F489266
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1060 | 292 | 1060 | 143 |
Family's Representative Sequence
| Representative Sequence | 3300005840|Ga0068870_10315663|Ga0068870_103156632 |
| Length | 161 |
| Sequence | MWLCFLLLVVTFFVTKSLETEIDIAYTDAHIAAYPIEYIAGIDLYNAGEFHAAHDAWEERWMGEVGPKEKLFLQAMIQSAVAFHHLDIGRPGAARQMYLRAKEKFARLGTPVFMSLDLDDYQVQLDSALSWLLSVADPRELAMPEINPPKIRLLPRVYEFD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 82 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 87 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 88 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 89 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 96 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 97 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 114 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 187 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 191 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 192 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 193 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 194 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 196 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 197 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 198 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 199 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 200 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 202 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 204 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 207 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 208 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 209 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 210 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 211 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 212 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 213 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 214 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 215 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 226 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 227 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 228 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 231 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 232 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 233 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 234 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 235 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 236 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 237 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 238 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 239 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 240 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 241 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 242 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 243 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 246 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 247 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 248 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 249 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 250 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 251 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 252 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 253 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 254 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 255 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 256 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 257 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 258 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 259 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 260 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 261 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 262 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 263 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 264 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 265 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 266 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 267 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 268 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 269 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 270 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 271 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 272 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 273 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 274 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 275 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 276 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 277 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 278 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 279 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 280 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 281 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 282 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.26 |
| Rhizosphere | 97.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1874972 | 2162886007 | Bacteria | 915 |
| 2 | SwRhRL2b_contig_983262 | 2162886007 | Bacteria | 872 |
| 3 | CNAas_1001022 | 3300000532 | Unclassified | 2584 |
| 4 | LJNas_1024266 | 3300000546 | Unclassified | 648 |
| 5 | JGI24749J21850_1023508 | 3300002076 | Unclassified | 876 |
| 6 | JGI24751J29686_10000107 | 3300002459 | Bacteria | 44982 |
| 7 | JGI25406J46586_10022414 | 3300003203 | Bacteria | 2517 |
| 8 | JGI25406J46586_10026276 | 3300003203 | Bacteria | 2247 |
| 9 | rootL2_10229176 | 3300003322 | Unclassified | 1785 |
| 10 | Ga0065714_10064435 | 3300005288 | Bacteria | 121919 |
| 11 | Ga0065714_10485774 | 3300005288 | Unclassified | 532 |
| 12 | Ga0065704_10002076 | 3300005289 | Bacteria | 7544 |
| 13 | Ga0065704_10140109 | 3300005289 | Bacteria | 1526 |
| 14 | Ga0065704_10201753 | 3300005289 | Bacteria | 1143 |
| 15 | Ga0065704_10237409 | 3300005289 | Bacteria | 1018 |
| 16 | Ga0065704_10393606 | 3300005289 | Unclassified | 759 |
| 17 | Ga0065704_10620604 | 3300005289 | Unclassified | 597 |
| 18 | Ga0065712_10000118 | 3300005290 | Bacteria | 121959 |
| 19 | Ga0065712_10002294 | 3300005290 | Unclassified | 4858 |
| 20 | Ga0065712_10005369 | 3300005290 | Bacteria | 3175 |
| 21 | Ga0065712_10005863 | 3300005290 | Bacteria | 3316 |
| 22 | Ga0065712_10018041 | 3300005290 | Unclassified | 1666 |
| 23 | Ga0065712_10073348 | 3300005290 | Unclassified | 4421 |
| 24 | Ga0065715_10007562 | 3300005293 | Unclassified | 2934 |
| 25 | Ga0065715_10015929 | 3300005293 | Bacteria | 2146 |
| 26 | Ga0065715_10089159 | 3300005293 | Bacteria | 13317 |
| 27 | Ga0065715_10090332 | 3300005293 | Bacteria | 7197 |
| 28 | Ga0065715_10099361 | 3300005293 | Bacteria | 3373 |
| 29 | Ga0065715_10100976 | 3300005293 | Unclassified | 3248 |
| 30 | Ga0065715_10110229 | 3300005293 | Bacteria | 2630 |
| 31 | Ga0065715_10123838 | 3300005293 | Unclassified | 2168 |
| 32 | Ga0065715_10206344 | 3300005293 | Bacteria | 1320 |
| 33 | Ga0065715_10260587 | 3300005293 | Bacteria | 1139 |
| 34 | Ga0065715_10282463 | 3300005293 | Unclassified | 1083 |
| 35 | Ga0065715_10310441 | 3300005293 | Bacteria | 1022 |
| 36 | Ga0065715_10399621 | 3300005293 | Unclassified | 883 |
| 37 | Ga0065715_10584042 | 3300005293 | Unclassified | 718 |
| 38 | Ga0065715_10779036 | 3300005293 | Unclassified | 618 |
| 39 | Ga0065707_10001813 | 3300005295 | Bacteria | 12883 |
| 40 | Ga0065707_10138063 | 3300005295 | Unclassified | 1811 |
| 41 | Ga0065707_10144234 | 3300005295 | Unclassified | 1733 |
| 42 | Ga0065707_10253448 | 3300005295 | Bacteria | 1112 |
| 43 | Ga0065707_10340592 | 3300005295 | Unclassified | 908 |
| 44 | Ga0065707_10398166 | 3300005295 | Bacteria | 856 |
| 45 | Ga0070676_10090439 | 3300005328 | Bacteria | 1874 |
| 46 | Ga0070676_10223646 | 3300005328 | Unclassified | 1244 |
| 47 | Ga0070676_10250226 | 3300005328 | Bacteria | 1182 |
| 48 | Ga0070676_10361062 | 3300005328 | Bacteria | 1001 |
| 49 | Ga0070676_11087608 | 3300005328 | Unclassified | 604 |
| 50 | Ga0070683_101073279 | 3300005329 | Unclassified | 773 |
| 51 | Ga0070690_100005943 | 3300005330 | Bacteria | 6891 |
| 52 | Ga0070690_100052256 | 3300005330 | Bacteria | 2611 |
| 53 | Ga0070690_100080578 | 3300005330 | Bacteria | 2129 |
| 54 | Ga0070690_101080185 | 3300005330 | Unclassified | 636 |
| 55 | Ga0070670_100001037 | 3300005331 | Bacteria | 22003 |
| 56 | Ga0070670_100006797 | 3300005331 | Bacteria | 9682 |
| 57 | Ga0070670_100017767 | 3300005331 | Bacteria | 6102 |
| 58 | Ga0070670_100632979 | 3300005331 | Unclassified | 959 |
| 59 | Ga0070677_10488909 | 3300005333 | Unclassified | 665 |
| 60 | Ga0068869_100025113 | 3300005334 | Bacteria | 4134 |
| 61 | Ga0068869_100039742 | 3300005334 | Bacteria | 3360 |
| 62 | Ga0068869_100107545 | 3300005334 | Bacteria | 2118 |
| 63 | Ga0068869_100192963 | 3300005334 | Unclassified | 1602 |
| 64 | Ga0068869_100366862 | 3300005334 | Bacteria | 1177 |
| 65 | Ga0068869_100393077 | 3300005334 | Bacteria | 1139 |
| 66 | Ga0068869_101906008 | 3300005334 | Bacteria | 533 |
| 67 | Ga0070666_10032891 | 3300005335 | Bacteria | 3428 |
| 68 | Ga0070666_10184527 | 3300005335 | Bacteria | 1464 |
| 69 | Ga0070680_100016262 | 3300005336 | Bacteria | 5853 |
| 70 | Ga0070680_100393408 | 3300005336 | Unclassified | 1181 |
| 71 | Ga0070682_100000051 | 3300005337 | Bacteria | 123476 |
| 72 | Ga0070682_100003753 | 3300005337 | Bacteria | 8445 |
| 73 | Ga0070682_100006511 | 3300005337 | Bacteria | 6554 |
| 74 | Ga0070682_100241834 | 3300005337 | Unclassified | 1296 |
| 75 | Ga0068868_100025154 | 3300005338 | Unclassified | 4523 |
| 76 | Ga0068868_100066068 | 3300005338 | Bacteria | 2875 |
| 77 | Ga0068868_100074948 | 3300005338 | Bacteria | 2704 |
| 78 | Ga0068868_100198035 | 3300005338 | Bacteria | 1673 |
| 79 | Ga0068868_100865720 | 3300005338 | Unclassified | 819 |
| 80 | Ga0070660_100089303 | 3300005339 | Bacteria | 2428 |
| 81 | Ga0070689_100008505 | 3300005340 | Bacteria | 7232 |
| 82 | Ga0070689_100212369 | 3300005340 | Bacteria | 1584 |
| 83 | Ga0070689_100249413 | 3300005340 | Unclassified | 1464 |
| 84 | Ga0070689_101057564 | 3300005340 | Unclassified | 724 |
| 85 | Ga0070687_100002881 | 3300005343 | Bacteria | 6576 |
| 86 | Ga0070687_100870944 | 3300005343 | Unclassified | 644 |
| 87 | Ga0070661_100351779 | 3300005344 | Unclassified | 1156 |
| 88 | Ga0070661_100938070 | 3300005344 | Unclassified | 716 |
| 89 | Ga0070692_10060728 | 3300005345 | Bacteria | 1991 |
| 90 | Ga0070692_10098348 | 3300005345 | Unclassified | 1600 |
| 91 | Ga0070692_10178320 | 3300005345 | Unclassified | 1230 |
| 92 | Ga0070692_10237931 | 3300005345 | Bacteria | 1084 |
| 93 | Ga0070692_10268256 | 3300005345 | Bacteria | 1029 |
| 94 | Ga0070692_10335894 | 3300005345 | Bacteria | 934 |
| 95 | Ga0070692_10390060 | 3300005345 | Unclassified | 876 |
| 96 | Ga0070692_10450274 | 3300005345 | Unclassified | 824 |
| 97 | Ga0070692_10497103 | 3300005345 | Unclassified | 790 |
| 98 | Ga0070692_10650010 | 3300005345 | Bacteria | 704 |
| 99 | Ga0070668_100003898 | 3300005347 | Bacteria | 11016 |
| 100 | Ga0070668_100314715 | 3300005347 | Unclassified | 1316 |
| 101 | Ga0070669_100000729 | 3300005353 | Bacteria | 23953 |
| 102 | Ga0070669_100007926 | 3300005353 | Bacteria | 7589 |
| 103 | Ga0070669_100049912 | 3300005353 | Bacteria | 3056 |
| 104 | Ga0070669_100056435 | 3300005353 | Bacteria | 2879 |
| 105 | Ga0070669_100122299 | 3300005353 | Unclassified | 1987 |
| 106 | Ga0070669_100139726 | 3300005353 | Bacteria | 1866 |
| 107 | Ga0070669_100725315 | 3300005353 | Unclassified | 841 |
| 108 | Ga0070669_101210195 | 3300005353 | Bacteria | 653 |
| 109 | Ga0070675_100427867 | 3300005354 | Bacteria | 1184 |
| 110 | Ga0070675_100482761 | 3300005354 | Unclassified | 1115 |
| 111 | Ga0070675_100532517 | 3300005354 | Unclassified | 1061 |
| 112 | Ga0070671_100005506 | 3300005355 | Bacteria | 10097 |
| 113 | Ga0070671_100143151 | 3300005355 | Bacteria | 2018 |
| 114 | Ga0070671_101374756 | 3300005355 | Bacteria | 623 |
| 115 | Ga0070674_100362285 | 3300005356 | Unclassified | 1174 |
| 116 | Ga0070674_100879921 | 3300005356 | Bacteria | 779 |
| 117 | Ga0070673_100082896 | 3300005364 | Unclassified | 2604 |
| 118 | Ga0070673_100281582 | 3300005364 | Bacteria | 1459 |
| 119 | Ga0070673_100310862 | 3300005364 | Unclassified | 1390 |
| 120 | Ga0070673_100464799 | 3300005364 | Bacteria | 1140 |
| 121 | Ga0070673_100920831 | 3300005364 | Unclassified | 811 |
| 122 | Ga0070673_101494164 | 3300005364 | Unclassified | 637 |
| 123 | Ga0070673_101620656 | 3300005364 | Bacteria | 612 |
| 124 | Ga0070688_100111543 | 3300005365 | Bacteria | 1819 |
| 125 | Ga0070688_100649716 | 3300005365 | Unclassified | 812 |
| 126 | Ga0070688_101034628 | 3300005365 | Bacteria | 654 |
| 127 | Ga0070659_100025535 | 3300005366 | Bacteria | 4539 |
| 128 | Ga0070659_100061476 | 3300005366 | Bacteria | 2968 |
| 129 | Ga0070659_100652277 | 3300005366 | Unclassified | 907 |
| 130 | Ga0070659_100665752 | 3300005366 | Unclassified | 898 |
| 131 | Ga0070667_100020193 | 3300005367 | Bacteria | 5531 |
| 132 | Ga0070667_100085781 | 3300005367 | Unclassified | 2701 |
| 133 | Ga0070703_10013066 | 3300005406 | Bacteria | 2354 |
| 134 | Ga0070703_10273453 | 3300005406 | Unclassified | 694 |
| 135 | Ga0070709_10761512 | 3300005434 | Unclassified | 757 |
| 136 | Ga0070701_10032396 | 3300005438 | Unclassified | 2602 |
| 137 | Ga0070701_10076093 | 3300005438 | Unclassified | 1806 |
| 138 | Ga0070701_10877009 | 3300005438 | Unclassified | 618 |
| 139 | Ga0070701_11381406 | 3300005438 | Unclassified | 506 |
| 140 | Ga0070705_100028934 | 3300005440 | Unclassified | 3040 |
| 141 | Ga0070705_100046690 | 3300005440 | Bacteria | 2498 |
| 142 | Ga0070705_100049793 | 3300005440 | Unclassified | 2434 |
| 143 | Ga0070705_100052194 | 3300005440 | Unclassified | 2388 |
| 144 | Ga0070705_100225949 | 3300005440 | Bacteria | 1299 |
| 145 | Ga0070705_100318141 | 3300005440 | Bacteria | 1122 |
| 146 | Ga0070705_100435808 | 3300005440 | Unclassified | 979 |
| 147 | Ga0070705_100514269 | 3300005440 | Unclassified | 911 |
| 148 | Ga0070700_100000092 | 3300005441 | Bacteria | 60316 |
| 149 | Ga0070700_100013167 | 3300005441 | Unclassified | 4640 |
| 150 | Ga0070700_100024519 | 3300005441 | Bacteria | 3542 |
| 151 | Ga0070700_100035616 | 3300005441 | Unclassified | 3013 |
| 152 | Ga0070700_100066629 | 3300005441 | Bacteria | 2286 |
| 153 | Ga0070700_100082032 | 3300005441 | Bacteria | 2084 |
| 154 | Ga0070700_100629017 | 3300005441 | Bacteria | 845 |
| 155 | Ga0070694_100009639 | 3300005444 | Bacteria | 5927 |
| 156 | Ga0070694_100014362 | 3300005444 | Unclassified | 4957 |
| 157 | Ga0070694_100021114 | 3300005444 | Unclassified | 4158 |
| 158 | Ga0070694_100030338 | 3300005444 | Bacteria | 3536 |
| 159 | Ga0070694_100063279 | 3300005444 | Unclassified | 2529 |
| 160 | Ga0070694_100066438 | 3300005444 | Bacteria | 2474 |
| 161 | Ga0070694_100167011 | 3300005444 | Bacteria | 1619 |
| 162 | Ga0070694_100220243 | 3300005444 | Bacteria | 1423 |
| 163 | Ga0070694_100330415 | 3300005444 | Unclassified | 1176 |
| 164 | Ga0070694_100856847 | 3300005444 | Bacteria | 748 |
| 165 | Ga0070694_101269899 | 3300005444 | Bacteria | 619 |
| 166 | Ga0070708_100002362 | 3300005445 | Bacteria | 14604 |
| 167 | Ga0070708_100553254 | 3300005445 | Unclassified | 1085 |
| 168 | Ga0070708_100826520 | 3300005445 | Unclassified | 871 |
| 169 | Ga0070678_100084501 | 3300005456 | Bacteria | 2416 |
| 170 | Ga0070678_100265509 | 3300005456 | Bacteria | 1445 |
| 171 | Ga0070678_100459123 | 3300005456 | Bacteria | 1117 |
| 172 | Ga0070678_100992586 | 3300005456 | Unclassified | 771 |
| 173 | Ga0070662_100140783 | 3300005457 | Bacteria | 1869 |
| 174 | Ga0070662_100172586 | 3300005457 | Bacteria | 1699 |
| 175 | Ga0070662_100728486 | 3300005457 | Unclassified | 840 |
| 176 | Ga0070662_101123321 | 3300005457 | Unclassified | 675 |
| 177 | Ga0070681_10002322 | 3300005458 | Bacteria | 17395 |
| 178 | Ga0070681_10008066 | 3300005458 | Bacteria | 10307 |
| 179 | Ga0070681_10022916 | 3300005458 | Bacteria | 6276 |
| 180 | Ga0070681_10230401 | 3300005458 | Bacteria | 1767 |
| 181 | Ga0068867_100014031 | 3300005459 | Bacteria | 5676 |
| 182 | Ga0068867_100025690 | 3300005459 | Bacteria | 4227 |
| 183 | Ga0068867_100088519 | 3300005459 | Unclassified | 2346 |
| 184 | Ga0068867_100252513 | 3300005459 | Unclassified | 1434 |
| 185 | Ga0068867_100266958 | 3300005459 | Unclassified | 1397 |
| 186 | Ga0068867_101956888 | 3300005459 | Unclassified | 553 |
| 187 | Ga0070685_10293847 | 3300005466 | Bacteria | 1092 |
| 188 | Ga0070685_11066855 | 3300005466 | Bacteria | 609 |
| 189 | Ga0070685_11297953 | 3300005466 | Bacteria | 556 |
| 190 | Ga0070706_100000097 | 3300005467 | Bacteria | 106315 |
| 191 | Ga0070706_100021785 | 3300005467 | Bacteria | 5901 |
| 192 | Ga0070706_100021984 | 3300005467 | Bacteria | 5874 |
| 193 | Ga0070706_100090285 | 3300005467 | Bacteria | 2841 |
| 194 | Ga0070706_100937058 | 3300005467 | Unclassified | 799 |
| 195 | Ga0070707_100026729 | 3300005468 | Bacteria | 5482 |
| 196 | Ga0070707_100208076 | 3300005468 | Bacteria | 1907 |
| 197 | Ga0070707_100317534 | 3300005468 | Bacteria | 1514 |
| 198 | Ga0070707_100861749 | 3300005468 | Bacteria | 870 |
| 199 | Ga0070698_100003588 | 3300005471 | Bacteria | 17057 |
| 200 | Ga0070698_100006142 | 3300005471 | Bacteria | 13081 |
| 201 | Ga0070698_100029558 | 3300005471 | Bacteria | 5690 |
| 202 | Ga0070698_100040853 | 3300005471 | Bacteria | 4765 |
| 203 | Ga0070699_100009745 | 3300005518 | Bacteria | 8311 |
| 204 | Ga0070699_100038140 | 3300005518 | Bacteria | 4161 |
| 205 | Ga0070699_100437859 | 3300005518 | Unclassified | 1184 |
| 206 | Ga0070699_100502529 | 3300005518 | Bacteria | 1101 |
| 207 | Ga0070699_100556264 | 3300005518 | Bacteria | 1044 |
| 208 | Ga0070699_101987188 | 3300005518 | Unclassified | 532 |
| 209 | Ga0070679_100082638 | 3300005530 | Bacteria | 3202 |
| 210 | Ga0070684_101935542 | 3300005535 | Unclassified | 556 |
| 211 | Ga0070697_100000176 | 3300005536 | Bacteria | 52306 |
| 212 | Ga0070697_100026034 | 3300005536 | Bacteria | 4667 |
| 213 | Ga0070697_101135558 | 3300005536 | Bacteria | 696 |
| 214 | Ga0070697_101298482 | 3300005536 | Unclassified | 649 |
| 215 | Ga0070697_101739318 | 3300005536 | Unclassified | 558 |
| 216 | Ga0068853_100041243 | 3300005539 | Unclassified | 3941 |
| 217 | Ga0068853_100051590 | 3300005539 | Unclassified | 3541 |
