Ga0065715_101009762 138
38 3300005293 Ga0065715_10123838 Ga0065715_101238382 138
39 3300005293 Ga0065715_10310441 Ga0065715_103104411 138
40 3300005295 Ga0065707_10340592 Ga0065707_103405921 138
41 3300005330 Ga0070690_101080185 Ga0070690_1010801851 138
42 3300005331 Ga0070670_100001037 Ga0070670_10000103715 138
43 3300005331 Ga0070670_100017767 Ga0070670_1000177674 138
44 3300005334 Ga0068869_101906008 Ga0068869_1019060081 138
45 3300005343 Ga0070687_100870944 Ga0070687_1008709441 138
46 3300005344 Ga0070661_100938070 Ga0070661_1009380701 138
47 3300005345 Ga0070692_10237931 Ga0070692_102379312 138
48 3300005345 Ga0070692_10450274 Ga0070692_104502742 138
49 3300005354 Ga0070675_100532517 Ga0070675_1005325172 138
50 3300005356 Ga0070674_100879921 Ga0070674_1008799212 138
51 3300005364 Ga0070673_101494164 Ga0070673_1014941641 138
52 3300005366 Ga0070659_100061476 Ga0070659_1000614761 138
53 3300005438 Ga0070701_10032396 Ga0070701_100323964 138
54 3300005441 Ga0070700_100035616 Ga0070700_1000356164 138
55 3300005444 Ga0070694_100330415 Ga0070694_1003304151 138
56 3300005444 Ga0070694_101269899 Ga0070694_1012698992 138
57 3300005459 Ga0068867_100252513 Ga0068867_1002525132 138
58 3300005466 Ga0070685_11297953 Ga0070685_112979531 138
59 3300005539 Ga0068853_100315269 Ga0068853_1003152692 138
60 3300005546 Ga0070696_100865349 Ga0070696_1008653491 138
61 3300005547 Ga0070693_100078078 Ga0070693_1000780783 138
62 3300005549 Ga0070704_100688425 Ga0070704_1006884252 138
63 3300005564 Ga0070664_100125031 Ga0070664_1001250312 138
64 3300005564 Ga0070664_100192721 Ga0070664_1001927212 138
65 3300005577 Ga0068857_100067092 Ga0068857_1000670921 138
66 3300005578 Ga0068854_101356184 Ga0068854_1013561842 138
67 3300005615 Ga0070702_100322854 Ga0070702_1003228542 138
68 3300005617 Ga0068859_100069646 Ga0068859_1000696464 138
69 3300005617 Ga0068859_100091632 Ga0068859_1000916323 138
70 3300005617 Ga0068859_100264536 Ga0068859_1002645362 138
71 3300005617 Ga0068859_100306733 Ga0068859_1003067332 138
72 3300005617 Ga0068859_100771954 Ga0068859_1007719542 138
73 3300005617 Ga0068859_100918069 Ga0068859_1009180692 138
74 3300005618 Ga0068864_100632611 Ga0068864_1006326112 138
75 3300005718 Ga0068866_10113348 Ga0068866_101133482 138
76 3300005719 Ga0068861_100010957 Ga0068861_1000109578 138
77 3300005840 Ga0068870_10096885 Ga0068870_100968852 138
78 3300005840 Ga0068870_10512172 Ga0068870_105121721 138
79 3300005841 Ga0068863_102645650 Ga0068863_1026456501 138
80 3300005842 Ga0068858_100313763 Ga0068858_1003137632 138
81 3300005842 Ga0068858_100502341 Ga0068858_1005023411 138
82 3300005843 Ga0068860_100095569 Ga0068860_1000955694 138
83 3300005843 Ga0068860_100164402 Ga0068860_1001644023 138
84 3300005844 Ga0068862_101720658 Ga0068862_1017206582 138
85 3300005985 Ga0081539_10000067 Ga0081539_10000067130 138
86 3300006237 Ga0097621_100743033 Ga0097621_1007430332 138
87 3300006871 Ga0075434_100837926 Ga0075434_1008379262 138
88 3300006881 Ga0068865_100720682 Ga0068865_1007206822 138
89 3300006931 Ga0097620_100069647 Ga0097620_1000696474 138
90 3300006931 Ga0097620_100091625 Ga0097620_1000916253 138
91 3300006931 Ga0097620_100264532 Ga0097620_1002645322 138
92 3300006931 Ga0097620_100306736 Ga0097620_1003067362 138
93 3300006931 Ga0097620_100771979 Ga0097620_1007719792 138
94 3300006931 Ga0097620_100918037 Ga0097620_1009180372 138
95 3300009011 Ga0105251_10457182 Ga0105251_104571822 138
96 3300009092 Ga0105250_10135033 Ga0105250_101350332 138
97 3300009101 Ga0105247_10013105 Ga0105247_100131052 138
98 3300009101 Ga0105247_10020829 Ga0105247_100208292 138
99 3300009148 Ga0105243_10122873 Ga0105243_101228733 138
100 3300009174 Ga0105241_11006207 Ga0105241_110062072 138
101 3300009176 Ga0105242_10088270 Ga0105242_100882704 138
102 3300009176 Ga0105242_11577363 Ga0105242_115773632 138
103 3300009177 Ga0105248_10087616 Ga0105248_100876165 138
104 3300009177 Ga0105248_10428889 Ga0105248_104288892 138
105 3300009545 Ga0105237_10117960 Ga0105237_101179604 138
106 3300009551 Ga0105238_10064038 Ga0105238_100640382 138
107 3300009553 Ga0105249_10066785 Ga0105249_100667854 138
108 3300010375 Ga0105239_12145922 Ga0105239_121459222 138
109 3300010375 Ga0105239_12212756 Ga0105239_122127562 138
110 3300011119 Ga0105246_11858765 Ga0105246_118587652 138
111 3300013306 Ga0163162_10670436 Ga0163162_106704361 138
112 3300013306 Ga0163162_13026378 Ga0163162_130263781 138
113 3300014325 Ga0163163_10000183 Ga0163163_1000018337 138
114 3300014325 Ga0163163_10578035 Ga0163163_105780352 138
115 3300014325 Ga0163163_10793545 Ga0163163_107935452 138
116 3300014326 Ga0157380_10963826 Ga0157380_109638262 138
117 3300014968 Ga0157379_10142071 Ga0157379_101420713 138
118 3300014968 Ga0157379_10449365 Ga0157379_104493652 138
119 3300025315 Ga0207697_10383768 Ga0207697_103837682 138
120 3300025900 Ga0207710_10003825 Ga0207710_100038252 138
121 3300025901 Ga0207688_10821881 Ga0207688_108218812 138
122 3300025904 Ga0207647_10132344 Ga0207647_101323443 138
123 3300025911 Ga0207654_10002853 Ga0207654_100028531 138
124 3300025911 Ga0207654_10077227 Ga0207654_100772272 138
125 3300025914 Ga0207671_10098612 Ga0207671_100986122 138
126 3300025914 Ga0207671_10598881 Ga0207671_105988812 138
127 3300025920 Ga0207649_10460819 Ga0207649_104608192 138
128 3300025921 Ga0207652_10741916 Ga0207652_107419162 138
129 3300025923 Ga0207681_11231990 Ga0207681_112319901 138
130 3300025924 Ga0207694_10032355 Ga0207694_100323554 138
131 3300025925 Ga0207650_10000001 Ga0207650_10000001515 138
132 3300025925 Ga0207650_10943325 Ga0207650_109433252 138
133 3300025926 Ga0207659_10172431 Ga0207659_101724312 138
134 3300025933 Ga0207706_10743602 Ga0207706_107436022 138
135 3300025934 Ga0207686_10269800 Ga0207686_102698001 138
136 3300025935 Ga0207709_10163778 Ga0207709_101637783 138
137 3300025938 Ga0207704_10503622 Ga0207704_105036222 138
138 3300025940 Ga0207691_11308473 Ga0207691_113084731 138
139 3300025941 Ga0207711_10082859 Ga0207711_100828592 138
140 3300025941 Ga0207711_10184406 Ga0207711_101844062 138
141 3300025942 Ga0207689_10866498 Ga0207689_108664982 138
142 3300025945 Ga0207679_10614995 Ga0207679_106149951 138
143 3300025961 Ga0207712_10181959 Ga0207712_101819593 138
144 3300025961 Ga0207712_10468011 Ga0207712_104680112 138
145 3300025981 Ga0207640_10743839 Ga0207640_107438392 138
146 3300026035 Ga0207703_11066295 Ga0207703_110662952 138
147 3300026067 Ga0207678_10936053 Ga0207678_109360531 138
148 3300026075 Ga0207708_10017238 Ga0207708_100172384 138
149 3300026089 Ga0207648_11048559 Ga0207648_110485592 138
150 3300026095 Ga0207676_11015304 Ga0207676_110153042 138
151 3300026116 Ga0207674_10369663 Ga0207674_103696632 138
152 3300026116 Ga0207674_10844498 Ga0207674_108444982 138
153 3300026116 Ga0207674_11655802 Ga0207674_116558022 138
154 3300026118 Ga0207675_100015208 Ga0207675_1000152087 138
155 3300026118 Ga0207675_100539154 Ga0207675_1005391541 138
156 3300026118 Ga0207675_100625648 Ga0207675_1006256482 138
157 3300026142 Ga0207698_10140659 Ga0207698_101406593 138
158 3300026142 Ga0207698_10708902 Ga0207698_107089022 138
159 3300028380 Ga0268265_10475761 Ga0268265_104757612 138
160 3300028381 Ga0268264_10119034 Ga0268264_101190342 138
161 3300028381 Ga0268264_10278244 Ga0268264_102782442 138
162 3300028381 Ga0268264_10304717 Ga0268264_103047172 138
163 3300032004 Ga0307414_10754802 Ga0307414_107548022 138
164 3300032005 Ga0307411_11787378 Ga0307411_117873782 138
165 3300032126 Ga0307415_100237548 Ga0307415_1002375482 138
166 3300035207 Ga0373942_0001683 Ga0373942_0001683_3361_3789 138
167 3300035241 Ga0373961_0256853 Ga0373961_0256853_196_624 138
168 3300038698 Ga0242419_007524 Ga0242419_007524_292_708 138
169 3300048909 Ga0496106_0083993 Ga0496106_0083993_1469_1885 138
170 3300048911 Ga0496108_0849964 Ga0496108_0849964_212_628 138
171 3300048912 Ga0496109_0588341 Ga0496109_0588341_392_808 138