| 218 | Ga0068853_100100877 | 3300005539 | Bacteria | 2552 |
| 219 | Ga0068853_100315269 | 3300005539 | Bacteria | 1449 |
| 220 | Ga0068853_100824328 | 3300005539 | Unclassified | 889 |
| 221 | Ga0070672_100220655 | 3300005543 | Bacteria | 1590 |
| 222 | Ga0070672_100384674 | 3300005543 | Bacteria | 1200 |
| 223 | Ga0070672_100799659 | 3300005543 | Unclassified | 830 |
| 224 | Ga0070672_101092064 | 3300005543 | Bacteria | 709 |
| 225 | Ga0070672_101397763 | 3300005543 | Unclassified | 626 |
| 226 | Ga0070686_100072686 | 3300005544 | Unclassified | 2256 |
| 227 | Ga0070695_100039223 | 3300005545 | Unclassified | 2993 |
| 228 | Ga0070695_100055135 | 3300005545 | Bacteria | 2561 |
| 229 | Ga0070695_100083928 | 3300005545 | Bacteria | 2112 |
| 230 | Ga0070695_100088960 | 3300005545 | Bacteria | 2057 |
| 231 | Ga0070695_100109706 | 3300005545 | Unclassified | 1870 |
| 232 | Ga0070695_100139498 | 3300005545 | Bacteria | 1679 |
| 233 | Ga0070695_100141530 | 3300005545 | Unclassified | 1669 |
| 234 | Ga0070695_100509117 | 3300005545 | Unclassified | 932 |
| 235 | Ga0070695_100750907 | 3300005545 | Unclassified | 778 |
| 236 | Ga0070696_100018228 | 3300005546 | Bacteria | 4742 |
| 237 | Ga0070696_100045041 | 3300005546 | Unclassified | 3056 |
| 238 | Ga0070696_100061942 | 3300005546 | Bacteria | 2618 |
| 239 | Ga0070696_100192430 | 3300005546 | Bacteria | 1519 |
| 240 | Ga0070696_100276096 | 3300005546 | Bacteria | 1279 |
| 241 | Ga0070696_100389728 | 3300005546 | Bacteria | 1088 |
| 242 | Ga0070696_100663725 | 3300005546 | Bacteria | 846 |
| 243 | Ga0070696_100865349 | 3300005546 | Unclassified | 748 |
| 244 | Ga0070696_100871939 | 3300005546 | Unclassified | 745 |
| 245 | Ga0070696_100954400 | 3300005546 | Unclassified | 714 |
| 246 | Ga0070693_100000305 | 3300005547 | Bacteria | 22777 |
| 247 | Ga0070693_100043186 | 3300005547 | Bacteria | 2545 |
| 248 | Ga0070693_100065843 | 3300005547 | Bacteria | 2119 |
| 249 | Ga0070693_100066277 | 3300005547 | Unclassified | 2113 |
| 250 | Ga0070693_100078078 | 3300005547 | Unclassified | 1966 |
| 251 | Ga0070693_100406452 | 3300005547 | Unclassified | 945 |
| 252 | Ga0070665_100031856 | 3300005548 | Bacteria | 5307 |
| 253 | Ga0070665_100259179 | 3300005548 | Unclassified | 1740 |
| 254 | Ga0070665_100366628 | 3300005548 | Bacteria | 1447 |
| 255 | Ga0070704_100019639 | 3300005549 | Unclassified | 4345 |
| 256 | Ga0070704_100028429 | 3300005549 | Bacteria | 3720 |
| 257 | Ga0070704_100044294 | 3300005549 | Unclassified | 3091 |
| 258 | Ga0070704_100087485 | 3300005549 | Unclassified | 2312 |
| 259 | Ga0070704_100334979 | 3300005549 | Bacteria | 1272 |
| 260 | Ga0070704_100688425 | 3300005549 | Unclassified | 906 |
| 261 | Ga0070704_100759479 | 3300005549 | Unclassified | 864 |
| 262 | Ga0070704_100904995 | 3300005549 | Bacteria | 794 |
| 263 | Ga0070704_100910981 | 3300005549 | Unclassified | 791 |
| 264 | Ga0068855_100485039 | 3300005563 | Unclassified | 1345 |
| 265 | Ga0068855_102324219 | 3300005563 | Unclassified | 536 |
| 266 | Ga0070664_100011220 | 3300005564 | Bacteria | 7268 |
| 267 | Ga0070664_100125031 | 3300005564 | Bacteria | 2255 |
| 268 | Ga0070664_100177205 | 3300005564 | Bacteria | 1893 |
| 269 | Ga0070664_100192721 | 3300005564 | Bacteria | 1816 |
| 270 | Ga0070664_100273588 | 3300005564 | Unclassified | 1522 |
| 271 | Ga0070664_100526083 | 3300005564 | Unclassified | 1092 |
| 272 | Ga0070664_100683934 | 3300005564 | Unclassified | 955 |
| 273 | Ga0068857_100000277 | 3300005577 | Bacteria | 35101 |
| 274 | Ga0068857_100067092 | 3300005577 | Bacteria | 3193 |
| 275 | Ga0068857_100457782 | 3300005577 | Unclassified | 1193 |
| 276 | Ga0068857_100614039 | 3300005577 | Bacteria | 1028 |
| 277 | Ga0068857_100909935 | 3300005577 | Bacteria | 844 |
| 278 | Ga0068857_101179827 | 3300005577 | Unclassified | 741 |
| 279 | Ga0068857_101181049 | 3300005577 | Unclassified | 740 |
| 280 | Ga0068854_100122249 | 3300005578 | Bacteria | 1978 |
| 281 | Ga0068854_100130332 | 3300005578 | Bacteria | 1919 |
| 282 | Ga0068854_100336664 | 3300005578 | Unclassified | 1231 |
| 283 | Ga0068854_100640828 | 3300005578 | Unclassified | 911 |
| 284 | Ga0068854_101356184 | 3300005578 | Bacteria | 642 |
| 285 | Ga0068856_101984724 | 3300005614 | Unclassified | 592 |
| 286 | Ga0070702_100003303 | 3300005615 | Bacteria | 7192 |
| 287 | Ga0070702_100010068 | 3300005615 | Bacteria | 4646 |
| 288 | Ga0070702_100017240 | 3300005615 | Bacteria | 3722 |
| 289 | Ga0070702_100122575 | 3300005615 | Archaea | 1629 |
| 290 | Ga0070702_100222670 | 3300005615 | Unclassified | 1262 |
| 291 | Ga0070702_100322854 | 3300005615 | Bacteria | 1077 |
| 292 | Ga0070702_100536965 | 3300005615 | Bacteria | 865 |
| 293 | Ga0068852_100145754 | 3300005616 | Unclassified | 2196 |
| 294 | Ga0068852_100746137 | 3300005616 | Bacteria | 991 |
| 295 | Ga0068859_100032266 | 3300005617 | Bacteria | 5261 |
| 296 | Ga0068859_100047921 | 3300005617 | Bacteria | 4293 |
| 297 | Ga0068859_100056252 | 3300005617 | Bacteria | 3958 |
| 298 | Ga0068859_100069646 | 3300005617 | Bacteria | 3553 |
| 299 | Ga0068859_100076104 | 3300005617 | Bacteria | 3397 |
| 300 | Ga0068859_100082256 | 3300005617 | Bacteria | 3263 |
| 301 | Ga0068859_100091632 | 3300005617 | Unclassified | 3090 |
| 302 | Ga0068859_100155199 | 3300005617 | Unclassified | 2366 |
| 303 | Ga0068859_100197537 | 3300005617 | Bacteria | 2096 |
| 304 | Ga0068859_100264536 | 3300005617 | Unclassified | 1812 |
| 305 | Ga0068859_100306733 | 3300005617 | Unclassified | 1681 |
| 306 | Ga0068859_100771954 | 3300005617 | Unclassified | 1049 |
| 307 | Ga0068859_100918069 | 3300005617 | Unclassified | 960 |
| 308 | Ga0068859_101078732 | 3300005617 | Bacteria | 883 |
| 309 | Ga0068859_101447938 | 3300005617 | Unclassified | 758 |
| 310 | Ga0068859_101565272 | 3300005617 | Unclassified | 728 |
| 311 | Ga0068859_101594401 | 3300005617 | Bacteria | 721 |
| 312 | Ga0068859_101691498 | 3300005617 | Unclassified | 699 |
| 313 | Ga0068864_100001610 | 3300005618 | Bacteria | 18609 |
| 314 | Ga0068864_100007660 | 3300005618 | Bacteria | 8893 |
| 315 | Ga0068864_100024460 | 3300005618 | Bacteria | 5082 |
| 316 | Ga0068864_100072626 | 3300005618 | Unclassified | 2999 |
| 317 | Ga0068864_100109417 | 3300005618 | Unclassified | 2460 |
| 318 | Ga0068864_100319606 | 3300005618 | Bacteria | 1458 |
| 319 | Ga0068864_100632611 | 3300005618 | Bacteria | 1041 |
| 320 | Ga0068864_100998191 | 3300005618 | Unclassified | 830 |
| 321 | Ga0068864_101035380 | 3300005618 | Bacteria | 815 |
| 322 | Ga0068864_101274847 | 3300005618 | Unclassified | 735 |
| 323 | Ga0068864_101619725 | 3300005618 | Bacteria | 651 |
| 324 | Ga0068866_10076616 | 3300005718 | Bacteria | 1784 |
| 325 | Ga0068866_10113348 | 3300005718 | Unclassified | 1517 |
| 326 | Ga0068866_10583330 | 3300005718 | Unclassified | 752 |
| 327 | Ga0068861_100010957 | 3300005719 | Bacteria | 6300 |
| 328 | Ga0068861_100028721 | 3300005719 | Bacteria | 4060 |
| 329 | Ga0068861_100037632 | 3300005719 | Bacteria | 3597 |
| 330 | Ga0068861_100068417 | 3300005719 | Bacteria | 2744 |
| 331 | Ga0068861_100223151 | 3300005719 | Unclassified | 1594 |
| 332 | Ga0068861_100497972 | 3300005719 | Unclassified | 1101 |
| 333 | Ga0068861_100598295 | 3300005719 | Unclassified | 1012 |
| 334 | Ga0068861_100787358 | 3300005719 | Unclassified | 891 |
| 335 | Ga0068861_101047303 | 3300005719 | Bacteria | 781 |
| 336 | Ga0068861_101550159 | 3300005719 | Unclassified | 651 |
| 337 | Ga0068861_102058976 | 3300005719 | Unclassified | 570 |
| 338 | Ga0068851_10011958 | 3300005834 | Unclassified | 4082 |
| 339 | Ga0068851_10093937 | 3300005834 | Unclassified | 1583 |
| 340 | Ga0068870_10000847 | 3300005840 | Bacteria | 11937 |
| 341 | Ga0068870_10027719 | 3300005840 | Bacteria | 2836 |
| 342 | Ga0068870_10075576 | 3300005840 | Bacteria | 1848 |
| 343 | Ga0068870_10096885 | 3300005840 | Unclassified | 1659 |
| 344 | Ga0068870_10133279 | 3300005840 | Bacteria | 1446 |
| 345 | Ga0068870_10315663 | 3300005840 | Bacteria | 991 |
| 346 | Ga0068870_10380733 | 3300005840 | Bacteria | 913 |
| 347 | Ga0068870_10512172 | 3300005840 | Unclassified | 802 |
| 348 | Ga0068870_10973515 | 3300005840 | Unclassified | 603 |
| 349 | Ga0068863_100071411 | 3300005841 | Bacteria | 3284 |
| 350 | Ga0068863_100125851 | 3300005841 | Bacteria | 2445 |
| 351 | Ga0068863_100130818 | 3300005841 | Archaea | 2396 |
| 352 | Ga0068863_100133583 | 3300005841 | Bacteria | 2370 |
| 353 | Ga0068863_100612072 | 3300005841 | Unclassified | 1079 |
| 354 | Ga0068863_100787577 | 3300005841 | Bacteria | 948 |
| 355 | Ga0068863_102645650 | 3300005841 | Unclassified | 511 |
| 356 | Ga0068858_100052748 | 3300005842 | Unclassified | 3763 |
| 357 | Ga0068858_100072879 | 3300005842 | Unclassified | 3187 |
| 358 | Ga0068858_100083895 | 3300005842 | Unclassified | 2963 |
| 359 | Ga0068858_100150078 | 3300005842 | Unclassified | 2191 |
| 360 | Ga0068858_100265803 | 3300005842 | Bacteria | 1631 |
| 361 | Ga0068858_100313763 | 3300005842 | Unclassified | 1497 |
| 362 | Ga0068858_100489751 | 3300005842 | Bacteria | 1187 |
| 363 | Ga0068858_100502341 | 3300005842 | Bacteria | 1172 |
| 364 | Ga0068858_101426488 | 3300005842 | Unclassified | 682 |
| 365 | Ga0068860_100047159 | 3300005843 | Bacteria | 4107 |
| 366 | Ga0068860_100061511 | 3300005843 | Unclassified | 3567 |
| 367 | Ga0068860_100076808 | 3300005843 | Unclassified | 3176 |
| 368 | Ga0068860_100095569 | 3300005843 | Unclassified | 2833 |
| 369 | Ga0068860_100099306 | 3300005843 | Unclassified | 2776 |
| 370 | Ga0068860_100130106 | 3300005843 | Bacteria | 2415 |
| 371 | Ga0068860_100156914 | 3300005843 | Bacteria | 2193 |
| 372 | Ga0068860_100164402 | 3300005843 | Unclassified | 2141 |
| 373 | Ga0068860_100182651 | 3300005843 | Unclassified | 2027 |
| 374 | Ga0068860_100769004 | 3300005843 | Unclassified | 975 |
| 375 | Ga0068862_100135621 | 3300005844 | Bacteria | 2181 |
| 376 | Ga0068862_100574056 | 3300005844 | Bacteria | 1079 |
| 377 | Ga0068862_100577106 | 3300005844 | Unclassified | 1077 |
| 378 | Ga0068862_101205650 | 3300005844 | Bacteria | 755 |
| 379 | Ga0068862_101261050 | 3300005844 | Unclassified | 739 |
| 380 | Ga0068862_101720658 | 3300005844 | Bacteria | 635 |
| 381 | Ga0068862_102255382 | 3300005844 | Unclassified | 556 |
| 382 | Ga0081539_10000067 | 3300005985 | Bacteria | 246361 |
| 383 | Ga0081539_10003247 | 3300005985 | Bacteria | 20448 |
| 384 | Ga0081539_10029095 | 3300005985 | Unclassified | 3461 |
| 385 | Ga0075432_10456860 | 3300006058 | Bacteria | 561 |
| 386 | Ga0070716_101387873 | 3300006173 | Unclassified | 571 |
| 387 | Ga0097621_100001354 | 3300006237 | Bacteria | 16867 |
| 388 | Ga0097621_100001882 | 3300006237 | Bacteria | 14354 |
| 389 | Ga0097621_100015727 | 3300006237 | Bacteria | 5701 |
| 390 | Ga0097621_100743033 | 3300006237 | Bacteria | 906 |
| 391 | Ga0068871_100003285 | 3300006358 | Bacteria | 11094 |
| 392 | Ga0068871_100021215 | 3300006358 | Unclassified | 4989 |
| 393 | Ga0068871_100565083 | 3300006358 | Bacteria | 1031 |
| 394 | Ga0075428_100070337 | 3300006844 | Bacteria | 3826 |
| 395 | Ga0075428_100424178 | 3300006844 | Unclassified | 1425 |
| 396 | Ga0075428_100548643 | 3300006844 | Unclassified | 1236 |
| 397 | Ga0075430_100181848 | 3300006846 | Bacteria | 1749 |
| 398 | Ga0075430_101249432 | 3300006846 | Unclassified | 611 |
| 399 | Ga0075431_100158837 | 3300006847 | Bacteria | 2325 |
| 400 | Ga0075431_100463168 | 3300006847 | Bacteria | 1262 |
| 401 | Ga0075433_10032308 | 3300006852 | Bacteria | 4483 |
| 402 | Ga0075433_10065599 | 3300006852 | Unclassified | 3184 |
| 403 | Ga0075433_10090500 | 3300006852 | Bacteria | 2705 |
| 404 | Ga0075433_10123122 | 3300006852 | Unclassified | 2304 |
| 405 | Ga0075433_10160708 | 3300006852 | Unclassified | 1999 |
| 406 | Ga0075433_10212242 | 3300006852 | Bacteria | 1720 |
| 407 | Ga0075433_10371980 | 3300006852 | Unclassified | 1262 |
| 408 | Ga0075433_10637907 | 3300006852 | Unclassified | 934 |
| 409 | Ga0075433_11272307 | 3300006852 | Unclassified | 638 |
| 410 | Ga0075433_11821727 | 3300006852 | Unclassified | 523 |
| 411 | Ga0075434_100054566 | 3300006871 | Unclassified | 3970 |
| 412 | Ga0075434_100058548 | 3300006871 | Bacteria | 3829 |
| 413 | Ga0075434_100539414 | 3300006871 | Bacteria | 1186 |
| 414 | Ga0075434_100837926 | 3300006871 | Bacteria | 935 |
| 415 | Ga0075434_101713228 | 3300006871 | Bacteria | 636 |
| 416 | Ga0075434_101725128 | 3300006871 | Unclassified | 634 |
| 417 | Ga0075434_101755485 | 3300006871 | Unclassified | 628 |
| 418 | Ga0075434_102356380 | 3300006871 | Unclassified | 535 |
| 419 | Ga0075429_100059945 | 3300006880 | Bacteria | 3316 |
| 420 | Ga0075429_100248149 | 3300006880 | Bacteria | 1559 |
| 421 | Ga0075429_100852102 | 3300006880 | Unclassified | 798 |
| 422 | Ga0068865_100022198 | 3300006881 | Bacteria | 4136 |
| 423 | Ga0068865_100384022 | 3300006881 | Unclassified | 1146 |
| 424 | Ga0068865_100447858 | 3300006881 | Bacteria | 1067 |
| 425 | Ga0068865_100720682 | 3300006881 | Unclassified | 854 |
| 426 | Ga0068865_101366598 | 3300006881 | Unclassified | 631 |
| 427 | Ga0068865_101715957 | 3300006881 | Unclassified | 566 |
| 428 | Ga0075436_100013635 | 3300006914 | Bacteria | 5568 |
| 429 | Ga0097620_100032266 | 3300006931 | Bacteria | 5261 |
| 430 | Ga0097620_100047919 | 3300006931 | Bacteria | 4293 |
| 431 | Ga0097620_100056252 | 3300006931 | Bacteria | 3958 |
| 432 | Ga0097620_100069647 | 3300006931 | Bacteria | 3553 |
| 433 | Ga0097620_100076103 | 3300006931 | Bacteria | 3397 |
| 434 | Ga0097620_100082258 | 3300006931 | Bacteria | 3263 |
| 435 | Ga0097620_100091625 | 3300006931 | Unclassified | 3090 |
| 436 | Ga0097620_100136599 | 3300006931 | Unclassified | 2525 |
| 437 | Ga0097620_100155198 | 3300006931 | Unclassified | 2366 |
| 438 | Ga0097620_100197537 | 3300006931 | Bacteria | 2096 |
| 439 | Ga0097620_100264532 | 3300006931 | Unclassified | 1812 |
| 440 | Ga0097620_100306736 | 3300006931 | Unclassified | 1681 |
| 441 | Ga0097620_100771979 | 3300006931 | Unclassified | 1049 |
| 442 | Ga0097620_100918037 | 3300006931 | Unclassified | 960 |
| 443 | Ga0097620_101078761 | 3300006931 | Bacteria | 883 |
| 444 | Ga0097620_101447394 | 3300006931 | Unclassified | 758 |
| 445 | Ga0097620_101565646 | 3300006931 | Unclassified | 728 |
| 446 | Ga0097620_101691512 | 3300006931 | Unclassified | 699 |
| 447 | Ga0075435_100029269 | 3300007076 | Bacteria | 4322 |
| 448 | Ga0099794_10586380 | 3300007265 | Unclassified | 590 |
| 449 | Ga0105251_10457182 | 3300009011 | Bacteria | 592 |
| 450 | Ga0105250_10135033 | 3300009092 | Unclassified | 1020 |
| 451 | Ga0105240_10036772 | 3300009093 | Bacteria | 6296 |
| 452 | Ga0105240_12003630 | 3300009093 | Unclassified | 602 |
| 453 | Ga0111539_10001469 | 3300009094 | Bacteria | 31496 |
| 454 | Ga0111539_10007977 | 3300009094 | Bacteria | 13504 |
| 455 | Ga0111539_10010383 | 3300009094 | Bacteria | 11722 |
| 456 | Ga0111539_10167162 | 3300009094 | Unclassified | 2571 |
| 457 | Ga0111539_10545040 | 3300009094 | Unclassified | 1351 |
| 458 | Ga0105245_10092553 | 3300009098 | Bacteria | 2784 |
| 459 | Ga0105245_10280029 | 3300009098 | Unclassified | 1629 |
| 460 | Ga0105245_10441515 | 3300009098 | Bacteria | 1308 |
| 461 | Ga0105245_10886280 | 3300009098 | Unclassified | 933 |
| 462 | Ga0105245_11306987 | 3300009098 | Bacteria | 774 |
| 463 | Ga0105247_10013105 | 3300009101 | Bacteria | 4974 |
| 464 | Ga0105247_10017782 | 3300009101 | Unclassified | 4263 |
| 465 | Ga0105247_10020829 | 3300009101 | Bacteria | 3944 |
| 466 | Ga0105247_10868129 | 3300009101 | Unclassified | 694 |
| 467 | Ga0105247_11727951 | 3300009101 | Unclassified | 518 |
| 468 | Ga0114129_10026332 | 3300009147 | Bacteria | 8236 |
| 469 | Ga0114129_10030702 | 3300009147 | Bacteria | 7601 |
| 470 | Ga0114129_10053343 | 3300009147 | Bacteria | 5671 |
| 471 | Ga0114129_10058691 | 3300009147 | Bacteria | 5382 |
| 472 | Ga0114129_10140117 | 3300009147 | Bacteria | 3316 |
| 473 | Ga0114129_10225919 | 3300009147 | Bacteria | 2523 |
| 474 | Ga0114129_10329266 | 3300009147 | Bacteria | 2029 |
| 475 | Ga0114129_10996248 | 3300009147 | Bacteria | 1056 |
| 476 | Ga0114129_11138347 | 3300009147 | Unclassified | 975 |
| 477 | Ga0114129_11180585 | 3300009147 | Bacteria | 954 |
| 478 | Ga0105243_10003775 | 3300009148 | Bacteria | 12142 |
| 479 | Ga0105243_10061092 | 3300009148 | Unclassified | 3012 |
| 480 | Ga0105243_10122873 | 3300009148 | Bacteria | 2192 |
| 481 | Ga0105243_10429077 | 3300009148 | Bacteria | 1235 |
| 482 | Ga0105243_10790024 | 3300009148 | Unclassified | 934 |
| 483 | Ga0105243_10825810 | 3300009148 | Unclassified | 916 |
| 484 | Ga0105243_10942561 | 3300009148 | Bacteria | 862 |
| 485 | Ga0105243_11761155 | 3300009148 | Unclassified | 650 |
| 486 | Ga0105243_11953724 | 3300009148 | Bacteria | 620 |
| 487 | Ga0105241_10070093 | 3300009174 | Bacteria | 2719 |
| 488 | Ga0105241_10281017 | 3300009174 | Bacteria | 1422 |
| 489 | Ga0105241_10282215 | 3300009174 | Unclassified | 1419 |
| 490 | Ga0105241_10409882 | 3300009174 | Unclassified | 1191 |
| 491 | Ga0105241_10574385 | 3300009174 | Bacteria | 1015 |
| 492 | Ga0105241_10677885 | 3300009174 | Unclassified | 939 |
| 493 | Ga0105241_10834251 | 3300009174 | Bacteria | 851 |
| 494 | Ga0105241_11006207 | 3300009174 | Unclassified | 780 |
| 495 | Ga0105241_11303056 | 3300009174 | Bacteria | 692 |
| 496 | Ga0105242_10088270 | 3300009176 | Unclassified | 2605 |
| 497 | Ga0105242_10244232 | 3300009176 | Bacteria | 1615 |
| 498 | Ga0105242_11577363 | 3300009176 | Unclassified | 689 |
| 499 | Ga0105242_12133979 | 3300009176 | Bacteria | 605 |
| 500 | Ga0105248_10001663 | 3300009177 | Bacteria | 24717 |
| 501 | Ga0105248_10012918 | 3300009177 | Bacteria | 9206 |
| 502 | Ga0105248_10077288 | 3300009177 | Bacteria | 3742 |
| 503 | Ga0105248_10087616 | 3300009177 | Bacteria | 3504 |
| 504 | Ga0105248_10274483 | 3300009177 | Unclassified | 1898 |
| 505 | Ga0105248_10351329 | 3300009177 | Unclassified | 1660 |
| 506 | Ga0105248_10428889 | 3300009177 | Unclassified | 1489 |
| 507 | Ga0105248_13260840 | 3300009177 | Unclassified | 516 |
| 508 | Ga0105237_10004213 | 3300009545 | Bacteria | 16744 |
| 509 | Ga0105237_10051585 | 3300009545 | Bacteria | 4132 |
| 510 | Ga0105237_10117960 | 3300009545 | Unclassified | 2647 |
| 511 | Ga0105237_10528877 | 3300009545 | Unclassified | 1186 |
| 512 | Ga0105238_10009780 | 3300009551 | Bacteria | 9600 |
| 513 | Ga0105238_10064038 | 3300009551 | Unclassified | 3677 |
| 514 | Ga0105238_10674264 | 3300009551 | Bacteria | 1045 |
| 515 | Ga0105249_10001351 | 3300009553 | Bacteria | 21430 |
| 516 | Ga0105249_10019365 | 3300009553 | Bacteria | 6071 |
| 517 | Ga0105249_10066785 | 3300009553 | Unclassified | 3312 |
| 518 | Ga0105249_10167824 | 3300009553 | Bacteria | 2126 |
| 519 | Ga0105249_10254620 | 3300009553 | Unclassified | 1742 |
| 520 | Ga0105249_10492621 | 3300009553 | Unclassified | 1270 |
| 521 | Ga0105249_11065361 | 3300009553 | Unclassified | 878 |
| 522 | Ga0105249_11168156 | 3300009553 | Bacteria | 840 |
| 523 | Ga0105249_11321613 | 3300009553 | Unclassified | 793 |
| 524 | Ga0105249_12125146 | 3300009553 | Unclassified | 634 |
| 525 | Ga0105239_10081369 | 3300010375 | Bacteria | 3565 |
| 526 | Ga0105239_10684171 | 3300010375 | Unclassified | 1172 |
| 527 | Ga0105239_10749224 | 3300010375 | Bacteria | 1118 |
| 528 | Ga0105239_12145922 | 3300010375 | Unclassified | 649 |
| 529 | Ga0105239_12212756 | 3300010375 | Bacteria | 639 |
| 530 | Ga0105246_10031719 | 3300011119 | Bacteria | 3498 |
| 531 | Ga0105246_10074102 | 3300011119 | Bacteria | 2405 |
| 532 | Ga0105246_10121618 | 3300011119 | Bacteria | 1935 |
| 533 | Ga0105246_10159825 | 3300011119 | Bacteria | 1715 |
| 534 | Ga0105246_10162642 | 3300011119 | Unclassified | 1702 |
| 535 | Ga0105246_10294988 | 3300011119 | Bacteria | 1306 |
| 536 | Ga0105246_10563003 | 3300011119 | Unclassified | 979 |
| 537 | Ga0105246_11814357 | 3300011119 | Unclassified | 583 |
| 538 | Ga0105246_11858765 | 3300011119 | Bacteria | 577 |
| 539 | Ga0157327_1042121 | 3300012512 | Unclassified | 618 |
| 540 | Ga0157373_10033443 | 3300013100 | Unclassified | 3699 |
| 541 | Ga0157373_10107041 | 3300013100 | Bacteria | 1966 |
| 542 | Ga0157373_10288513 | 3300013100 | Bacteria | 1164 |
| 543 | Ga0157373_10836311 | 3300013100 | Bacteria | 680 |
| 544 | Ga0157371_10256321 | 3300013102 | Bacteria | 1260 |
| 545 | Ga0157371_11448912 | 3300013102 | Unclassified | 534 |
| 546 | Ga0157374_10007848 | 3300013296 | Bacteria | 9112 |
| 547 | Ga0157374_10512560 | 3300013296 | Bacteria | 1205 |
| 548 | Ga0157374_10822191 | 3300013296 | Unclassified | 945 |
| 549 | Ga0157378_10010711 | 3300013297 | Bacteria | 8016 |
| 550 | Ga0157378_10049326 | 3300013297 | Unclassified | 3745 |
| 551 | Ga0157378_10109696 | 3300013297 | Bacteria | 2528 |
| 552 | Ga0157378_10336898 | 3300013297 | Bacteria | 1470 |
| 553 | Ga0157378_10675609 | 3300013297 | Bacteria | 1050 |
| 554 | Ga0163162_10001516 | 3300013306 | Bacteria | 21633 |
| 555 | Ga0163162_10002329 | 3300013306 | Bacteria | 17822 |
| 556 | Ga0163162_10005889 | 3300013306 | Bacteria | 11859 |
| 557 | Ga0163162_10011561 | 3300013306 | Bacteria | 8612 |
| 558 | Ga0163162_10037774 | 3300013306 | Bacteria | 4820 |
| 559 | Ga0163162_10049352 | 3300013306 | Unclassified | 4218 |
| 560 | Ga0163162_10085592 | 3300013306 | Bacteria | 3230 |
| 561 | Ga0163162_10670436 | 3300013306 | Unclassified | 1160 |
| 562 | Ga0163162_13026378 | 3300013306 | Bacteria | 540 |
| 563 | Ga0157372_10025429 | 3300013307 | Bacteria | 6437 |
| 564 | Ga0157372_10037304 | 3300013307 | Bacteria | 5360 |
| 565 | Ga0157372_10058402 | 3300013307 | Bacteria | 4312 |
| 566 | Ga0157372_10857264 | 3300013307 | Bacteria | 1054 |
| 567 | Ga0157375_10005360 | 3300013308 | Bacteria | 11147 |
| 568 | Ga0157375_10009563 | 3300013308 | Bacteria | 8511 |
| 569 | Ga0157375_10240685 | 3300013308 | Unclassified | 1969 |
| 570 | Ga0157375_10409195 | 3300013308 | Bacteria | 1523 |
| 571 | Ga0157375_10474186 | 3300013308 | Bacteria | 1416 |
| 572 | Ga0157375_10724946 | 3300013308 | Bacteria | 1147 |
| 573 | Ga0157375_10910626 | 3300013308 | Unclassified | 1023 |
| 574 | Ga0157375_10938039 | 3300013308 | Bacteria | 1008 |
| 575 | Ga0157375_11760246 | 3300013308 | Bacteria | 734 |
| 576 | Ga0157375_11931294 | 3300013308 | Unclassified | 701 |
| 577 | Ga0157375_11955979 | 3300013308 | Unclassified | 696 |
| 578 | Ga0163163_10000183 | 3300014325 | Bacteria | 64505 |
| 579 | Ga0163163_10010501 | 3300014325 | Bacteria | 8331 |
| 580 | Ga0163163_10043868 | 3300014325 | Unclassified | 4386 |
| 581 | Ga0163163_10045314 | 3300014325 | Unclassified | 4316 |
| 582 | Ga0163163_10075029 | 3300014325 | Bacteria | 3375 |
| 583 | Ga0163163_10179947 | 3300014325 | Unclassified | 2161 |
| 584 | Ga0163163_10181782 | 3300014325 | Bacteria | 2150 |
| 585 | Ga0163163_10248392 | 3300014325 | Unclassified | 1830 |
| 586 | Ga0163163_10578035 | 3300014325 | Bacteria | 1187 |
| 587 | Ga0163163_10766215 | 3300014325 | Unclassified | 1028 |
| 588 | Ga0163163_10793545 | 3300014325 | Unclassified | 1010 |
| 589 | Ga0163163_11474052 | 3300014325 | Unclassified | 742 |
| 590 | Ga0163163_13182301 | 3300014325 | Unclassified | 512 |
| 591 | Ga0157380_10031735 | 3300014326 | Unclassified | 4058 |
| 592 | Ga0157380_10033357 | 3300014326 | Unclassified | 3964 |
| 593 | Ga0157380_10103104 | 3300014326 | Bacteria | 2380 |
| 594 | Ga0157380_10125972 | 3300014326 | Bacteria | 2177 |
| 595 | Ga0157380_10143609 | 3300014326 | Unclassified | 2054 |
| 596 | Ga0157380_10523085 | 3300014326 | Archaea | 1157 |
| 597 | Ga0157380_10963826 | 3300014326 | Bacteria | 884 |
| 598 | Ga0157380_11121094 | 3300014326 | Unclassified | 827 |
| 599 | Ga0157380_11338208 | 3300014326 | Bacteria | 765 |
| 600 | Ga0157377_10022694 | 3300014745 | Unclassified | 3318 |
| 601 | Ga0157377_10103750 | 3300014745 | Unclassified | 1699 |
| 602 | Ga0157377_10580414 | 3300014745 | Unclassified | 796 |
| 603 | Ga0157379_10120996 | 3300014968 | Unclassified | 2354 |
| 604 | Ga0157379_10142071 | 3300014968 | Bacteria | 2164 |
| 605 | Ga0157379_10225193 | 3300014968 | Unclassified | 1700 |
| 606 | Ga0157379_10449365 | 3300014968 | Unclassified | 1189 |
| 607 | Ga0157379_10589394 | 3300014968 | Unclassified | 1037 |
| 608 | Ga0157379_10712097 | 3300014968 | Bacteria | 943 |
| 609 | Ga0157379_10748913 | 3300014968 | Unclassified | 920 |
| 610 | Ga0157376_10011208 | 3300014969 | Bacteria | 6597 |
| 611 | Ga0157376_10125147 | 3300014969 | Bacteria | 2285 |
| 612 | Ga0182007_10225337 | 3300015262 | Bacteria | 664 |
| 613 | Ga0163161_10028642 | 3300017792 | Unclassified | 3956 |
| 614 | Ga0163161_10640796 | 3300017792 | Unclassified | 880 |
| 615 | Ga0207697_10299817 | 3300025315 | Unclassified | 713 |
| 616 | Ga0207697_10383768 | 3300025315 | Bacteria | 624 |
| 617 | Ga0207653_10010901 | 3300025885 | Unclassified | 2836 |
| 618 | Ga0207653_10243206 | 3300025885 | Unclassified | 688 |
| 619 | Ga0207682_10199156 | 3300025893 | Bacteria | 920 |
| 620 | Ga0207682_10549013 | 3300025893 | Bacteria | 546 |
| 621 | Ga0207642_10158567 | 3300025899 | Bacteria | 1212 |
| 622 | Ga0207710_10003825 | 3300025900 | Bacteria | 6649 |
| 623 | Ga0207710_10434115 | 3300025900 | Unclassified | 677 |
| 624 | Ga0207688_10821881 | 3300025901 | Unclassified | 589 |
| 625 | Ga0207680_10013632 | 3300025903 | Unclassified | 4182 |
| 626 | Ga0207680_10419302 | 3300025903 | Unclassified | 948 |
| 627 | Ga0207647_10000502 | 3300025904 | Bacteria | 31375 |
| 628 | Ga0207647_10132344 | 3300025904 | Unclassified | 1465 |
| 629 | Ga0207647_10167431 | 3300025904 | Bacteria | 1280 |
| 630 | Ga0207699_10658590 | 3300025906 | Unclassified | 765 |
| 631 | Ga0207645_10119803 | 3300025907 | Unclassified | 1708 |
| 632 | Ga0207645_10406137 | 3300025907 | Bacteria | 916 |
| 633 | Ga0207645_10527368 | 3300025907 | Unclassified | 800 |
| 634 | Ga0207643_10000882 | 3300025908 | Bacteria | 18068 |
| 635 | Ga0207643_10017495 | 3300025908 | Bacteria | 3920 |
| 636 | Ga0207643_10027010 | 3300025908 | Bacteria | 3182 |
| 637 | Ga0207643_10091750 | 3300025908 | Bacteria | 1772 |
| 638 | Ga0207643_10106872 | 3300025908 | Bacteria | 1645 |
| 639 | Ga0207643_10159023 | 3300025908 | Unclassified | 1358 |
| 640 | Ga0207643_10217564 | 3300025908 | Bacteria | 1168 |
| 641 | Ga0207643_10697011 | 3300025908 | Unclassified | 656 |
| 642 | Ga0207684_10000023 | 3300025910 | Bacteria | 334838 |
| 643 | Ga0207684_10005029 | 3300025910 | Bacteria | 12326 |
| 644 | Ga0207684_10043569 | 3300025910 | Bacteria | 3805 |
| 645 | Ga0207684_10418384 | 3300025910 | Bacteria | 1152 |
| 646 | Ga0207654_10002853 | 3300025911 | Bacteria | 8764 |
| 647 | Ga0207654_10077227 | 3300025911 | Unclassified | 1996 |
| 648 | Ga0207654_10126422 | 3300025911 | Unclassified | 1612 |
| 649 | Ga0207654_10235228 | 3300025911 | Bacteria | 1222 |
| 650 | Ga0207654_10607803 | 3300025911 | Bacteria | 781 |
| 651 | Ga0207707_10003187 | 3300025912 | Bacteria | 14567 |
| 652 | Ga0207707_10023481 | 3300025912 | Bacteria | 5394 |
| 653 | Ga0207695_10064972 | 3300025913 | Unclassified | 3753 |
| 654 | Ga0207695_11233643 | 3300025913 | Unclassified | 628 |
| 655 | Ga0207671_10006170 | 3300025914 | Bacteria | 10770 |
| 656 | Ga0207671_10058480 | 3300025914 | Unclassified | 2858 |
| 657 | Ga0207671_10098612 | 3300025914 | Unclassified | 2210 |
| 658 | Ga0207671_10177748 | 3300025914 | Unclassified | 1655 |
| 659 | Ga0207671_10598881 | 3300025914 | Bacteria | 878 |
| 660 | Ga0207660_10327480 | 3300025917 | Unclassified | 1224 |
| 661 | Ga0207660_11400909 | 3300025917 | Unclassified | 566 |
| 662 | Ga0207662_10003999 | 3300025918 | Bacteria | 7682 |
| 663 | Ga0207662_10008041 | 3300025918 | Bacteria | 5756 |
| 664 | Ga0207662_10385984 | 3300025918 | Bacteria | 947 |
| 665 | Ga0207662_10613566 | 3300025918 | Unclassified | 758 |
| 666 | Ga0207649_10035097 | 3300025920 | Bacteria | 3011 |
| 667 | Ga0207649_10460819 | 3300025920 | Bacteria | 961 |
| 668 | Ga0207652_10130898 | 3300025921 | Bacteria | 2238 |
| 669 | Ga0207652_10741916 | 3300025921 | Unclassified | 874 |
| 670 | Ga0207646_10029914 | 3300025922 | Bacteria | 4944 |
| 671 | Ga0207646_10200587 | 3300025922 | Bacteria | 1802 |
| 672 | Ga0207646_10572822 | 3300025922 | Bacteria | 1014 |
| 673 | Ga0207646_10599873 | 3300025922 | Unclassified | 988 |
| 674 | Ga0207681_10000428 | 3300025923 | Bacteria | 29304 |
| 675 | Ga0207681_10058913 | 3300025923 | Bacteria | 2631 |
| 676 | Ga0207681_10155173 | 3300025923 | Unclassified | 1720 |
| 677 | Ga0207681_10282414 | 3300025923 | Unclassified | 1307 |
| 678 | Ga0207681_10354506 | 3300025923 | Bacteria | 1175 |
| 679 | Ga0207681_10479387 | 3300025923 | Bacteria | 1016 |
| 680 | Ga0207681_10606531 | 3300025923 | Unclassified | 905 |
| 681 | Ga0207681_10804014 | 3300025923 | Unclassified | 785 |
| 682 | Ga0207681_11231990 | 3300025923 | Unclassified | 629 |
| 683 | Ga0207694_10032355 | 3300025924 | Unclassified | 4003 |
| 684 | Ga0207694_10899313 | 3300025924 | Unclassified | 749 |
| 685 | Ga0207650_10000001 | 3300025925 | Bacteria | 1545726 |
| 686 | Ga0207650_10001704 | 3300025925 | Bacteria | 15617 |
| 687 | Ga0207650_10063733 | 3300025925 | Bacteria | 2757 |
| 688 | Ga0207650_10216831 | 3300025925 | Bacteria | 1539 |
| 689 | Ga0207650_10557791 | 3300025925 | Bacteria | 961 |
| 690 | Ga0207650_10641149 | 3300025925 | Bacteria | 895 |
| 691 | Ga0207650_10687307 | 3300025925 | Unclassified | 864 |
| 692 | Ga0207650_10943325 | 3300025925 | Bacteria | 733 |
| 693 | Ga0207650_11320080 | 3300025925 | Unclassified | 614 |
| 694 | Ga0207659_10128702 | 3300025926 | Bacteria | 1951 |
| 695 | Ga0207659_10172431 | 3300025926 | Bacteria | 1707 |
| 696 | Ga0207659_10232456 | 3300025926 | Unclassified | 1488 |
| 697 | Ga0207659_10237442 | 3300025926 | Bacteria | 1473 |
| 698 | Ga0207659_10476543 | 3300025926 | Unclassified | 1054 |
| 699 | Ga0207659_10707251 | 3300025926 | Bacteria | 863 |
| 700 | Ga0207687_10805985 | 3300025927 | Bacteria | 801 |
| 701 | Ga0207687_10946317 | 3300025927 | Bacteria | 738 |
| 702 | Ga0207687_11534639 | 3300025927 | Unclassified | 572 |
| 703 | Ga0207644_10016817 | 3300025931 | Unclassified | 4927 |
| 704 | Ga0207644_10175879 | 3300025931 | Unclassified | 1674 |
| 705 | Ga0207644_10296843 | 3300025931 | Bacteria | 1301 |
| 706 | Ga0207690_10550433 | 3300025932 | Unclassified | 938 |
| 707 | Ga0207706_10119607 | 3300025933 | Bacteria | 2316 |
| 708 | Ga0207706_10152083 | 3300025933 | Bacteria | 2035 |
| 709 | Ga0207706_10332994 | 3300025933 | Bacteria | 1321 |
| 710 | Ga0207706_10461217 | 3300025933 | Unclassified | 1099 |
| 711 | Ga0207706_10743602 | 3300025933 | Unclassified | 836 |
| 712 | Ga0207686_10269800 | 3300025934 | Unclassified | 1251 |
| 713 | Ga0207686_10308149 | 3300025934 | Unclassified | 1178 |
| 714 | Ga0207709_10009935 | 3300025935 | Bacteria | 5240 |
| 715 | Ga0207709_10163778 | 3300025935 | Unclassified | 1554 |
| 716 | Ga0207709_10190194 | 3300025935 | Unclassified | 1457 |
| 717 | Ga0207709_10363425 | 3300025935 | Bacteria | 1096 |
| 718 | Ga0207709_10501379 | 3300025935 | Unclassified | 947 |
| 719 | Ga0207709_10803704 | 3300025935 | Bacteria | 759 |
| 720 | Ga0207709_11385677 | 3300025935 | Unclassified | 582 |
| 721 | Ga0207670_10003418 | 3300025936 | Bacteria | 8427 |
| 722 | Ga0207670_10198793 | 3300025936 | Unclassified | 1522 |
| 723 | Ga0207670_10253654 | 3300025936 | Unclassified | 1361 |
| 724 | Ga0207670_10384688 | 3300025936 | Bacteria | 1118 |
| 725 | Ga0207670_10916367 | 3300025936 | Unclassified | 735 |
| 726 | Ga0207670_11044450 | 3300025936 | Unclassified | 688 |
| 727 | Ga0207670_11066729 | 3300025936 | Unclassified | 681 |
| 728 | Ga0207669_10147748 | 3300025937 | Bacteria | 1642 |
| 729 | Ga0207704_10043235 | 3300025938 | Bacteria | 2658 |
| 730 | Ga0207704_10284319 | 3300025938 | Unclassified | 1259 |
| 731 | Ga0207704_10503622 | 3300025938 | Unclassified | 976 |
| 732 | Ga0207704_11044273 | 3300025938 | Unclassified | 693 |
| 733 | Ga0207704_11363850 | 3300025938 | Unclassified | 607 |
| 734 | Ga0207691_10047107 | 3300025940 | Bacteria | 3958 |
| 735 | Ga0207691_10060123 | 3300025940 | Bacteria | 3454 |
| 736 | Ga0207691_10367169 | 3300025940 | Bacteria | 1230 |
| 737 | Ga0207691_10927578 | 3300025940 | Unclassified | 728 |
| 738 | Ga0207691_11308473 | 3300025940 | Unclassified | 598 |
| 739 | Ga0207711_10013634 | 3300025941 | Bacteria | 6751 |
| 740 | Ga0207711_10015352 | 3300025941 | Bacteria | 6356 |
| 741 | Ga0207711_10076895 | 3300025941 | Unclassified | 2908 |
| 742 | Ga0207711_10082859 | 3300025941 | Bacteria | 2804 |
| 743 | Ga0207711_10184406 | 3300025941 | Bacteria | 1899 |
| 744 | Ga0207711_10772195 | 3300025941 | Bacteria | 895 |
| 745 | Ga0207689_10000986 | 3300025942 | Bacteria | 27294 |
| 746 | Ga0207689_10033647 | 3300025942 | Bacteria | 4258 |
| 747 | Ga0207689_10067771 | 3300025942 | Unclassified | 2933 |
| 748 | Ga0207689_10067902 | 3300025942 | Bacteria | 2930 |
| 749 | Ga0207689_10126998 | 3300025942 | Bacteria | 2098 |
| 750 | Ga0207689_10320801 | 3300025942 | Bacteria | 1286 |
| 751 | Ga0207689_10866498 | 3300025942 | Bacteria | 762 |
| 752 | Ga0207689_10980089 | 3300025942 | Unclassified | 713 |
| 753 | Ga0207661_10869739 | 3300025944 | Unclassified | 830 |
| 754 | Ga0207679_10020984 | 3300025945 | Bacteria | 4420 |
| 755 | Ga0207679_10241735 | 3300025945 | Bacteria | 1530 |
| 756 | Ga0207679_10404006 | 3300025945 | Unclassified | 1202 |
| 757 | Ga0207679_10409259 | 3300025945 | Bacteria | 1195 |
| 758 | Ga0207679_10614995 | 3300025945 | Bacteria | 980 |
| 759 | Ga0207679_10649428 | 3300025945 | Unclassified | 954 |
| 760 | Ga0207679_10855401 | 3300025945 | Unclassified | 831 |
| 761 | Ga0207667_11844196 | 3300025949 | Unclassified | 568 |
| 762 | Ga0207651_10139337 | 3300025960 | Bacteria | 1871 |
| 763 | Ga0207651_10215743 | 3300025960 | Bacteria | 1548 |
| 764 | Ga0207651_10277461 | 3300025960 | Unclassified | 1383 |
| 765 | Ga0207651_10745919 | 3300025960 | Unclassified | 865 |
| 766 | Ga0207712_10000022 | 3300025961 | Bacteria | 284365 |
| 767 | Ga0207712_10079374 | 3300025961 | Bacteria | 2384 |
| 768 | Ga0207712_10181959 | 3300025961 | Unclassified | 1652 |
| 769 | Ga0207712_10324155 | 3300025961 | Unclassified | 1272 |
| 770 | Ga0207712_10409449 | 3300025961 | Bacteria | 1142 |
| 771 | Ga0207712_10468011 | 3300025961 | Unclassified | 1072 |
| 772 | Ga0207668_10811369 | 3300025972 | Unclassified | 829 |
| 773 | Ga0207640_10047255 | 3300025981 | Bacteria | 2775 |
| 774 | Ga0207640_10100036 | 3300025981 | Bacteria | 2031 |
| 775 | Ga0207640_10279333 | 3300025981 | Bacteria | 1311 |
| 776 | Ga0207640_10296511 | 3300025981 | Bacteria | 1277 |
| 777 | Ga0207640_10743839 | 3300025981 | Unclassified | 845 |
| 778 | Ga0207658_10167670 | 3300025986 | Unclassified | 1806 |
| 779 | Ga0207658_10169305 | 3300025986 | Bacteria | 1798 |
| 780 | Ga0207677_10009473 | 3300026023 | Bacteria | 5482 |
| 781 | Ga0207677_10084605 | 3300026023 | Bacteria | 2287 |
| 782 | Ga0207677_10692936 | 3300026023 | Bacteria | 903 |
| 783 | Ga0207703_10064754 | 3300026035 | Unclassified | 3001 |
| 784 | Ga0207703_10128217 | 3300026035 | Unclassified | 2187 |
| 785 | Ga0207703_11049639 | 3300026035 | Unclassified | 782 |
| 786 | Ga0207703_11066295 | 3300026035 | Unclassified | 776 |
| 787 | Ga0207639_10072676 | 3300026041 | Bacteria | 2694 |
| 788 | Ga0207639_10074660 | 3300026041 | Bacteria | 2663 |
| 789 | Ga0207639_10154386 | 3300026041 | Bacteria | 1926 |
| 790 | Ga0207678_10936053 | 3300026067 | Unclassified | 766 |
| 791 | Ga0207708_10000061 | 3300026075 | Bacteria | 92741 |
| 792 | Ga0207708_10003905 | 3300026075 | Bacteria | 10970 |
| 793 | Ga0207708_10011771 | 3300026075 | Bacteria | 6519 |
| 794 | Ga0207708_10017238 | 3300026075 | Bacteria | 5436 |
| 795 | Ga0207708_10047707 | 3300026075 | Bacteria | 3260 |
| 796 | Ga0207708_10079676 | 3300026075 | Bacteria | 2516 |
| 797 | Ga0207708_10124313 | 3300026075 | Unclassified | 2012 |
| 798 | Ga0207708_10559911 | 3300026075 | Unclassified | 965 |
| 799 | Ga0207702_10177755 | 3300026078 | Bacteria | 1957 |
| 800 | Ga0207641_10021456 | 3300026088 | Bacteria | 5307 |
| 801 | Ga0207641_10044331 | 3300026088 | Bacteria | 3741 |
| 802 | Ga0207641_10075946 | 3300026088 | Unclassified | 2903 |
| 803 | Ga0207641_10088733 | 3300026088 | Bacteria | 2701 |
| 804 | Ga0207641_10216868 | 3300026088 | Bacteria | 1772 |
| 805 | Ga0207641_10407544 | 3300026088 | Unclassified | 1306 |
| 806 | Ga0207641_10751353 | 3300026088 | Unclassified | 963 |
| 807 | Ga0207641_11097964 | 3300026088 | Unclassified | 794 |
| 808 | Ga0207648_10001908 | 3300026089 | Bacteria | 22765 |
| 809 | Ga0207648_10130644 | 3300026089 | Unclassified | 2211 |
| 810 | Ga0207648_10134137 | 3300026089 | Bacteria | 2180 |
| 811 | Ga0207648_11048559 | 3300026089 | Unclassified | 764 |
| 812 | Ga0207648_11601862 | 3300026089 | Unclassified | 612 |
| 813 | Ga0207676_10016632 | 3300026095 | Bacteria | 5327 |
| 814 | Ga0207676_10030471 | 3300026095 | Bacteria | 4050 |
| 815 | Ga0207676_10092309 | 3300026095 | Bacteria | 2489 |
| 816 | Ga0207676_10095588 | 3300026095 | Archaea | 2451 |
| 817 | Ga0207676_10174782 | 3300026095 | Bacteria | 1874 |