172 3300048915 Ga0496112_0124296 Ga0496112_0124296_508_924 138
173 3300048915 Ga0496112_0353615 Ga0496112_0353615_188_604 138
174 3300049679 Ga0501249_113967 Ga0501249_113967_17_445 138
175 3300049704 Ga0501221_187444 Ga0501221_187444_59_487 138
176 3300049705 Ga0501225_0050947 Ga0501225_0050947_695_1123 138
177 3300005293 Ga0065715_10007562 Ga0065715_100075622 139
178 3300005334 Ga0068869_100393077 Ga0068869_1003930772 139
179 3300005353 Ga0070669_101210195 Ga0070669_1012101952 139
180 3300005356 Ga0070674_100362285 Ga0070674_1003622852 139
181 3300005364 Ga0070673_100082896 Ga0070673_1000828963 139
182 3300005438 Ga0070701_11381406 Ga0070701_113814061 139
183 3300005440 Ga0070705_100052194 Ga0070705_1000521943 139
184 3300005458 Ga0070681_10008066 Ga0070681_1000806611 139
185 3300005467 Ga0070706_100000097 Ga0070706_10000009727 139
186 3300005468 Ga0070707_100861749 Ga0070707_1008617492 139
187 3300005545 Ga0070695_100141530 Ga0070695_1001415302 139
188 3300005546 Ga0070696_100276096 Ga0070696_1002760962 139
189 3300005547 Ga0070693_100066277 Ga0070693_1000662772 139
190 3300005549 Ga0070704_100087485 Ga0070704_1000874852 139
191 3300005577 Ga0068857_100909935 Ga0068857_1009099352 139
192 3300005615 Ga0070702_100122575 Ga0070702_1001225752 139
193 3300005618 Ga0068864_101035380 Ga0068864_1010353802 139
194 3300005719 Ga0068861_102058976 Ga0068861_1020589761 139
195 3300005841 Ga0068863_100130818 Ga0068863_1001308184 139
196 3300005843 Ga0068860_100061511 Ga0068860_1000615113 139
197 3300006852 Ga0075433_10371980 Ga0075433_103719802 139
198 3300009094 Ga0111539_10545040 Ga0111539_105450402 139
199 3300013102 Ga0157371_10256321 Ga0157371_102563212 139
200 3300014326 Ga0157380_10523085 Ga0157380_105230851 139
201 3300014745 Ga0157377_10580414 Ga0157377_105804141 139
202 3300025908 Ga0207643_10217564 Ga0207643_102175643 139
203 3300025910 Ga0207684_10000023 Ga0207684_10000023154 139
204 3300025912 Ga0207707_10003187 Ga0207707_100031878 139
205 3300025914 Ga0207671_10058480 Ga0207671_100584802 139
206 3300025923 Ga0207681_10606531 Ga0207681_106065312 139
207 3300025925 Ga0207650_10687307 Ga0207650_106873072 139
208 3300025942 Ga0207689_10033647 Ga0207689_100336475 139
209 3300026035 Ga0207703_11049639 Ga0207703_110496391 139
210 3300026088 Ga0207641_10075946 Ga0207641_100759463 139
211 3300026095 Ga0207676_10095588 Ga0207676_100955881 139
212 3300026095 Ga0207676_10734979 Ga0207676_107349792 139
213 3300026118 Ga0207675_100924764 Ga0207675_1009247642 139
214 3300027907 Ga0207428_10491885 Ga0207428_104918851 139
215 3300028381 Ga0268264_10177562 Ga0268264_101775623 139
216 3300031731 Ga0307405_11459476 Ga0307405_114594761 139
217 3300037418 Ga0395900_0056945 Ga0395900_0056945_1996_2415 139
218 3300038443 Ga0395901_0231048 Ga0395901_0231048_872_1291 139
219 3300048905 Ga0496102_0364345 Ga0496102_0364345_567_986 139
220 3300048912 Ga0496109_1367692 Ga0496109_1367692_156_575 139
221 3300050511 nmdc:mga08y16_844037_c1 nmdc:mga08y16_844037_c1_139_561 139
222 3300050515 nmdc:mga0a205_610558_c1 nmdc:mga0a205_610558_c1_66_485 139
223 3300000546 LJNas_1024266 LJNas_10242662 140
224 3300005347 Ga0070668_100003898 Ga0070668_1000038988 140
225 3300005444 Ga0070694_100014362 Ga0070694_1000143624 140
226 3300005459 Ga0068867_100266958 Ga0068867_1002669582 140
227 3300005545 Ga0070695_100083928 Ga0070695_1000839283 140
228 3300005548 Ga0070665_100366628 Ga0070665_1003666282 140
229 3300006931 Ga0097620_100136599 Ga0097620_1001365995 140
230 3300009148 Ga0105243_10790024 Ga0105243_107900242 140
231 3300009148 Ga0105243_10825810 Ga0105243_108258102 140
232 3300009553 Ga0105249_10001351 Ga0105249_1000135116 140
233 3300011119 Ga0105246_10121618 Ga0105246_101216182 140
234 3300013306 Ga0163162_10001516 Ga0163162_1000151616 140
235 3300014326 Ga0157380_11338208 Ga0157380_113382082 140
236 3300025935 Ga0207709_11385677 Ga0207709_113856771 140
237 3300025936 Ga0207670_10253654 Ga0207670_102536541 140
238 3300025961 Ga0207712_10000022 Ga0207712_10000022198 140
239 3300026116 Ga0207674_10109212 Ga0207674_101092122 140
240 3300047320 Ga0495672_0049690 Ga0495672_0049690_1601_2038 140
241 3300050507 nmdc:mga05p37_1593869_c1 nmdc:mga05p37_1593869_c1_104_526 140
242 3300005293 Ga0065715_10584042 Ga0065715_105840422 141
243 3300005444 Ga0070694_100167011 Ga0070694_1001670112 141
244 3300005445 Ga0070708_100826520 Ga0070708_1008265201 141
245 3300005467 Ga0070706_100021785 Ga0070706_1000217856 141
246 3300005468 Ga0070707_100317534 Ga0070707_1003175342 141
247 3300005471 Ga0070698_100003588 Ga0070698_10000358814 141
248 3300005536 Ga0070697_100000176 Ga0070697_10000017610 141
249 3300005539 Ga0068853_100100877 Ga0068853_1001008772 141
250 3300005545 Ga0070695_100750907 Ga0070695_1007509071 141
251 3300005617 Ga0068859_101594401 Ga0068859_1015944012 141
252 3300005618 Ga0068864_101274847 Ga0068864_1012748472 141
253 3300005719 Ga0068861_101550159 Ga0068861_1015501592 141
254 3300005844 Ga0068862_102255382 Ga0068862_1022553821 141
255 3300006852 Ga0075433_10212242 Ga0075433_102122423 141
256 3300006852 Ga0075433_11821727 Ga0075433_118217271 141
257 3300006871 Ga0075434_100054566 Ga0075434_1000545665 141
258 3300009098 Ga0105245_10886280 Ga0105245_108862802 141
259 3300009101 Ga0105247_10868129 Ga0105247_108681291 141
260 3300009147 Ga0114129_11138347 Ga0114129_111383471 141
261 3300009148 Ga0105243_11761155 Ga0105243_117611551 141
262 3300009545 Ga0105237_10051585 Ga0105237_100515851 141
263 3300009553 Ga0105249_10019365 Ga0105249_100193654 141
264 3300009553 Ga0105249_10254620 Ga0105249_102546202 141
265 3300010375 Ga0105239_10081369 Ga0105239_100813692 141
266 3300013100 Ga0157373_10836311 Ga0157373_108363112 141
267 3300013306 Ga0163162_10005889 Ga0163162_100058898 141
268 3300013308 Ga0157375_11931294 Ga0157375_119312941 141
269 3300025893 Ga0207682_10549013 Ga0207682_105490131 141
270 3300025907 Ga0207645_10406137 Ga0207645_104061372 141
271 3300025910 Ga0207684_10005029 Ga0207684_100050292 141
272 3300025911 Ga0207654_10235228 Ga0207654_102352282 141
273 3300025913 Ga0207695_11233643 Ga0207695_112336431 141
274 3300025922 Ga0207646_10200587 Ga0207646_102005872 141
275 3300025935 Ga0207709_10363425 Ga0207709_103634251 141
276 3300025961 Ga0207712_10324155 Ga0207712_103241552 141
277 3300026041 Ga0207639_10072676 Ga0207639_100726763 141
278 3300026075 Ga0207708_10047707 Ga0207708_100477073 141
279 3300026078 Ga0207702_10177755 Ga0207702_101777553 141
280 3300026118 Ga0207675_101104144 Ga0207675_1011041442 141
281 3300031852 Ga0307410_10409014 Ga0307410_104090142 141
282 3300032126 Ga0307415_100268670 Ga0307415_1002686702 141
283 3300037418 Ga0395900_0338097 Ga0395900_0338097_973_1398 141
284 3300046515 Ga0495620_0208669 Ga0495620_0208669_144_596 141
285 3300046525 Ga0495663_0000123 Ga0495663_0000123_27414_27866 141
286 3300046537 Ga0495598_0000081 Ga0495598_0000081_14013_14465 141
287 3300046539 Ga0495621_0000084 Ga0495621_0000084_18042_18494 141
288 3300046616 Ga0495668_0083344 Ga0495668_0083344_1171_1623 141
289 3300047445 Ga0495677_0238481 Ga0495677_0238481_233_685 141
290 3300048905 Ga0496102_0017178 Ga0496102_0017178_4020_4451 141
291 3300049520 Ga0501297_022777 Ga0501297_022777_237_662 141
292 3300049522 Ga0501299_006165 Ga0501299_006165_389_814 141
293 3300049524 Ga0501301_018947 Ga0501301_018947_93_518 141
294 3300049653 Ga0501206_018915 Ga0501206_018915_431_856 141
295 3300049660 Ga0501216_019821 Ga0501216_019821_334_759 141
296 3300049661 Ga0501217_026126 Ga0501217_026126_739_1164 141
297 3300049670 Ga0501236_030478 Ga0501236_030478_241_666 141
298 3300049672 Ga0501239_006013 Ga0501239_006013_410_835 141
299 3300049680 Ga0501250_001385 Ga0501250_001385_354_779 141
300 3300049689 Ga0501260_013423 Ga0501260_013423_146_571 141
301 3300049708 Ga0501245_004655 Ga0501245_004655_121_546 141
302 3300049769 Ga0501272_007445 Ga0501272_007445_153_578 141