| 818 | Ga0207676_10290512 | 3300026095 | Unclassified | 1488 |
| 819 | Ga0207676_10320870 | 3300026095 | Bacteria | 1422 |
| 820 | Ga0207676_10505199 | 3300026095 | Bacteria | 1148 |
| 821 | Ga0207676_10598868 | 3300026095 | Bacteria | 1058 |
| 822 | Ga0207676_10734979 | 3300026095 | Bacteria | 959 |
| 823 | Ga0207676_10886295 | 3300026095 | Bacteria | 874 |
| 824 | Ga0207676_10902602 | 3300026095 | Bacteria | 867 |
| 825 | Ga0207676_10965472 | 3300026095 | Unclassified | 838 |
| 826 | Ga0207676_11015304 | 3300026095 | Unclassified | 818 |
| 827 | Ga0207674_10000192 | 3300026116 | Bacteria | 75255 |
| 828 | Ga0207674_10062925 | 3300026116 | Unclassified | 3747 |
| 829 | Ga0207674_10091041 | 3300026116 | Unclassified | 3041 |
| 830 | Ga0207674_10109212 | 3300026116 | Unclassified | 2742 |
| 831 | Ga0207674_10369663 | 3300026116 | Bacteria | 1386 |
| 832 | Ga0207674_10844498 | 3300026116 | Bacteria | 883 |
| 833 | Ga0207674_11112653 | 3300026116 | Unclassified | 759 |
| 834 | Ga0207674_11655802 | 3300026116 | Unclassified | 608 |
| 835 | Ga0207674_11984298 | 3300026116 | Unclassified | 547 |
| 836 | Ga0207675_100014671 | 3300026118 | Bacteria | 7307 |
| 837 | Ga0207675_100015208 | 3300026118 | Bacteria | 7178 |
| 838 | Ga0207675_100068923 | 3300026118 | Bacteria | 3306 |
| 839 | Ga0207675_100137528 | 3300026118 | Bacteria | 2319 |
| 840 | Ga0207675_100151655 | 3300026118 | Bacteria | 2206 |
| 841 | Ga0207675_100186991 | 3300026118 | Bacteria | 1986 |
| 842 | Ga0207675_100336642 | 3300026118 | Unclassified | 1476 |
| 843 | Ga0207675_100539154 | 3300026118 | Bacteria | 1165 |
| 844 | Ga0207675_100625648 | 3300026118 | Unclassified | 1081 |
| 845 | Ga0207675_100670158 | 3300026118 | Unclassified | 1044 |
| 846 | Ga0207675_100721040 | 3300026118 | Bacteria | 1007 |
| 847 | Ga0207675_100924764 | 3300026118 | Bacteria | 889 |
| 848 | Ga0207675_101104144 | 3300026118 | Bacteria | 813 |
| 849 | Ga0207683_10193041 | 3300026121 | Bacteria | 1849 |
| 850 | Ga0207683_10249816 | 3300026121 | Unclassified | 1619 |
| 851 | Ga0207683_10315731 | 3300026121 | Unclassified | 1431 |
| 852 | Ga0207698_10105970 | 3300026142 | Bacteria | 2343 |
| 853 | Ga0207698_10140659 | 3300026142 | Bacteria | 2079 |
| 854 | Ga0207698_10308515 | 3300026142 | Bacteria | 1476 |
| 855 | Ga0207698_10358001 | 3300026142 | Bacteria | 1381 |
| 856 | Ga0207698_10708902 | 3300026142 | Bacteria | 1002 |
| 857 | Ga0207428_10026938 | 3300027907 | Bacteria | 4789 |
| 858 | Ga0207428_10071524 | 3300027907 | Bacteria | 2724 |
| 859 | Ga0207428_10283238 | 3300027907 | Unclassified | 1230 |
| 860 | Ga0207428_10491885 | 3300027907 | Unclassified | 891 |
| 861 | Ga0268266_10075086 | 3300028379 | Bacteria | 2936 |
| 862 | Ga0268266_11395527 | 3300028379 | Unclassified | 676 |
| 863 | Ga0268265_10100036 | 3300028380 | Bacteria | 2339 |
| 864 | Ga0268265_10135975 | 3300028380 | Bacteria | 2051 |
| 865 | Ga0268265_10322505 | 3300028380 | Bacteria | 1400 |
| 866 | Ga0268265_10475761 | 3300028380 | Unclassified | 1172 |
| 867 | Ga0268265_10551586 | 3300028380 | Bacteria | 1094 |
| 868 | Ga0268265_10756535 | 3300028380 | Bacteria | 943 |
| 869 | Ga0268265_11547431 | 3300028380 | Unclassified | 667 |
| 870 | Ga0268264_10006536 | 3300028381 | Bacteria | 9817 |
| 871 | Ga0268264_10057568 | 3300028381 | Unclassified | 3251 |
| 872 | Ga0268264_10058091 | 3300028381 | Bacteria | 3238 |
| 873 | Ga0268264_10119034 | 3300028381 | Unclassified | 2325 |
| 874 | Ga0268264_10177562 | 3300028381 | Bacteria | 1931 |
| 875 | Ga0268264_10204039 | 3300028381 | Unclassified | 1810 |
| 876 | Ga0268264_10278244 | 3300028381 | Unclassified | 1566 |
| 877 | Ga0268264_10304717 | 3300028381 | Unclassified | 1501 |
| 878 | Ga0268264_10743407 | 3300028381 | Unclassified | 977 |
| 879 | Ga0307408_100249878 | 3300031548 | Unclassified | 1462 |
| 880 | Ga0307408_100818120 | 3300031548 | Unclassified | 847 |
| 881 | Ga0307405_11459476 | 3300031731 | Unclassified | 600 |
| 882 | Ga0307413_10251320 | 3300031824 | Bacteria | 1312 |
| 883 | Ga0307410_10409014 | 3300031852 | Bacteria | 1098 |
| 884 | Ga0307412_10583142 | 3300031911 | Unclassified | 944 |
| 885 | Ga0307412_11097708 | 3300031911 | Unclassified | 708 |
| 886 | Ga0307409_100033275 | 3300031995 | Unclassified | 3750 |
| 887 | Ga0307416_100210316 | 3300032002 | Unclassified | 1855 |
| 888 | Ga0307416_100387319 | 3300032002 | Bacteria | 1430 |
| 889 | Ga0307414_10238473 | 3300032004 | Unclassified | 1504 |
| 890 | Ga0307414_10754802 | 3300032004 | Unclassified | 884 |
| 891 | Ga0307411_10216827 | 3300032005 | Bacteria | 1482 |
| 892 | Ga0307411_10677169 | 3300032005 | Unclassified | 896 |
| 893 | Ga0307411_11787378 | 3300032005 | Unclassified | 570 |
| 894 | Ga0307415_100155891 | 3300032126 | Bacteria | 1763 |
| 895 | Ga0307415_100237548 | 3300032126 | Unclassified | 1472 |
| 896 | Ga0307415_100250285 | 3300032126 | Bacteria | 1439 |
| 897 | Ga0307415_100268670 | 3300032126 | Bacteria | 1396 |
| 898 | Ga0373940_0219664 | 3300035088 | Unclassified | 631 |
| 899 | Ga0373951_0003178 | 3300035091 | Unclassified | 4033 |
| 900 | Ga0373942_0001683 | 3300035207 | Bacteria | 5610 |
| 901 | Ga0373961_0256853 | 3300035241 | Bacteria | 634 |
| 902 | Ga0373931_0351913 | 3300035691 | Unclassified | 922 |
| 903 | Ga0373937_0076330 | 3300036401 | Unclassified | 3095 |
| 904 | Ga0395900_0056945 | 3300037418 | Bacteria | 4024 |
| 905 | Ga0395900_0163643 | 3300037418 | Bacteria | 2268 |
| 906 | Ga0395900_0177050 | 3300037418 | Bacteria | 2169 |
| 907 | Ga0395900_0338097 | 3300037418 | Bacteria | 1482 |
| 908 | Ga0395900_0550887 | 3300037418 | Unclassified | 1098 |
| 909 | Ga0395898_0341776 | 3300037466 | Unclassified | 1427 |
| 910 | Ga0395901_0231048 | 3300038443 | Bacteria | 1931 |
| 911 | Ga0395901_0428296 | 3300038443 | Bacteria | 1356 |
| 912 | Ga0242419_007524 | 3300038698 | Unclassified | 804 |
| 913 | Ga0439431_0099174 | 3300041997 | Unclassified | 799 |
| 914 | Ga0439455_0008734 | 3300042012 | Bacteria | 2179 |
| 915 | Ga0439458_0009743 | 3300042157 | Unclassified | 2139 |
| 916 | Ga0451577_0910173 | 3300042876 | Bacteria | 792 |
| 917 | Ga0451577_1644934 | 3300042876 | Unclassified | 566 |
| 918 | Ga0451576_0845476 | 3300045051 | Unclassified | 961 |
| 919 | Ga0495582_0134736 | 3300046473 | Unclassified | 1397 |
| 920 | Ga0495620_0208669 | 3300046515 | Unclassified | 750 |
| 921 | Ga0495663_0000123 | 3300046525 | Bacteria | 32150 |
| 922 | Ga0495598_0000081 | 3300046537 | Bacteria | 15622 |
| 923 | Ga0495621_0000084 | 3300046539 | Bacteria | 19306 |
| 924 | Ga0495668_0083344 | 3300046616 | Unclassified | 1754 |
| 925 | Ga0495625_0278567 | 3300046660 | Bacteria | 1077 |
| 926 | Ga0495658_0092964 | 3300046683 | Unclassified | 1789 |
| 927 | Ga0495672_0049690 | 3300047320 | Bacteria | 2481 |
| 928 | Ga0495677_0238481 | 3300047445 | Unclassified | 710 |
| 929 | Ga0496102_0017178 | 3300048905 | Bacteria | 6336 |
| 930 | Ga0496102_0364345 | 3300048905 | Bacteria | 1361 |
| 931 | Ga0496104_0466631 | 3300048907 | Bacteria | 1174 |
| 932 | Ga0496104_1119724 | 3300048907 | Bacteria | 691 |
| 933 | Ga0496106_0059689 | 3300048909 | Bacteria | 2890 |
| 934 | Ga0496106_0083993 | 3300048909 | Bacteria | 2449 |
| 935 | Ga0496108_0314066 | 3300048911 | Unclassified | 1366 |
| 936 | Ga0496108_0849964 | 3300048911 | Unclassified | 785 |
| 937 | Ga0496109_0588341 | 3300048912 | Unclassified | 1049 |
| 938 | Ga0496109_0825548 | 3300048912 | Unclassified | 865 |
| 939 | Ga0496109_1367692 | 3300048912 | Bacteria | 644 |
| 940 | Ga0496110_0200101 | 3300048913 | Bacteria | 1815 |
| 941 | Ga0496110_0493001 | 3300048913 | Bacteria | 1116 |
| 942 | Ga0496111_0379224 | 3300048914 | Unclassified | 1046 |
| 943 | Ga0496112_0124296 | 3300048915 | Bacteria | 2551 |
| 944 | Ga0496112_0232018 | 3300048915 | Unclassified | 1800 |
| 945 | Ga0496112_0289181 | 3300048915 | Bacteria | 1585 |
| 946 | Ga0496112_0322164 | 3300048915 | Bacteria | 1490 |
| 947 | Ga0496112_0353615 | 3300048915 | Unclassified | 1411 |
| 948 | Ga0496112_0524628 | 3300048915 | Unclassified | 1119 |
| 949 | Ga0496112_0946015 | 3300048915 | Archaea | 783 |
| 950 | Ga0496112_1217422 | 3300048915 | Bacteria | 670 |
| 951 | Ga0496113_0044188 | 3300048916 | Unclassified | 3300 |
| 952 | Ga0496113_0085652 | 3300048916 | Unclassified | 2421 |
| 953 | Ga0501290_008692 | 3300049513 | Bacteria | 1287 |
| 954 | Ga0501291_006100 | 3300049514 | Unclassified | 1597 |
| 955 | Ga0501291_026577 | 3300049514 | Unclassified | 954 |
| 956 | Ga0501292_006230 | 3300049515 | Unclassified | 1688 |
| 957 | Ga0501294_007750 | 3300049517 | Unclassified | 1039 |
| 958 | Ga0501296_000186 | 3300049519 | Bacteria | 6568 |
| 959 | Ga0501297_000526 | 3300049520 | Unclassified | 3450 |
| 960 | Ga0501297_022777 | 3300049520 | Bacteria | 793 |
| 961 | Ga0501298_007749 | 3300049521 | Unclassified | 1788 |
| 962 | Ga0501299_000948 | 3300049522 | Unclassified | 3588 |
| 963 | Ga0501299_006165 | 3300049522 | Bacteria | 1873 |
| 964 | Ga0501299_012388 | 3300049522 | Unclassified | 1454 |
| 965 | Ga0501301_018947 | 3300049524 | Unclassified | 646 |
| 966 | Ga0501038_0007200 | 3300049574 | Bacteria | 10280 |
| 967 | Ga0501075_0340260 | 3300049591 | Bacteria | 1143 |
| 968 | Ga0501198_028644 | 3300049649 | Unclassified | 920 |
| 969 | Ga0501198_068401 | 3300049649 | Unclassified | 665 |
| 970 | Ga0501202_020467 | 3300049652 | Unclassified | 1315 |
| 971 | Ga0501202_024105 | 3300049652 | Unclassified | 1232 |
| 972 | Ga0501202_076030 | 3300049652 | Unclassified | 781 |
| 973 | Ga0501206_018915 | 3300049653 | Unclassified | 973 |
| 974 | Ga0501216_003648 | 3300049660 | Unclassified | 2257 |
| 975 | Ga0501216_019821 | 3300049660 | Bacteria | 1170 |
| 976 | Ga0501216_036119 | 3300049660 | Unclassified | 931 |
| 977 | Ga0501216_037190 | 3300049660 | Bacteria | 920 |
| 978 | Ga0501217_026126 | 3300049661 | Bacteria | 1409 |
| 979 | Ga0501217_037540 | 3300049661 | Bacteria | 1220 |
| 980 | Ga0501223_016094 | 3300049663 | Bacteria | 1479 |
| 981 | Ga0501224_005508 | 3300049664 | Bacteria | 1816 |
| 982 | Ga0501224_039528 | 3300049664 | Unclassified | 713 |
| 983 | Ga0501230_147204 | 3300049667 | Unclassified | 533 |
| 984 | Ga0501233_010910 | 3300049668 | Unclassified | 1799 |
| 985 | Ga0501235_012410 | 3300049669 | Bacteria | 1874 |
| 986 | Ga0501235_016418 | 3300049669 | Unclassified | 1635 |
| 987 | Ga0501236_030478 | 3300049670 | Unclassified | 851 |
| 988 | Ga0501236_140037 | 3300049670 | Unclassified | 505 |
| 989 | Ga0501239_006013 | 3300049672 | Bacteria | 1236 |
| 990 | Ga0501249_012607 | 3300049679 | Bacteria | 1788 |
| 991 | Ga0501249_113967 | 3300049679 | Unclassified | 655 |
| 992 | Ga0501249_116063 | 3300049679 | Bacteria | 650 |
| 993 | Ga0501250_001385 | 3300049680 | Bacteria | 1978 |
| 994 | Ga0501251_023260 | 3300049681 | Unclassified | 838 |
| 995 | Ga0501253_021611 | 3300049683 | Unclassified | 1136 |
| 996 | Ga0501260_006938 | 3300049689 | Unclassified | 1097 |
| 997 | Ga0501260_007902 | 3300049689 | Bacteria | 1042 |
| 998 | Ga0501260_013423 | 3300049689 | Unclassified | 845 |
| 999 | Ga0501221_187444 | 3300049704 | Unclassified | 569 |
| 1000 | Ga0501225_0003895 | 3300049705 | Bacteria | 4470 |
| 1001 | Ga0501225_0016539 | 3300049705 | Unclassified | 2052 |
| 1002 | Ga0501225_0017575 | 3300049705 | Bacteria | 1985 |
| 1003 | Ga0501225_0050947 | 3300049705 | Unclassified | 1153 |
| 1004 | Ga0501229_004125 | 3300049706 | Bacteria | 1759 |
| 1005 | Ga0501229_019004 | 3300049706 | Unclassified | 904 |
| 1006 | Ga0501234_026874 | 3300049707 | Bacteria | 924 |
| 1007 | Ga0501234_082537 | 3300049707 | Unclassified | 568 |
| 1008 | Ga0501245_004655 | 3300049708 | Bacteria | 1888 |
| 1009 | Ga0501245_005544 | 3300049708 | Unclassified | 1750 |
| 1010 | Ga0501245_055822 | 3300049708 | Unclassified | 711 |
| 1011 | Ga0501263_020496 | 3300049760 | Bacteria | 887 |
| 1012 | Ga0501264_004315 | 3300049761 | Unclassified | 1289 |
| 1013 | Ga0501265_007485 | 3300049762 | Unclassified | 1287 |
| 1014 | Ga0501268_057442 | 3300049765 | Bacteria | 765 |
| 1015 | Ga0501269_017992 | 3300049766 | Unclassified | 875 |
| 1016 | Ga0501271_031811 | 3300049768 | Unclassified | 655 |
| 1017 | Ga0501272_007445 | 3300049769 | Bacteria | 1186 |
| 1018 | Ga0501273_049801 | 3300049770 | Unclassified | 638 |
| 1019 | Ga0501274_001355 | 3300049771 | Unclassified | 1865 |
| 1020 | Ga0501275_084120 | 3300049772 | Unclassified | 520 |
| 1021 | Ga0501278_003167 | 3300049774 | Bacteria | 1163 |
| 1022 | Ga0501282_040751 | 3300049778 | Unclassified | 554 |
| 1023 | Ga0501283_006164 | 3300049779 | Unclassified | 1670 |
| 1024 | Ga0501283_012153 | 3300049779 | Bacteria | 1291 |
| 1025 | Ga0501212_011401 | 3300049851 | Unclassified | 1280 |
| 1026 | Ga0501226_013419 | 3300049853 | Unclassified | 905 |
| 1027 | nmdc:mga05p37_101353_c1 | 3300050507 | Bacteria | 3546 |
| 1028 | nmdc:mga05p37_1593869_c1 | 3300050507 | Unclassified | 644 |
| 1029 | nmdc:mga05p37_338829_c1 | 3300050507 | Bacteria | 1774 |
| 1030 | nmdc:mga05p37_368157_c1 | 3300050507 | Bacteria | 1687 |
| 1031 | nmdc:mga05p37_930106_c1 | 3300050507 | Archaea | 933 |
| 1032 | nmdc:mga09592_144706_c1 | 3300050508 | Bacteria | 2049 |
| 1033 | nmdc:mga09592_1472985_c1 | 3300050508 | Unclassified | 555 |
| 1034 | nmdc:mga0qj67_353864_c1 | 3300050509 | Unclassified | 1187 |
| 1035 | nmdc:mga0qj67_48770_c1 | 3300050509 | Bacteria | 3346 |
| 1036 | nmdc:mga06r32_151961_c1 | 3300050510 | Bacteria | 2294 |
| 1037 | nmdc:mga06r32_70656_c1 | 3300050510 | Bacteria | 3377 |
| 1038 | nmdc:mga08y16_172612_c1 | 3300050511 | Bacteria | 2246 |
| 1039 | nmdc:mga08y16_436742_c1 | 3300050511 | Bacteria | 1337 |
| 1040 | nmdc:mga08y16_58197_c1 | 3300050511 | Bacteria | 4038 |
| 1041 | nmdc:mga08y16_844037_c1 | 3300050511 | Unclassified | 906 |
| 1042 | nmdc:mga0n895_169326_c1 | 3300050512 | Unclassified | 2216 |
| 1043 | nmdc:mga0n895_2218011_c1 | 3300050512 | Unclassified | 504 |
| 1044 | nmdc:mga0n895_48686_c1 | 3300050512 | Bacteria | 4150 |
| 1045 | nmdc:mga0rr50_24584_c1 | 3300050513 | Bacteria | 4174 |
| 1046 | nmdc:mga0rr50_845755_c1 | 3300050513 | Unclassified | 780 |
| 1047 | nmdc:mga08x19_3718_c1 | 3300050514 | Bacteria | 9084 |
| 1048 | nmdc:mga0a205_124443_c1 | 3300050515 | Unclassified | 2478 |
| 1049 | nmdc:mga0a205_231286_c1 | 3300050515 | Unclassified | 1732 |
| 1050 | nmdc:mga0a205_233499_c1 | 3300050515 | Unclassified | 1722 |
| 1051 | nmdc:mga0a205_240041_c1 | 3300050515 | Bacteria | 1693 |
| 1052 | nmdc:mga0a205_251725_c1 | 3300050515 | Bacteria | 1646 |
| 1053 | nmdc:mga0a205_267826_c1 | 3300050515 | Bacteria | 1586 |
| 1054 | nmdc:mga0a205_27719_c2 | 3300050515 | Bacteria | 4446 |
| 1055 | nmdc:mga0a205_610558_c1 | 3300050515 | Unclassified | 943 |
| 1056 | nmdc:mga0a205_6874_c1 | 3300050515 | Bacteria | 5707 |
| 1057 | nmdc:mga0a205_712717_c1 | 3300050515 | Unclassified | 853 |
| 1058 | nmdc:mga0a205_991763_c1 | 3300050515 | Unclassified | 687 |
| 1059 | Ga0501084_0253607 | 3300054114 | Bacteria | 1485 |
| 1060 | Ga0530510_1190407 | 3300061734 | Bacteria | 584 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005337 | Ga0070682_100006511 | Ga0070682_1000065117 | 133 |
| 2 | 3300005338 | Ga0068868_100198035 | Ga0068868_1001980352 | 133 |
| 3 | 3300005345 | Ga0070692_10098348 | Ga0070692_100983482 | 133 |
| 4 | 3300005366 | Ga0070659_100652277 | Ga0070659_1006522772 | 133 |
| 5 | 3300005406 | Ga0070703_10013066 | Ga0070703_100130662 | 133 |
| 6 | 3300005440 | Ga0070705_100435808 | Ga0070705_1004358082 | 133 |
| 7 | 3300005444 | Ga0070694_100063279 | Ga0070694_1000632793 | 133 |
| 8 | 3300005545 | Ga0070695_100109706 | Ga0070695_1001097062 | 133 |
| 9 | 3300005547 | Ga0070693_100000305 | Ga0070693_10000030517 | 133 |
| 10 | 3300005549 | Ga0070704_100044294 | Ga0070704_1000442943 | 133 |
| 11 | 3300005615 | Ga0070702_100222670 | Ga0070702_1002226702 | 133 |
| 12 | 3300005616 | Ga0068852_100145754 | Ga0068852_1001457542 | 133 |
| 13 | 3300005617 | Ga0068859_100032266 | Ga0068859_1000322666 | 133 |
| 14 | 3300005834 | Ga0068851_10011958 | Ga0068851_100119583 | 133 |
| 15 | 3300005842 | Ga0068858_100052748 | Ga0068858_1000527484 | 133 |
| 16 | 3300006931 | Ga0097620_100032266 | Ga0097620_1000322662 | 133 |
| 17 | 3300009545 | Ga0105237_10004213 | Ga0105237_1000421312 | 133 |
| 18 | 3300025885 | Ga0207653_10010901 | Ga0207653_100109013 | 133 |
| 19 | 3300025904 | Ga0207647_10167431 | Ga0207647_101674312 | 133 |
| 20 | 3300025914 | Ga0207671_10006170 | Ga0207671_100061708 | 133 |
| 21 | 3300026023 | Ga0207677_10084605 | Ga0207677_100846053 | 133 |
| 22 | 3300026035 | Ga0207703_10064754 | Ga0207703_100647543 | 133 |
| 23 | 3300048916 | Ga0496113_0044188 | Ga0496113_0044188_2294_2728 | 133 |
| 24 | 3300003322 | rootL2_10229176 | rootL2_102291763 | 137 |
| 25 | 3300005337 | Ga0070682_100000051 | Ga0070682_10000005158 | 137 |
| 26 | 3300005364 | Ga0070673_101620656 | Ga0070673_1016206561 | 137 |
| 27 | 3300013308 | Ga0157375_11760246 | Ga0157375_117602461 | 137 |
| 28 | 3300025925 | Ga0207650_10641149 | Ga0207650_106411492 | 137 |
| 29 | 3300025926 | Ga0207659_10128702 | Ga0207659_101287022 | 137 |
| 30 | 3300025935 | Ga0207709_10803704 | Ga0207709_108037041 | 137 |
| 31 | 3300025960 | Ga0207651_10745919 | Ga0207651_107459192 | 137 |
| 32 | 3300002076 | JGI24749J21850_1023508 | JGI24749J21850_10235082 | 138 |
| 33 | 3300002459 | JGI24751J29686_10000107 | JGI24751J29686_100001075 | 138 |
| 34 | 3300003203 | JGI25406J46586_10026276 | JGI25406J46586_100262763 | 138 |
| 35 | 3300005289 | Ga0065704_10393606 | Ga0065704_103936062 | 138 |
| 36 | 3300005290 | Ga0065712_10002294 | Ga0065712_100022944 | 138 |
| 37 | 3300005293 | Ga0065715_10100976 | Ga0065715_101009762 | 138 |
| 38 | 3300005293 | Ga0065715_10123838 | Ga0065715_101238382 | 138 |
| 39 | 3300005293 | Ga0065715_10310441 | Ga0065715_103104411 | 138 |
| 40 | 3300005295 | Ga0065707_10340592 | Ga0065707_103405921 | 138 |
| 41 | 3300005330 | Ga0070690_101080185 | Ga0070690_1010801851 | 138 |
| 42 | 3300005331 | Ga0070670_100001037 | Ga0070670_10000103715 | 138 |
| 43 | 3300005331 | Ga0070670_100017767 | Ga0070670_1000177674 | 138 |
| 44 | 3300005334 | Ga0068869_101906008 | Ga0068869_1019060081 | 138 |
| 45 | 3300005343 | Ga0070687_100870944 | Ga0070687_1008709441 | 138 |
| 46 | 3300005344 | Ga0070661_100938070 | Ga0070661_1009380701 | 138 |
| 47 | 3300005345 | Ga0070692_10237931 | Ga0070692_102379312 | 138 |
| 48 | 3300005345 | Ga0070692_10450274 | Ga0070692_104502742 | 138 |
| 49 | 3300005354 | Ga0070675_100532517 | Ga0070675_1005325172 | 138 |
| 50 | 3300005356 | Ga0070674_100879921 | Ga0070674_1008799212 | 138 |
| 51 | 3300005364 | Ga0070673_101494164 | Ga0070673_1014941641 | 138 |
| 52 | 3300005366 | Ga0070659_100061476 | Ga0070659_1000614761 | 138 |
| 53 | 3300005438 | Ga0070701_10032396 | Ga0070701_100323964 | 138 |
| 54 | 3300005441 | Ga0070700_100035616 | Ga0070700_1000356164 | 138 |
| 55 | 3300005444 | Ga0070694_100330415 | Ga0070694_1003304151 | 138 |
| 56 | 3300005444 | Ga0070694_101269899 | Ga0070694_1012698992 | 138 |
| 57 | 3300005459 | Ga0068867_100252513 | Ga0068867_1002525132 | 138 |
| 58 | 3300005466 | Ga0070685_11297953 | Ga0070685_112979531 | 138 |
| 59 | 3300005539 | Ga0068853_100315269 | Ga0068853_1003152692 | 138 |
| 60 | 3300005546 | Ga0070696_100865349 | Ga0070696_1008653491 | 138 |
| 61 | 3300005547 | Ga0070693_100078078 | Ga0070693_1000780783 | 138 |
| 62 | 3300005549 | Ga0070704_100688425 | Ga0070704_1006884252 | 138 |
| 63 | 3300005564 | Ga0070664_100125031 | Ga0070664_1001250312 | 138 |
| 64 | 3300005564 | Ga0070664_100192721 | Ga0070664_1001927212 | 138 |
| 65 | 3300005577 | Ga0068857_100067092 | Ga0068857_1000670921 | 138 |
| 66 | 3300005578 | Ga0068854_101356184 | Ga0068854_1013561842 | 138 |
| 67 | 3300005615 | Ga0070702_100322854 | Ga0070702_1003228542 | 138 |
| 68 | 3300005617 | Ga0068859_100069646 | Ga0068859_1000696464 | 138 |
| 69 | 3300005617 | Ga0068859_100091632 | Ga0068859_1000916323 | 138 |
| 70 | 3300005617 | Ga0068859_100264536 | Ga0068859_1002645362 | 138 |
| 71 | 3300005617 | Ga0068859_100306733 | Ga0068859_1003067332 | 138 |
| 72 | 3300005617 | Ga0068859_100771954 | Ga0068859_1007719542 | 138 |
| 73 | 3300005617 | Ga0068859_100918069 | Ga0068859_1009180692 | 138 |
| 74 | 3300005618 | Ga0068864_100632611 | Ga0068864_1006326112 | 138 |
| 75 | 3300005718 | Ga0068866_10113348 | Ga0068866_101133482 | 138 |
| 76 | 3300005719 | Ga0068861_100010957 | Ga0068861_1000109578 | 138 |
| 77 | 3300005840 | Ga0068870_10096885 | Ga0068870_100968852 | 138 |
| 78 | 3300005840 | Ga0068870_10512172 | Ga0068870_105121721 | 138 |
| 79 | 3300005841 | Ga0068863_102645650 | Ga0068863_1026456501 | 138 |
| 80 | 3300005842 | Ga0068858_100313763 | Ga0068858_1003137632 | 138 |
| 81 | 3300005842 | Ga0068858_100502341 | Ga0068858_1005023411 | 138 |
| 82 | 3300005843 | Ga0068860_100095569 | Ga0068860_1000955694 | 138 |
| 83 | 3300005843 | Ga0068860_100164402 | Ga0068860_1001644023 | 138 |
| 84 | 3300005844 | Ga0068862_101720658 | Ga0068862_1017206582 | 138 |
| 85 | 3300005985 | Ga0081539_10000067 | Ga0081539_10000067130 | 138 |
| 86 | 3300006237 | Ga0097621_100743033 | Ga0097621_1007430332 | 138 |
| 87 | 3300006871 | Ga0075434_100837926 | Ga0075434_1008379262 | 138 |
| 88 | 3300006881 | Ga0068865_100720682 | Ga0068865_1007206822 | 138 |
| 89 | 3300006931 | Ga0097620_100069647 | Ga0097620_1000696474 | 138 |
| 90 | 3300006931 | Ga0097620_100091625 | Ga0097620_1000916253 | 138 |
| 91 | 3300006931 | Ga0097620_100264532 | Ga0097620_1002645322 | 138 |
| 92 | 3300006931 | Ga0097620_100306736 | Ga0097620_1003067362 | 138 |
| 93 | 3300006931 | Ga0097620_100771979 | Ga0097620_1007719792 | 138 |
| 94 | 3300006931 | Ga0097620_100918037 | Ga0097620_1009180372 | 138 |
| 95 | 3300009011 | Ga0105251_10457182 | Ga0105251_104571822 | 138 |
| 96 | 3300009092 | Ga0105250_10135033 | Ga0105250_101350332 | 138 |
| 97 | 3300009101 | Ga0105247_10013105 | Ga0105247_100131052 | 138 |
| 98 | 3300009101 | Ga0105247_10020829 | Ga0105247_100208292 | 138 |
| 99 | 3300009148 | Ga0105243_10122873 | Ga0105243_101228733 | 138 |
| 100 | 3300009174 | Ga0105241_11006207 | Ga0105241_110062072 | 138 |
| 101 | 3300009176 | Ga0105242_10088270 | Ga0105242_100882704 | 138 |
| 102 | 3300009176 | Ga0105242_11577363 | Ga0105242_115773632 | 138 |
| 103 | 3300009177 | Ga0105248_10087616 | Ga0105248_100876165 | 138 |
| 104 | 3300009177 | Ga0105248_10428889 | Ga0105248_104288892 | 138 |
| 105 | 3300009545 | Ga0105237_10117960 | Ga0105237_101179604 | 138 |
| 106 | 3300009551 | Ga0105238_10064038 | Ga0105238_100640382 | 138 |
| 107 | 3300009553 | Ga0105249_10066785 | Ga0105249_100667854 | 138 |
| 108 | 3300010375 | Ga0105239_12145922 | Ga0105239_121459222 | 138 |
| 109 | 3300010375 | Ga0105239_12212756 | Ga0105239_122127562 | 138 |
| 110 | 3300011119 | Ga0105246_11858765 | Ga0105246_118587652 | 138 |
| 111 | 3300013306 | Ga0163162_10670436 | Ga0163162_106704361 | 138 |
| 112 | 3300013306 | Ga0163162_13026378 | Ga0163162_130263781 | 138 |
| 113 | 3300014325 | Ga0163163_10000183 | Ga0163163_1000018337 | 138 |
| 114 | 3300014325 | Ga0163163_10578035 | Ga0163163_105780352 | 138 |
| 115 | 3300014325 | Ga0163163_10793545 | Ga0163163_107935452 | 138 |
| 116 | 3300014326 | Ga0157380_10963826 | Ga0157380_109638262 | 138 |
| 117 | 3300014968 | Ga0157379_10142071 | Ga0157379_101420713 | 138 |
| 118 | 3300014968 | Ga0157379_10449365 | Ga0157379_104493652 | 138 |
| 119 | 3300025315 | Ga0207697_10383768 | Ga0207697_103837682 | 138 |
| 120 | 3300025900 | Ga0207710_10003825 | Ga0207710_100038252 | 138 |
| 121 | 3300025901 | Ga0207688_10821881 | Ga0207688_108218812 | 138 |
| 122 | 3300025904 | Ga0207647_10132344 | Ga0207647_101323443 | 138 |
| 123 | 3300025911 | Ga0207654_10002853 | Ga0207654_100028531 | 138 |
| 124 | 3300025911 | Ga0207654_10077227 | Ga0207654_100772272 | 138 |
| 125 | 3300025914 | Ga0207671_10098612 | Ga0207671_100986122 | 138 |
| 126 | 3300025914 | Ga0207671_10598881 | Ga0207671_105988812 | 138 |
| 127 | 3300025920 | Ga0207649_10460819 | Ga0207649_104608192 | 138 |
| 128 | 3300025921 | Ga0207652_10741916 | Ga0207652_107419162 | 138 |
| 129 | 3300025923 | Ga0207681_11231990 | Ga0207681_112319901 | 138 |
| 130 | 3300025924 | Ga0207694_10032355 | Ga0207694_100323554 | 138 |
| 131 | 3300025925 | Ga0207650_10000001 | Ga0207650_10000001515 | 138 |
| 132 | 3300025925 | Ga0207650_10943325 | Ga0207650_109433252 | 138 |
| 133 | 3300025926 | Ga0207659_10172431 | Ga0207659_101724312 | 138 |
| 134 | 3300025933 | Ga0207706_10743602 | Ga0207706_107436022 | 138 |
| 135 | 3300025934 | Ga0207686_10269800 | Ga0207686_102698001 | 138 |
| 136 | 3300025935 | Ga0207709_10163778 | Ga0207709_101637783 | 138 |
| 137 | 3300025938 | Ga0207704_10503622 | Ga0207704_105036222 | 138 |
| 138 | 3300025940 | Ga0207691_11308473 | Ga0207691_113084731 | 138 |
| 139 | 3300025941 | Ga0207711_10082859 | Ga0207711_100828592 | 138 |
| 140 | 3300025941 | Ga0207711_10184406 | Ga0207711_101844062 | 138 |
| 141 | 3300025942 | Ga0207689_10866498 | Ga0207689_108664982 | 138 |
| 142 | 3300025945 | Ga0207679_10614995 | Ga0207679_106149951 | 138 |
| 143 | 3300025961 | Ga0207712_10181959 | Ga0207712_101819593 | 138 |
| 144 | 3300025961 | Ga0207712_10468011 | Ga0207712_104680112 | 138 |
| 145 | 3300025981 | Ga0207640_10743839 | Ga0207640_107438392 | 138 |
| 146 | 3300026035 | Ga0207703_11066295 | Ga0207703_110662952 | 138 |
| 147 | 3300026067 | Ga0207678_10936053 | Ga0207678_109360531 | 138 |
| 148 | 3300026075 | Ga0207708_10017238 | Ga0207708_100172384 | 138 |
| 149 | 3300026089 | Ga0207648_11048559 | Ga0207648_110485592 | 138 |
| 150 | 3300026095 | Ga0207676_11015304 | Ga0207676_110153042 | 138 |
| 151 | 3300026116 | Ga0207674_10369663 | Ga0207674_103696632 | 138 |
| 152 | 3300026116 | Ga0207674_10844498 | Ga0207674_108444982 | 138 |
| 153 | 3300026116 | Ga0207674_11655802 | Ga0207674_116558022 | 138 |
| 154 | 3300026118 | Ga0207675_100015208 | Ga0207675_1000152087 | 138 |
| 155 | 3300026118 | Ga0207675_100539154 | Ga0207675_1005391541 | 138 |
| 156 | 3300026118 | Ga0207675_100625648 | Ga0207675_1006256482 | 138 |
| 157 | 3300026142 | Ga0207698_10140659 | Ga0207698_101406593 | 138 |
| 158 | 3300026142 | Ga0207698_10708902 | Ga0207698_107089022 | 138 |
| 159 | 3300028380 | Ga0268265_10475761 | Ga0268265_104757612 | 138 |
| 160 | 3300028381 | Ga0268264_10119034 | Ga0268264_101190342 | 138 |
| 161 | 3300028381 | Ga0268264_10278244 | Ga0268264_102782442 | 138 |
| 162 | 3300028381 | Ga0268264_10304717 | Ga0268264_103047172 | 138 |
| 163 | 3300032004 | Ga0307414_10754802 | Ga0307414_107548022 | 138 |
| 164 | 3300032005 | Ga0307411_11787378 | Ga0307411_117873782 | 138 |
| 165 | 3300032126 | Ga0307415_100237548 | Ga0307415_1002375482 | 138 |
| 166 | 3300035207 | Ga0373942_0001683 | Ga0373942_0001683_3361_3789 | 138 |
| 167 | 3300035241 | Ga0373961_0256853 | Ga0373961_0256853_196_624 | 138 |
| 168 | 3300038698 | Ga0242419_007524 | Ga0242419_007524_292_708 | 138 |
| 169 | 3300048909 | Ga0496106_0083993 | Ga0496106_0083993_1469_1885 | 138 |
| 170 | 3300048911 | Ga0496108_0849964 | Ga0496108_0849964_212_628 | 138 |
| 171 | 3300048912 | Ga0496109_0588341 | Ga0496109_0588341_392_808 | 138 |
| 172 | 3300048915 | Ga0496112_0124296 | Ga0496112_0124296_508_924 | 138 |
| 173 | 3300048915 | Ga0496112_0353615 | Ga0496112_0353615_188_604 | 138 |
| 174 | 3300049679 | Ga0501249_113967 | Ga0501249_113967_17_445 | 138 |
| 175 | 3300049704 | Ga0501221_187444 | Ga0501221_187444_59_487 | 138 |
| 176 | 3300049705 | Ga0501225_0050947 | Ga0501225_0050947_695_1123 | 138 |
| 177 | 3300005293 | Ga0065715_10007562 | Ga0065715_100075622 | 139 |
| 178 | 3300005334 | Ga0068869_100393077 | Ga0068869_1003930772 | 139 |
| 179 | 3300005353 | Ga0070669_101210195 | Ga0070669_1012101952 | 139 |
| 180 | 3300005356 | Ga0070674_100362285 | Ga0070674_1003622852 | 139 |
| 181 | 3300005364 | Ga0070673_100082896 | Ga0070673_1000828963 | 139 |
| 182 | 3300005438 | Ga0070701_11381406 | Ga0070701_113814061 | 139 |
| 183 | 3300005440 | Ga0070705_100052194 | Ga0070705_1000521943 | 139 |
| 184 | 3300005458 | Ga0070681_10008066 | Ga0070681_1000806611 | 139 |
| 185 | 3300005467 | Ga0070706_100000097 | Ga0070706_10000009727 | 139 |
| 186 | 3300005468 | Ga0070707_100861749 | Ga0070707_1008617492 | 139 |
| 187 | 3300005545 | Ga0070695_100141530 | Ga0070695_1001415302 | 139 |
| 188 | 3300005546 | Ga0070696_100276096 | Ga0070696_1002760962 | 139 |
| 189 | 3300005547 | Ga0070693_100066277 | Ga0070693_1000662772 | 139 |
| 190 | 3300005549 | Ga0070704_100087485 | Ga0070704_1000874852 | 139 |
| 191 | 3300005577 | Ga0068857_100909935 | Ga0068857_1009099352 | 139 |
| 192 | 3300005615 | Ga0070702_100122575 | Ga0070702_1001225752 | 139 |
| 193 | 3300005618 | Ga0068864_101035380 | Ga0068864_1010353802 | 139 |
| 194 | 3300005719 | Ga0068861_102058976 | Ga0068861_1020589761 | 139 |
| 195 | 3300005841 | Ga0068863_100130818 | Ga0068863_1001308184 | 139 |
| 196 | 3300005843 | Ga0068860_100061511 | Ga0068860_1000615113 | 139 |
| 197 | 3300006852 | Ga0075433_10371980 | Ga0075433_103719802 | 139 |
| 198 | 3300009094 | Ga0111539_10545040 | Ga0111539_105450402 | 139 |
| 199 | 3300013102 | Ga0157371_10256321 | Ga0157371_102563212 | 139 |
| 200 | 3300014326 | Ga0157380_10523085 | Ga0157380_105230851 | 139 |
| 201 | 3300014745 | Ga0157377_10580414 | Ga0157377_105804141 | 139 |
| 202 | 3300025908 | Ga0207643_10217564 | Ga0207643_102175643 | 139 |
| 203 | 3300025910 | Ga0207684_10000023 | Ga0207684_10000023154 | 139 |
| 204 | 3300025912 | Ga0207707_10003187 | Ga0207707_100031878 | 139 |
| 205 | 3300025914 | Ga0207671_10058480 | Ga0207671_100584802 | 139 |
| 206 | 3300025923 | Ga0207681_10606531 | Ga0207681_106065312 | 139 |
| 207 | 3300025925 | Ga0207650_10687307 | Ga0207650_106873072 | 139 |
| 208 | 3300025942 | Ga0207689_10033647 | Ga0207689_100336475 | 139 |
| 209 | 3300026035 | Ga0207703_11049639 | Ga0207703_110496391 | 139 |
| 210 | 3300026088 | Ga0207641_10075946 | Ga0207641_100759463 | 139 |
| 211 | 3300026095 | Ga0207676_10095588 | Ga0207676_100955881 | 139 |
| 212 | 3300026095 | Ga0207676_10734979 | Ga0207676_107349792 | 139 |
| 213 | 3300026118 | Ga0207675_100924764 | Ga0207675_1009247642 | 139 |
| 214 | 3300027907 | Ga0207428_10491885 | Ga0207428_104918851 | 139 |
| 215 | 3300028381 | Ga0268264_10177562 | Ga0268264_101775623 | 139 |
| 216 | 3300031731 | Ga0307405_11459476 | Ga0307405_114594761 | 139 |
| 217 | 3300037418 | Ga0395900_0056945 | Ga0395900_0056945_1996_2415 | 139 |
| 218 | 3300038443 | Ga0395901_0231048 | Ga0395901_0231048_872_1291 | 139 |
| 219 | 3300048905 | Ga0496102_0364345 | Ga0496102_0364345_567_986 | 139 |
| 220 | 3300048912 | Ga0496109_1367692 | Ga0496109_1367692_156_575 | 139 |
| 221 | 3300050511 | nmdc:mga08y16_844037_c1 | nmdc:mga08y16_844037_c1_139_561 | 139 |
| 222 | 3300050515 | nmdc:mga0a205_610558_c1 | nmdc:mga0a205_610558_c1_66_485 | 139 |
| 223 | 3300000546 | LJNas_1024266 | LJNas_10242662 | 140 |
| 224 | 3300005347 | Ga0070668_100003898 | Ga0070668_1000038988 | 140 |
| 225 | 3300005444 | Ga0070694_100014362 | Ga0070694_1000143624 | 140 |
| 226 | 3300005459 | Ga0068867_100266958 | Ga0068867_1002669582 | 140 |
| 227 | 3300005545 | Ga0070695_100083928 | Ga0070695_1000839283 | 140 |
| 228 | 3300005548 | Ga0070665_100366628 | Ga0070665_1003666282 | 140 |
| 229 | 3300006931 | Ga0097620_100136599 | Ga0097620_1001365995 | 140 |
| 230 | 3300009148 | Ga0105243_10790024 | Ga0105243_107900242 | 140 |
| 231 | 3300009148 | Ga0105243_10825810 | Ga0105243_108258102 | 140 |
| 232 | 3300009553 | Ga0105249_10001351 | Ga0105249_1000135116 | 140 |
| 233 | 3300011119 | Ga0105246_10121618 | Ga0105246_101216182 | 140 |
| 234 | 3300013306 | Ga0163162_10001516 | Ga0163162_1000151616 | 140 |
| 235 | 3300014326 | Ga0157380_11338208 | Ga0157380_113382082 | 140 |
| 236 | 3300025935 | Ga0207709_11385677 | Ga0207709_113856771 | 140 |
| 237 | 3300025936 | Ga0207670_10253654 | Ga0207670_102536541 | 140 |
| 238 | 3300025961 | Ga0207712_10000022 | Ga0207712_10000022198 | 140 |
| 239 | 3300026116 | Ga0207674_10109212 | Ga0207674_101092122 | 140 |
| 240 | 3300047320 | Ga0495672_0049690 | Ga0495672_0049690_1601_2038 | 140 |
| 241 | 3300050507 | nmdc:mga05p37_1593869_c1 | nmdc:mga05p37_1593869_c1_104_526 | 140 |
| 242 | 3300005293 | Ga0065715_10584042 | Ga0065715_105840422 | 141 |
| 243 | 3300005444 | Ga0070694_100167011 | Ga0070694_1001670112 | 141 |
| 244 | 3300005445 | Ga0070708_100826520 | Ga0070708_1008265201 | 141 |
| 245 | 3300005467 | Ga0070706_100021785 | Ga0070706_1000217856 | 141 |
| 246 | 3300005468 | Ga0070707_100317534 | Ga0070707_1003175342 | 141 |
| 247 | 3300005471 | Ga0070698_100003588 | Ga0070698_10000358814 | 141 |
| 248 | 3300005536 | Ga0070697_100000176 | Ga0070697_10000017610 | 141 |
| 249 | 3300005539 | Ga0068853_100100877 | Ga0068853_1001008772 | 141 |
| 250 | 3300005545 | Ga0070695_100750907 | Ga0070695_1007509071 | 141 |
| 251 | 3300005617 | Ga0068859_101594401 | Ga0068859_1015944012 | 141 |
| 252 | 3300005618 | Ga0068864_101274847 | Ga0068864_1012748472 | 141 |
| 253 | 3300005719 | Ga0068861_101550159 | Ga0068861_1015501592 | 141 |
| 254 | 3300005844 | Ga0068862_102255382 | Ga0068862_1022553821 | 141 |
| 255 | 3300006852 | Ga0075433_10212242 | Ga0075433_102122423 | 141 |
| 256 | 3300006852 | Ga0075433_11821727 | Ga0075433_118217271 | 141 |
| 257 | 3300006871 | Ga0075434_100054566 | Ga0075434_1000545665 | 141 |
| 258 | 3300009098 | Ga0105245_10886280 | Ga0105245_108862802 | 141 |
| 259 | 3300009101 | Ga0105247_10868129 | Ga0105247_108681291 | 141 |
| 260 | 3300009147 | Ga0114129_11138347 | Ga0114129_111383471 | 141 |
| 261 | 3300009148 | Ga0105243_11761155 | Ga0105243_117611551 | 141 |
| 262 | 3300009545 | Ga0105237_10051585 | Ga0105237_100515851 | 141 |
| 263 | 3300009553 | Ga0105249_10019365 | Ga0105249_100193654 | 141 |
| 264 | 3300009553 | Ga0105249_10254620 | Ga0105249_102546202 | 141 |
| 265 | 3300010375 | Ga0105239_10081369 | Ga0105239_100813692 | 141 |
| 266 | 3300013100 | Ga0157373_10836311 | Ga0157373_108363112 | 141 |
| 267 | 3300013306 | Ga0163162_10005889 | Ga0163162_100058898 | 141 |
| 268 | 3300013308 | Ga0157375_11931294 | Ga0157375_119312941 | 141 |
| 269 | 3300025893 | Ga0207682_10549013 | Ga0207682_105490131 | 141 |
| 270 | 3300025907 | Ga0207645_10406137 | Ga0207645_104061372 | 141 |
| 271 | 3300025910 | Ga0207684_10005029 | Ga0207684_100050292 | 141 |
| 272 | 3300025911 | Ga0207654_10235228 | Ga0207654_102352282 | 141 |
| 273 | 3300025913 | Ga0207695_11233643 | Ga0207695_112336431 | 141 |
| 274 | 3300025922 | Ga0207646_10200587 | Ga0207646_102005872 | 141 |
| 275 | 3300025935 | Ga0207709_10363425 | Ga0207709_103634251 | 141 |
| 276 | 3300025961 | Ga0207712_10324155 | Ga0207712_103241552 | 141 |
| 277 | 3300026041 | Ga0207639_10072676 | Ga0207639_100726763 | 141 |
| 278 | 3300026075 | Ga0207708_10047707 | Ga0207708_100477073 | 141 |
| 279 | 3300026078 | Ga0207702_10177755 | Ga0207702_101777553 | 141 |
| 280 | 3300026118 | Ga0207675_101104144 | Ga0207675_1011041442 | 141 |
| 281 | 3300031852 | Ga0307410_10409014 | Ga0307410_104090142 | 141 |
| 282 | 3300032126 | Ga0307415_100268670 | Ga0307415_1002686702 | 141 |
| 283 | 3300037418 | Ga0395900_0338097 | Ga0395900_0338097_973_1398 | 141 |
| 284 | 3300046515 | Ga0495620_0208669 | Ga0495620_0208669_144_596 | 141 |
| 285 | 3300046525 | Ga0495663_0000123 | Ga0495663_0000123_27414_27866 | 141 |
| 286 | 3300046537 | Ga0495598_0000081 | Ga0495598_0000081_14013_14465 | 141 |
| 287 | 3300046539 | Ga0495621_0000084 | Ga0495621_0000084_18042_18494 | 141 |
| 288 | 3300046616 | Ga0495668_0083344 | Ga0495668_0083344_1171_1623 | 141 |
| 289 | 3300047445 | Ga0495677_0238481 | Ga0495677_0238481_233_685 | 141 |
| 290 | 3300048905 | Ga0496102_0017178 | Ga0496102_0017178_4020_4451 | 141 |
| 291 | 3300049520 | Ga0501297_022777 | Ga0501297_022777_237_662 | 141 |
| 292 | 3300049522 | Ga0501299_006165 | Ga0501299_006165_389_814 | 141 |
| 293 | 3300049524 | Ga0501301_018947 | Ga0501301_018947_93_518 | 141 |
| 294 | 3300049653 | Ga0501206_018915 | Ga0501206_018915_431_856 | 141 |
| 295 | 3300049660 | Ga0501216_019821 | Ga0501216_019821_334_759 | 141 |
| 296 | 3300049661 | Ga0501217_026126 | Ga0501217_026126_739_1164 | 141 |
| 297 | 3300049670 | Ga0501236_030478 | Ga0501236_030478_241_666 | 141 |
| 298 | 3300049672 | Ga0501239_006013 | Ga0501239_006013_410_835 | 141 |
| 299 | 3300049680 | Ga0501250_001385 | Ga0501250_001385_354_779 | 141 |
| 300 | 3300049689 | Ga0501260_013423 | Ga0501260_013423_146_571 | 141 |
| 301 | 3300049708 | Ga0501245_004655 | Ga0501245_004655_121_546 | 141 |
| 302 | 3300049769 | Ga0501272_007445 | Ga0501272_007445_153_578 | 141 |
| 303 | 3300049779 | Ga0501283_012153 | Ga0501283_012153_421_846 | 141 |
| 304 | 3300050512 | nmdc:mga0n895_48686_c1 | nmdc:mga0n895_48686_c1_3637_4062 | 141 |
| 305 | 3300050515 | nmdc:mga0a205_251725_c1 | nmdc:mga0a205_251725_c1_1067_1492 | 141 |
| 306 | 3300003203 | JGI25406J46586_10022414 | JGI25406J46586_100224143 | 142 |
| 307 | 3300005288 | Ga0065714_10485774 | Ga0065714_104857741 | 142 |
| 308 | 3300005289 | Ga0065704_10140109 | Ga0065704_101401092 | 142 |
| 309 | 3300005289 | Ga0065704_10201753 | Ga0065704_102017532 | 142 |
| 310 | 3300005289 | Ga0065704_10237409 | Ga0065704_102374092 | 142 |