303 3300049779 Ga0501283_012153 Ga0501283_012153_421_846 141
304 3300050512 nmdc:mga0n895_48686_c1 nmdc:mga0n895_48686_c1_3637_4062 141
305 3300050515 nmdc:mga0a205_251725_c1 nmdc:mga0a205_251725_c1_1067_1492 141
306 3300003203 JGI25406J46586_10022414 JGI25406J46586_100224143 142
307 3300005288 Ga0065714_10485774 Ga0065714_104857741 142
308 3300005289 Ga0065704_10140109 Ga0065704_101401092 142
309 3300005289 Ga0065704_10201753 Ga0065704_102017532 142
310 3300005289 Ga0065704_10237409 Ga0065704_102374092 142
311 3300005289 Ga0065704_10620604 Ga0065704_106206041 142
312 3300005290 Ga0065712_10005369 Ga0065712_100053693 142
313 3300005290 Ga0065712_10018041 Ga0065712_100180413 142
314 3300005290 Ga0065712_10073348 Ga0065712_100733482 142
315 3300005293 Ga0065715_10099361 Ga0065715_100993613 142
316 3300005293 Ga0065715_10282463 Ga0065715_102824632 142
317 3300005293 Ga0065715_10399621 Ga0065715_103996211 142
318 3300005293 Ga0065715_10779036 Ga0065715_107790361 142
319 3300005295 Ga0065707_10138063 Ga0065707_101380633 142
320 3300005295 Ga0065707_10144234 Ga0065707_101442342 142
321 3300005295 Ga0065707_10253448 Ga0065707_102534482 142
322 3300005295 Ga0065707_10398166 Ga0065707_103981661 142
323 3300005328 Ga0070676_10223646 Ga0070676_102236461 142
324 3300005328 Ga0070676_10250226 Ga0070676_102502262 142
325 3300005328 Ga0070676_11087608 Ga0070676_110876081 142
326 3300005329 Ga0070683_101073279 Ga0070683_1010732792 142
327 3300005330 Ga0070690_100005943 Ga0070690_1000059438 142
328 3300005330 Ga0070690_100052256 Ga0070690_1000522563 142
329 3300005330 Ga0070690_100080578 Ga0070690_1000805783 142
330 3300005331 Ga0070670_100006797 Ga0070670_1000067976 142
331 3300005331 Ga0070670_100632979 Ga0070670_1006329791 142
332 3300005333 Ga0070677_10488909 Ga0070677_104889091 142
333 3300005334 Ga0068869_100025113 Ga0068869_1000251133 142
334 3300005334 Ga0068869_100039742 Ga0068869_1000397424 142
335 3300005334 Ga0068869_100107545 Ga0068869_1001075453 142
336 3300005334 Ga0068869_100192963 Ga0068869_1001929632 142
337 3300005335 Ga0070666_10032891 Ga0070666_100328914 142
338 3300005335 Ga0070666_10184527 Ga0070666_101845272 142
339 3300005336 Ga0070680_100016262 Ga0070680_1000162622 142
340 3300005336 Ga0070680_100393408 Ga0070680_1003934081 142
341 3300005337 Ga0070682_100241834 Ga0070682_1002418342 142
342 3300005338 Ga0068868_100025154 Ga0068868_1000251544 142
343 3300005338 Ga0068868_100066068 Ga0068868_1000660682 142
344 3300005338 Ga0068868_100074948 Ga0068868_1000749483 142
345 3300005338 Ga0068868_100865720 Ga0068868_1008657202 142
346 3300005339 Ga0070660_100089303 Ga0070660_1000893033 142
347 3300005340 Ga0070689_100212369 Ga0070689_1002123692 142
348 3300005340 Ga0070689_100249413 Ga0070689_1002494132 142
349 3300005340 Ga0070689_101057564 Ga0070689_1010575642 142
350 3300005343 Ga0070687_100002881 Ga0070687_1000028815 142
351 3300005344 Ga0070661_100351779 Ga0070661_1003517792 142
352 3300005345 Ga0070692_10060728 Ga0070692_100607282 142
353 3300005345 Ga0070692_10178320 Ga0070692_101783202 142
354 3300005345 Ga0070692_10268256 Ga0070692_102682562 142
355 3300005345 Ga0070692_10390060 Ga0070692_103900602 142
356 3300005345 Ga0070692_10497103 Ga0070692_104971031 142
357 3300005347 Ga0070668_100314715 Ga0070668_1003147152 142
358 3300005353 Ga0070669_100000729 Ga0070669_10000072917 142
359 3300005353 Ga0070669_100007926 Ga0070669_1000079267 142
360 3300005353 Ga0070669_100049912 Ga0070669_1000499123 142
361 3300005353 Ga0070669_100056435 Ga0070669_1000564353 142
362 3300005353 Ga0070669_100122299 Ga0070669_1001222992 142
363 3300005353 Ga0070669_100139726 Ga0070669_1001397261 142
364 3300005354 Ga0070675_100427867 Ga0070675_1004278672 142
365 3300005355 Ga0070671_100005506 Ga0070671_1000055067 142
366 3300005355 Ga0070671_100143151 Ga0070671_1001431513 142
367 3300005355 Ga0070671_101374756 Ga0070671_1013747562 142
368 3300005364 Ga0070673_100281582 Ga0070673_1002815821 142
369 3300005364 Ga0070673_100310862 Ga0070673_1003108622 142
370 3300005364 Ga0070673_100920831 Ga0070673_1009208312 142
371 3300005365 Ga0070688_100111543 Ga0070688_1001115432 142
372 3300005365 Ga0070688_100649716 Ga0070688_1006497162 142
373 3300005366 Ga0070659_100025535 Ga0070659_1000255354 142
374 3300005366 Ga0070659_100665752 Ga0070659_1006657522 142
375 3300005367 Ga0070667_100020193 Ga0070667_1000201936 142
376 3300005367 Ga0070667_100085781 Ga0070667_1000857813 142
377 3300005434 Ga0070709_10761512 Ga0070709_107615121 142
378 3300005438 Ga0070701_10076093 Ga0070701_100760932 142
379 3300005440 Ga0070705_100046690 Ga0070705_1000466902 142
380 3300005440 Ga0070705_100318141 Ga0070705_1003181412 142
381 3300005440 Ga0070705_100514269 Ga0070705_1005142692 142
382 3300005441 Ga0070700_100066629 Ga0070700_1000666293 142
383 3300005441 Ga0070700_100082032 Ga0070700_1000820322 142
384 3300005441 Ga0070700_100629017 Ga0070700_1006290172 142
385 3300005444 Ga0070694_100021114 Ga0070694_1000211143 142
386 3300005444 Ga0070694_100066438 Ga0070694_1000664382 142
387 3300005444 Ga0070694_100220243 Ga0070694_1002202432 142
388 3300005444 Ga0070694_100856847 Ga0070694_1008568471 142
389 3300005456 Ga0070678_100084501 Ga0070678_1000845013 142
390 3300005456 Ga0070678_100459123 Ga0070678_1004591232 142
391 3300005456 Ga0070678_100992586 Ga0070678_1009925862 142
392 3300005457 Ga0070662_100172586 Ga0070662_1001725863 142
393 3300005457 Ga0070662_100728486 Ga0070662_1007284861 142
394 3300005457 Ga0070662_101123321 Ga0070662_1011233211 142
395 3300005458 Ga0070681_10002322 Ga0070681_100023229 142
396 3300005458 Ga0070681_10022916 Ga0070681_100229164 142
397 3300005458 Ga0070681_10230401 Ga0070681_102304013 142
398 3300005459 Ga0068867_100025690 Ga0068867_1000256904 142
399 3300005459 Ga0068867_100088519 Ga0068867_1000885193 142
400 3300005459 Ga0068867_101956888 Ga0068867_1019568881 142
401 3300005466 Ga0070685_10293847 Ga0070685_102938472 142
402 3300005467 Ga0070706_100937058 Ga0070706_1009370581 142
403 3300005468 Ga0070707_100208076 Ga0070707_1002080762 142
404 3300005518 Ga0070699_100437859 Ga0070699_1004378592 142
405 3300005518 Ga0070699_100556264 Ga0070699_1005562642 142
406 3300005518 Ga0070699_101987188 Ga0070699_1019871881 142
407 3300005530 Ga0070679_100082638 Ga0070679_1000826382 142
408 3300005535 Ga0070684_101935542 Ga0070684_1019355421 142
409 3300005536 Ga0070697_101135558 Ga0070697_1011355581 142
410 3300005536 Ga0070697_101739318 Ga0070697_1017393181 142
411 3300005539 Ga0068853_100051590 Ga0068853_1000515904 142
412 3300005539 Ga0068853_100824328 Ga0068853_1008243282 142
413 3300005543 Ga0070672_100384674 Ga0070672_1003846742 142
414 3300005543 Ga0070672_100799659 Ga0070672_1007996591 142
415 3300005544 Ga0070686_100072686 Ga0070686_1000726862 142
416 3300005545 Ga0070695_100088960 Ga0070695_1000889602 142
417 3300005545 Ga0070695_100139498 Ga0070695_1001394983 142
418 3300005545 Ga0070695_100509117 Ga0070695_1005091172 142
419 3300005546 Ga0070696_100018228 Ga0070696_1000182285 142
420 3300005546 Ga0070696_100061942 Ga0070696_1000619422 142
421 3300005546 Ga0070696_100192430 Ga0070696_1001924302 142
422 3300005546 Ga0070696_100663725 Ga0070696_1006637251 142
423 3300005546 Ga0070696_100871939 Ga0070696_1008719392 142
424 3300005547 Ga0070693_100043186 Ga0070693_1000431862 142
425 3300005547 Ga0070693_100065843 Ga0070693_1000658433 142
426 3300005547 Ga0070693_100406452 Ga0070693_1004064522 142
427 3300005548 Ga0070665_100031856 Ga0070665_1000318565 142
428 3300005548 Ga0070665_100259179 Ga0070665_1002591792 142
429 3300005549 Ga0070704_100028429 Ga0070704_1000284292 142
430 3300005549 Ga0070704_100904995 Ga0070704_1009049952 142
431 3300005549 Ga0070704_100910981 Ga0070704_1009109811 142
432 3300005563 Ga0068855_102324219 Ga0068855_1023242191 142
433 3300005564 Ga0070664_100011220 Ga0070664_1000112203 142
434 3300005564 Ga0070664_100177205 Ga0070664_1001772053 142
435 3300005564 Ga0070664_100273588 Ga0070664_1002735881 142
436 3300005564 Ga0070664_100526083 Ga0070664_1005260832 142
437 3300005564 Ga0070664_100683934 Ga0070664_1006839342 142
438 3300005577 Ga0068857_100000277 Ga0068857_10000027729 142
439 3300005578 Ga0068854_100122249 Ga0068854_1001222492 142
440 3300005578 Ga0068854_100130332 Ga0068854_1001303323 142
441 3300005578 Ga0068854_100640828 Ga0068854_1006408282 142
442 3300005614 Ga0068856_101984724 Ga0068856_1019847241 142
443 3300005615 Ga0070702_100010068 Ga0070702_1000100682 142
444 3300005615 Ga0070702_100017240 Ga0070702_1000172404 142
445 3300005616 Ga0068852_100746137 Ga0068852_1007461372 142
446 3300005617 Ga0068859_100047921 Ga0068859_1000479213 142
447 3300005617 Ga0068859_100056252 Ga0068859_1000562522 142
448 3300005617 Ga0068859_100155199 Ga0068859_1001551992 142
449 3300005617 Ga0068859_100197537 Ga0068859_1001975372 142
450 3300005617 Ga0068859_101078732 Ga0068859_1010787321 142
451 3300005617 Ga0068859_101447938 Ga0068859_1014479382 142
452 3300005617 Ga0068859_101691498 Ga0068859_1016914982 142
453 3300005618 Ga0068864_100001610 Ga0068864_1000016108 142
454 3300005618 Ga0068864_100024460 Ga0068864_1000244603 142
455 3300005618 Ga0068864_100998191 Ga0068864_1009981911 142
456 3300005718 Ga0068866_10076616 Ga0068866_100766162 142
457 3300005718 Ga0068866_10583330 Ga0068866_105833302 142
458 3300005719 Ga0068861_100028721 Ga0068861_1000287213 142
459 3300005719 Ga0068861_100068417 Ga0068861_1000684172 142
460 3300005719 Ga0068861_100223151 Ga0068861_1002231512 142
461 3300005719 Ga0068861_100497972 Ga0068861_1004979722 142
462 3300005834 Ga0068851_10093937 Ga0068851_100939373 142
463 3300005840 Ga0068870_10000847 Ga0068870_100008478 142
464 3300005840 Ga0068870_10133279 Ga0068870_101332793 142
465 3300005840 Ga0068870_10380733 Ga0068870_103807332 142
466 3300005841 Ga0068863_100125851 Ga0068863_1001258511 142
467 3300005841 Ga0068863_100133583 Ga0068863_1001335832 142
468 3300005842 Ga0068858_100072879 Ga0068858_1000728793 142
469 3300005842 Ga0068858_100083895 Ga0068858_1000838953 142
470 3300005842 Ga0068858_100150078 Ga0068858_1001500784 142
471 3300005842 Ga0068858_100489751 Ga0068858_1004897511 142
472 3300005842 Ga0068858_101426488 Ga0068858_1014264882 142
473 3300005843 Ga0068860_100047159 Ga0068860_1000471594 142
474 3300005843 Ga0068860_100076808 Ga0068860_1000768084 142
475 3300005843 Ga0068860_100156914 Ga0068860_1001569143 142
476 3300005843 Ga0068860_100182651 Ga0068860_1001826512 142
477 3300005843 Ga0068860_100769004 Ga0068860_1007690041 142
478 3300005844 Ga0068862_100135621 Ga0068862_1001356213 142
479 3300005844 Ga0068862_100577106 Ga0068862_1005771062 142
480 3300005844 Ga0068862_101205650 Ga0068862_1012056501 142
481 3300005844 Ga0068862_101261050 Ga0068862_1012610502 142
482 3300005985 Ga0081539_10003247 Ga0081539_100032476 142
483 3300006173 Ga0070716_101387873 Ga0070716_1013878731 142
484 3300006237 Ga0097621_100001882 Ga0097621_1000018823 142
485 3300006237 Ga0097621_100015727 Ga0097621_1000157274 142
486 3300006358 Ga0068871_100021215 Ga0068871_1000212154 142
487 3300006358 Ga0068871_100565083 Ga0068871_1005650832 142
488 3300006844 Ga0075428_100070337 Ga0075428_1000703372 142
489 3300006844 Ga0075428_100424178 Ga0075428_1004241782 142
490 3300006844 Ga0075428_100548643 Ga0075428_1005486432 142
491 3300006846 Ga0075430_100181848 Ga0075430_1001818483 142
492 3300006846 Ga0075430_101249432 Ga0075430_1012494321 142
493 3300006847 Ga0075431_100158837 Ga0075431_1001588372 142
494 3300006852 Ga0075433_10065599 Ga0075433_100655992 142
495 3300006852 Ga0075433_10090500 Ga0075433_100905003 142
496 3300006871 Ga0075434_100539414 Ga0075434_1005394142 142
497 3300006871 Ga0075434_101713228 Ga0075434_1017132282 142
498 3300006871 Ga0075434_101725128 Ga0075434_1017251281 142
499 3300006871 Ga0075434_101755485 Ga0075434_1017554851 142
500 3300006880 Ga0075429_100059945 Ga0075429_1000599453 142
501 3300006880 Ga0075429_100248149 Ga0075429_1002481492 142
502 3300006881 Ga0068865_100022198 Ga0068865_1000221982 142
503 3300006881 Ga0068865_100447858 Ga0068865_1004478582 142
504 3300006881 Ga0068865_101366598 Ga0068865_1013665981 142
505 3300006881 Ga0068865_101715957 Ga0068865_1017159571 142
506 3300006914 Ga0075436_100013635 Ga0075436_1000136357 142
507 3300006931 Ga0097620_100047919 Ga0097620_1000479193 142
508 3300006931 Ga0097620_100056252 Ga0097620_1000562524 142
509 3300006931 Ga0097620_100155198 Ga0097620_1001551984 142
510 3300006931 Ga0097620_100197537 Ga0097620_1001975372 142
511 3300006931 Ga0097620_101078761 Ga0097620_1010787611 142
512 3300006931 Ga0097620_101447394 Ga0097620_1014473942 142
513 3300006931 Ga0097620_101691512 Ga0097620_1016915122 142
514 3300007076 Ga0075435_100029269 Ga0075435_1000292693 142
515 3300007265 Ga0099794_10586380 Ga0099794_105863801 142
516 3300009094 Ga0111539_10007977 Ga0111539_100079777 142
517 3300009094 Ga0111539_10010383 Ga0111539_100103838 142
518 3300009094 Ga0111539_10167162 Ga0111539_101671621 142
519 3300009098 Ga0105245_10092553 Ga0105245_100925534 142
520 3300009098 Ga0105245_10280029 Ga0105245_102800292 142
521 3300009098 Ga0105245_10441515 Ga0105245_104415152 142
522 3300009101 Ga0105247_11727951 Ga0105247_117279511 142
523 3300009147 Ga0114129_10026332 Ga0114129_100263327 142
524 3300009147 Ga0114129_10030702 Ga0114129_100307028 142
525 3300009147 Ga0114129_10058691 Ga0114129_100586912 142
526 3300009147 Ga0114129_10140117 Ga0114129_101401172 142
527 3300009147 Ga0114129_10225919 Ga0114129_102259192 142
528 3300009147 Ga0114129_10996248 Ga0114129_109962482 142
529 3300009147 Ga0114129_11180585 Ga0114129_111805852 142
530 3300009148 Ga0105243_10003775 Ga0105243_100037751 142
531 3300009148 Ga0105243_10061092 Ga0105243_100610924 142
532 3300009174 Ga0105241_10281017 Ga0105241_102810173 142
533 3300009174 Ga0105241_10409882 Ga0105241_104098822 142
534 3300009174 Ga0105241_10677885 Ga0105241_106778852 142
535 3300009174 Ga0105241_11303056 Ga0105241_113030561 142
536 3300009176 Ga0105242_10244232 Ga0105242_102442323 142
537 3300009177 Ga0105248_10012918 Ga0105248_100129187 142
538 3300009177 Ga0105248_10274483 Ga0105248_102744832 142
539 3300009177 Ga0105248_10351329 Ga0105248_103513292 142
540 3300009551 Ga0105238_10674264 Ga0105238_106742642 142
541 3300009553 Ga0105249_10492621 Ga0105249_104926212 142
542 3300009553 Ga0105249_11168156 Ga0105249_111681562 142
543 3300009553 Ga0105249_11321613 Ga0105249_113216132 142
544 3300009553 Ga0105249_12125146 Ga0105249_121251462 142
545 3300010375 Ga0105239_10684171 Ga0105239_106841711 142
546 3300011119 Ga0105246_10074102 Ga0105246_100741023 142
547 3300011119 Ga0105246_10159825 Ga0105246_101598252 142
548 3300011119 Ga0105246_10294988 Ga0105246_102949882 142
549 3300011119 Ga0105246_10563003 Ga0105246_105630032 142
550 3300011119 Ga0105246_11814357 Ga0105246_118143571 142
551 3300012512 Ga0157327_1042121 Ga0157327_10421211 142
552 3300013100 Ga0157373_10033443 Ga0157373_100334434 142
553 3300013100 Ga0157373_10107041 Ga0157373_101070414 142
554 3300013100 Ga0157373_10288513 Ga0157373_102885132 142
555 3300013102 Ga0157371_11448912 Ga0157371_114489121 142
556 3300013296 Ga0157374_10007848 Ga0157374_100078485 142
557 3300013296 Ga0157374_10512560 Ga0157374_105125602 142
558 3300013296 Ga0157374_10822191 Ga0157374_108221912 142
559 3300013297 Ga0157378_10010711 Ga0157378_100107113 142
560 3300013297 Ga0157378_10049326 Ga0157378_100493263 142
561 3300013297 Ga0157378_10336898 Ga0157378_103368982 142
562 3300013306 Ga0163162_10002329 Ga0163162_100023297 142
563 3300013306 Ga0163162_10011561 Ga0163162_100115619 142
564 3300013306 Ga0163162_10037774 Ga0163162_100377743 142
565 3300013306 Ga0163162_10049352 Ga0163162_100493525 142
566 3300013306 Ga0163162_10085592 Ga0163162_100855923 142
567 3300013307 Ga0157372_10025429 Ga0157372_100254294 142