| 311 | 3300005289 | Ga0065704_10620604 | Ga0065704_106206041 | 142 |
| 312 | 3300005290 | Ga0065712_10005369 | Ga0065712_100053693 | 142 |
| 313 | 3300005290 | Ga0065712_10018041 | Ga0065712_100180413 | 142 |
| 314 | 3300005290 | Ga0065712_10073348 | Ga0065712_100733482 | 142 |
| 315 | 3300005293 | Ga0065715_10099361 | Ga0065715_100993613 | 142 |
| 316 | 3300005293 | Ga0065715_10282463 | Ga0065715_102824632 | 142 |
| 317 | 3300005293 | Ga0065715_10399621 | Ga0065715_103996211 | 142 |
| 318 | 3300005293 | Ga0065715_10779036 | Ga0065715_107790361 | 142 |
| 319 | 3300005295 | Ga0065707_10138063 | Ga0065707_101380633 | 142 |
| 320 | 3300005295 | Ga0065707_10144234 | Ga0065707_101442342 | 142 |
| 321 | 3300005295 | Ga0065707_10253448 | Ga0065707_102534482 | 142 |
| 322 | 3300005295 | Ga0065707_10398166 | Ga0065707_103981661 | 142 |
| 323 | 3300005328 | Ga0070676_10223646 | Ga0070676_102236461 | 142 |
| 324 | 3300005328 | Ga0070676_10250226 | Ga0070676_102502262 | 142 |
| 325 | 3300005328 | Ga0070676_11087608 | Ga0070676_110876081 | 142 |
| 326 | 3300005329 | Ga0070683_101073279 | Ga0070683_1010732792 | 142 |
| 327 | 3300005330 | Ga0070690_100005943 | Ga0070690_1000059438 | 142 |
| 328 | 3300005330 | Ga0070690_100052256 | Ga0070690_1000522563 | 142 |
| 329 | 3300005330 | Ga0070690_100080578 | Ga0070690_1000805783 | 142 |
| 330 | 3300005331 | Ga0070670_100006797 | Ga0070670_1000067976 | 142 |
| 331 | 3300005331 | Ga0070670_100632979 | Ga0070670_1006329791 | 142 |
| 332 | 3300005333 | Ga0070677_10488909 | Ga0070677_104889091 | 142 |
| 333 | 3300005334 | Ga0068869_100025113 | Ga0068869_1000251133 | 142 |
| 334 | 3300005334 | Ga0068869_100039742 | Ga0068869_1000397424 | 142 |
| 335 | 3300005334 | Ga0068869_100107545 | Ga0068869_1001075453 | 142 |
| 336 | 3300005334 | Ga0068869_100192963 | Ga0068869_1001929632 | 142 |
| 337 | 3300005335 | Ga0070666_10032891 | Ga0070666_100328914 | 142 |
| 338 | 3300005335 | Ga0070666_10184527 | Ga0070666_101845272 | 142 |
| 339 | 3300005336 | Ga0070680_100016262 | Ga0070680_1000162622 | 142 |
| 340 | 3300005336 | Ga0070680_100393408 | Ga0070680_1003934081 | 142 |
| 341 | 3300005337 | Ga0070682_100241834 | Ga0070682_1002418342 | 142 |
| 342 | 3300005338 | Ga0068868_100025154 | Ga0068868_1000251544 | 142 |
| 343 | 3300005338 | Ga0068868_100066068 | Ga0068868_1000660682 | 142 |
| 344 | 3300005338 | Ga0068868_100074948 | Ga0068868_1000749483 | 142 |
| 345 | 3300005338 | Ga0068868_100865720 | Ga0068868_1008657202 | 142 |
| 346 | 3300005339 | Ga0070660_100089303 | Ga0070660_1000893033 | 142 |
| 347 | 3300005340 | Ga0070689_100212369 | Ga0070689_1002123692 | 142 |
| 348 | 3300005340 | Ga0070689_100249413 | Ga0070689_1002494132 | 142 |
| 349 | 3300005340 | Ga0070689_101057564 | Ga0070689_1010575642 | 142 |
| 350 | 3300005343 | Ga0070687_100002881 | Ga0070687_1000028815 | 142 |
| 351 | 3300005344 | Ga0070661_100351779 | Ga0070661_1003517792 | 142 |
| 352 | 3300005345 | Ga0070692_10060728 | Ga0070692_100607282 | 142 |
| 353 | 3300005345 | Ga0070692_10178320 | Ga0070692_101783202 | 142 |
| 354 | 3300005345 | Ga0070692_10268256 | Ga0070692_102682562 | 142 |
| 355 | 3300005345 | Ga0070692_10390060 | Ga0070692_103900602 | 142 |
| 356 | 3300005345 | Ga0070692_10497103 | Ga0070692_104971031 | 142 |
| 357 | 3300005347 | Ga0070668_100314715 | Ga0070668_1003147152 | 142 |
| 358 | 3300005353 | Ga0070669_100000729 | Ga0070669_10000072917 | 142 |
| 359 | 3300005353 | Ga0070669_100007926 | Ga0070669_1000079267 | 142 |
| 360 | 3300005353 | Ga0070669_100049912 | Ga0070669_1000499123 | 142 |
| 361 | 3300005353 | Ga0070669_100056435 | Ga0070669_1000564353 | 142 |
| 362 | 3300005353 | Ga0070669_100122299 | Ga0070669_1001222992 | 142 |
| 363 | 3300005353 | Ga0070669_100139726 | Ga0070669_1001397261 | 142 |
| 364 | 3300005354 | Ga0070675_100427867 | Ga0070675_1004278672 | 142 |
| 365 | 3300005355 | Ga0070671_100005506 | Ga0070671_1000055067 | 142 |
| 366 | 3300005355 | Ga0070671_100143151 | Ga0070671_1001431513 | 142 |
| 367 | 3300005355 | Ga0070671_101374756 | Ga0070671_1013747562 | 142 |
| 368 | 3300005364 | Ga0070673_100281582 | Ga0070673_1002815821 | 142 |
| 369 | 3300005364 | Ga0070673_100310862 | Ga0070673_1003108622 | 142 |
| 370 | 3300005364 | Ga0070673_100920831 | Ga0070673_1009208312 | 142 |
| 371 | 3300005365 | Ga0070688_100111543 | Ga0070688_1001115432 | 142 |
| 372 | 3300005365 | Ga0070688_100649716 | Ga0070688_1006497162 | 142 |
| 373 | 3300005366 | Ga0070659_100025535 | Ga0070659_1000255354 | 142 |
| 374 | 3300005366 | Ga0070659_100665752 | Ga0070659_1006657522 | 142 |
| 375 | 3300005367 | Ga0070667_100020193 | Ga0070667_1000201936 | 142 |
| 376 | 3300005367 | Ga0070667_100085781 | Ga0070667_1000857813 | 142 |
| 377 | 3300005434 | Ga0070709_10761512 | Ga0070709_107615121 | 142 |
| 378 | 3300005438 | Ga0070701_10076093 | Ga0070701_100760932 | 142 |
| 379 | 3300005440 | Ga0070705_100046690 | Ga0070705_1000466902 | 142 |
| 380 | 3300005440 | Ga0070705_100318141 | Ga0070705_1003181412 | 142 |
| 381 | 3300005440 | Ga0070705_100514269 | Ga0070705_1005142692 | 142 |
| 382 | 3300005441 | Ga0070700_100066629 | Ga0070700_1000666293 | 142 |
| 383 | 3300005441 | Ga0070700_100082032 | Ga0070700_1000820322 | 142 |
| 384 | 3300005441 | Ga0070700_100629017 | Ga0070700_1006290172 | 142 |
| 385 | 3300005444 | Ga0070694_100021114 | Ga0070694_1000211143 | 142 |
| 386 | 3300005444 | Ga0070694_100066438 | Ga0070694_1000664382 | 142 |
| 387 | 3300005444 | Ga0070694_100220243 | Ga0070694_1002202432 | 142 |
| 388 | 3300005444 | Ga0070694_100856847 | Ga0070694_1008568471 | 142 |
| 389 | 3300005456 | Ga0070678_100084501 | Ga0070678_1000845013 | 142 |
| 390 | 3300005456 | Ga0070678_100459123 | Ga0070678_1004591232 | 142 |
| 391 | 3300005456 | Ga0070678_100992586 | Ga0070678_1009925862 | 142 |
| 392 | 3300005457 | Ga0070662_100172586 | Ga0070662_1001725863 | 142 |
| 393 | 3300005457 | Ga0070662_100728486 | Ga0070662_1007284861 | 142 |
| 394 | 3300005457 | Ga0070662_101123321 | Ga0070662_1011233211 | 142 |
| 395 | 3300005458 | Ga0070681_10002322 | Ga0070681_100023229 | 142 |
| 396 | 3300005458 | Ga0070681_10022916 | Ga0070681_100229164 | 142 |
| 397 | 3300005458 | Ga0070681_10230401 | Ga0070681_102304013 | 142 |
| 398 | 3300005459 | Ga0068867_100025690 | Ga0068867_1000256904 | 142 |
| 399 | 3300005459 | Ga0068867_100088519 | Ga0068867_1000885193 | 142 |
| 400 | 3300005459 | Ga0068867_101956888 | Ga0068867_1019568881 | 142 |
| 401 | 3300005466 | Ga0070685_10293847 | Ga0070685_102938472 | 142 |
| 402 | 3300005467 | Ga0070706_100937058 | Ga0070706_1009370581 | 142 |
| 403 | 3300005468 | Ga0070707_100208076 | Ga0070707_1002080762 | 142 |
| 404 | 3300005518 | Ga0070699_100437859 | Ga0070699_1004378592 | 142 |
| 405 | 3300005518 | Ga0070699_100556264 | Ga0070699_1005562642 | 142 |
| 406 | 3300005518 | Ga0070699_101987188 | Ga0070699_1019871881 | 142 |
| 407 | 3300005530 | Ga0070679_100082638 | Ga0070679_1000826382 | 142 |
| 408 | 3300005535 | Ga0070684_101935542 | Ga0070684_1019355421 | 142 |
| 409 | 3300005536 | Ga0070697_101135558 | Ga0070697_1011355581 | 142 |
| 410 | 3300005536 | Ga0070697_101739318 | Ga0070697_1017393181 | 142 |
| 411 | 3300005539 | Ga0068853_100051590 | Ga0068853_1000515904 | 142 |
| 412 | 3300005539 | Ga0068853_100824328 | Ga0068853_1008243282 | 142 |
| 413 | 3300005543 | Ga0070672_100384674 | Ga0070672_1003846742 | 142 |
| 414 | 3300005543 | Ga0070672_100799659 | Ga0070672_1007996591 | 142 |
| 415 | 3300005544 | Ga0070686_100072686 | Ga0070686_1000726862 | 142 |
| 416 | 3300005545 | Ga0070695_100088960 | Ga0070695_1000889602 | 142 |
| 417 | 3300005545 | Ga0070695_100139498 | Ga0070695_1001394983 | 142 |
| 418 | 3300005545 | Ga0070695_100509117 | Ga0070695_1005091172 | 142 |
| 419 | 3300005546 | Ga0070696_100018228 | Ga0070696_1000182285 | 142 |
| 420 | 3300005546 | Ga0070696_100061942 | Ga0070696_1000619422 | 142 |
| 421 | 3300005546 | Ga0070696_100192430 | Ga0070696_1001924302 | 142 |
| 422 | 3300005546 | Ga0070696_100663725 | Ga0070696_1006637251 | 142 |
| 423 | 3300005546 | Ga0070696_100871939 | Ga0070696_1008719392 | 142 |
| 424 | 3300005547 | Ga0070693_100043186 | Ga0070693_1000431862 | 142 |
| 425 | 3300005547 | Ga0070693_100065843 | Ga0070693_1000658433 | 142 |
| 426 | 3300005547 | Ga0070693_100406452 | Ga0070693_1004064522 | 142 |
| 427 | 3300005548 | Ga0070665_100031856 | Ga0070665_1000318565 | 142 |
| 428 | 3300005548 | Ga0070665_100259179 | Ga0070665_1002591792 | 142 |
| 429 | 3300005549 | Ga0070704_100028429 | Ga0070704_1000284292 | 142 |
| 430 | 3300005549 | Ga0070704_100904995 | Ga0070704_1009049952 | 142 |
| 431 | 3300005549 | Ga0070704_100910981 | Ga0070704_1009109811 | 142 |
| 432 | 3300005563 | Ga0068855_102324219 | Ga0068855_1023242191 | 142 |
| 433 | 3300005564 | Ga0070664_100011220 | Ga0070664_1000112203 | 142 |
| 434 | 3300005564 | Ga0070664_100177205 | Ga0070664_1001772053 | 142 |
| 435 | 3300005564 | Ga0070664_100273588 | Ga0070664_1002735881 | 142 |
| 436 | 3300005564 | Ga0070664_100526083 | Ga0070664_1005260832 | 142 |
| 437 | 3300005564 | Ga0070664_100683934 | Ga0070664_1006839342 | 142 |
| 438 | 3300005577 | Ga0068857_100000277 | Ga0068857_10000027729 | 142 |
| 439 | 3300005578 | Ga0068854_100122249 | Ga0068854_1001222492 | 142 |
| 440 | 3300005578 | Ga0068854_100130332 | Ga0068854_1001303323 | 142 |
| 441 | 3300005578 | Ga0068854_100640828 | Ga0068854_1006408282 | 142 |
| 442 | 3300005614 | Ga0068856_101984724 | Ga0068856_1019847241 | 142 |
| 443 | 3300005615 | Ga0070702_100010068 | Ga0070702_1000100682 | 142 |
| 444 | 3300005615 | Ga0070702_100017240 | Ga0070702_1000172404 | 142 |
| 445 | 3300005616 | Ga0068852_100746137 | Ga0068852_1007461372 | 142 |
| 446 | 3300005617 | Ga0068859_100047921 | Ga0068859_1000479213 | 142 |
| 447 | 3300005617 | Ga0068859_100056252 | Ga0068859_1000562522 | 142 |
| 448 | 3300005617 | Ga0068859_100155199 | Ga0068859_1001551992 | 142 |
| 449 | 3300005617 | Ga0068859_100197537 | Ga0068859_1001975372 | 142 |
| 450 | 3300005617 | Ga0068859_101078732 | Ga0068859_1010787321 | 142 |
| 451 | 3300005617 | Ga0068859_101447938 | Ga0068859_1014479382 | 142 |
| 452 | 3300005617 | Ga0068859_101691498 | Ga0068859_1016914982 | 142 |
| 453 | 3300005618 | Ga0068864_100001610 | Ga0068864_1000016108 | 142 |
| 454 | 3300005618 | Ga0068864_100024460 | Ga0068864_1000244603 | 142 |
| 455 | 3300005618 | Ga0068864_100998191 | Ga0068864_1009981911 | 142 |
| 456 | 3300005718 | Ga0068866_10076616 | Ga0068866_100766162 | 142 |
| 457 | 3300005718 | Ga0068866_10583330 | Ga0068866_105833302 | 142 |
| 458 | 3300005719 | Ga0068861_100028721 | Ga0068861_1000287213 | 142 |
| 459 | 3300005719 | Ga0068861_100068417 | Ga0068861_1000684172 | 142 |
| 460 | 3300005719 | Ga0068861_100223151 | Ga0068861_1002231512 | 142 |
| 461 | 3300005719 | Ga0068861_100497972 | Ga0068861_1004979722 | 142 |
| 462 | 3300005834 | Ga0068851_10093937 | Ga0068851_100939373 | 142 |
| 463 | 3300005840 | Ga0068870_10000847 | Ga0068870_100008478 | 142 |
| 464 | 3300005840 | Ga0068870_10133279 | Ga0068870_101332793 | 142 |
| 465 | 3300005840 | Ga0068870_10380733 | Ga0068870_103807332 | 142 |
| 466 | 3300005841 | Ga0068863_100125851 | Ga0068863_1001258511 | 142 |
| 467 | 3300005841 | Ga0068863_100133583 | Ga0068863_1001335832 | 142 |
| 468 | 3300005842 | Ga0068858_100072879 | Ga0068858_1000728793 | 142 |
| 469 | 3300005842 | Ga0068858_100083895 | Ga0068858_1000838953 | 142 |
| 470 | 3300005842 | Ga0068858_100150078 | Ga0068858_1001500784 | 142 |
| 471 | 3300005842 | Ga0068858_100489751 | Ga0068858_1004897511 | 142 |
| 472 | 3300005842 | Ga0068858_101426488 | Ga0068858_1014264882 | 142 |
| 473 | 3300005843 | Ga0068860_100047159 | Ga0068860_1000471594 | 142 |
| 474 | 3300005843 | Ga0068860_100076808 | Ga0068860_1000768084 | 142 |
| 475 | 3300005843 | Ga0068860_100156914 | Ga0068860_1001569143 | 142 |
| 476 | 3300005843 | Ga0068860_100182651 | Ga0068860_1001826512 | 142 |
| 477 | 3300005843 | Ga0068860_100769004 | Ga0068860_1007690041 | 142 |
| 478 | 3300005844 | Ga0068862_100135621 | Ga0068862_1001356213 | 142 |
| 479 | 3300005844 | Ga0068862_100577106 | Ga0068862_1005771062 | 142 |
| 480 | 3300005844 | Ga0068862_101205650 | Ga0068862_1012056501 | 142 |
| 481 | 3300005844 | Ga0068862_101261050 | Ga0068862_1012610502 | 142 |
| 482 | 3300005985 | Ga0081539_10003247 | Ga0081539_100032476 | 142 |
| 483 | 3300006173 | Ga0070716_101387873 | Ga0070716_1013878731 | 142 |
| 484 | 3300006237 | Ga0097621_100001882 | Ga0097621_1000018823 | 142 |
| 485 | 3300006237 | Ga0097621_100015727 | Ga0097621_1000157274 | 142 |
| 486 | 3300006358 | Ga0068871_100021215 | Ga0068871_1000212154 | 142 |
| 487 | 3300006358 | Ga0068871_100565083 | Ga0068871_1005650832 | 142 |
| 488 | 3300006844 | Ga0075428_100070337 | Ga0075428_1000703372 | 142 |
| 489 | 3300006844 | Ga0075428_100424178 | Ga0075428_1004241782 | 142 |
| 490 | 3300006844 | Ga0075428_100548643 | Ga0075428_1005486432 | 142 |
| 491 | 3300006846 | Ga0075430_100181848 | Ga0075430_1001818483 | 142 |
| 492 | 3300006846 | Ga0075430_101249432 | Ga0075430_1012494321 | 142 |
| 493 | 3300006847 | Ga0075431_100158837 | Ga0075431_1001588372 | 142 |
| 494 | 3300006852 | Ga0075433_10065599 | Ga0075433_100655992 | 142 |
| 495 | 3300006852 | Ga0075433_10090500 | Ga0075433_100905003 | 142 |
| 496 | 3300006871 | Ga0075434_100539414 | Ga0075434_1005394142 | 142 |
| 497 | 3300006871 | Ga0075434_101713228 | Ga0075434_1017132282 | 142 |
| 498 | 3300006871 | Ga0075434_101725128 | Ga0075434_1017251281 | 142 |
| 499 | 3300006871 | Ga0075434_101755485 | Ga0075434_1017554851 | 142 |
| 500 | 3300006880 | Ga0075429_100059945 | Ga0075429_1000599453 | 142 |
| 501 | 3300006880 | Ga0075429_100248149 | Ga0075429_1002481492 | 142 |
| 502 | 3300006881 | Ga0068865_100022198 | Ga0068865_1000221982 | 142 |
| 503 | 3300006881 | Ga0068865_100447858 | Ga0068865_1004478582 | 142 |
| 504 | 3300006881 | Ga0068865_101366598 | Ga0068865_1013665981 | 142 |
| 505 | 3300006881 | Ga0068865_101715957 | Ga0068865_1017159571 | 142 |
| 506 | 3300006914 | Ga0075436_100013635 | Ga0075436_1000136357 | 142 |
| 507 | 3300006931 | Ga0097620_100047919 | Ga0097620_1000479193 | 142 |
| 508 | 3300006931 | Ga0097620_100056252 | Ga0097620_1000562524 | 142 |
| 509 | 3300006931 | Ga0097620_100155198 | Ga0097620_1001551984 | 142 |
| 510 | 3300006931 | Ga0097620_100197537 | Ga0097620_1001975372 | 142 |
| 511 | 3300006931 | Ga0097620_101078761 | Ga0097620_1010787611 | 142 |
| 512 | 3300006931 | Ga0097620_101447394 | Ga0097620_1014473942 | 142 |
| 513 | 3300006931 | Ga0097620_101691512 | Ga0097620_1016915122 | 142 |
| 514 | 3300007076 | Ga0075435_100029269 | Ga0075435_1000292693 | 142 |
| 515 | 3300007265 | Ga0099794_10586380 | Ga0099794_105863801 | 142 |
| 516 | 3300009094 | Ga0111539_10007977 | Ga0111539_100079777 | 142 |
| 517 | 3300009094 | Ga0111539_10010383 | Ga0111539_100103838 | 142 |
| 518 | 3300009094 | Ga0111539_10167162 | Ga0111539_101671621 | 142 |
| 519 | 3300009098 | Ga0105245_10092553 | Ga0105245_100925534 | 142 |
| 520 | 3300009098 | Ga0105245_10280029 | Ga0105245_102800292 | 142 |
| 521 | 3300009098 | Ga0105245_10441515 | Ga0105245_104415152 | 142 |
| 522 | 3300009101 | Ga0105247_11727951 | Ga0105247_117279511 | 142 |
| 523 | 3300009147 | Ga0114129_10026332 | Ga0114129_100263327 | 142 |
| 524 | 3300009147 | Ga0114129_10030702 | Ga0114129_100307028 | 142 |
| 525 | 3300009147 | Ga0114129_10058691 | Ga0114129_100586912 | 142 |
| 526 | 3300009147 | Ga0114129_10140117 | Ga0114129_101401172 | 142 |
| 527 | 3300009147 | Ga0114129_10225919 | Ga0114129_102259192 | 142 |
| 528 | 3300009147 | Ga0114129_10996248 | Ga0114129_109962482 | 142 |
| 529 | 3300009147 | Ga0114129_11180585 | Ga0114129_111805852 | 142 |
| 530 | 3300009148 | Ga0105243_10003775 | Ga0105243_100037751 | 142 |
| 531 | 3300009148 | Ga0105243_10061092 | Ga0105243_100610924 | 142 |
| 532 | 3300009174 | Ga0105241_10281017 | Ga0105241_102810173 | 142 |
| 533 | 3300009174 | Ga0105241_10409882 | Ga0105241_104098822 | 142 |
| 534 | 3300009174 | Ga0105241_10677885 | Ga0105241_106778852 | 142 |
| 535 | 3300009174 | Ga0105241_11303056 | Ga0105241_113030561 | 142 |
| 536 | 3300009176 | Ga0105242_10244232 | Ga0105242_102442323 | 142 |
| 537 | 3300009177 | Ga0105248_10012918 | Ga0105248_100129187 | 142 |
| 538 | 3300009177 | Ga0105248_10274483 | Ga0105248_102744832 | 142 |
| 539 | 3300009177 | Ga0105248_10351329 | Ga0105248_103513292 | 142 |
| 540 | 3300009551 | Ga0105238_10674264 | Ga0105238_106742642 | 142 |
| 541 | 3300009553 | Ga0105249_10492621 | Ga0105249_104926212 | 142 |
| 542 | 3300009553 | Ga0105249_11168156 | Ga0105249_111681562 | 142 |
| 543 | 3300009553 | Ga0105249_11321613 | Ga0105249_113216132 | 142 |
| 544 | 3300009553 | Ga0105249_12125146 | Ga0105249_121251462 | 142 |
| 545 | 3300010375 | Ga0105239_10684171 | Ga0105239_106841711 | 142 |
| 546 | 3300011119 | Ga0105246_10074102 | Ga0105246_100741023 | 142 |
| 547 | 3300011119 | Ga0105246_10159825 | Ga0105246_101598252 | 142 |
| 548 | 3300011119 | Ga0105246_10294988 | Ga0105246_102949882 | 142 |
| 549 | 3300011119 | Ga0105246_10563003 | Ga0105246_105630032 | 142 |
| 550 | 3300011119 | Ga0105246_11814357 | Ga0105246_118143571 | 142 |
| 551 | 3300012512 | Ga0157327_1042121 | Ga0157327_10421211 | 142 |
| 552 | 3300013100 | Ga0157373_10033443 | Ga0157373_100334434 | 142 |
| 553 | 3300013100 | Ga0157373_10107041 | Ga0157373_101070414 | 142 |
| 554 | 3300013100 | Ga0157373_10288513 | Ga0157373_102885132 | 142 |
| 555 | 3300013102 | Ga0157371_11448912 | Ga0157371_114489121 | 142 |
| 556 | 3300013296 | Ga0157374_10007848 | Ga0157374_100078485 | 142 |
| 557 | 3300013296 | Ga0157374_10512560 | Ga0157374_105125602 | 142 |
| 558 | 3300013296 | Ga0157374_10822191 | Ga0157374_108221912 | 142 |
| 559 | 3300013297 | Ga0157378_10010711 | Ga0157378_100107113 | 142 |
| 560 | 3300013297 | Ga0157378_10049326 | Ga0157378_100493263 | 142 |
| 561 | 3300013297 | Ga0157378_10336898 | Ga0157378_103368982 | 142 |
| 562 | 3300013306 | Ga0163162_10002329 | Ga0163162_100023297 | 142 |
| 563 | 3300013306 | Ga0163162_10011561 | Ga0163162_100115619 | 142 |
| 564 | 3300013306 | Ga0163162_10037774 | Ga0163162_100377743 | 142 |
| 565 | 3300013306 | Ga0163162_10049352 | Ga0163162_100493525 | 142 |
| 566 | 3300013306 | Ga0163162_10085592 | Ga0163162_100855923 | 142 |
| 567 | 3300013307 | Ga0157372_10025429 | Ga0157372_100254294 | 142 |
| 568 | 3300013307 | Ga0157372_10058402 | Ga0157372_100584023 | 142 |
| 569 | 3300013308 | Ga0157375_10005360 | Ga0157375_100053607 | 142 |
| 570 | 3300013308 | Ga0157375_10009563 | Ga0157375_100095636 | 142 |
| 571 | 3300013308 | Ga0157375_10240685 | Ga0157375_102406853 | 142 |
| 572 | 3300013308 | Ga0157375_10409195 | Ga0157375_104091952 | 142 |
| 573 | 3300013308 | Ga0157375_10474186 | Ga0157375_104741862 | 142 |
| 574 | 3300013308 | Ga0157375_10724946 | Ga0157375_107249461 | 142 |
| 575 | 3300013308 | Ga0157375_10910626 | Ga0157375_109106262 | 142 |
| 576 | 3300013308 | Ga0157375_10938039 | Ga0157375_109380392 | 142 |
| 577 | 3300014325 | Ga0163163_10010501 | Ga0163163_100105014 | 142 |
| 578 | 3300014325 | Ga0163163_10043868 | Ga0163163_100438684 | 142 |
| 579 | 3300014325 | Ga0163163_10045314 | Ga0163163_100453142 | 142 |
| 580 | 3300014325 | Ga0163163_10075029 | Ga0163163_100750292 | 142 |
| 581 | 3300014325 | Ga0163163_10181782 | Ga0163163_101817823 | 142 |
| 582 | 3300014325 | Ga0163163_10248392 | Ga0163163_102483922 | 142 |
| 583 | 3300014325 | Ga0163163_10766215 | Ga0163163_107662152 | 142 |
| 584 | 3300014326 | Ga0157380_10033357 | Ga0157380_100333572 | 142 |
| 585 | 3300014326 | Ga0157380_10125972 | Ga0157380_101259723 | 142 |
| 586 | 3300014326 | Ga0157380_10143609 | Ga0157380_101436092 | 142 |
| 587 | 3300014326 | Ga0157380_11121094 | Ga0157380_111210942 | 142 |
| 588 | 3300014745 | Ga0157377_10022694 | Ga0157377_100226944 | 142 |
| 589 | 3300014968 | Ga0157379_10225193 | Ga0157379_102251932 | 142 |
| 590 | 3300014968 | Ga0157379_10589394 | Ga0157379_105893942 | 142 |
| 591 | 3300014968 | Ga0157379_10748913 | Ga0157379_107489132 | 142 |
| 592 | 3300014969 | Ga0157376_10011208 | Ga0157376_100112086 | 142 |
| 593 | 3300014969 | Ga0157376_10125147 | Ga0157376_101251472 | 142 |
| 594 | 3300015262 | Ga0182007_10225337 | Ga0182007_102253371 | 142 |
| 595 | 3300017792 | Ga0163161_10028642 | Ga0163161_100286421 | 142 |
| 596 | 3300017792 | Ga0163161_10640796 | Ga0163161_106407961 | 142 |
| 597 | 3300025315 | Ga0207697_10299817 | Ga0207697_102998172 | 142 |
| 598 | 3300025893 | Ga0207682_10199156 | Ga0207682_101991562 | 142 |
| 599 | 3300025899 | Ga0207642_10158567 | Ga0207642_101585672 | 142 |
| 600 | 3300025903 | Ga0207680_10013632 | Ga0207680_100136324 | 142 |
| 601 | 3300025903 | Ga0207680_10419302 | Ga0207680_104193022 | 142 |
| 602 | 3300025906 | Ga0207699_10658590 | Ga0207699_106585901 | 142 |
| 603 | 3300025907 | Ga0207645_10119803 | Ga0207645_101198032 | 142 |
| 604 | 3300025907 | Ga0207645_10527368 | Ga0207645_105273681 | 142 |
| 605 | 3300025908 | Ga0207643_10017495 | Ga0207643_100174954 | 142 |
| 606 | 3300025908 | Ga0207643_10027010 | Ga0207643_100270103 | 142 |
| 607 | 3300025908 | Ga0207643_10091750 | Ga0207643_100917503 | 142 |
| 608 | 3300025908 | Ga0207643_10159023 | Ga0207643_101590232 | 142 |
| 609 | 3300025908 | Ga0207643_10697011 | Ga0207643_106970111 | 142 |
| 610 | 3300025912 | Ga0207707_10023481 | Ga0207707_100234816 | 142 |
| 611 | 3300025917 | Ga0207660_10327480 | Ga0207660_103274802 | 142 |
| 612 | 3300025917 | Ga0207660_11400909 | Ga0207660_114009092 | 142 |
| 613 | 3300025918 | Ga0207662_10003999 | Ga0207662_100039992 | 142 |
| 614 | 3300025918 | Ga0207662_10008041 | Ga0207662_100080418 | 142 |
| 615 | 3300025918 | Ga0207662_10385984 | Ga0207662_103859842 | 142 |
| 616 | 3300025918 | Ga0207662_10613566 | Ga0207662_106135662 | 142 |
| 617 | 3300025920 | Ga0207649_10035097 | Ga0207649_100350972 | 142 |
| 618 | 3300025921 | Ga0207652_10130898 | Ga0207652_101308982 | 142 |
| 619 | 3300025922 | Ga0207646_10572822 | Ga0207646_105728222 | 142 |
| 620 | 3300025923 | Ga0207681_10000428 | Ga0207681_1000042811 | 142 |
| 621 | 3300025923 | Ga0207681_10058913 | Ga0207681_100589132 | 142 |
| 622 | 3300025923 | Ga0207681_10155173 | Ga0207681_101551733 | 142 |
| 623 | 3300025923 | Ga0207681_10282414 | Ga0207681_102824142 | 142 |
| 624 | 3300025923 | Ga0207681_10354506 | Ga0207681_103545062 | 142 |
| 625 | 3300025923 | Ga0207681_10804014 | Ga0207681_108040141 | 142 |
| 626 | 3300025925 | Ga0207650_10001704 | Ga0207650_1000170410 | 142 |
| 627 | 3300025925 | Ga0207650_10216831 | Ga0207650_102168312 | 142 |
| 628 | 3300025925 | Ga0207650_11320080 | Ga0207650_113200801 | 142 |
| 629 | 3300025926 | Ga0207659_10232456 | Ga0207659_102324562 | 142 |
| 630 | 3300025926 | Ga0207659_10237442 | Ga0207659_102374422 | 142 |
| 631 | 3300025927 | Ga0207687_10805985 | Ga0207687_108059852 | 142 |
| 632 | 3300025927 | Ga0207687_10946317 | Ga0207687_109463171 | 142 |
| 633 | 3300025927 | Ga0207687_11534639 | Ga0207687_115346391 | 142 |
| 634 | 3300025931 | Ga0207644_10016817 | Ga0207644_100168173 | 142 |
| 635 | 3300025931 | Ga0207644_10175879 | Ga0207644_101758792 | 142 |
| 636 | 3300025931 | Ga0207644_10296843 | Ga0207644_102968432 | 142 |
| 637 | 3300025932 | Ga0207690_10550433 | Ga0207690_105504332 | 142 |
| 638 | 3300025933 | Ga0207706_10152083 | Ga0207706_101520834 | 142 |
| 639 | 3300025933 | Ga0207706_10332994 | Ga0207706_103329943 | 142 |
| 640 | 3300025933 | Ga0207706_10461217 | Ga0207706_104612172 | 142 |
| 641 | 3300025934 | Ga0207686_10308149 | Ga0207686_103081492 | 142 |
| 642 | 3300025935 | Ga0207709_10501379 | Ga0207709_105013792 | 142 |
| 643 | 3300025936 | Ga0207670_10198793 | Ga0207670_101987932 | 142 |
| 644 | 3300025936 | Ga0207670_10384688 | Ga0207670_103846882 | 142 |
| 645 | 3300025936 | Ga0207670_10916367 | Ga0207670_109163672 | 142 |
| 646 | 3300025936 | Ga0207670_11044450 | Ga0207670_110444501 | 142 |
| 647 | 3300025936 | Ga0207670_11066729 | Ga0207670_110667292 | 142 |
| 648 | 3300025937 | Ga0207669_10147748 | Ga0207669_101477482 | 142 |
| 649 | 3300025938 | Ga0207704_10043235 | Ga0207704_100432354 | 142 |
| 650 | 3300025938 | Ga0207704_10284319 | Ga0207704_102843191 | 142 |
| 651 | 3300025938 | Ga0207704_11044273 | Ga0207704_110442731 | 142 |
| 652 | 3300025940 | Ga0207691_10047107 | Ga0207691_100471074 | 142 |
| 653 | 3300025940 | Ga0207691_10060123 | Ga0207691_100601232 | 142 |
| 654 | 3300025941 | Ga0207711_10013634 | Ga0207711_100136345 | 142 |
| 655 | 3300025941 | Ga0207711_10076895 | Ga0207711_100768953 | 142 |
| 656 | 3300025942 | Ga0207689_10000986 | Ga0207689_1000098610 | 142 |
| 657 | 3300025942 | Ga0207689_10067771 | Ga0207689_100677712 | 142 |
| 658 | 3300025942 | Ga0207689_10067902 | Ga0207689_100679024 | 142 |
| 659 | 3300025942 | Ga0207689_10126998 | Ga0207689_101269983 | 142 |
| 660 | 3300025942 | Ga0207689_10980089 | Ga0207689_109800891 | 142 |
| 661 | 3300025944 | Ga0207661_10869739 | Ga0207661_108697391 | 142 |
| 662 | 3300025945 | Ga0207679_10020984 | Ga0207679_100209843 | 142 |
| 663 | 3300025945 | Ga0207679_10241735 | Ga0207679_102417353 | 142 |
| 664 | 3300025945 | Ga0207679_10404006 | Ga0207679_104040061 | 142 |
| 665 | 3300025945 | Ga0207679_10649428 | Ga0207679_106494282 | 142 |
| 666 | 3300025949 | Ga0207667_11844196 | Ga0207667_118441961 | 142 |
| 667 | 3300025960 | Ga0207651_10139337 | Ga0207651_101393373 | 142 |
| 668 | 3300025960 | Ga0207651_10277461 | Ga0207651_102774612 | 142 |
| 669 | 3300025961 | Ga0207712_10079374 | Ga0207712_100793743 | 142 |
| 670 | 3300025961 | Ga0207712_10409449 | Ga0207712_104094492 | 142 |
| 671 | 3300025981 | Ga0207640_10047255 | Ga0207640_100472553 | 142 |
| 672 | 3300025981 | Ga0207640_10100036 | Ga0207640_101000363 | 142 |
| 673 | 3300025981 | Ga0207640_10296511 | Ga0207640_102965112 | 142 |
| 674 | 3300025986 | Ga0207658_10167670 | Ga0207658_101676702 | 142 |
| 675 | 3300025986 | Ga0207658_10169305 | Ga0207658_101693053 | 142 |
| 676 | 3300026023 | Ga0207677_10009473 | Ga0207677_100094736 | 142 |
| 677 | 3300026023 | Ga0207677_10692936 | Ga0207677_106929362 | 142 |
| 678 | 3300026035 | Ga0207703_10128217 | Ga0207703_101282172 | 142 |
| 679 | 3300026041 | Ga0207639_10154386 | Ga0207639_101543861 | 142 |
| 680 | 3300026075 | Ga0207708_10079676 | Ga0207708_100796763 | 142 |
| 681 | 3300026075 | Ga0207708_10124313 | Ga0207708_101243132 | 142 |
| 682 | 3300026088 | Ga0207641_10044331 | Ga0207641_100443313 | 142 |
| 683 | 3300026088 | Ga0207641_10216868 | Ga0207641_102168682 | 142 |
| 684 | 3300026088 | Ga0207641_10751353 | Ga0207641_107513532 | 142 |
| 685 | 3300026089 | Ga0207648_10001908 | Ga0207648_1000190813 | 142 |
| 686 | 3300026089 | Ga0207648_10130644 | Ga0207648_101306443 | 142 |
| 687 | 3300026089 | Ga0207648_10134137 | Ga0207648_101341371 | 142 |
| 688 | 3300026089 | Ga0207648_11601862 | Ga0207648_116018622 | 142 |
| 689 | 3300026095 | Ga0207676_10016632 | Ga0207676_100166323 | 142 |
| 690 | 3300026095 | Ga0207676_10092309 | Ga0207676_100923092 | 142 |
| 691 | 3300026095 | Ga0207676_10174782 | Ga0207676_101747822 | 142 |
| 692 | 3300026095 | Ga0207676_10290512 | Ga0207676_102905122 | 142 |
| 693 | 3300026095 | Ga0207676_10320870 | Ga0207676_103208702 | 142 |
| 694 | 3300026095 | Ga0207676_10965472 | Ga0207676_109654721 | 142 |
| 695 | 3300026116 | Ga0207674_10000192 | Ga0207674_1000019221 | 142 |
| 696 | 3300026118 | Ga0207675_100068923 | Ga0207675_1000689233 | 142 |
| 697 | 3300026118 | Ga0207675_100151655 | Ga0207675_1001516551 | 142 |
| 698 | 3300026118 | Ga0207675_100186991 | Ga0207675_1001869913 | 142 |
| 699 | 3300026118 | Ga0207675_100336642 | Ga0207675_1003366422 | 142 |
| 700 | 3300026118 | Ga0207675_100670158 | Ga0207675_1006701582 | 142 |
| 701 | 3300026118 | Ga0207675_100721040 | Ga0207675_1007210402 | 142 |
| 702 | 3300026121 | Ga0207683_10249816 | Ga0207683_102498161 | 142 |
| 703 | 3300026121 | Ga0207683_10315731 | Ga0207683_103157312 | 142 |
| 704 | 3300026142 | Ga0207698_10358001 | Ga0207698_103580011 | 142 |
| 705 | 3300027907 | Ga0207428_10026938 | Ga0207428_100269382 | 142 |
| 706 | 3300027907 | Ga0207428_10071524 | Ga0207428_100715243 | 142 |
| 707 | 3300028379 | Ga0268266_10075086 | Ga0268266_100750864 | 142 |
| 708 | 3300028379 | Ga0268266_11395527 | Ga0268266_113955272 | 142 |
| 709 | 3300028380 | Ga0268265_10100036 | Ga0268265_101000363 | 142 |
| 710 | 3300028380 | Ga0268265_10756535 | Ga0268265_107565352 | 142 |
| 711 | 3300028380 | Ga0268265_11547431 | Ga0268265_115474311 | 142 |
| 712 | 3300028381 | Ga0268264_10057568 | Ga0268264_100575682 | 142 |
| 713 | 3300028381 | Ga0268264_10058091 | Ga0268264_100580913 | 142 |
| 714 | 3300028381 | Ga0268264_10204039 | Ga0268264_102040393 | 142 |
| 715 | 3300028381 | Ga0268264_10743407 | Ga0268264_107434072 | 142 |
| 716 | 3300031548 | Ga0307408_100249878 | Ga0307408_1002498782 | 142 |
| 717 | 3300031824 | Ga0307413_10251320 | Ga0307413_102513202 | 142 |
| 718 | 3300031911 | Ga0307412_10583142 | Ga0307412_105831421 | 142 |
| 719 | 3300031995 | Ga0307409_100033275 | Ga0307409_1000332752 | 142 |
| 720 | 3300032002 | Ga0307416_100210316 | Ga0307416_1002103162 | 142 |
| 721 | 3300032002 | Ga0307416_100387319 | Ga0307416_1003873192 | 142 |
| 722 | 3300032004 | Ga0307414_10238473 | Ga0307414_102384732 | 142 |
| 723 | 3300032005 | Ga0307411_10677169 | Ga0307411_106771691 | 142 |
| 724 | 3300032126 | Ga0307415_100155891 | Ga0307415_1001558912 | 142 |
| 725 | 3300032126 | Ga0307415_100250285 | Ga0307415_1002502852 | 142 |
| 726 | 3300035088 | Ga0373940_0219664 | Ga0373940_0219664_171_599 | 142 |
| 727 | 3300035091 | Ga0373951_0003178 | Ga0373951_0003178_107_535 | 142 |
| 728 | 3300035691 | Ga0373931_0351913 | Ga0373931_0351913_326_754 | 142 |
| 729 | 3300036401 | Ga0373937_0076330 | Ga0373937_0076330_1033_1464 | 142 |
| 730 | 3300042876 | Ga0451577_0910173 | Ga0451577_0910173_26_484 | 142 |
| 731 | 3300045051 | Ga0451576_0845476 | Ga0451576_0845476_21_467 | 142 |
| 732 | 3300046473 | Ga0495582_0134736 | Ga0495582_0134736_197_628 | 142 |
| 733 | 3300046660 | Ga0495625_0278567 | Ga0495625_0278567_303_734 | 142 |
| 734 | 3300046683 | Ga0495658_0092964 | Ga0495658_0092964_533_964 | 142 |
| 735 | 3300048907 | Ga0496104_0466631 | Ga0496104_0466631_42_473 | 142 |
| 736 | 3300048907 | Ga0496104_1119724 | Ga0496104_1119724_188_619 | 142 |
| 737 | 3300048911 | Ga0496108_0314066 | Ga0496108_0314066_209_640 | 142 |
| 738 | 3300048912 | Ga0496109_0825548 | Ga0496109_0825548_208_639 | 142 |
| 739 | 3300048913 | Ga0496110_0493001 | Ga0496110_0493001_218_664 | 142 |
| 740 | 3300048914 | Ga0496111_0379224 | Ga0496111_0379224_85_531 | 142 |
| 741 | 3300048915 | Ga0496112_0289181 | Ga0496112_0289181_512_952 | 142 |
| 742 | 3300048915 | Ga0496112_0524628 | Ga0496112_0524628_32_463 | 142 |
| 743 | 3300048915 | Ga0496112_0946015 | Ga0496112_0946015_305_760 | 142 |
| 744 | 3300048916 | Ga0496113_0085652 | Ga0496113_0085652_461_889 | 142 |
| 745 | 3300049514 | Ga0501291_026577 | Ga0501291_026577_155_592 | 142 |
| 746 | 3300049522 | Ga0501299_012388 | Ga0501299_012388_958_1395 | 142 |
| 747 | 3300049649 | Ga0501198_028644 | Ga0501198_028644_151_588 | 142 |
| 748 | 3300049652 | Ga0501202_024105 | Ga0501202_024105_391_819 | 142 |
| 749 | 3300049652 | Ga0501202_076030 | Ga0501202_076030_67_504 | 142 |
| 750 | 3300049660 | Ga0501216_003648 | Ga0501216_003648_321_758 | 142 |
| 751 | 3300049660 | Ga0501216_036119 | Ga0501216_036119_139_567 | 142 |
| 752 | 3300049661 | Ga0501217_037540 | Ga0501217_037540_707_1144 | 142 |
| 753 | 3300049663 | Ga0501223_016094 | Ga0501223_016094_967_1395 | 142 |
| 754 | 3300049664 | Ga0501224_005508 | Ga0501224_005508_1307_1735 | 142 |
| 755 | 3300049667 | Ga0501230_147204 | Ga0501230_147204_50_478 | 142 |
| 756 | 3300049669 | Ga0501235_012410 | Ga0501235_012410_162_590 | 142 |
| 757 | 3300049670 | Ga0501236_140037 | Ga0501236_140037_28_456 | 142 |
| 758 | 3300049679 | Ga0501249_012607 | Ga0501249_012607_912_1340 | 142 |
| 759 | 3300049681 | Ga0501251_023260 | Ga0501251_023260_171_608 | 142 |
| 760 | 3300049689 | Ga0501260_006938 | Ga0501260_006938_347_775 | 142 |
| 761 | 3300049705 | Ga0501225_0016539 | Ga0501225_0016539_1273_1710 | 142 |
| 762 | 3300049705 | Ga0501225_0017575 | Ga0501225_0017575_351_779 | 142 |
| 763 | 3300049706 | Ga0501229_004125 | Ga0501229_004125_529_957 | 142 |
| 764 | 3300049708 | Ga0501245_005544 | Ga0501245_005544_471_899 | 142 |
| 765 | 3300049708 | Ga0501245_055822 | Ga0501245_055822_11_448 | 142 |
| 766 | 3300049766 | Ga0501269_017992 | Ga0501269_017992_380_808 | 142 |
| 767 | 3300049770 | Ga0501273_049801 | Ga0501273_049801_86_514 | 142 |
| 768 | 3300049772 | Ga0501275_084120 | Ga0501275_084120_43_471 | 142 |
| 769 | 3300049851 | Ga0501212_011401 | Ga0501212_011401_747_1184 | 142 |
| 770 | 3300050507 | nmdc:mga05p37_338829_c1 | nmdc:mga05p37_338829_c1_972_1403 | 142 |
| 771 | 3300050507 | nmdc:mga05p37_368157_c1 | nmdc:mga05p37_368157_c1_714_1145 | 142 |
| 772 | 3300050508 | nmdc:mga09592_1472985_c1 | nmdc:mga09592_1472985_c1_31_462 | 142 |
| 773 | 3300050509 | nmdc:mga0qj67_353864_c1 | nmdc:mga0qj67_353864_c1_195_626 | 142 |
| 774 | 3300050510 | nmdc:mga06r32_70656_c1 | nmdc:mga06r32_70656_c1_798_1229 | 142 |
| 775 | 3300050511 | nmdc:mga08y16_172612_c1 | nmdc:mga08y16_172612_c1_151_582 | 142 |
| 776 | 3300050511 | nmdc:mga08y16_58197_c1 | nmdc:mga08y16_58197_c1_2212_2649 | 142 |
| 777 | 3300050512 | nmdc:mga0n895_169326_c1 | nmdc:mga0n895_169326_c1_1353_1811 | 142 |
| 778 | 3300050512 | nmdc:mga0n895_2218011_c1 | nmdc:mga0n895_2218011_c1_54_485 | 142 |
| 779 | 3300050513 | nmdc:mga0rr50_24584_c1 | nmdc:mga0rr50_24584_c1_2332_2763 | 142 |
| 780 | 3300050514 | nmdc:mga08x19_3718_c1 | nmdc:mga08x19_3718_c1_4539_4970 | 142 |
| 781 | 3300050515 | nmdc:mga0a205_231286_c1 | nmdc:mga0a205_231286_c1_66_524 | 142 |
| 782 | 3300050515 | nmdc:mga0a205_240041_c1 | nmdc:mga0a205_240041_c1_516_974 | 142 |
| 783 | 3300050515 | nmdc:mga0a205_267826_c1 | nmdc:mga0a205_267826_c1_460_891 | 142 |
| 784 | 3300050515 | nmdc:mga0a205_712717_c1 | nmdc:mga0a205_712717_c1_165_611 | 142 |
| 785 | 2162886007 | SwRhRL2b_contig_1874972 | SwRhRL2b_0840.00005600 | 143 |
| 786 | 2162886007 | SwRhRL2b_contig_983262 | SwRhRL2b_0816.00001050 | 143 |
| 787 | 3300000532 | CNAas_1001022 | CNAas_10010221 | 143 |
| 788 | 3300005288 | Ga0065714_10064435 | Ga0065714_100644359 | 143 |
| 789 | 3300005289 | Ga0065704_10002076 | Ga0065704_100020768 | 143 |
| 790 | 3300005290 | Ga0065712_10000118 | Ga0065712_1000011810 | 143 |
| 791 | 3300005290 | Ga0065712_10005863 | Ga0065712_100058632 | 143 |
| 792 | 3300005293 | Ga0065715_10015929 | Ga0065715_100159293 | 143 |
| 793 | 3300005293 | Ga0065715_10089159 | Ga0065715_100891599 | 143 |
| 794 | 3300005293 | Ga0065715_10090332 | Ga0065715_100903322 | 143 |
| 795 | 3300005293 | Ga0065715_10110229 | Ga0065715_101102292 | 143 |
| 796 | 3300005293 | Ga0065715_10206344 | Ga0065715_102063442 | 143 |
| 797 | 3300005293 | Ga0065715_10260587 | Ga0065715_102605872 | 143 |
| 798 | 3300005295 | Ga0065707_10001813 | Ga0065707_100018135 | 143 |
| 799 | 3300005328 | Ga0070676_10090439 | Ga0070676_100904391 | 143 |
| 800 | 3300005328 | Ga0070676_10361062 | Ga0070676_103610621 | 143 |
| 801 | 3300005334 | Ga0068869_100366862 | Ga0068869_1003668622 | 143 |
| 802 | 3300005337 | Ga0070682_100003753 | Ga0070682_1000037538 | 143 |
| 803 | 3300005340 | Ga0070689_100008505 | Ga0070689_1000085052 | 143 |
| 804 | 3300005345 | Ga0070692_10335894 | Ga0070692_103358942 | 143 |
| 805 | 3300005345 | Ga0070692_10650010 | Ga0070692_106500101 | 143 |
| 806 | 3300005353 | Ga0070669_100725315 | Ga0070669_1007253152 | 143 |
| 807 | 3300005354 | Ga0070675_100482761 | Ga0070675_1004827611 | 143 |
| 808 | 3300005364 | Ga0070673_100464799 | Ga0070673_1004647992 | 143 |
| 809 | 3300005365 | Ga0070688_101034628 | Ga0070688_1010346282 | 143 |
| 810 | 3300005406 | Ga0070703_10273453 | Ga0070703_102734531 | 143 |
| 811 | 3300005438 | Ga0070701_10877009 | Ga0070701_108770092 | 143 |
| 812 | 3300005440 | Ga0070705_100028934 | Ga0070705_1000289342 | 143 |
| 813 | 3300005440 | Ga0070705_100049793 | Ga0070705_1000497932 | 143 |
| 814 | 3300005440 | Ga0070705_100225949 | Ga0070705_1002259491 | 143 |
| 815 | 3300005441 | Ga0070700_100000092 | Ga0070700_10000009236 | 143 |
| 816 | 3300005441 | Ga0070700_100013167 | Ga0070700_1000131673 | 143 |
| 817 | 3300005441 | Ga0070700_100024519 | Ga0070700_1000245196 | 143 |
| 818 | 3300005444 | Ga0070694_100009639 | Ga0070694_1000096397 | 143 |
| 819 | 3300005444 | Ga0070694_100030338 | Ga0070694_1000303385 | 143 |
| 820 | 3300005445 | Ga0070708_100002362 | Ga0070708_10000236211 | 143 |
| 821 | 3300005445 | Ga0070708_100553254 | Ga0070708_1005532542 | 143 |
| 822 | 3300005456 | Ga0070678_100265509 | Ga0070678_1002655092 | 143 |
| 823 | 3300005457 | Ga0070662_100140783 | Ga0070662_1001407833 | 143 |
| 824 | 3300005459 | Ga0068867_100014031 | Ga0068867_1000140313 | 143 |
| 825 | 3300005466 | Ga0070685_11066855 | Ga0070685_110668551 | 143 |
| 826 | 3300005467 | Ga0070706_100021984 | Ga0070706_1000219845 | 143 |
| 827 | 3300005467 | Ga0070706_100090285 | Ga0070706_1000902852 | 143 |
| 828 | 3300005468 | Ga0070707_100026729 | Ga0070707_1000267296 | 143 |
| 829 | 3300005471 | Ga0070698_100006142 | Ga0070698_10000614210 | 143 |