568 3300013307 Ga0157372_10058402 Ga0157372_100584023 142
569 3300013308 Ga0157375_10005360 Ga0157375_100053607 142
570 3300013308 Ga0157375_10009563 Ga0157375_100095636 142
571 3300013308 Ga0157375_10240685 Ga0157375_102406853 142
572 3300013308 Ga0157375_10409195 Ga0157375_104091952 142
573 3300013308 Ga0157375_10474186 Ga0157375_104741862 142
574 3300013308 Ga0157375_10724946 Ga0157375_107249461 142
575 3300013308 Ga0157375_10910626 Ga0157375_109106262 142
576 3300013308 Ga0157375_10938039 Ga0157375_109380392 142
577 3300014325 Ga0163163_10010501 Ga0163163_100105014 142
578 3300014325 Ga0163163_10043868 Ga0163163_100438684 142
579 3300014325 Ga0163163_10045314 Ga0163163_100453142 142
580 3300014325 Ga0163163_10075029 Ga0163163_100750292 142
581 3300014325 Ga0163163_10181782 Ga0163163_101817823 142
582 3300014325 Ga0163163_10248392 Ga0163163_102483922 142
583 3300014325 Ga0163163_10766215 Ga0163163_107662152 142
584 3300014326 Ga0157380_10033357 Ga0157380_100333572 142
585 3300014326 Ga0157380_10125972 Ga0157380_101259723 142
586 3300014326 Ga0157380_10143609 Ga0157380_101436092 142
587 3300014326 Ga0157380_11121094 Ga0157380_111210942 142
588 3300014745 Ga0157377_10022694 Ga0157377_100226944 142
589 3300014968 Ga0157379_10225193 Ga0157379_102251932 142
590 3300014968 Ga0157379_10589394 Ga0157379_105893942 142
591 3300014968 Ga0157379_10748913 Ga0157379_107489132 142
592 3300014969 Ga0157376_10011208 Ga0157376_100112086 142
593 3300014969 Ga0157376_10125147 Ga0157376_101251472 142
594 3300015262 Ga0182007_10225337 Ga0182007_102253371 142
595 3300017792 Ga0163161_10028642 Ga0163161_100286421 142
596 3300017792 Ga0163161_10640796 Ga0163161_106407961 142
597 3300025315 Ga0207697_10299817 Ga0207697_102998172 142
598 3300025893 Ga0207682_10199156 Ga0207682_101991562 142
599 3300025899 Ga0207642_10158567 Ga0207642_101585672 142
600 3300025903 Ga0207680_10013632 Ga0207680_100136324 142
601 3300025903 Ga0207680_10419302 Ga0207680_104193022 142
602 3300025906 Ga0207699_10658590 Ga0207699_106585901 142
603 3300025907 Ga0207645_10119803 Ga0207645_101198032 142
604 3300025907 Ga0207645_10527368 Ga0207645_105273681 142
605 3300025908 Ga0207643_10017495 Ga0207643_100174954 142
606 3300025908 Ga0207643_10027010 Ga0207643_100270103 142
607 3300025908 Ga0207643_10091750 Ga0207643_100917503 142
608 3300025908 Ga0207643_10159023 Ga0207643_101590232 142
609 3300025908 Ga0207643_10697011 Ga0207643_106970111 142
610 3300025912 Ga0207707_10023481 Ga0207707_100234816 142
611 3300025917 Ga0207660_10327480 Ga0207660_103274802 142
612 3300025917 Ga0207660_11400909 Ga0207660_114009092 142
613 3300025918 Ga0207662_10003999 Ga0207662_100039992 142
614 3300025918 Ga0207662_10008041 Ga0207662_100080418 142
615 3300025918 Ga0207662_10385984 Ga0207662_103859842 142
616 3300025918 Ga0207662_10613566 Ga0207662_106135662 142
617 3300025920 Ga0207649_10035097 Ga0207649_100350972 142
618 3300025921 Ga0207652_10130898 Ga0207652_101308982 142
619 3300025922 Ga0207646_10572822 Ga0207646_105728222 142
620 3300025923 Ga0207681_10000428 Ga0207681_1000042811 142
621 3300025923 Ga0207681_10058913 Ga0207681_100589132 142
622 3300025923 Ga0207681_10155173 Ga0207681_101551733 142
623 3300025923 Ga0207681_10282414 Ga0207681_102824142 142
624 3300025923 Ga0207681_10354506 Ga0207681_103545062 142
625 3300025923 Ga0207681_10804014 Ga0207681_108040141 142
626 3300025925 Ga0207650_10001704 Ga0207650_1000170410 142
627 3300025925 Ga0207650_10216831 Ga0207650_102168312 142
628 3300025925 Ga0207650_11320080 Ga0207650_113200801 142
629 3300025926 Ga0207659_10232456 Ga0207659_102324562 142
630 3300025926 Ga0207659_10237442 Ga0207659_102374422 142
631 3300025927 Ga0207687_10805985 Ga0207687_108059852 142
632 3300025927 Ga0207687_10946317 Ga0207687_109463171 142
633 3300025927 Ga0207687_11534639 Ga0207687_115346391 142
634 3300025931 Ga0207644_10016817 Ga0207644_100168173 142
635 3300025931 Ga0207644_10175879 Ga0207644_101758792 142
636 3300025931 Ga0207644_10296843 Ga0207644_102968432 142
637 3300025932 Ga0207690_10550433 Ga0207690_105504332 142
638 3300025933 Ga0207706_10152083 Ga0207706_101520834 142
639 3300025933 Ga0207706_10332994 Ga0207706_103329943 142
640 3300025933 Ga0207706_10461217 Ga0207706_104612172 142
641 3300025934 Ga0207686_10308149 Ga0207686_103081492 142
642 3300025935 Ga0207709_10501379 Ga0207709_105013792 142
643 3300025936 Ga0207670_10198793 Ga0207670_101987932 142
644 3300025936 Ga0207670_10384688 Ga0207670_103846882 142
645 3300025936 Ga0207670_10916367 Ga0207670_109163672 142
646 3300025936 Ga0207670_11044450 Ga0207670_110444501 142
647 3300025936 Ga0207670_11066729 Ga0207670_110667292 142
648 3300025937 Ga0207669_10147748 Ga0207669_101477482 142
649 3300025938 Ga0207704_10043235 Ga0207704_100432354 142
650 3300025938 Ga0207704_10284319 Ga0207704_102843191 142
651 3300025938 Ga0207704_11044273 Ga0207704_110442731 142
652 3300025940 Ga0207691_10047107 Ga0207691_100471074 142
653 3300025940 Ga0207691_10060123 Ga0207691_100601232 142
654 3300025941 Ga0207711_10013634 Ga0207711_100136345 142
655 3300025941 Ga0207711_10076895 Ga0207711_100768953 142
656 3300025942 Ga0207689_10000986 Ga0207689_1000098610 142
657 3300025942 Ga0207689_10067771 Ga0207689_100677712 142
658 3300025942 Ga0207689_10067902 Ga0207689_100679024 142
659 3300025942 Ga0207689_10126998 Ga0207689_101269983 142
660 3300025942 Ga0207689_10980089 Ga0207689_109800891 142
661 3300025944 Ga0207661_10869739 Ga0207661_108697391 142
662 3300025945 Ga0207679_10020984 Ga0207679_100209843 142
663 3300025945 Ga0207679_10241735 Ga0207679_102417353 142
664 3300025945 Ga0207679_10404006 Ga0207679_104040061 142
665 3300025945 Ga0207679_10649428 Ga0207679_106494282 142
666 3300025949 Ga0207667_11844196 Ga0207667_118441961 142
667 3300025960 Ga0207651_10139337 Ga0207651_101393373 142
668 3300025960 Ga0207651_10277461 Ga0207651_102774612 142
669 3300025961 Ga0207712_10079374 Ga0207712_100793743 142
670 3300025961 Ga0207712_10409449 Ga0207712_104094492 142
671 3300025981 Ga0207640_10047255 Ga0207640_100472553 142
672 3300025981 Ga0207640_10100036 Ga0207640_101000363 142
673 3300025981 Ga0207640_10296511 Ga0207640_102965112 142
674 3300025986 Ga0207658_10167670 Ga0207658_101676702 142
675 3300025986 Ga0207658_10169305 Ga0207658_101693053 142
676 3300026023 Ga0207677_10009473 Ga0207677_100094736 142
677 3300026023 Ga0207677_10692936 Ga0207677_106929362 142
678 3300026035 Ga0207703_10128217 Ga0207703_101282172 142
679 3300026041 Ga0207639_10154386 Ga0207639_101543861 142
680 3300026075 Ga0207708_10079676 Ga0207708_100796763 142
681 3300026075 Ga0207708_10124313 Ga0207708_101243132 142
682 3300026088 Ga0207641_10044331 Ga0207641_100443313 142
683 3300026088 Ga0207641_10216868 Ga0207641_102168682 142
684 3300026088 Ga0207641_10751353 Ga0207641_107513532 142
685 3300026089 Ga0207648_10001908 Ga0207648_1000190813 142
686 3300026089 Ga0207648_10130644 Ga0207648_101306443 142
687 3300026089 Ga0207648_10134137 Ga0207648_101341371 142
688 3300026089 Ga0207648_11601862 Ga0207648_116018622 142
689 3300026095 Ga0207676_10016632 Ga0207676_100166323 142
690 3300026095 Ga0207676_10092309 Ga0207676_100923092 142
691 3300026095 Ga0207676_10174782 Ga0207676_101747822 142
692 3300026095 Ga0207676_10290512 Ga0207676_102905122 142
693 3300026095 Ga0207676_10320870 Ga0207676_103208702 142
694 3300026095 Ga0207676_10965472 Ga0207676_109654721 142
695 3300026116 Ga0207674_10000192 Ga0207674_1000019221 142
696 3300026118 Ga0207675_100068923 Ga0207675_1000689233 142
697 3300026118 Ga0207675_100151655 Ga0207675_1001516551 142
698 3300026118 Ga0207675_100186991 Ga0207675_1001869913 142
699 3300026118 Ga0207675_100336642 Ga0207675_1003366422 142
700 3300026118 Ga0207675_100670158 Ga0207675_1006701582 142
701 3300026118 Ga0207675_100721040 Ga0207675_1007210402 142
702 3300026121 Ga0207683_10249816 Ga0207683_102498161 142
703 3300026121 Ga0207683_10315731 Ga0207683_103157312 142
704 3300026142 Ga0207698_10358001 Ga0207698_103580011 142
705 3300027907 Ga0207428_10026938 Ga0207428_100269382 142
706 3300027907 Ga0207428_10071524 Ga0207428_100715243 142
707 3300028379 Ga0268266_10075086 Ga0268266_100750864 142
708 3300028379 Ga0268266_11395527 Ga0268266_113955272 142
709 3300028380 Ga0268265_10100036 Ga0268265_101000363 142
710 3300028380 Ga0268265_10756535 Ga0268265_107565352 142
711 3300028380 Ga0268265_11547431 Ga0268265_115474311 142
712 3300028381 Ga0268264_10057568 Ga0268264_100575682 142
713 3300028381 Ga0268264_10058091 Ga0268264_100580913 142
714 3300028381 Ga0268264_10204039 Ga0268264_102040393 142
715 3300028381 Ga0268264_10743407 Ga0268264_107434072 142
716 3300031548 Ga0307408_100249878 Ga0307408_1002498782 142
717 3300031824 Ga0307413_10251320 Ga0307413_102513202 142
718 3300031911 Ga0307412_10583142 Ga0307412_105831421 142
719 3300031995 Ga0307409_100033275 Ga0307409_1000332752 142
720 3300032002 Ga0307416_100210316 Ga0307416_1002103162 142
721 3300032002 Ga0307416_100387319 Ga0307416_1003873192 142
722 3300032004 Ga0307414_10238473 Ga0307414_102384732 142
723 3300032005 Ga0307411_10677169 Ga0307411_106771691 142
724 3300032126 Ga0307415_100155891 Ga0307415_1001558912 142
725 3300032126 Ga0307415_100250285 Ga0307415_1002502852 142
726 3300035088 Ga0373940_0219664 Ga0373940_0219664_171_599 142
727 3300035091 Ga0373951_0003178 Ga0373951_0003178_107_535 142
728 3300035691 Ga0373931_0351913 Ga0373931_0351913_326_754 142
729 3300036401 Ga0373937_0076330 Ga0373937_0076330_1033_1464 142
730 3300042876 Ga0451577_0910173 Ga0451577_0910173_26_484 142
731 3300045051 Ga0451576_0845476 Ga0451576_0845476_21_467 142
732 3300046473 Ga0495582_0134736 Ga0495582_0134736_197_628 142
733 3300046660 Ga0495625_0278567 Ga0495625_0278567_303_734 142
734 3300046683 Ga0495658_0092964 Ga0495658_0092964_533_964 142
735 3300048907 Ga0496104_0466631 Ga0496104_0466631_42_473 142
736 3300048907 Ga0496104_1119724 Ga0496104_1119724_188_619 142
737 3300048911 Ga0496108_0314066 Ga0496108_0314066_209_640 142
738 3300048912 Ga0496109_0825548 Ga0496109_0825548_208_639 142
739 3300048913 Ga0496110_0493001 Ga0496110_0493001_218_664 142
740 3300048914 Ga0496111_0379224 Ga0496111_0379224_85_531 142
741 3300048915 Ga0496112_0289181 Ga0496112_0289181_512_952 142
742 3300048915 Ga0496112_0524628 Ga0496112_0524628_32_463 142
743 3300048915 Ga0496112_0946015 Ga0496112_0946015_305_760 142
744 3300048916 Ga0496113_0085652 Ga0496113_0085652_461_889 142
745 3300049514 Ga0501291_026577 Ga0501291_026577_155_592 142
746 3300049522 Ga0501299_012388 Ga0501299_012388_958_1395 142
747 3300049649 Ga0501198_028644 Ga0501198_028644_151_588 142
748 3300049652 Ga0501202_024105 Ga0501202_024105_391_819 142
749 3300049652 Ga0501202_076030 Ga0501202_076030_67_504 142
750 3300049660 Ga0501216_003648 Ga0501216_003648_321_758 142
751 3300049660 Ga0501216_036119 Ga0501216_036119_139_567 142
752 3300049661 Ga0501217_037540 Ga0501217_037540_707_1144 142
753 3300049663 Ga0501223_016094 Ga0501223_016094_967_1395 142
754 3300049664 Ga0501224_005508 Ga0501224_005508_1307_1735 142
755 3300049667 Ga0501230_147204 Ga0501230_147204_50_478 142
756 3300049669 Ga0501235_012410 Ga0501235_012410_162_590 142
757 3300049670 Ga0501236_140037 Ga0501236_140037_28_456 142
758 3300049679 Ga0501249_012607 Ga0501249_012607_912_1340 142
759 3300049681 Ga0501251_023260 Ga0501251_023260_171_608 142
760 3300049689 Ga0501260_006938 Ga0501260_006938_347_775 142
761 3300049705 Ga0501225_0016539 Ga0501225_0016539_1273_1710 142
762 3300049705 Ga0501225_0017575 Ga0501225_0017575_351_779 142
763 3300049706 Ga0501229_004125 Ga0501229_004125_529_957 142
764 3300049708 Ga0501245_005544 Ga0501245_005544_471_899 142
765 3300049708 Ga0501245_055822 Ga0501245_055822_11_448 142
766 3300049766 Ga0501269_017992 Ga0501269_017992_380_808 142
767 3300049770 Ga0501273_049801 Ga0501273_049801_86_514 142
768 3300049772 Ga0501275_084120 Ga0501275_084120_43_471 142
769 3300049851 Ga0501212_011401 Ga0501212_011401_747_1184 142
770 3300050507 nmdc:mga05p37_338829_c1 nmdc:mga05p37_338829_c1_972_1403 142
771 3300050507 nmdc:mga05p37_368157_c1 nmdc:mga05p37_368157_c1_714_1145 142
772 3300050508 nmdc:mga09592_1472985_c1 nmdc:mga09592_1472985_c1_31_462 142
773 3300050509 nmdc:mga0qj67_353864_c1 nmdc:mga0qj67_353864_c1_195_626 142
774 3300050510 nmdc:mga06r32_70656_c1 nmdc:mga06r32_70656_c1_798_1229 142
775 3300050511 nmdc:mga08y16_172612_c1 nmdc:mga08y16_172612_c1_151_582 142
776 3300050511 nmdc:mga08y16_58197_c1 nmdc:mga08y16_58197_c1_2212_2649 142
777 3300050512 nmdc:mga0n895_169326_c1 nmdc:mga0n895_169326_c1_1353_1811 142
778 3300050512 nmdc:mga0n895_2218011_c1 nmdc:mga0n895_2218011_c1_54_485 142
779 3300050513 nmdc:mga0rr50_24584_c1 nmdc:mga0rr50_24584_c1_2332_2763 142
780 3300050514 nmdc:mga08x19_3718_c1 nmdc:mga08x19_3718_c1_4539_4970 142
781 3300050515 nmdc:mga0a205_231286_c1 nmdc:mga0a205_231286_c1_66_524 142
782 3300050515 nmdc:mga0a205_240041_c1 nmdc:mga0a205_240041_c1_516_974 142
783 3300050515 nmdc:mga0a205_267826_c1 nmdc:mga0a205_267826_c1_460_891 142
784 3300050515 nmdc:mga0a205_712717_c1 nmdc:mga0a205_712717_c1_165_611 142
785 2162886007 SwRhRL2b_contig_1874972 SwRhRL2b_0840.00005600 143
786 2162886007 SwRhRL2b_contig_983262 SwRhRL2b_0816.00001050 143
787 3300000532 CNAas_1001022 CNAas_10010221 143
788 3300005288 Ga0065714_10064435 Ga0065714_100644359 143
789 3300005289 Ga0065704_10002076 Ga0065704_100020768 143
790 3300005290 Ga0065712_10000118 Ga0065712_1000011810 143
791 3300005290 Ga0065712_10005863 Ga0065712_100058632 143
792 3300005293 Ga0065715_10015929 Ga0065715_100159293 143
793 3300005293 Ga0065715_10089159 Ga0065715_100891599 143
794 3300005293 Ga0065715_10090332 Ga0065715_100903322 143
795 3300005293 Ga0065715_10110229 Ga0065715_101102292 143
796 3300005293 Ga0065715_10206344 Ga0065715_102063442 143
797 3300005293 Ga0065715_10260587 Ga0065715_102605872 143
798 3300005295 Ga0065707_10001813 Ga0065707_100018135 143
799 3300005328 Ga0070676_10090439 Ga0070676_100904391 143
800 3300005328 Ga0070676_10361062 Ga0070676_103610621 143
801 3300005334 Ga0068869_100366862 Ga0068869_1003668622 143
802 3300005337 Ga0070682_100003753 Ga0070682_1000037538 143
803 3300005340 Ga0070689_100008505 Ga0070689_1000085052 143
804 3300005345 Ga0070692_10335894 Ga0070692_103358942 143
805 3300005345 Ga0070692_10650010 Ga0070692_106500101 143
806 3300005353 Ga0070669_100725315 Ga0070669_1007253152 143
807 3300005354 Ga0070675_100482761 Ga0070675_1004827611 143
808 3300005364 Ga0070673_100464799 Ga0070673_1004647992 143
809 3300005365 Ga0070688_101034628 Ga0070688_1010346282 143
810 3300005406 Ga0070703_10273453 Ga0070703_102734531 143
811 3300005438 Ga0070701_10877009 Ga0070701_108770092 143
812 3300005440 Ga0070705_100028934 Ga0070705_1000289342 143
813 3300005440 Ga0070705_100049793 Ga0070705_1000497932 143
814 3300005440 Ga0070705_100225949 Ga0070705_1002259491 143
815 3300005441 Ga0070700_100000092 Ga0070700_10000009236 143
816 3300005441 Ga0070700_100013167 Ga0070700_1000131673 143
817 3300005441 Ga0070700_100024519 Ga0070700_1000245196 143
818 3300005444 Ga0070694_100009639 Ga0070694_1000096397 143
819 3300005444 Ga0070694_100030338 Ga0070694_1000303385 143
820 3300005445 Ga0070708_100002362 Ga0070708_10000236211 143
821 3300005445 Ga0070708_100553254 Ga0070708_1005532542 143
822 3300005456 Ga0070678_100265509 Ga0070678_1002655092 143
823 3300005457 Ga0070662_100140783 Ga0070662_1001407833 143
824 3300005459 Ga0068867_100014031 Ga0068867_1000140313 143
825 3300005466 Ga0070685_11066855 Ga0070685_110668551 143
826 3300005467 Ga0070706_100021984 Ga0070706_1000219845 143
827 3300005467 Ga0070706_100090285 Ga0070706_1000902852 143
828 3300005468 Ga0070707_100026729 Ga0070707_1000267296 143
829 3300005471 Ga0070698_100006142 Ga0070698_10000614210 143
830 3300005471 Ga0070698_100029558 Ga0070698_1000295582 143
831 3300005471 Ga0070698_100040853 Ga0070698_1000408532 143
832 3300005518 Ga0070699_100009745 Ga0070699_1000097454 143
833 3300005518 Ga0070699_100038140 Ga0070699_1000381403 143
834 3300005518 Ga0070699_100502529 Ga0070699_1005025292 143
835 3300005536 Ga0070697_100026034 Ga0070697_1000260345 143
836 3300005536 Ga0070697_101298482 Ga0070697_1012984822 143
837 3300005539 Ga0068853_100041243 Ga0068853_1000412432 143
838 3300005543 Ga0070672_100220655 Ga0070672_1002206552 143
839 3300005543 Ga0070672_101092064 Ga0070672_1010920642 143
840 3300005543 Ga0070672_101397763 Ga0070672_1013977632 143
841 3300005545 Ga0070695_100039223 Ga0070695_1000392233 143
842 3300005545 Ga0070695_100055135 Ga0070695_1000551353 143
843 3300005546 Ga0070696_100045041 Ga0070696_1000450412 143
844 3300005546 Ga0070696_100389728 Ga0070696_1003897282 143
845 3300005546 Ga0070696_100954400 Ga0070696_1009544001 143
846 3300005549 Ga0070704_100019639 Ga0070704_1000196393 143
847 3300005549 Ga0070704_100334979 Ga0070704_1003349793 143
848 3300005549 Ga0070704_100759479 Ga0070704_1007594792 143
849 3300005563 Ga0068855_100485039 Ga0068855_1004850392 143
850 3300005577 Ga0068857_100457782 Ga0068857_1004577822 143
851 3300005577 Ga0068857_100614039 Ga0068857_1006140392 143
852 3300005577 Ga0068857_101179827 Ga0068857_1011798272 143
853 3300005577 Ga0068857_101181049 Ga0068857_1011810491 143
854 3300005578 Ga0068854_100336664 Ga0068854_1003366642 143
855 3300005615 Ga0070702_100003303 Ga0070702_1000033036 143
856 3300005615 Ga0070702_100536965 Ga0070702_1005369652 143
857 3300005617 Ga0068859_100076104 Ga0068859_1000761043 143
858 3300005617 Ga0068859_100082256 Ga0068859_1000822563 143
859 3300005617 Ga0068859_101565272 Ga0068859_1015652721 143
860 3300005618 Ga0068864_100007660 Ga0068864_1000076607 143
861 3300005618 Ga0068864_100072626 Ga0068864_1000726262 143
862 3300005618 Ga0068864_100109417 Ga0068864_1001094173 143
863 3300005618 Ga0068864_100319606 Ga0068864_1003196062 143
864 3300005618 Ga0068864_101619725 Ga0068864_1016197252 143
865 3300005719 Ga0068861_100037632 Ga0068861_1000376322 143
866 3300005719 Ga0068861_100598295 Ga0068861_1005982952 143
867 3300005719 Ga0068861_100787358 Ga0068861_1007873582 143
868 3300005719 Ga0068861_101047303 Ga0068861_1010473032 143
869 3300005840 Ga0068870_10027719 Ga0068870_100277194 143
870 3300005840 Ga0068870_10075576 Ga0068870_100755762 143
871 3300005840 Ga0068870_10315663 Ga0068870_103156632 143
872 3300005840 Ga0068870_10973515 Ga0068870_109735151 143
873 3300005841 Ga0068863_100071411 Ga0068863_1000714114 143
874 3300005841 Ga0068863_100612072 Ga0068863_1006120722 143
875 3300005841 Ga0068863_100787577 Ga0068863_1007875772 143
876 3300005842 Ga0068858_100265803 Ga0068858_1002658032 143
877 3300005843 Ga0068860_100099306 Ga0068860_1000993062 143
878 3300005843 Ga0068860_100130106 Ga0068860_1001301062 143
879 3300005844 Ga0068862_100574056 Ga0068862_1005740562 143
880 3300005985 Ga0081539_10029095 Ga0081539_100290953 143
881 3300006058 Ga0075432_10456860 Ga0075432_104568601 143
882 3300006237 Ga0097621_100001354 Ga0097621_10000135410 143
883 3300006358 Ga0068871_100003285 Ga0068871_1000032856 143
884 3300006847 Ga0075431_100463168 Ga0075431_1004631681 143
885 3300006852 Ga0075433_10032308 Ga0075433_100323084 143
886 3300006852 Ga0075433_10123122 Ga0075433_101231221 143
887 3300006852 Ga0075433_10160708 Ga0075433_101607084 143
888 3300006852 Ga0075433_10637907 Ga0075433_106379071 143
889 3300006852 Ga0075433_11272307 Ga0075433_112723071 143
890 3300006871 Ga0075434_100058548 Ga0075434_1000585485 143
891 3300006871 Ga0075434_102356380 Ga0075434_1023563801 143
892 3300006880 Ga0075429_100852102 Ga0075429_1008521022 143
893 3300006881 Ga0068865_100384022 Ga0068865_1003840222 143
894 3300006931 Ga0097620_100076103 Ga0097620_1000761033 143
895 3300006931 Ga0097620_100082258 Ga0097620_1000822583 143
896 3300006931 Ga0097620_101565646 Ga0097620_1015656462 143
897 3300009093 Ga0105240_10036772 Ga0105240_100367727 143
898 3300009093 Ga0105240_12003630 Ga0105240_120036301 143
899 3300009094 Ga0111539_10001469 Ga0111539_1000146920 143
900 3300009098 Ga0105245_11306987 Ga0105245_113069871 143
901 3300009101 Ga0105247_10017782 Ga0105247_100177825 143
902 3300009147 Ga0114129_10053343 Ga0114129_100533436 143
903 3300009147 Ga0114129_10329266 Ga0114129_103292664 143
904 3300009148 Ga0105243_10429077 Ga0105243_104290772 143
905 3300009148 Ga0105243_10942561 Ga0105243_109425612 143
906 3300009148 Ga0105243_11953724 Ga0105243_119537241 143
907 3300009174 Ga0105241_10070093 Ga0105241_100700934 143
908 3300009174 Ga0105241_10282215 Ga0105241_102822153 143
909 3300009174 Ga0105241_10574385 Ga0105241_105743852 143
910 3300009174 Ga0105241_10834251 Ga0105241_108342512 143
911 3300009176 Ga0105242_12133979 Ga0105242_121339792 143
912 3300009177 Ga0105248_10001663 Ga0105248_1000166317 143
913 3300009177 Ga0105248_10077288 Ga0105248_100772882 143
914 3300009177 Ga0105248_13260840 Ga0105248_132608401 143
915 3300009545 Ga0105237_10528877 Ga0105237_105288773 143
916 3300009551 Ga0105238_10009780 Ga0105238_100097807 143
917 3300009553 Ga0105249_10167824 Ga0105249_101678243 143
918 3300009553 Ga0105249_11065361 Ga0105249_110653612 143
919 3300010375 Ga0105239_10749224 Ga0105239_107492242 143
920 3300011119 Ga0105246_10031719 Ga0105246_100317195 143
921 3300011119 Ga0105246_10162642 Ga0105246_101626423 143
922 3300013297 Ga0157378_10109696 Ga0157378_101096963 143
923 3300013297 Ga0157378_10675609 Ga0157378_106756092 143
924 3300013307 Ga0157372_10037304 Ga0157372_100373044 143
925 3300013307 Ga0157372_10857264 Ga0157372_108572642 143
926 3300013308 Ga0157375_11955979 Ga0157375_119559792 143
927 3300014325 Ga0163163_10179947 Ga0163163_101799473 143
928 3300014325 Ga0163163_11474052 Ga0163163_114740522 143
929 3300014325 Ga0163163_13182301 Ga0163163_131823011 143
930 3300014326 Ga0157380_10031735 Ga0157380_100317352 143
931 3300014326 Ga0157380_10103104 Ga0157380_101031041 143
932 3300014745 Ga0157377_10103750 Ga0157377_101037503 143
933 3300014968 Ga0157379_10120996 Ga0157379_101209962 143
934 3300014968 Ga0157379_10712097 Ga0157379_107120972 143
935 3300025885 Ga0207653_10243206 Ga0207653_102432062 143
936 3300025900 Ga0207710_10434115 Ga0207710_104341151 143
937 3300025904 Ga0207647_10000502 Ga0207647_1000050228 143
938 3300025908 Ga0207643_10000882 Ga0207643_100008827 143
939 3300025908 Ga0207643_10106872 Ga0207643_101068723 143
940 3300025910 Ga0207684_10043569 Ga0207684_100435693 143
941 3300025910 Ga0207684_10418384 Ga0207684_104183842 143
942 3300025911 Ga0207654_10126422 Ga0207654_101264222 143
943 3300025911 Ga0207654_10607803 Ga0207654_106078032 143
944 3300025913 Ga0207695_10064972 Ga0207695_100649722 143
945 3300025914 Ga0207671_10177748 Ga0207671_101777481 143
946 3300025922 Ga0207646_10029914 Ga0207646_100299144 143
947 3300025922 Ga0207646_10599873 Ga0207646_105998732 143
948 3300025923 Ga0207681_10479387 Ga0207681_104793871 143
949 3300025924 Ga0207694_10899313 Ga0207694_108993132 143
950 3300025925 Ga0207650_10063733 Ga0207650_100637333 143
951 3300025925 Ga0207650_10557791 Ga0207650_105577911 143
952 3300025926 Ga0207659_10476543 Ga0207659_104765432 143
953 3300025926 Ga0207659_10707251 Ga0207659_107072512 143
954 3300025933 Ga0207706_10119607 Ga0207706_101196073 143
955 3300025935 Ga0207709_10009935 Ga0207709_100099357 143
956 3300025935 Ga0207709_10190194 Ga0207709_101901942 143
957 3300025936 Ga0207670_10003418 Ga0207670_100034185 143
958 3300025938 Ga0207704_11363850 Ga0207704_113638501 143
959 3300025940 Ga0207691_10367169 Ga0207691_103671692 143
960 3300025940 Ga0207691_10927578 Ga0207691_109275781 143
961 3300025941 Ga0207711_10015352 Ga0207711_1001535210 143
962 3300025941 Ga0207711_10772195 Ga0207711_107721952 143
963 3300025942 Ga0207689_10320801 Ga0207689_103208013 143
964 3300025945 Ga0207679_10409259 Ga0207679_104092592 143
965 3300025945 Ga0207679_10855401 Ga0207679_108554011 143
966 3300025960 Ga0207651_10215743 Ga0207651_102157431 143
967 3300025972 Ga0207668_10811369 Ga0207668_108113691 143
968 3300025981 Ga0207640_10279333 Ga0207640_102793332 143
969 3300026041 Ga0207639_10074660 Ga0207639_100746603 143
970 3300026075 Ga0207708_10000061 Ga0207708_1000006136 143
971 3300026075 Ga0207708_10003905 Ga0207708_100039056 143
972 3300026075 Ga0207708_10011771 Ga0207708_100117717 143
973 3300026075 Ga0207708_10559911 Ga0207708_105599111 143
974 3300026088 Ga0207641_10021456 Ga0207641_100214565 143
975 3300026088 Ga0207641_10088733 Ga0207641_100887333 143
976 3300026088 Ga0207641_10407544 Ga0207641_104075443 143
977 3300026088 Ga0207641_11097964 Ga0207641_110979642 143
978 3300026095 Ga0207676_10030471 Ga0207676_100304716 143
979 3300026095 Ga0207676_10505199 Ga0207676_105051992 143
980 3300026095 Ga0207676_10598868 Ga0207676_105988682 143
981 3300026095 Ga0207676_10886295 Ga0207676_108862951 143
982 3300026095 Ga0207676_10902602 Ga0207676_109026021 143
983 3300026116 Ga0207674_10062925 Ga0207674_100629255 143
984 3300026116 Ga0207674_10091041 Ga0207674_100910413 143
985 3300026116 Ga0207674_11112653 Ga0207674_111126532 143
986 3300026116 Ga0207674_11984298 Ga0207674_119842981 143
987 3300026118 Ga0207675_100014671 Ga0207675_1000146716 143
988 3300026118 Ga0207675_100137528 Ga0207675_1001375282 143
989 3300026121 Ga0207683_10193041 Ga0207683_101930412 143
990 3300026142 Ga0207698_10105970 Ga0207698_101059703 143
991 3300026142 Ga0207698_10308515 Ga0207698_103085153 143
992 3300027907 Ga0207428_10283238 Ga0207428_102832381 143
993 3300028380 Ga0268265_10135975 Ga0268265_101359752 143
994 3300028380 Ga0268265_10322505 Ga0268265_103225052 143
995 3300028380 Ga0268265_10551586 Ga0268265_105515862 143
996 3300028381 Ga0268264_10006536 Ga0268264_100065363 143
997 3300031548 Ga0307408_100818120 Ga0307408_1008181201 143
998 3300031911 Ga0307412_11097708 Ga0307412_110977082 143
999 3300032005 Ga0307411_10216827 Ga0307411_102168271 143
1000 3300037418 Ga0395900_0163643 Ga0395900_0163643_1045_1476 143
1001 3300037418 Ga0395900_0177050 Ga0395900_0177050_299_730 143
1002 3300037418 Ga0395900_0550887 Ga0395900_0550887_140_598 143
1003 3300037466 Ga0395898_0341776 Ga0395898_0341776_906_1337 143
1004 3300038443 Ga0395901_0428296 Ga0395901_0428296_727_1185 143
1005 3300041997 Ga0439431_0099174 Ga0439431_0099174_281_727 143
1006 3300042012 Ga0439455_0008734 Ga0439455_0008734_630_1061 143
1007 3300042157 Ga0439458_0009743 Ga0439458_0009743_1197_1628 143
1008 3300042876 Ga0451577_1644934 Ga0451577_1644934_106_537 143
1009 3300048909 Ga0496106_0059689 Ga0496106_0059689_430_861 143
1010 3300048913 Ga0496110_0200101 Ga0496110_0200101_1328_1759 143
1011 3300048915 Ga0496112_0232018 Ga0496112_0232018_140_592 143
1012 3300048915 Ga0496112_0322164 Ga0496112_0322164_997_1428 143
1013 3300048915 Ga0496112_1217422 Ga0496112_1217422_178_609 143
1014 3300049513 Ga0501290_008692 Ga0501290_008692_40_471 143
1015 3300049514 Ga0501291_006100 Ga0501291_006100_688_1119 143
1016 3300049515 Ga0501292_006230 Ga0501292_006230_542_973 143
1017 3300049517 Ga0501294_007750 Ga0501294_007750_142_573 143
1018 3300049519 Ga0501296_000186 Ga0501296_000186_3551_3982 143
1019 3300049520 Ga0501297_000526 Ga0501297_000526_633_1064 143
1020 3300049521 Ga0501298_007749 Ga0501298_007749_631_1062 143
1021 3300049522 Ga0501299_000948 Ga0501299_000948_2333_2764 143
1022 3300049574 Ga0501038_0007200 Ga0501038_0007200_1731_2183 143
1023 3300049591 Ga0501075_0340260 Ga0501075_0340260_470_916 143
1024 3300049649 Ga0501198_068401 Ga0501198_068401_20_451 143
1025 3300049652 Ga0501202_020467 Ga0501202_020467_466_897 143
1026 3300049660 Ga0501216_037190 Ga0501216_037190_345_776 143
1027 3300049664 Ga0501224_039528 Ga0501224_039528_250_681 143
1028 3300049668 Ga0501233_010910 Ga0501233_010910_647_1078 143
1029 3300049669 Ga0501235_016418 Ga0501235_016418_631_1062 143
1030 3300049679 Ga0501249_116063 Ga0501249_116063_190_621 143
1031 3300049683 Ga0501253_021611 Ga0501253_021611_162_593 143
1032 3300049689 Ga0501260_007902 Ga0501260_007902_555_986 143
1033 3300049705 Ga0501225_0003895 Ga0501225_0003895_3143_3574 143
1034 3300049706 Ga0501229_019004 Ga0501229_019004_68_499 143
1035 3300049707 Ga0501234_026874 Ga0501234_026874_14_445 143
1036 3300049707 Ga0501234_082537 Ga0501234_082537_68_499 143
1037 3300049760 Ga0501263_020496 Ga0501263_020496_141_572 143
1038 3300049761 Ga0501264_004315 Ga0501264_004315_536_967 143
1039 3300049762 Ga0501265_007485 Ga0501265_007485_411_842 143
1040 3300049765 Ga0501268_057442 Ga0501268_057442_294_725 143
1041 3300049768 Ga0501271_031811 Ga0501271_031811_90_521 143
1042 3300049771 Ga0501274_001355 Ga0501274_001355_534_965 143
1043 3300049774 Ga0501278_003167 Ga0501278_003167_36_467 143
1044 3300049778 Ga0501282_040751 Ga0501282_040751_88_519 143
1045 3300049779 Ga0501283_006164 Ga0501283_006164_1033_1464 143
1046 3300049853 Ga0501226_013419 Ga0501226_013419_83_514 143
1047 3300050507 nmdc:mga05p37_101353_c1 nmdc:mga05p37_101353_c1_2623_3054 143
1048 3300050507 nmdc:mga05p37_930106_c1 nmdc:mga05p37_930106_c1_450_896 143
1049 3300050508 nmdc:mga09592_144706_c1 nmdc:mga09592_144706_c1_721_1164 143
1050 3300050509 nmdc:mga0qj67_48770_c1 nmdc:mga0qj67_48770_c1_223_666 143
1051 3300050510 nmdc:mga06r32_151961_c1 nmdc:mga06r32_151961_c1_39_482 143
1052 3300050511 nmdc:mga08y16_436742_c1 nmdc:mga08y16_436742_c1_120_551 143
1053 3300050513 nmdc:mga0rr50_845755_c1 nmdc:mga0rr50_845755_c1_142_591 143
1054 3300050515 nmdc:mga0a205_124443_c1 nmdc:mga0a205_124443_c1_2013_2444 143
1055 3300050515 nmdc:mga0a205_233499_c1 nmdc:mga0a205_233499_c1_1178_1618 143
1056 3300050515 nmdc:mga0a205_27719_c2 nmdc:mga0a205_27719_c2_1491_1922 143
1057 3300050515 nmdc:mga0a205_6874_c1 nmdc:mga0a205_6874_c1_260_691 143
1058 3300050515 nmdc:mga0a205_991763_c1 nmdc:mga0a205_991763_c1_10_441 143
1059 3300054114 Ga0501084_0253607 Ga0501084_0253607_271_717 143
1060 3300061734 Ga0530510_1190407 Ga0530510_1190407_18_449 143

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03745

DUF309

Domain of unknown function (DUF309)

38

97

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6a09-assembly1.cif.gz_A salmonella typhi yfdx in the p222 space group 0.9046 53 92
2w2u-assembly2.cif.gz_B structural insight into the interaction between archaeal escrt-iii and aaa-atpase 0.8163 48 116
2ijq-assembly1.cif.gz_A crystal structure of protein rrnac1037 from haloarcula marismortui, pfam duf309 0.815 19 135
2w2u-assembly1.cif.gz_A structural insight into the interaction between archaeal escrt-iii and aaa-atpase 0.8141 47 116
2ijq-assembly2.cif.gz_B crystal structure of protein rrnac1037 from haloarcula marismortui, pfam duf309 0.8117 19 135
ID Description Score Start End Superfamily
af_P76510_96_156_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9399 17 71 1.25.40.10
af_O80675_54_197_1.10.3450.10 Mainly Alpha;Orthogonal Bundle;Hyaluronidase domain-like;TTHA0068-like 0.9154 20 116 1.10.3450.10
af_P76510_96_156_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.839 17 71 1.25.40.10
af_Q2FY75_1_133_1.10.3450.10 Mainly Alpha;Orthogonal Bundle;Hyaluronidase domain-like;TTHA0068-like 0.822 19 137 1.10.3450.10
2w2uA00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.8141 47 116 1.20.58.80
ID Description Score Start End GO Terms
AF-A0A2V8LQU5-F1-model_v4 DUF309 domain-containing protein 0.9869 8 140
AF-A0A2V8PQL7-F1-model_v4 DUF309 domain-containing protein 0.9848 7 83
AF-A0A2V8LQU5-F1-model_v4 DUF309 domain-containing protein 0.9653 8 140
AF-A0A1Q7NGE4-F1-model_v4 DUF309 domain-containing protein 0.9531 2 141
AF-A0A2V8PQL7-F1-model_v4 DUF309 domain-containing protein 0.9484 7 83

Feature Viewer

pLDDT pTM Quality
93.75 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map