| 830 | 3300005471 | Ga0070698_100029558 | Ga0070698_1000295582 | 143 |
| 831 | 3300005471 | Ga0070698_100040853 | Ga0070698_1000408532 | 143 |
| 832 | 3300005518 | Ga0070699_100009745 | Ga0070699_1000097454 | 143 |
| 833 | 3300005518 | Ga0070699_100038140 | Ga0070699_1000381403 | 143 |
| 834 | 3300005518 | Ga0070699_100502529 | Ga0070699_1005025292 | 143 |
| 835 | 3300005536 | Ga0070697_100026034 | Ga0070697_1000260345 | 143 |
| 836 | 3300005536 | Ga0070697_101298482 | Ga0070697_1012984822 | 143 |
| 837 | 3300005539 | Ga0068853_100041243 | Ga0068853_1000412432 | 143 |
| 838 | 3300005543 | Ga0070672_100220655 | Ga0070672_1002206552 | 143 |
| 839 | 3300005543 | Ga0070672_101092064 | Ga0070672_1010920642 | 143 |
| 840 | 3300005543 | Ga0070672_101397763 | Ga0070672_1013977632 | 143 |
| 841 | 3300005545 | Ga0070695_100039223 | Ga0070695_1000392233 | 143 |
| 842 | 3300005545 | Ga0070695_100055135 | Ga0070695_1000551353 | 143 |
| 843 | 3300005546 | Ga0070696_100045041 | Ga0070696_1000450412 | 143 |
| 844 | 3300005546 | Ga0070696_100389728 | Ga0070696_1003897282 | 143 |
| 845 | 3300005546 | Ga0070696_100954400 | Ga0070696_1009544001 | 143 |
| 846 | 3300005549 | Ga0070704_100019639 | Ga0070704_1000196393 | 143 |
| 847 | 3300005549 | Ga0070704_100334979 | Ga0070704_1003349793 | 143 |
| 848 | 3300005549 | Ga0070704_100759479 | Ga0070704_1007594792 | 143 |
| 849 | 3300005563 | Ga0068855_100485039 | Ga0068855_1004850392 | 143 |
| 850 | 3300005577 | Ga0068857_100457782 | Ga0068857_1004577822 | 143 |
| 851 | 3300005577 | Ga0068857_100614039 | Ga0068857_1006140392 | 143 |
| 852 | 3300005577 | Ga0068857_101179827 | Ga0068857_1011798272 | 143 |
| 853 | 3300005577 | Ga0068857_101181049 | Ga0068857_1011810491 | 143 |
| 854 | 3300005578 | Ga0068854_100336664 | Ga0068854_1003366642 | 143 |
| 855 | 3300005615 | Ga0070702_100003303 | Ga0070702_1000033036 | 143 |
| 856 | 3300005615 | Ga0070702_100536965 | Ga0070702_1005369652 | 143 |
| 857 | 3300005617 | Ga0068859_100076104 | Ga0068859_1000761043 | 143 |
| 858 | 3300005617 | Ga0068859_100082256 | Ga0068859_1000822563 | 143 |
| 859 | 3300005617 | Ga0068859_101565272 | Ga0068859_1015652721 | 143 |
| 860 | 3300005618 | Ga0068864_100007660 | Ga0068864_1000076607 | 143 |
| 861 | 3300005618 | Ga0068864_100072626 | Ga0068864_1000726262 | 143 |
| 862 | 3300005618 | Ga0068864_100109417 | Ga0068864_1001094173 | 143 |
| 863 | 3300005618 | Ga0068864_100319606 | Ga0068864_1003196062 | 143 |
| 864 | 3300005618 | Ga0068864_101619725 | Ga0068864_1016197252 | 143 |
| 865 | 3300005719 | Ga0068861_100037632 | Ga0068861_1000376322 | 143 |
| 866 | 3300005719 | Ga0068861_100598295 | Ga0068861_1005982952 | 143 |
| 867 | 3300005719 | Ga0068861_100787358 | Ga0068861_1007873582 | 143 |
| 868 | 3300005719 | Ga0068861_101047303 | Ga0068861_1010473032 | 143 |
| 869 | 3300005840 | Ga0068870_10027719 | Ga0068870_100277194 | 143 |
| 870 | 3300005840 | Ga0068870_10075576 | Ga0068870_100755762 | 143 |
| 871 | 3300005840 | Ga0068870_10315663 | Ga0068870_103156632 | 143 |
| 872 | 3300005840 | Ga0068870_10973515 | Ga0068870_109735151 | 143 |
| 873 | 3300005841 | Ga0068863_100071411 | Ga0068863_1000714114 | 143 |
| 874 | 3300005841 | Ga0068863_100612072 | Ga0068863_1006120722 | 143 |
| 875 | 3300005841 | Ga0068863_100787577 | Ga0068863_1007875772 | 143 |
| 876 | 3300005842 | Ga0068858_100265803 | Ga0068858_1002658032 | 143 |
| 877 | 3300005843 | Ga0068860_100099306 | Ga0068860_1000993062 | 143 |
| 878 | 3300005843 | Ga0068860_100130106 | Ga0068860_1001301062 | 143 |
| 879 | 3300005844 | Ga0068862_100574056 | Ga0068862_1005740562 | 143 |
| 880 | 3300005985 | Ga0081539_10029095 | Ga0081539_100290953 | 143 |
| 881 | 3300006058 | Ga0075432_10456860 | Ga0075432_104568601 | 143 |
| 882 | 3300006237 | Ga0097621_100001354 | Ga0097621_10000135410 | 143 |
| 883 | 3300006358 | Ga0068871_100003285 | Ga0068871_1000032856 | 143 |
| 884 | 3300006847 | Ga0075431_100463168 | Ga0075431_1004631681 | 143 |
| 885 | 3300006852 | Ga0075433_10032308 | Ga0075433_100323084 | 143 |
| 886 | 3300006852 | Ga0075433_10123122 | Ga0075433_101231221 | 143 |
| 887 | 3300006852 | Ga0075433_10160708 | Ga0075433_101607084 | 143 |
| 888 | 3300006852 | Ga0075433_10637907 | Ga0075433_106379071 | 143 |
| 889 | 3300006852 | Ga0075433_11272307 | Ga0075433_112723071 | 143 |
| 890 | 3300006871 | Ga0075434_100058548 | Ga0075434_1000585485 | 143 |
| 891 | 3300006871 | Ga0075434_102356380 | Ga0075434_1023563801 | 143 |
| 892 | 3300006880 | Ga0075429_100852102 | Ga0075429_1008521022 | 143 |
| 893 | 3300006881 | Ga0068865_100384022 | Ga0068865_1003840222 | 143 |
| 894 | 3300006931 | Ga0097620_100076103 | Ga0097620_1000761033 | 143 |
| 895 | 3300006931 | Ga0097620_100082258 | Ga0097620_1000822583 | 143 |
| 896 | 3300006931 | Ga0097620_101565646 | Ga0097620_1015656462 | 143 |
| 897 | 3300009093 | Ga0105240_10036772 | Ga0105240_100367727 | 143 |
| 898 | 3300009093 | Ga0105240_12003630 | Ga0105240_120036301 | 143 |
| 899 | 3300009094 | Ga0111539_10001469 | Ga0111539_1000146920 | 143 |
| 900 | 3300009098 | Ga0105245_11306987 | Ga0105245_113069871 | 143 |
| 901 | 3300009101 | Ga0105247_10017782 | Ga0105247_100177825 | 143 |
| 902 | 3300009147 | Ga0114129_10053343 | Ga0114129_100533436 | 143 |
| 903 | 3300009147 | Ga0114129_10329266 | Ga0114129_103292664 | 143 |
| 904 | 3300009148 | Ga0105243_10429077 | Ga0105243_104290772 | 143 |
| 905 | 3300009148 | Ga0105243_10942561 | Ga0105243_109425612 | 143 |
| 906 | 3300009148 | Ga0105243_11953724 | Ga0105243_119537241 | 143 |
| 907 | 3300009174 | Ga0105241_10070093 | Ga0105241_100700934 | 143 |
| 908 | 3300009174 | Ga0105241_10282215 | Ga0105241_102822153 | 143 |
| 909 | 3300009174 | Ga0105241_10574385 | Ga0105241_105743852 | 143 |
| 910 | 3300009174 | Ga0105241_10834251 | Ga0105241_108342512 | 143 |
| 911 | 3300009176 | Ga0105242_12133979 | Ga0105242_121339792 | 143 |
| 912 | 3300009177 | Ga0105248_10001663 | Ga0105248_1000166317 | 143 |
| 913 | 3300009177 | Ga0105248_10077288 | Ga0105248_100772882 | 143 |
| 914 | 3300009177 | Ga0105248_13260840 | Ga0105248_132608401 | 143 |
| 915 | 3300009545 | Ga0105237_10528877 | Ga0105237_105288773 | 143 |
| 916 | 3300009551 | Ga0105238_10009780 | Ga0105238_100097807 | 143 |
| 917 | 3300009553 | Ga0105249_10167824 | Ga0105249_101678243 | 143 |
| 918 | 3300009553 | Ga0105249_11065361 | Ga0105249_110653612 | 143 |
| 919 | 3300010375 | Ga0105239_10749224 | Ga0105239_107492242 | 143 |
| 920 | 3300011119 | Ga0105246_10031719 | Ga0105246_100317195 | 143 |
| 921 | 3300011119 | Ga0105246_10162642 | Ga0105246_101626423 | 143 |
| 922 | 3300013297 | Ga0157378_10109696 | Ga0157378_101096963 | 143 |
| 923 | 3300013297 | Ga0157378_10675609 | Ga0157378_106756092 | 143 |
| 924 | 3300013307 | Ga0157372_10037304 | Ga0157372_100373044 | 143 |
| 925 | 3300013307 | Ga0157372_10857264 | Ga0157372_108572642 | 143 |
| 926 | 3300013308 | Ga0157375_11955979 | Ga0157375_119559792 | 143 |
| 927 | 3300014325 | Ga0163163_10179947 | Ga0163163_101799473 | 143 |
| 928 | 3300014325 | Ga0163163_11474052 | Ga0163163_114740522 | 143 |
| 929 | 3300014325 | Ga0163163_13182301 | Ga0163163_131823011 | 143 |
| 930 | 3300014326 | Ga0157380_10031735 | Ga0157380_100317352 | 143 |
| 931 | 3300014326 | Ga0157380_10103104 | Ga0157380_101031041 | 143 |
| 932 | 3300014745 | Ga0157377_10103750 | Ga0157377_101037503 | 143 |
| 933 | 3300014968 | Ga0157379_10120996 | Ga0157379_101209962 | 143 |
| 934 | 3300014968 | Ga0157379_10712097 | Ga0157379_107120972 | 143 |
| 935 | 3300025885 | Ga0207653_10243206 | Ga0207653_102432062 | 143 |
| 936 | 3300025900 | Ga0207710_10434115 | Ga0207710_104341151 | 143 |
| 937 | 3300025904 | Ga0207647_10000502 | Ga0207647_1000050228 | 143 |
| 938 | 3300025908 | Ga0207643_10000882 | Ga0207643_100008827 | 143 |
| 939 | 3300025908 | Ga0207643_10106872 | Ga0207643_101068723 | 143 |
| 940 | 3300025910 | Ga0207684_10043569 | Ga0207684_100435693 | 143 |
| 941 | 3300025910 | Ga0207684_10418384 | Ga0207684_104183842 | 143 |
| 942 | 3300025911 | Ga0207654_10126422 | Ga0207654_101264222 | 143 |
| 943 | 3300025911 | Ga0207654_10607803 | Ga0207654_106078032 | 143 |
| 944 | 3300025913 | Ga0207695_10064972 | Ga0207695_100649722 | 143 |
| 945 | 3300025914 | Ga0207671_10177748 | Ga0207671_101777481 | 143 |
| 946 | 3300025922 | Ga0207646_10029914 | Ga0207646_100299144 | 143 |
| 947 | 3300025922 | Ga0207646_10599873 | Ga0207646_105998732 | 143 |
| 948 | 3300025923 | Ga0207681_10479387 | Ga0207681_104793871 | 143 |
| 949 | 3300025924 | Ga0207694_10899313 | Ga0207694_108993132 | 143 |
| 950 | 3300025925 | Ga0207650_10063733 | Ga0207650_100637333 | 143 |
| 951 | 3300025925 | Ga0207650_10557791 | Ga0207650_105577911 | 143 |
| 952 | 3300025926 | Ga0207659_10476543 | Ga0207659_104765432 | 143 |
| 953 | 3300025926 | Ga0207659_10707251 | Ga0207659_107072512 | 143 |
| 954 | 3300025933 | Ga0207706_10119607 | Ga0207706_101196073 | 143 |
| 955 | 3300025935 | Ga0207709_10009935 | Ga0207709_100099357 | 143 |
| 956 | 3300025935 | Ga0207709_10190194 | Ga0207709_101901942 | 143 |
| 957 | 3300025936 | Ga0207670_10003418 | Ga0207670_100034185 | 143 |
| 958 | 3300025938 | Ga0207704_11363850 | Ga0207704_113638501 | 143 |
| 959 | 3300025940 | Ga0207691_10367169 | Ga0207691_103671692 | 143 |
| 960 | 3300025940 | Ga0207691_10927578 | Ga0207691_109275781 | 143 |
| 961 | 3300025941 | Ga0207711_10015352 | Ga0207711_1001535210 | 143 |
| 962 | 3300025941 | Ga0207711_10772195 | Ga0207711_107721952 | 143 |
| 963 | 3300025942 | Ga0207689_10320801 | Ga0207689_103208013 | 143 |
| 964 | 3300025945 | Ga0207679_10409259 | Ga0207679_104092592 | 143 |
| 965 | 3300025945 | Ga0207679_10855401 | Ga0207679_108554011 | 143 |
| 966 | 3300025960 | Ga0207651_10215743 | Ga0207651_102157431 | 143 |
| 967 | 3300025972 | Ga0207668_10811369 | Ga0207668_108113691 | 143 |
| 968 | 3300025981 | Ga0207640_10279333 | Ga0207640_102793332 | 143 |
| 969 | 3300026041 | Ga0207639_10074660 | Ga0207639_100746603 | 143 |
| 970 | 3300026075 | Ga0207708_10000061 | Ga0207708_1000006136 | 143 |
| 971 | 3300026075 | Ga0207708_10003905 | Ga0207708_100039056 | 143 |
| 972 | 3300026075 | Ga0207708_10011771 | Ga0207708_100117717 | 143 |
| 973 | 3300026075 | Ga0207708_10559911 | Ga0207708_105599111 | 143 |
| 974 | 3300026088 | Ga0207641_10021456 | Ga0207641_100214565 | 143 |
| 975 | 3300026088 | Ga0207641_10088733 | Ga0207641_100887333 | 143 |
| 976 | 3300026088 | Ga0207641_10407544 | Ga0207641_104075443 | 143 |
| 977 | 3300026088 | Ga0207641_11097964 | Ga0207641_110979642 | 143 |
| 978 | 3300026095 | Ga0207676_10030471 | Ga0207676_100304716 | 143 |
| 979 | 3300026095 | Ga0207676_10505199 | Ga0207676_105051992 | 143 |
| 980 | 3300026095 | Ga0207676_10598868 | Ga0207676_105988682 | 143 |
| 981 | 3300026095 | Ga0207676_10886295 | Ga0207676_108862951 | 143 |
| 982 | 3300026095 | Ga0207676_10902602 | Ga0207676_109026021 | 143 |
| 983 | 3300026116 | Ga0207674_10062925 | Ga0207674_100629255 | 143 |
| 984 | 3300026116 | Ga0207674_10091041 | Ga0207674_100910413 | 143 |
| 985 | 3300026116 | Ga0207674_11112653 | Ga0207674_111126532 | 143 |
| 986 | 3300026116 | Ga0207674_11984298 | Ga0207674_119842981 | 143 |
| 987 | 3300026118 | Ga0207675_100014671 | Ga0207675_1000146716 | 143 |
| 988 | 3300026118 | Ga0207675_100137528 | Ga0207675_1001375282 | 143 |
| 989 | 3300026121 | Ga0207683_10193041 | Ga0207683_101930412 | 143 |
| 990 | 3300026142 | Ga0207698_10105970 | Ga0207698_101059703 | 143 |
| 991 | 3300026142 | Ga0207698_10308515 | Ga0207698_103085153 | 143 |
| 992 | 3300027907 | Ga0207428_10283238 | Ga0207428_102832381 | 143 |
| 993 | 3300028380 | Ga0268265_10135975 | Ga0268265_101359752 | 143 |
| 994 | 3300028380 | Ga0268265_10322505 | Ga0268265_103225052 | 143 |
| 995 | 3300028380 | Ga0268265_10551586 | Ga0268265_105515862 | 143 |
| 996 | 3300028381 | Ga0268264_10006536 | Ga0268264_100065363 | 143 |
| 997 | 3300031548 | Ga0307408_100818120 | Ga0307408_1008181201 | 143 |
| 998 | 3300031911 | Ga0307412_11097708 | Ga0307412_110977082 | 143 |
| 999 | 3300032005 | Ga0307411_10216827 | Ga0307411_102168271 | 143 |
| 1000 | 3300037418 | Ga0395900_0163643 | Ga0395900_0163643_1045_1476 | 143 |
| 1001 | 3300037418 | Ga0395900_0177050 | Ga0395900_0177050_299_730 | 143 |
| 1002 | 3300037418 | Ga0395900_0550887 | Ga0395900_0550887_140_598 | 143 |
| 1003 | 3300037466 | Ga0395898_0341776 | Ga0395898_0341776_906_1337 | 143 |
| 1004 | 3300038443 | Ga0395901_0428296 | Ga0395901_0428296_727_1185 | 143 |
| 1005 | 3300041997 | Ga0439431_0099174 | Ga0439431_0099174_281_727 | 143 |
| 1006 | 3300042012 | Ga0439455_0008734 | Ga0439455_0008734_630_1061 | 143 |
| 1007 | 3300042157 | Ga0439458_0009743 | Ga0439458_0009743_1197_1628 | 143 |
| 1008 | 3300042876 | Ga0451577_1644934 | Ga0451577_1644934_106_537 | 143 |
| 1009 | 3300048909 | Ga0496106_0059689 | Ga0496106_0059689_430_861 | 143 |
| 1010 | 3300048913 | Ga0496110_0200101 | Ga0496110_0200101_1328_1759 | 143 |
| 1011 | 3300048915 | Ga0496112_0232018 | Ga0496112_0232018_140_592 | 143 |
| 1012 | 3300048915 | Ga0496112_0322164 | Ga0496112_0322164_997_1428 | 143 |
| 1013 | 3300048915 | Ga0496112_1217422 | Ga0496112_1217422_178_609 | 143 |
| 1014 | 3300049513 | Ga0501290_008692 | Ga0501290_008692_40_471 | 143 |
| 1015 | 3300049514 | Ga0501291_006100 | Ga0501291_006100_688_1119 | 143 |
| 1016 | 3300049515 | Ga0501292_006230 | Ga0501292_006230_542_973 | 143 |
| 1017 | 3300049517 | Ga0501294_007750 | Ga0501294_007750_142_573 | 143 |
| 1018 | 3300049519 | Ga0501296_000186 | Ga0501296_000186_3551_3982 | 143 |
| 1019 | 3300049520 | Ga0501297_000526 | Ga0501297_000526_633_1064 | 143 |
| 1020 | 3300049521 | Ga0501298_007749 | Ga0501298_007749_631_1062 | 143 |
| 1021 | 3300049522 | Ga0501299_000948 | Ga0501299_000948_2333_2764 | 143 |
| 1022 | 3300049574 | Ga0501038_0007200 | Ga0501038_0007200_1731_2183 | 143 |
| 1023 | 3300049591 | Ga0501075_0340260 | Ga0501075_0340260_470_916 | 143 |
| 1024 | 3300049649 | Ga0501198_068401 | Ga0501198_068401_20_451 | 143 |
| 1025 | 3300049652 | Ga0501202_020467 | Ga0501202_020467_466_897 | 143 |
| 1026 | 3300049660 | Ga0501216_037190 | Ga0501216_037190_345_776 | 143 |
| 1027 | 3300049664 | Ga0501224_039528 | Ga0501224_039528_250_681 | 143 |
| 1028 | 3300049668 | Ga0501233_010910 | Ga0501233_010910_647_1078 | 143 |
| 1029 | 3300049669 | Ga0501235_016418 | Ga0501235_016418_631_1062 | 143 |
| 1030 | 3300049679 | Ga0501249_116063 | Ga0501249_116063_190_621 | 143 |
| 1031 | 3300049683 | Ga0501253_021611 | Ga0501253_021611_162_593 | 143 |
| 1032 | 3300049689 | Ga0501260_007902 | Ga0501260_007902_555_986 | 143 |
| 1033 | 3300049705 | Ga0501225_0003895 | Ga0501225_0003895_3143_3574 | 143 |
| 1034 | 3300049706 | Ga0501229_019004 | Ga0501229_019004_68_499 | 143 |
| 1035 | 3300049707 | Ga0501234_026874 | Ga0501234_026874_14_445 | 143 |
| 1036 | 3300049707 | Ga0501234_082537 | Ga0501234_082537_68_499 | 143 |
| 1037 | 3300049760 | Ga0501263_020496 | Ga0501263_020496_141_572 | 143 |
| 1038 | 3300049761 | Ga0501264_004315 | Ga0501264_004315_536_967 | 143 |
| 1039 | 3300049762 | Ga0501265_007485 | Ga0501265_007485_411_842 | 143 |
| 1040 | 3300049765 | Ga0501268_057442 | Ga0501268_057442_294_725 | 143 |
| 1041 | 3300049768 | Ga0501271_031811 | Ga0501271_031811_90_521 | 143 |
| 1042 | 3300049771 | Ga0501274_001355 | Ga0501274_001355_534_965 | 143 |
| 1043 | 3300049774 | Ga0501278_003167 | Ga0501278_003167_36_467 | 143 |
| 1044 | 3300049778 | Ga0501282_040751 | Ga0501282_040751_88_519 | 143 |
| 1045 | 3300049779 | Ga0501283_006164 | Ga0501283_006164_1033_1464 | 143 |
| 1046 | 3300049853 | Ga0501226_013419 | Ga0501226_013419_83_514 | 143 |
| 1047 | 3300050507 | nmdc:mga05p37_101353_c1 | nmdc:mga05p37_101353_c1_2623_3054 | 143 |
| 1048 | 3300050507 | nmdc:mga05p37_930106_c1 | nmdc:mga05p37_930106_c1_450_896 | 143 |
| 1049 | 3300050508 | nmdc:mga09592_144706_c1 | nmdc:mga09592_144706_c1_721_1164 | 143 |
| 1050 | 3300050509 | nmdc:mga0qj67_48770_c1 | nmdc:mga0qj67_48770_c1_223_666 | 143 |
| 1051 | 3300050510 | nmdc:mga06r32_151961_c1 | nmdc:mga06r32_151961_c1_39_482 | 143 |
| 1052 | 3300050511 | nmdc:mga08y16_436742_c1 | nmdc:mga08y16_436742_c1_120_551 | 143 |
| 1053 | 3300050513 | nmdc:mga0rr50_845755_c1 | nmdc:mga0rr50_845755_c1_142_591 | 143 |
| 1054 | 3300050515 | nmdc:mga0a205_124443_c1 | nmdc:mga0a205_124443_c1_2013_2444 | 143 |
| 1055 | 3300050515 | nmdc:mga0a205_233499_c1 | nmdc:mga0a205_233499_c1_1178_1618 | 143 |
| 1056 | 3300050515 | nmdc:mga0a205_27719_c2 | nmdc:mga0a205_27719_c2_1491_1922 | 143 |
| 1057 | 3300050515 | nmdc:mga0a205_6874_c1 | nmdc:mga0a205_6874_c1_260_691 | 143 |
| 1058 | 3300050515 | nmdc:mga0a205_991763_c1 | nmdc:mga0a205_991763_c1_10_441 | 143 |
| 1059 | 3300054114 | Ga0501084_0253607 | Ga0501084_0253607_271_717 | 143 |
| 1060 | 3300061734 | Ga0530510_1190407 | Ga0530510_1190407_18_449 | 143 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6a09-assembly1.cif.gz_A | salmonella typhi yfdx in the p222 space group | 0.9046 | 53 | 92 |
| 2w2u-assembly2.cif.gz_B | structural insight into the interaction between archaeal escrt-iii and aaa-atpase | 0.8163 | 48 | 116 |
| 2ijq-assembly1.cif.gz_A | crystal structure of protein rrnac1037 from haloarcula marismortui, pfam duf309 | 0.815 | 19 | 135 |
| 2w2u-assembly1.cif.gz_A | structural insight into the interaction between archaeal escrt-iii and aaa-atpase | 0.8141 | 47 | 116 |
| 2ijq-assembly2.cif.gz_B | crystal structure of protein rrnac1037 from haloarcula marismortui, pfam duf309 | 0.8117 | 19 | 135 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76510_96_156_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9399 | 17 | 71 | 1.25.40.10 |
| af_O80675_54_197_1.10.3450.10 | Mainly Alpha;Orthogonal Bundle;Hyaluronidase domain-like;TTHA0068-like | 0.9154 | 20 | 116 | 1.10.3450.10 |
| af_P76510_96_156_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.839 | 17 | 71 | 1.25.40.10 |
| af_Q2FY75_1_133_1.10.3450.10 | Mainly Alpha;Orthogonal Bundle;Hyaluronidase domain-like;TTHA0068-like | 0.822 | 19 | 137 | 1.10.3450.10 |
| 2w2uA00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit | 0.8141 | 47 | 116 | 1.20.58.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8LQU5-F1-model_v4 | DUF309 domain-containing protein | 0.9869 | 8 | 140 |
|
| AF-A0A2V8PQL7-F1-model_v4 | DUF309 domain-containing protein | 0.9848 | 7 | 83 |
|
| AF-A0A2V8LQU5-F1-model_v4 | DUF309 domain-containing protein | 0.9653 | 8 | 140 |
|
| AF-A0A1Q7NGE4-F1-model_v4 | DUF309 domain-containing protein | 0.9531 | 2 | 141 |
|
| AF-A0A2V8PQL7-F1-model_v4 | DUF309 domain-containing protein | 0.9484 | 7 | 83 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar