F489249

General Info

Members Datasets Scaffolds Average Seq Length
1059 341 1055 157

Family's Representative Sequence

Representative Sequence 3300026023|Ga0207677_10580578|Ga0207677_105805782
Length 182
Sequence MRPSLNRKPAKKPILSHYDKAGEARMVDVSAKSETKRTARAQAFVKMSAAVLAELGNNPKGDPLQVARIAGITAAKKTSELIPMCHPLLLSHIDVKLSVKDDGVQISTSVTTTAPTGVEMEALTAATVAALTVYDMTKALDKGIEIQDIYLIEKTGGKSGTYARKGKTAAAGSRSDSRSDSE

Samples

Sample ID Description Type Environment
1 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
2 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
3 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
4 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
84 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
116 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
117 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
118 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
119 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
120 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
121 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
178 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
179 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
180 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
181 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
184 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
185 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
186 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
187 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
188 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
189 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
190 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
191 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
192 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
193 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
194 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
195 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
196 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
197 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
198 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
199 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
200 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
201 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
202 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
203 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
206 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
207 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
208 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
209 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
210 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
211 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
212 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
213 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
215 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
216 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
217 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
218 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
219 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
220 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
221 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
222 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
223 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
224 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
225 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
227 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
228 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
229 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
230 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
231 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
232 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
234 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
235 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
236 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
237 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
238 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
239 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
240 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
241 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
242 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
243 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
244 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
245 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
246 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
247 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
248 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
249 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
250 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
251 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
252 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
253 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
254 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
255 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
256 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
257 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
258 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
259 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
260 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
261 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
262 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
263 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
264 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
265 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
266 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
267 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
268 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
269 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
270 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
271 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
272 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
273 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
274 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
275 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
276 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
277 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
278 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
279 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
280 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
281 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
282 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
283 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
284 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
285 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
286 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
287 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
288 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
289 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
290 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
291 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
292 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
293 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
294 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
295 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
296 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
297 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
298 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
299 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
300 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
301 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
302 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
303 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
304 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
305 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
306 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
307 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
308 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
309 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
310 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
311 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
312 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
313 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
319 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
320 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
321 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
322 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
323 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
324 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
325 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
326 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
327 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
328 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
329 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
330 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
331 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
332 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
333 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
334 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
335 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
336 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
337 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
338 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
339 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
340 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
341 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.96
Metatranscriptomes 0.66
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.57
Nodule 0
Rhizoplane 4.91
Rhizosphere 92.92
Stem 0
Stem Tuber 0
Unclassified 1.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055530_10000901 3300003791 Bacteria 24454
2 Ga0055531_10000583 3300003794 Bacteria 31858
3 Ga0065715_10529869 3300005293 Unclassified 756
4 Ga0070658_10088066 3300005327 Bacteria 2556
5 Ga0070658_10112111 3300005327 Bacteria 2261
6 Ga0070658_10995641 3300005327 Unclassified 729
7 Ga0070683_100000051 3300005329 Bacteria 90543
8 Ga0070683_100013688 3300005329 Bacteria 7081
9 Ga0070683_100019789 3300005329 Bacteria 5983
10 Ga0070683_100034270 3300005329 Bacteria 4636
11 Ga0070683_100061409 3300005329 Bacteria 3495
12 Ga0070683_100065764 3300005329 Bacteria 3376
13 Ga0070683_100145819 3300005329 Bacteria 2243
14 Ga0070683_100398021 3300005329 Bacteria 1313
15 Ga0070683_100480833 3300005329 Bacteria 1186
16 Ga0070683_100527741 3300005329 Bacteria 1128
17 Ga0070683_100789692 3300005329 Bacteria 910
18 Ga0070690_100664012 3300005330 Bacteria 797
19 Ga0070670_100204356 3300005331 Bacteria 1717
20 Ga0070670_100995684 3300005331 Bacteria 762
21 Ga0070670_101629465 3300005331 Unclassified 593
22 Ga0070677_10461993 3300005333 Bacteria 681
23 Ga0068869_100010065 3300005334 Bacteria 6151
24 Ga0068869_100170892 3300005334 Bacteria 1698
25 Ga0068869_100300870 3300005334 Bacteria 1295
26 Ga0070666_10133786 3300005335 Bacteria 1724
27 Ga0070680_100009354 3300005336 Bacteria 7528
28 Ga0070680_100143936 3300005336 Bacteria 1999
29 Ga0070680_100952131 3300005336 Unclassified 741
30 Ga0070682_100104446 3300005337 Bacteria 1876
31 Ga0070682_100115730 3300005337 Bacteria 1793
32 Ga0070682_100646689 3300005337 Bacteria 841
33 Ga0068868_100270331 3300005338 Bacteria 1436
34 Ga0068868_100695108 3300005338 Bacteria 909
35 Ga0070660_100036846 3300005339 Bacteria 3706
36 Ga0070660_100221281 3300005339 Bacteria 1539
37 Ga0070660_100349242 3300005339 Bacteria 1218
38 Ga0070689_100637155 3300005340 Bacteria 926
39 Ga0070691_10009177 3300005341 Bacteria 4521
40 Ga0070661_100746171 3300005344 Bacteria 800
41 Ga0070692_10059267 3300005345 Bacteria 2012
42 Ga0070692_10097797 3300005345 Bacteria 1605
43 Ga0070668_100286256 3300005347 Bacteria 1378
44 Ga0070668_100599076 3300005347 Bacteria 964
45 Ga0070671_100110263 3300005355 Bacteria 2311
46 Ga0070671_100962886 3300005355 Bacteria 747
47 Ga0070688_100741580 3300005365 Bacteria 764
48 Ga0070659_100641206 3300005366 Bacteria 915
49 Ga0070667_100126251 3300005367 Bacteria 2230
50 Ga0070667_100201538 3300005367 Bacteria 1766
51 Ga0070667_100296367 3300005367 Bacteria 1455
52 Ga0070667_101124904 3300005367 Bacteria 734
53 Ga0070667_101137263 3300005367 Bacteria 730
54 Ga0070709_10017253 3300005434 Bacteria 4137
55 Ga0070709_10048410 3300005434 Unclassified 2652
56 Ga0070709_10098765 3300005434 Bacteria 1941
57 Ga0070709_10432040 3300005434 Bacteria 989
58 Ga0070709_10736486 3300005434 Unclassified 769
59 Ga0070714_100000386 3300005435 Bacteria 32917
60 Ga0070714_100760365 3300005435 Bacteria 937
61 Ga0070713_100037923 3300005436 Bacteria 3900
62 Ga0070713_100078111 3300005436 Bacteria 2817
63 Ga0070713_100099516 3300005436 Bacteria 2516
64 Ga0070713_100171742 3300005436 Bacteria 1942
65 Ga0070713_100194876 3300005436 Unclassified 1827
66 Ga0070710_10015779 3300005437 Bacteria 3830
67 Ga0070710_10360148 3300005437 Bacteria 965
68 Ga0070710_10452193 3300005437 Bacteria 871
69 Ga0070711_100186534 3300005439 Bacteria 1591
70 Ga0070711_100750712 3300005439 Unclassified 824
71 Ga0070711_100971110 3300005439 Bacteria 728
72 Ga0070694_100647108 3300005444 Unclassified 855
73 Ga0070708_100031899 3300005445 Bacteria 4565
74 Ga0070678_100059833 3300005456 Bacteria 2801
75 Ga0070678_100238520 3300005456 Unclassified 1519
76 Ga0070662_100196739 3300005457 Bacteria 1597
77 Ga0070681_10000605 3300005458 Bacteria 29575
78 Ga0070681_10002652 3300005458 Bacteria 16431
79 Ga0070681_10019182 3300005458 Bacteria 6844
80 Ga0070681_10538907 3300005458 Bacteria 1081
81 Ga0068867_100275770 3300005459 Bacteria 1377
82 Ga0068867_100508755 3300005459 Bacteria 1036
83 Ga0070685_10307602 3300005466 Bacteria 1070
84 Ga0070706_100252976 3300005467 Unclassified 1645
85 Ga0070706_101061849 3300005467 Bacteria 746
86 Ga0070706_101385274 3300005467 Bacteria 644
87 Ga0070707_100556620 3300005468 Bacteria 1109
88 Ga0070707_100642203 3300005468 Bacteria 1024
89 Ga0070707_101804062 3300005468 Bacteria 579
90 Ga0070698_100576842 3300005471 Bacteria 1065
91 Ga0070698_101077900 3300005471 Bacteria 752
92 Ga0070699_100022533 3300005518 Bacteria 5429
93 Ga0070699_100095222 3300005518 Bacteria 2607
94 Ga0070699_100761183 3300005518 Unclassified 886
95 Ga0070679_100000883 3300005530 Bacteria 26062
96 Ga0070679_100017372 3300005530 Bacteria 6962
97 Ga0070684_100000061 3300005535 Bacteria 70520
98 Ga0070684_100002114 3300005535 Bacteria 14642
99 Ga0070684_100028501 3300005535 Bacteria 4725
100 Ga0070684_100072418 3300005535 Bacteria 3034
101 Ga0070684_100210882 3300005535 Bacteria 1770
102 Ga0070684_100706194 3300005535 Bacteria 940
103 Ga0070684_100731726 3300005535 Bacteria 923
104 Ga0070697_100362927 3300005536 Unclassified 1252
105 Ga0070697_100443508 3300005536 Bacteria 1130
106 Ga0070697_100603109 3300005536 Bacteria 965
107 Ga0070697_100630723 3300005536 Bacteria 943
108 Ga0068853_100761029 3300005539 Bacteria 926
109 Ga0070672_100614830 3300005543 Bacteria 947
110 Ga0070693_100208695 3300005547 Bacteria 1273
111 Ga0070693_100399839 3300005547 Bacteria 952
112 Ga0070665_100031655 3300005548 Bacteria 5323
113 Ga0070665_100443090 3300005548 Unclassified 1308
114 Ga0070665_100671817 3300005548 Bacteria 1049
115 Ga0070704_100247052 3300005549 Bacteria 1463
116 Ga0068855_100001633 3300005563 Bacteria 28123
117 Ga0068855_100007832 3300005563 Bacteria 12909
118 Ga0068855_100031981 3300005563 Bacteria 6282
119 Ga0068855_100163150 3300005563 Bacteria 2528
120 Ga0068855_100251190 3300005563 Bacteria 1973
121 Ga0068855_100274674 3300005563 Bacteria 1873
122 Ga0068855_100632267 3300005563 Bacteria 1151
123 Ga0070664_100466001 3300005564 Bacteria 1161
124 Ga0070664_101141143 3300005564 Bacteria 734
125 Ga0068857_100003819 3300005577 Bacteria 12677
126 Ga0068857_100061655 3300005577 Bacteria 3332
127 Ga0068857_100238329 3300005577 Bacteria 1665
128 Ga0068854_100121973 3300005578 Bacteria 1980
129 Ga0068856_100075518 3300005614 Bacteria 3338
130 Ga0068856_100097875 3300005614 Bacteria 2923
131 Ga0068856_100203541 3300005614 Bacteria 1994
132 Ga0068856_100346035 3300005614 Bacteria 1505
133 Ga0068856_100754273 3300005614 Bacteria 993
134 Ga0068856_101111460 3300005614 Unclassified 808
135 Ga0070702_100194209 3300005615 Bacteria 1338
136 Ga0070702_101733148 3300005615 Bacteria 520
137 Ga0068852_100017342 3300005616 Bacteria 5647
138 Ga0068852_100031322 3300005616 Bacteria 4387
139 Ga0068852_100156588 3300005616 Bacteria 2123
140 Ga0068852_100184359 3300005616 Bacteria 1965
141 Ga0068852_100295873 3300005616 Bacteria 1565
142 Ga0068852_100350099 3300005616 Bacteria 1442
143 Ga0068859_100140769 3300005617 Bacteria 2486
144 Ga0068859_100664517 3300005617 Bacteria 1134
145 Ga0068859_101030168 3300005617 Unclassified 904
146 Ga0068859_101293571 3300005617 Bacteria 803
147 Ga0068859_101567583 3300005617 Bacteria 727
148 Ga0068864_100038294 3300005618 Bacteria 4095
149 Ga0068864_100052484 3300005618 Bacteria 3514
150 Ga0068864_100223924 3300005618 Bacteria 1736
151 Ga0068863_100019220 3300005841 Bacteria 6538
152 Ga0068863_100149236 3300005841 Bacteria 2236
153 Ga0068863_100382531 3300005841 Bacteria 1374
154 Ga0068863_100453238 3300005841 Bacteria 1259
155 Ga0068863_100523876 3300005841 Bacteria 1169
156 Ga0068863_100613615 3300005841 Bacteria 1077
157 Ga0068863_100923000 3300005841 Bacteria 874
158 Ga0068863_101864038 3300005841 Bacteria 611
159 Ga0068858_100013721 3300005842 Bacteria 7647
160 Ga0068858_100239136 3300005842 Bacteria 1723
161 Ga0068858_100482312 3300005842 Bacteria 1197
162 Ga0068860_100035691 3300005843 Bacteria 4768
163 Ga0068860_100074306 3300005843 Bacteria 3232
164 Ga0068860_100199313 3300005843 Bacteria 1939
165 Ga0068860_100310755 3300005843 Bacteria 1545
166 Ga0068860_100356335 3300005843 Bacteria 1441
167 Ga0068860_101123432 3300005843 Bacteria 805
168 Ga0068862_100371468 3300005844 Bacteria 1331
169 Ga0081539_10017275 3300005985 Bacteria 5076
170 Ga0070717_10027358 3300006028 Bacteria 4558
171 Ga0070717_10029546 3300006028 Bacteria 4398
172 Ga0070717_10059739 3300006028 Bacteria 3155
173 Ga0070717_10137100 3300006028 Bacteria 2108
174 Ga0070717_10305381 3300006028 Bacteria 1415
175 Ga0070717_10547250 3300006028 Bacteria 1048
176 Ga0070715_10180463 3300006163 Bacteria 1058
177 Ga0070716_100093300 3300006173 Bacteria 1827
178 Ga0070716_100431208 3300006173 Bacteria 956
179 Ga0070716_101171367 3300006173 Bacteria 616
180 Ga0070712_100093528 3300006175 Bacteria 2207
181 Ga0097621_100030891 3300006237 Bacteria 4244
182 Ga0097621_100107956 3300006237 Bacteria 2349
183 Ga0097621_100219441 3300006237 Bacteria 1656
184 Ga0097621_100220992 3300006237 Bacteria 1651
185 Ga0097621_100398349 3300006237 Bacteria 1232
186 Ga0097621_100438368 3300006237 Unclassified 1175
187 Ga0097621_100972286 3300006237 Bacteria 793
188 Ga0068871_100129353 3300006358 Bacteria 2139
189 Ga0068871_100143395 3300006358 Bacteria 2032
190 Ga0068871_100355858 3300006358 Bacteria 1296
191 Ga0068871_100607311 3300006358 Bacteria 995
192 Ga0068871_100620271 3300006358 Bacteria 985
193 Ga0068871_101036766 3300006358 Bacteria 765
194 Ga0068871_101179144 3300006358 Bacteria 718
195 Ga0075428_100350205 3300006844 Bacteria 1585
196 Ga0075430_100036376 3300006846 Bacteria 4175
197 Ga0075430_100055664 3300006846 Unclassified 3326
198 Ga0075431_100022732 3300006847 Bacteria 6409
199 Ga0075433_10004679 3300006852 Bacteria 10666
200 Ga0075433_10381162 3300006852 Bacteria 1245
201 Ga0075433_10937738 3300006852 Bacteria 755
202 Ga0075434_100021744 3300006871 Bacteria 6238
203 Ga0075434_100042803 3300006871 Bacteria 4491
204 Ga0075434_100213825 3300006871 Bacteria 1948
205 Ga0075434_101211643 3300006871 Bacteria 767
206 Ga0075429_101281910 3300006880 Bacteria 639
207 Ga0068865_101363481 3300006881 Bacteria 632
208 Ga0075436_100335292 3300006914 Bacteria 1088
209 Ga0075436_100469306 3300006914 Bacteria 918
210 Ga0097620_100140775 3300006931 Bacteria 2486
211 Ga0097620_100664536 3300006931 Bacteria 1134
212 Ga0097620_100747232 3300006931 Bacteria 1067
213 Ga0097620_101030339 3300006931 Unclassified 904
214 Ga0097620_101293603 3300006931 Bacteria 803
215 Ga0097620_101567370 3300006931 Bacteria 727
216 Ga0075435_100037403 3300007076 Bacteria 3865
217 Ga0075435_100124806 3300007076 Bacteria 2151
218 Ga0099794_10052393 3300007265 Unclassified 1967
219 Ga0099795_10037425 3300007788 Unclassified 1707
220 Ga0099795_10066245 3300007788 Unclassified 1352
221 Ga0099795_10080988 3300007788 Bacteria 1242
222 Ga0099795_10180297 3300007788 Bacteria 882
223 Ga0105244_10324366 3300009036 Bacteria 711
224 Ga0105240_10003450 3300009093 Bacteria 24537
225 Ga0105240_10005756 3300009093 Bacteria 18388
226 Ga0105240_10006166 3300009093 Bacteria 17670
227 Ga0105240_10017854 3300009093 Bacteria 9546
228 Ga0105240_10023379 3300009093 Bacteria 8175
229 Ga0105240_10119293 3300009093 Bacteria 3178
230 Ga0105240_10129063 3300009093 Bacteria 3034
231 Ga0105240_10144007 3300009093 Bacteria 2846
232 Ga0105240_10354356 3300009093 Bacteria 1664
233 Ga0105240_10433926 3300009093 Bacteria 1473
234 Ga0105240_10542221 3300009093 Bacteria 1288
235 Ga0105240_11124324 3300009093 Bacteria 835
236 Ga0105240_11611121 3300009093 Bacteria 679
237 Ga0111539_10883125 3300009094 Bacteria 1040
238 Ga0105245_10005590 3300009098 Bacteria 11043
239 Ga0105245_10011857 3300009098 Bacteria 7582
240 Ga0105245_10028346 3300009098 Bacteria 4939
241 Ga0105245_10042372 3300009098 Bacteria 4062
242 Ga0105245_10155998 3300009098 Bacteria 2162
243 Ga0105245_10184017 3300009098 Unclassified 1998
244 Ga0105245_10543839 3300009098 Bacteria 1183
245 Ga0105245_10626766 3300009098 Bacteria 1104
246 Ga0105245_10632212 3300009098 Unclassified 1099
247 Ga0105245_12094691 3300009098 Bacteria 619
248 Ga0105247_10029848 3300009101 Bacteria 3306
249 Ga0114129_10000566 3300009147 Bacteria 45463
250 Ga0114129_10046469 3300009147 Bacteria 6101
251 Ga0114129_10309270 3300009147 Bacteria 2104
252 Ga0114129_10363515 3300009147 Bacteria 1914
253 Ga0114129_10404112 3300009147 Unclassified 1799
254 Ga0114129_10446276 3300009147 Bacteria 1697
255 Ga0114129_10656859 3300009147 Bacteria 1353
256 Ga0114129_10767338 3300009147 Bacteria 1233
257 Ga0114129_10974250 3300009147 Bacteria 1070
258 Ga0114129_11198739 3300009147 Bacteria 946
259 Ga0114129_11344621 3300009147 Bacteria 884
260 Ga0114129_11794472 3300009147 Unclassified 746
261 Ga0114129_12365488 3300009147 Bacteria 637
262 Ga0105243_10052143 3300009148 Bacteria 3239
263 Ga0105243_10090238 3300009148 Bacteria 2521
264 Ga0105243_10146361 3300009148 Bacteria 2021
265 Ga0105243_10670369 3300009148 Bacteria 1007
266 Ga0105243_10672856 3300009148 Bacteria 1006
267 Ga0105243_11507300 3300009148 Bacteria 696
268 Ga0105243_11877135 3300009148 Bacteria 631
269 Ga0105241_10051974 3300009174 Bacteria 3127
270 Ga0105241_10053332 3300009174 Bacteria 3092
271 Ga0105241_10126772 3300009174 Bacteria 2062
272 Ga0105241_10326102 3300009174 Bacteria 1326
273 Ga0105241_10980062 3300009174 Bacteria 790
274 Ga0105241_11055750 3300009174 Bacteria 763
275 Ga0105242_10027196 3300009176 Bacteria 4540
276 Ga0105242_10058237 3300009176 Bacteria 3166
277 Ga0105242_10115850 3300009176 Bacteria 2292
278 Ga0105242_10349641 3300009176 Bacteria 1365
279 Ga0105242_10423348 3300009176 Bacteria 1248
280 Ga0105242_10543449 3300009176 Bacteria 1113
281 Ga0105248_10023999 3300009177 Bacteria 6779
282 Ga0105248_10026578 3300009177 Bacteria 6438
283 Ga0105248_10031143 3300009177 Bacteria 5961
284 Ga0105248_10070780 3300009177 Bacteria 3917
285 Ga0105248_10261316 3300009177 Bacteria 1949
286 Ga0105248_10482909 3300009177 Unclassified 1397
287 Ga0105248_10483744 3300009177 Bacteria 1395
288 Ga0105248_10517493 3300009177 Bacteria 1345
289 Ga0105248_11101824 3300009177 Unclassified 897
290 Ga0105248_11281469 3300009177 Bacteria 829
291 Ga0105248_11324386 3300009177 Bacteria 815
292 Ga0105248_11496530 3300009177 Bacteria 764
293 Ga0105248_11931346 3300009177 Bacteria 670
294 Ga0105248_12154749 3300009177 Bacteria 634
295 Ga0105237_10012111 3300009545 Bacteria 9104
296 Ga0105237_10040373 3300009545 Bacteria 4706
297 Ga0105237_10167903 3300009545 Bacteria 2194
298 Ga0105237_10171538 3300009545 Bacteria 2169
299 Ga0105237_10383669 3300009545 Bacteria 1410
300 Ga0105237_10419516 3300009545 Unclassified 1343
301 Ga0105237_10545667 3300009545 Bacteria 1166
302 Ga0105237_11529735 3300009545 Unclassified 674
303 Ga0105238_10006344 3300009551 Bacteria 11761
304 Ga0105238_10008033 3300009551 Bacteria 10557
305 Ga0105238_10065643 3300009551 Bacteria 3631
306 Ga0105238_10238950 3300009551 Bacteria 1794
307 Ga0105238_11250008 3300009551 Bacteria 768
308 Ga0105238_11599246 3300009551 Bacteria 682
309 Ga0105249_10017122 3300009553 Bacteria 6433
310 Ga0105249_10038088 3300009553 Bacteria 4362
311 Ga0105249_10192926 3300009553 Bacteria 1989
312 Ga0105249_10213984 3300009553 Bacteria 1893
313 Ga0105249_10766740 3300009553 Bacteria 1027
314 Ga0099796_10040988 3300010159 Bacteria 1566
315 Ga0099796_10172497 3300010159 Bacteria 864
316 Ga0105239_10011863 3300010375 Bacteria 9723
317 Ga0105239_10015915 3300010375 Bacteria 8326
318 Ga0105239_10023725 3300010375 Bacteria 6754
319 Ga0105239_10585977 3300010375 Bacteria 1272
320 Ga0105239_10623751 3300010375 Bacteria 1230
321 Ga0105239_12232423 3300010375 Bacteria 637
322 Ga0105246_10001137 3300011119 Bacteria 15431
323 Ga0105246_10211380 3300011119 Bacteria 1514
324 Ga0105246_10566344 3300011119 Bacteria 976
325 Ga0105246_10671886 3300011119 Bacteria 904
326 Ga0157373_10199304 3300013100 Bacteria 1411
327 Ga0157371_10038416 3300013102 Bacteria 3425
328 Ga0157370_10002104 3300013104 Bacteria 24327
329 Ga0157370_10002904 3300013104 Bacteria 20437
330 Ga0157370_10048458 3300013104 Bacteria 4070
331 Ga0157370_10100651 3300013104 Bacteria 2708
332 Ga0157370_10305475 3300013104 Bacteria 1468
333 Ga0157370_10630246 3300013104 Bacteria 981
334 Ga0157369_10012050 3300013105 Bacteria 9817
335 Ga0157369_10013263 3300013105 Bacteria 9324
336 Ga0157369_10032835 3300013105 Bacteria 5704
337 Ga0157369_10103620 3300013105 Bacteria 3031
338 Ga0157369_10180313 3300013105 Bacteria 2222
339 Ga0157369_10437218 3300013105 Unclassified 1355
340 Ga0157369_10620925 3300013105 Bacteria 1115
341 Ga0157374_10007004 3300013296 Bacteria 9595
342 Ga0157374_10012288 3300013296 Bacteria 7448
343 Ga0157374_10014907 3300013296 Bacteria 6812
344 Ga0157374_10039582 3300013296 Bacteria 4338
345 Ga0157374_10339973 3300013296 Bacteria 1490
346 Ga0157374_10561612 3300013296 Bacteria 1149
347 Ga0157374_10716266 3300013296 Bacteria 1014
348 Ga0157374_10789436 3300013296 Bacteria 965
349 Ga0157378_10003916 3300013297 Bacteria 13195
350 Ga0157378_10024514 3300013297 Bacteria 5310
351 Ga0157378_10068265 3300013297 Bacteria 3188
352 Ga0157378_10073479 3300013297 Unclassified 3075
353 Ga0157378_10118899 3300013297 Bacteria 2433
354 Ga0157378_10307441 3300013297 Bacteria 1536
355 Ga0157378_10314026 3300013297 Bacteria 1521
356 Ga0157378_10641094 3300013297 Bacteria 1077
357 Ga0157378_11075671 3300013297 Bacteria 841
358 Ga0163162_10008346 3300013306 Bacteria 10099
359 Ga0163162_10434440 3300013306 Bacteria 1445
360 Ga0163162_10640471 3300013306 Bacteria 1187
361 Ga0163162_10759428 3300013306 Bacteria 1089
362 Ga0163162_10919549 3300013306 Bacteria 987
363 Ga0163162_11011700 3300013306 Bacteria 940
364 Ga0163162_11074274 3300013306 Bacteria 911
365 Ga0163162_11885102 3300013306 Unclassified 684
366 Ga0163162_13107852 3300013306 Unclassified 533
367 Ga0157372_10003606 3300013307 Bacteria 16665
368 Ga0157372_10007318 3300013307 Bacteria 11750
369 Ga0157372_10050104 3300013307 Unclassified 4646
370 Ga0157372_10064369 3300013307 Bacteria 4114
371 Ga0157372_10066914 3300013307 Bacteria 4037
372 Ga0157372_10231714 3300013307 Bacteria 2141
373 Ga0157372_10382822 3300013307 Bacteria 1639
374 Ga0157372_11981606 3300013307 Bacteria 669
375 Ga0157375_10081896 3300013308 Unclassified 3268
376 Ga0157375_10107742 3300013308 Bacteria 2880
377 Ga0157375_10152200 3300013308 Bacteria 2450
378 Ga0157375_10169992 3300013308 Bacteria 2327
379 Ga0157375_10344453 3300013308 Bacteria 1656
380 Ga0157375_10388744 3300013308 Bacteria 1562
381 Ga0157375_10495081 3300013308 Bacteria 1387
382 Ga0157375_10785054 3300013308 Bacteria 1102
383 Ga0157375_11285747 3300013308 Unclassified 860
384 Ga0163163_10002295 3300014325 Bacteria 16141
385 Ga0163163_10003230 3300014325 Bacteria 13822
386 Ga0163163_10004829 3300014325 Bacteria 11579
387 Ga0163163_10034711 3300014325 Bacteria 4887
388 Ga0163163_10243325 3300014325 Unclassified 1849
389 Ga0163163_10305347 3300014325 Bacteria 1644
390 Ga0157380_10062307 3300014326 Bacteria 2987
391 Ga0157380_11305197 3300014326 Bacteria 773
392 Ga0157379_10016505 3300014968 Bacteria 6494
393 Ga0157379_10157363 3300014968 Bacteria 2050
394 Ga0157379_10323743 3300014968 Bacteria 1408
395 Ga0157379_10462606 3300014968 Bacteria 1172
396 Ga0157379_11149367 3300014968 Bacteria 745
397 Ga0157376_10003293 3300014969 Bacteria 11123
398 Ga0157376_10117350 3300014969 Unclassified 2353
399 Ga0157376_10254880 3300014969 Bacteria 1641
400 Ga0157376_10523703 3300014969 Bacteria 1169
401 Ga0157376_10541897 3300014969 Bacteria 1150
402 Ga0157376_10623391 3300014969 Bacteria 1076
403 Ga0157376_10689816 3300014969 Bacteria 1025
404 Ga0157376_10945103 3300014969 Bacteria 882
405 Ga0163161_10565009 3300017792 Bacteria 934
406 Ga0206353_10992914 3300020082 Bacteria 919
407 Ga0213873_10039413 3300021358 Bacteria 1210
408 Ga0213873_10256813 3300021358 Bacteria 555
409 Ga0213875_10000018 3300021388 Bacteria 233445
410 Ga0224570_100985 3300022730 Bacteria 2241
411 Ga0224569_101568 3300022732 Bacteria 1908
412 Ga0228598_1000659 3300024227 Bacteria 7253
413 Ga0228598_1003820 3300024227 Unclassified 3214
414 Ga0228598_1004693 3300024227 Bacteria 2886
415 Ga0209026_1005779 3300025250 Bacteria 3218
416 Ga0209676_1087506 3300025292 Bacteria 693
417 Ga0209050_1000010 3300025298 Bacteria 980454
418 Ga0209257_1000009 3300025304 Bacteria 1205047
419 Ga0207692_10151189 3300025898 Bacteria 1330
420 Ga0207710_10029613 3300025900 Bacteria 2384
421 Ga0207680_10452008 3300025903 Bacteria 912
422 Ga0207680_10527558 3300025903 Bacteria 842
423 Ga0207647_10019106 3300025904 Bacteria 4614
424 Ga0207647_10061055 3300025904 Bacteria 2302
425 Ga0207647_10668597 3300025904 Bacteria 568
426 Ga0207685_10189209 3300025905 Bacteria 959
427 Ga0207699_10061227 3300025906 Bacteria 2264
428 Ga0207699_10072937 3300025906 Bacteria 2104
429 Ga0207699_10421337 3300025906 Bacteria 954
430 Ga0207705_10043214 3300025909 Bacteria 3237
431 Ga0207705_10080686 3300025909 Bacteria 2370
432 Ga0207654_10049076 3300025911 Bacteria 2419
433 Ga0207707_10000372 3300025912 Bacteria 47046
434 Ga0207707_10043965 3300025912 Bacteria 3895
435 Ga0207707_10124030 3300025912 Bacteria 2259
436 Ga0207707_10186868 3300025912 Bacteria 1808
437 Ga0207707_10270942 3300025912 Bacteria 1471
438 Ga0207707_11374722 3300025912 Bacteria 564
439 Ga0207695_10000563 3300025913 Bacteria 76084
440 Ga0207695_10002828 3300025913 Bacteria 25226
441 Ga0207695_10004561 3300025913 Bacteria 18833
442 Ga0207695_10005869 3300025913 Bacteria 16115
443 Ga0207695_10029367 3300025913 Bacteria 6078
444 Ga0207695_10092201 3300025913 Unclassified 3040
445 Ga0207695_10163408 3300025913 Bacteria 2156
446 Ga0207695_10169270 3300025913 Bacteria 2111
447 Ga0207695_10404729 3300025913 Bacteria 1249
448 Ga0207671_10025128 3300025914 Bacteria 4475
449 Ga0207671_10333689 3300025914 Bacteria 1201
450 Ga0207671_11099217 3300025914 Bacteria 624
451 Ga0207693_10347722 3300025915 Bacteria 1160
452 Ga0207663_10028977 3300025916 Bacteria 3247
453 Ga0207663_10312894 3300025916 Bacteria 1177
454 Ga0207660_10607649 3300025917 Bacteria 891
455 Ga0207657_10001386 3300025919 Bacteria 25849
456 Ga0207652_10008525 3300025921 Bacteria 8251
457 Ga0207652_10260215 3300025921 Bacteria 1565
458 Ga0207694_10002271 3300025924 Bacteria 15729
459 Ga0207694_10388546 3300025924 Bacteria 1159
460 Ga0207694_10666481 3300025924 Bacteria 877
461 Ga0207694_11235810 3300025924 Unclassified 632
462 Ga0207650_10221852 3300025925 Bacteria 1522
463 Ga0207650_10261490 3300025925 Bacteria 1404
464 Ga0207650_11469098 3300025925 Unclassified 580
465 Ga0207687_10006608 3300025927 Bacteria 7651
466 Ga0207687_10017134 3300025927 Bacteria 4763
467 Ga0207687_10032204 3300025927 Bacteria 3549
468 Ga0207687_10073163 3300025927 Bacteria 2453
469 Ga0207687_10208403 3300025927 Bacteria 1532
470 Ga0207687_10255761 3300025927 Unclassified 1394
471 Ga0207687_10578533 3300025927 Bacteria 944
472 Ga0207700_10001086 3300025928 Bacteria 15659
473 Ga0207700_10140970 3300025928 Bacteria 1981
474 Ga0207700_10282479 3300025928 Bacteria 1428
475 Ga0207700_10394656 3300025928 Bacteria 1212
476 Ga0207700_10728654 3300025928 Bacteria 886
477 Ga0207700_11082883 3300025928 Unclassified 717
478 Ga0207700_11536484 3300025928 Bacteria 590
479 Ga0207664_10000741 3300025929 Bacteria 22186
480 Ga0207664_10140947 3300025929 Bacteria 2039
481 Ga0207644_10382064 3300025931 Bacteria 1149
482 Ga0207690_10503493 3300025932 Bacteria 980
483 Ga0207686_10015151 3300025934 Bacteria 4306
484 Ga0207686_10065427 3300025934 Bacteria 2318
485 Ga0207686_10271205 3300025934 Bacteria 1248
486 Ga0207686_10734616 3300025934 Bacteria 787
487 Ga0207709_10138972 3300025935 Bacteria 1667
488 Ga0207709_10156996 3300025935 Bacteria 1582
489 Ga0207709_10337455 3300025935 Bacteria 1133
490 Ga0207704_10819923 3300025938 Bacteria 778
491 Ga0207704_11642725 3300025938 Bacteria 552
492 Ga0207665_10085002 3300025939 Bacteria 2184
493 Ga0207665_10482390 3300025939 Bacteria 955
494 Ga0207665_10485751 3300025939 Bacteria 952
495 Ga0207665_10848692 3300025939 Bacteria 723
496 Ga0207711_10065883 3300025941 Bacteria 3132
497 Ga0207711_10072807 3300025941 Bacteria 2985
498 Ga0207711_10105464 3300025941 Bacteria 2500
499 Ga0207711_10283370 3300025941 Bacteria 1526
500 Ga0207689_10075607 3300025942 Bacteria 2768
501 Ga0207689_10173908 3300025942 Bacteria 1776
502 Ga0207689_10491664 3300025942 Bacteria 1028
503 Ga0207661_10000046 3300025944 Bacteria 107171
504 Ga0207661_10019082 3300025944 Bacteria 5104
505 Ga0207661_10125524 3300025944 Bacteria 2191
506 Ga0207661_10448291 3300025944 Bacteria 1175
507 Ga0207679_10707655 3300025945 Bacteria 914
508 Ga0207679_10943873 3300025945 Bacteria 790
509 Ga0207679_11146759 3300025945 Bacteria 713
510 Ga0207667_10001186 3300025949 Bacteria 32742
511 Ga0207667_10001746 3300025949 Bacteria 27378
512 Ga0207667_10015440 3300025949 Bacteria 8674
513 Ga0207667_10068619 3300025949 Bacteria 3691
514 Ga0207667_10081919 3300025949 Bacteria 3343
515 Ga0207667_10098288 3300025949 Bacteria 3021
516 Ga0207667_10119246 3300025949 Bacteria 2719
517 Ga0207667_10224153 3300025949 Bacteria 1926
518 Ga0207712_10139261 3300025961 Bacteria 1860
519 Ga0207668_10075779 3300025972 Bacteria 2420
520 Ga0207658_10869976 3300025986 Bacteria 820
521 Ga0207658_11566752 3300025986 Bacteria 602
522 Ga0207677_10580578 3300026023 Bacteria 981
523 Ga0207677_10995387 3300026023 Bacteria 760
524 Ga0207703_10103455 3300026035 Bacteria 2418
525 Ga0207703_10235098 3300026035 Bacteria 1645
526 Ga0207703_10247184 3300026035 Bacteria 1606
527 Ga0207703_10256979 3300026035 Bacteria 1577
528 Ga0207703_11592464 3300026035 Bacteria 628
529 Ga0207639_10686114 3300026041 Bacteria 949
530 Ga0207678_10281895 3300026067 Bacteria 1426
531 Ga0207702_10003891 3300026078 Bacteria 13446
532 Ga0207702_10099606 3300026078 Bacteria 2562
533 Ga0207702_10192047 3300026078 Bacteria 1887
534 Ga0207702_10402290 3300026078 Unclassified 1321
535 Ga0207641_10117373 3300026088 Bacteria 2369
536 Ga0207641_10133800 3300026088 Bacteria 2229
537 Ga0207641_10380907 3300026088 Bacteria 1351
538 Ga0207641_10396554 3300026088 Bacteria 1324
539 Ga0207641_10407972 3300026088 Bacteria 1306
540 Ga0207641_10886666 3300026088 Bacteria 885
541 Ga0207648_10255398 3300026089 Bacteria 1563
542 Ga0207648_10515084 3300026089 Bacteria 1096
543 Ga0207676_10021890 3300026095 Bacteria 4695
544 Ga0207676_10088982 3300026095 Bacteria 2529
545 Ga0207676_10300111 3300026095 Unclassified 1466
546 Ga0207676_10630469 3300026095 Bacteria 1032
547 Ga0207674_10000503 3300026116 Bacteria 51625
548 Ga0207674_10006231 3300026116 Bacteria 14062
549 Ga0207674_10030990 3300026116 Bacteria 5621
550 Ga0207674_10910809 3300026116 Bacteria 847
551 Ga0207675_100312070 3300026118 Bacteria 1534
552 Ga0207683_10537273 3300026121 Unclassified 1081
553 Ga0207698_10018426 3300026142 Bacteria 4756
554 Ga0207698_10034709 3300026142 Bacteria 3680
555 Ga0207698_10060178 3300026142 Bacteria 2952
556 Ga0207698_10114346 3300026142 Bacteria 2270
557 Ga0207698_10287447 3300026142 Bacteria 1524
558 Ga0207698_10340733 3300026142 Bacteria 1412
559 Ga0207698_11557471 3300026142 Bacteria 676
560 Ga0209179_1014511 3300027512 Unclassified 1448
561 Ga0209588_1100648 3300027671 Unclassified 930
562 Ga0265356_1002962 3300028017 Bacteria 2180
563 Ga0268266_10041127 3300028379 Bacteria 3942
564 Ga0268266_10201693 3300028379 Bacteria 1821
565 Ga0268266_10760196 3300028379 Bacteria 935
566 Ga0268266_10800347 3300028379 Bacteria 910
567 Ga0268265_11332614 3300028380 Bacteria 718
568 Ga0268264_10019401 3300028381 Bacteria 5557
569 Ga0268264_10286867 3300028381 Bacteria 1544
570 Ga0268264_10394757 3300028381 Bacteria 1328
571 Ga0268264_11108183 3300028381 Bacteria 800
572 Ga0268264_11154766 3300028381 Bacteria 783
573 Ga0265319_1011603 3300028563 Bacteria 3598
574 Ga0265334_10051509 3300028573 Bacteria 1578
575 Ga0265318_10000903 3300028577 Bacteria 19347
576 Ga0265318_10019966 3300028577 Bacteria 2711
577 Ga0265338_10001726 3300028800 Bacteria 34591
578 Ga0265338_10134159 3300028800 Bacteria 1950
579 Ga0265338_10144552 3300028800 Bacteria 1857
580 Ga0265338_10151590 3300028800 Bacteria 1801
581 Ga0265338_10303457 3300028800 Bacteria 1160
582 Ga0265338_10844649 3300028800 Bacteria 626
583 Ga0265762_1000400 3300030760 Bacteria 7461
584 Ga0265762_1018852 3300030760 Bacteria 1261
585 Ga0265762_1040157 3300030760 Bacteria 914
586 Ga0265760_10000041 3300031090 Bacteria 38626
587 Ga0265760_10000559 3300031090 Bacteria 10558
588 Ga0265760_10022140 3300031090 Bacteria 1841
589 Ga0265330_10000309 3300031235 Bacteria 35085
590 Ga0265332_10017045 3300031238 Bacteria 3204
591 Ga0265332_10018234 3300031238 Bacteria 3096
592 Ga0265328_10000459 3300031239 Bacteria 18931
593 Ga0265328_10036973 3300031239 Bacteria 1804
594 Ga0265328_10241231 3300031239 Bacteria 691
595 Ga0265320_10000377 3300031240 Bacteria 36151
596 Ga0265325_10001117 3300031241 Bacteria 19238
597 Ga0265325_10001276 3300031241 Bacteria 17879
598 Ga0265325_10001493 3300031241 Bacteria 16453
599 Ga0265325_10010845 3300031241 Bacteria 5254
600 Ga0265329_10004080 3300031242 Bacteria 6201
601 Ga0265329_10007071 3300031242 Bacteria 4378
602 Ga0265340_10002780 3300031247 Bacteria 9977
603 Ga0265340_10003167 3300031247 Bacteria 9332
604 Ga0265340_10005849 3300031247 Bacteria 6808
605 Ga0265340_10072663 3300031247 Bacteria 1628
606 Ga0265339_10002243 3300031249 Bacteria 13971
607 Ga0265339_10311071 3300031249 Bacteria 749
608 Ga0265331_10000172 3300031250 Bacteria 79901
609 Ga0265331_10003170 3300031250 Bacteria 10739
610 Ga0265331_10010058 3300031250 Bacteria 5258
611 Ga0265331_10026789 3300031250 Bacteria 2895
612 Ga0265331_10319498 3300031250 Bacteria 695
613 Ga0265316_10008573 3300031344 Bacteria 9476
614 Ga0265316_10009890 3300031344 Bacteria 8739
615 Ga0265316_10017595 3300031344 Bacteria 6170
616 Ga0265316_10062871 3300031344 Bacteria 2880
617 Ga0265316_10080983 3300031344 Bacteria 2490
618 Ga0265316_10085222 3300031344 Bacteria 2418
619 Ga0265316_10089078 3300031344 Unclassified 2356
620 Ga0265316_10194680 3300031344 Bacteria 1505
621 Ga0265316_10768015 3300031344 Bacteria 677
622 Ga0307408_100084919 3300031548 Bacteria 2376
623 Ga0307408_100175524 3300031548 Bacteria 1714
624 Ga0265313_10001182 3300031595 Bacteria 24959
625 Ga0265313_10002130 3300031595 Bacteria 17606
626 Ga0265313_10011745 3300031595 Bacteria 5419
627 Ga0265313_10015469 3300031595 Bacteria 4438
628 Ga0265313_10044715 3300031595 Bacteria 2160
629 Ga0265313_10064095 3300031595 Unclassified 1711
630 Ga0316579_10001174 3300031691 Bacteria 9351
631 Ga0265314_10068052 3300031711 Bacteria 2395
632 Ga0265314_10209043 3300031711 Bacteria 1147
633 Ga0265342_10000656 3300031712 Bacteria 36240
634 Ga0265342_10003719 3300031712 Bacteria 12363
635 Ga0265342_10033651 3300031712 Bacteria 3149
636 Ga0265342_10358141 3300031712 Bacteria 759
637 Ga0307405_10207501 3300031731 Bacteria 1428
638 Ga0307405_10518736 3300031731 Bacteria 958
639 Ga0307405_11191993 3300031731 Bacteria 658
640 Ga0307405_11878028 3300031731 Bacteria 534
641 Ga0316577_10020360 3300031733 Bacteria 3677
642 Ga0316577_10027058 3300031733 Bacteria 3197
643 Ga0307413_10140699 3300031824 Bacteria 1667
644 Ga0307410_10141951 3300031852 Bacteria 1778
645 Ga0307410_10818173 3300031852 Bacteria 793
646 Ga0307406_10347719 3300031901 Bacteria 1157
647 Ga0307406_10353341 3300031901 Bacteria 1149
648 Ga0307406_10377665 3300031901 Bacteria 1116
649 Ga0307409_100018111 3300031995 Bacteria 4720
650 Ga0307409_100071986 3300031995 Bacteria 2751
651 Ga0307409_102040183 3300031995 Bacteria 603
652 Ga0307416_100007450 3300032002 Bacteria 6962
653 Ga0307416_100196894 3300032002 Bacteria 1907
654 Ga0307416_100841999 3300032002 Bacteria 1015
655 Ga0307414_11050554 3300032004 Bacteria 751
656 Ga0307411_10064166 3300032005 Bacteria 2458
657 Ga0307411_11390963 3300032005 Bacteria 642
658 Ga0307415_100074170 3300032126 Bacteria 2404
659 Ga0307415_100587581 3300032126 Bacteria 989
660 Ga0316214_1009595 3300033545 Bacteria 1307
661 Ga0373926_0076211 3300035083 Bacteria 1236
662 Ga0373926_0124657 3300035083 Bacteria 973
663 Ga0373934_0002250 3300035086 Bacteria 7092
664 Ga0373934_0155418 3300035086 Bacteria 938
665 Ga0373940_0340705 3300035088 Bacteria 524
666 Ga0373944_0049227 3300035089 Bacteria 1324
667 Ga0373923_0008415 3300035111 Bacteria 3677
668 Ga0373923_0031754 3300035111 Bacteria 2131
669 Ga0373936_0110959 3300035113 Bacteria 1165
670 Ga0373936_0565896 3300035113 Unclassified 532
671 Ga0373939_0506748 3300035114 Bacteria 516
672 Ga0373953_0023029 3300035117 Bacteria 2355
673 Ga0373953_0024283 3300035117 Bacteria 2304
674 Ga0373953_0146798 3300035117 Bacteria 1010
675 Ga0373954_0027337 3300035118 Bacteria 2617
676 Ga0373954_0142004 3300035118 Bacteria 1171
677 Ga0373954_0323345 3300035118 Bacteria 761
678 Ga0373954_0328195 3300035118 Bacteria 755
679 Ga0373954_0450630 3300035118 Bacteria 637
680 Ga0373956_0086971 3300035119 Bacteria 1439
681 Ga0373956_0091753 3300035119 Bacteria 1402
682 Ga0373956_0160498 3300035119 Bacteria 1059
683 Ga0373957_0083752 3300035120 Bacteria 1261
684 Ga0373957_0103022 3300035120 Bacteria 1144
685 Ga0373943_0022103 3300035170 Bacteria 2943
686 Ga0373943_0143454 3300035170 Bacteria 1288
687 Ga0373946_0064348 3300035171 Bacteria 1568
688 Ga0373946_0390571 3300035171 Unclassified 701
689 Ga0373955_0011709 3300035172 Bacteria 4191
690 Ga0373955_0055758 3300035172 Bacteria 2166
691 Ga0373955_0889383 3300035172 Bacteria 548
692 Ga0373924_0108121 3300035410 Bacteria 1200
693 Ga0373924_0227672 3300035410 Bacteria 824
694 Ga0373931_1012677 3300035691 Bacteria 562
695 Ga0373935_0003584 3300035692 Bacteria 9048
696 Ga0373935_0008083 3300035692 Bacteria 6308
697 Ga0373935_0283867 3300035692 Bacteria 1166
698 Ga0373927_0037285 3300035695 Bacteria 3160
699 Ga0373927_0060855 3300035695 Bacteria 2443
700 Ga0373927_0106683 3300035695 Bacteria 1824
701 Ga0373927_0108985 3300035695 Bacteria 1804
702 Ga0373927_0144335 3300035695 Bacteria 1557
703 Ga0373927_0595616 3300035695 Bacteria 731
704 Ga0373927_0895256 3300035695 Bacteria 586
705 Ga0373933_0102349 3300035724 Bacteria 1778
706 Ga0373933_0135705 3300035724 Bacteria 1550
707 Ga0373933_0292694 3300035724 Bacteria 1053
708 Ga0373933_0418514 3300035724 Bacteria 875
709 Ga0373933_0810115 3300035724 Bacteria 616
710 Ga0373947_0029255 3300035725 Bacteria 3232
711 Ga0373947_0113154 3300035725 Bacteria 1717
712 Ga0373947_0183384 3300035725 Bacteria 1363
713 Ga0373947_0724997 3300035725 Bacteria 678
714 Ga0373947_1119030 3300035725 Bacteria 537
715 Ga0373937_0007944 3300036401 Bacteria 9199
716 Ga0373937_0009922 3300036401 Bacteria 8304
717 Ga0373937_0037913 3300036401 Bacteria 4392
718 Ga0373937_0228267 3300036401 Bacteria 1753
719 Ga0373937_0230707 3300036401 Bacteria 1743
720 Ga0373937_0285448 3300036401 Bacteria 1559
721 Ga0373937_0395139 3300036401 Bacteria 1312
722 Ga0373937_0524726 3300036401 Bacteria 1125
723 Ga0373937_0535139 3300036401 Bacteria 1113
724 Ga0373937_0612959 3300036401 Bacteria 1033
725 Ga0373937_0792492 3300036401 Bacteria 895
726 Ga0316582_0059782 3300036647 Bacteria 2442
727 Ga0316584_0008958 3300036712 Bacteria 6921
728 Ga0373925_0021124 3300037068 Bacteria 4742
729 Ga0373925_0026119 3300037068 Bacteria 4271
730 Ga0373925_0116921 3300037068 Bacteria 2066
731 Ga0373925_0160186 3300037068 Bacteria 1772
732 Ga0373925_0933010 3300037068 Bacteria 715
733 Ga0373925_1086007 3300037068 Unclassified 658
734 Ga0395905_0784054 3300037471 Bacteria 856
735 Ga0316581_0002385 3300037588 Bacteria 4481
736 Ga0436364_0158068 3300037853 Bacteria 183638
737 Ga0436364_0571688 3300037853 Bacteria 1209
738 Ga0436364_1087871 3300037853 Unclassified 1246
739 Ga0436364_1520900 3300037853 Bacteria 798
740 Ga0395901_0731610 3300038443 Unclassified 984
741 Ga0395901_0972019 3300038443 Bacteria 827
742 Ga0395901_1208229 3300038443 Unclassified 722
743 Ga0237819_00257 3300038705 Bacteria 19467
744 Ga0436365_0186607 3300039437 Bacteria 3640
745 Ga0436365_1352977 3300039437 Bacteria 1840
746 Ga0436365_1526227 3300039437 Bacteria 678
747 Ga0436360_0070677 3300039438 Bacteria 603
748 Ga0436363_0599044 3300039450 Unclassified 653
749 Ga0436362_0687981 3300039453 Bacteria 1174
750 Ga0436362_0856096 3300039453 Bacteria 607
751 Ga0451577_0081828 3300042876 Bacteria 2880
752 Ga0453683_0002862 3300044673 Bacteria 13075
753 Ga0453683_0671371 3300044673 Bacteria 678
754 Ga0466963_0623049 3300044694 Bacteria 762
755 Ga0466963_0888651 3300044694 Bacteria 628
756 Ga0453684_0259977 3300044712 Bacteria 1989
757 Ga0453684_1031754 3300044712 Bacteria 873
758 Ga0453684_1365239 3300044712 Bacteria 736
759 Ga0453684_1708142 3300044712 Bacteria 643
760 Ga0466960_0036131 3300044901 Bacteria 2313
761 Ga0466959_0538338 3300045049 Bacteria 788
762 Ga0451576_0002253 3300045051 Bacteria 29502
763 Ga0451576_0201670 3300045051 Bacteria 2078
764 Ga0451576_0787145 3300045051 Bacteria 999
765 Ga0451576_0869872 3300045051 Bacteria 946
766 Ga0451576_1339674 3300045051 Bacteria 746
767 Ga0466958_0126509 3300045836 Bacteria 1603
768 Ga0466958_0284203 3300045836 Bacteria 1061
769 Ga0495592_0002480 3300046454 Bacteria 13039
770 Ga0495592_0059096 3300046454 Bacteria 2825
771 Ga0495592_0093255 3300046454 Bacteria 2157
772 Ga0495592_0130109 3300046454 Unclassified 1761
773 Ga0495629_0042327 3300046459 Bacteria 3201
774 Ga0495651_0000142 3300046462 Bacteria 53097
775 Ga0495651_0000738 3300046462 Bacteria 25273
776 Ga0495651_0044271 3300046462 Bacteria 3450
777 Ga0495651_0075485 3300046462 Bacteria 2555
778 Ga0495651_0409695 3300046462 Unclassified 883
779 Ga0495651_0680561 3300046462 Bacteria 643
780 Ga0495653_0037395 3300046463 Bacteria 3814
781 Ga0495653_0083279 3300046463 Unclassified 2359
782 Ga0495653_0092896 3300046463 Bacteria 2202
783 Ga0495580_0002963 3300046472 Bacteria 14577
784 Ga0495580_0008407 3300046472 Bacteria 8211
785 Ga0495580_0029238 3300046472 Bacteria 4000
786 Ga0495580_0059801 3300046472 Bacteria 2678
787 Ga0495580_0098411 3300046472 Bacteria 2034
788 Ga0495580_0142311 3300046472 Bacteria 1662
789 Ga0495580_0158267 3300046472 Bacteria 1568
790 Ga0495580_0180459 3300046472 Bacteria 1458
791 Ga0495580_0253995 3300046472 Bacteria 1203
792 Ga0495580_0347322 3300046472 Bacteria 1005
793 Ga0495582_0022635 3300046473 Bacteria 3439
794 Ga0495582_0047345 3300046473 Bacteria 2368
795 Ga0495582_0049298 3300046473 Bacteria 2318
796 Ga0495582_0384322 3300046473 Bacteria 809
797 Ga0495605_0174133 3300046474 Bacteria 949
798 Ga0495639_0018201 3300046475 Bacteria 3057
799 Ga0495639_0357164 3300046475 Bacteria 734
800 Ga0495662_0004202 3300046476 Bacteria 7250
801 Ga0495664_0005176 3300046477 Bacteria 7156
802 Ga0495664_0252071 3300046477 Unclassified 1067
803 Ga0495594_0249716 3300046499 Bacteria 1011
804 Ga0495608_0017477 3300046511 Bacteria 4961
805 Ga0495608_0120537 3300046511 Bacteria 1682
806 Ga0495608_0141550 3300046511 Bacteria 1535
807 Ga0495608_0436851 3300046511 Bacteria 797
808 Ga0495618_0080749 3300046514 Unclassified 2075
809 Ga0495618_0274557 3300046514 Bacteria 1053
810 Ga0495628_0002130 3300046516 Bacteria 17926
811 Ga0495628_0007182 3300046516 Bacteria 9646
812 Ga0495628_0034769 3300046516 Unclassified 4052
813 Ga0495628_0074490 3300046516 Unclassified 2644
814 Ga0495628_0083571 3300046516 Bacteria 2479
815 Ga0495628_0211930 3300046516 Bacteria 1457
816 Ga0495630_0015008 3300046517 Bacteria 5653
817 Ga0495630_0075176 3300046517 Bacteria 2545
818 Ga0495630_0100354 3300046517 Bacteria 2190
819 Ga0495630_0308867 3300046517 Bacteria 1209
820 Ga0495630_0332254 3300046517 Bacteria 1162
821 Ga0495630_0407230 3300046517 Bacteria 1042
822 Ga0495666_0158460 3300046526 Bacteria 1050
823 Ga0495666_0245043 3300046526 Bacteria 817
824 Ga0495652_0012085 3300046529 Bacteria 7801
825 Ga0495652_0024929 3300046529 Bacteria 5292
826 Ga0495652_0100355 3300046529 Bacteria 2348
827 Ga0495652_0280667 3300046529 Bacteria 1220
828 Ga0495652_0291215 3300046529 Bacteria 1191
829 Ga0495665_0006278 3300046531 Bacteria 6413
830 Ga0495665_0037083 3300046531 Bacteria 2602
831 Ga0495665_0124988 3300046531 Bacteria 1347
832 Ga0495665_0133494 3300046531 Bacteria 1299
833 Ga0495665_0234064 3300046531 Bacteria 948
834 Ga0495640_0003218 3300046533 Bacteria 13145
835 Ga0495640_0074856 3300046533 Bacteria 2262
836 Ga0495640_0080645 3300046533 Unclassified 2164
837 Ga0495586_0023205 3300046535 Bacteria 3312
838 Ga0495586_0035594 3300046535 Bacteria 2675
839 Ga0495586_0040405 3300046535 Bacteria 2509
840 Ga0495586_0106240 3300046535 Bacteria 1561
841 Ga0495586_0413981 3300046535 Bacteria 776
842 Ga0495586_0507531 3300046535 Bacteria 696
843 Ga0495587_0000996 3300046536 Bacteria 18607
844 Ga0495587_0003613 3300046536 Bacteria 10292
845 Ga0495587_0091141 3300046536 Bacteria 1761
846 Ga0495587_0129377 3300046536 Bacteria 1443
847 Ga0495587_0400088 3300046536 Bacteria 763
848 Ga0495645_0002230 3300046543 Bacteria 13177
849 Ga0495645_0024408 3300046543 Bacteria 4387
850 Ga0495645_0025394 3300046543 Bacteria 4299
851 Ga0495645_0062331 3300046543 Unclassified 2701
852 Ga0495645_0172413 3300046543 Bacteria 1488
853 Ga0495645_0465551 3300046543 Bacteria 795
854 Ga0495667_0003314 3300046559 Bacteria 10782
855 Ga0495667_0033012 3300046559 Bacteria 3464
856 Ga0495667_0035349 3300046559 Bacteria 3339
857 Ga0495667_0063785 3300046559 Bacteria 2411
858 Ga0495667_0106175 3300046559 Bacteria 1815
859 Ga0495667_0289784 3300046559 Bacteria 1038
860 Ga0495634_0048305 3300046642 Bacteria 2865
861 Ga0495634_0074553 3300046642 Bacteria 2230
862 Ga0495635_0016914 3300046663 Bacteria 5094
863 Ga0495635_0017033 3300046663 Bacteria 5075
864 Ga0495635_0029780 3300046663 Bacteria 3797
865 Ga0495635_0031085 3300046663 Bacteria 3709
866 Ga0495635_0167409 3300046663 Bacteria 1495
867 Ga0495657_0003623 3300046675 Bacteria 12548
868 Ga0495657_0015047 3300046675 Bacteria 5672
869 Ga0495657_0065767 3300046675 Bacteria 2383
870 Ga0495657_0567674 3300046675 Bacteria 658
871 Ga0495599_0002263 3300046678 Bacteria 11202
872 Ga0495599_0046531 3300046678 Unclassified 2720
873 Ga0495599_0109724 3300046678 Bacteria 1719
874 Ga0495599_0180169 3300046678 Bacteria 1303
875 Ga0495623_0021497 3300046679 Bacteria 4165
876 Ga0495623_0091130 3300046679 Bacteria 1871
877 Ga0495623_0159211 3300046679 Unclassified 1328
878 Ga0495623_0161333 3300046679 Bacteria 1317
879 Ga0495646_0017362 3300046680 Bacteria 4565
880 Ga0495646_0025074 3300046680 Bacteria 3751
881 Ga0495646_0258822 3300046680 Bacteria 930
882 Ga0495647_0083096 3300046681 Bacteria 1301
883 Ga0495658_0003568 3300046683 Bacteria 7702
884 Ga0495658_0142275 3300046683 Bacteria 1468
885 Ga0495658_0266131 3300046683 Bacteria 1080
886 Ga0495669_0018609 3300046684 Bacteria 2988
887 Ga0495613_0032585 3300046689 Bacteria 3872
888 Ga0495613_0177300 3300046689 Bacteria 1510
889 Ga0495613_0235283 3300046689 Bacteria 1282
890 Ga0495613_0352533 3300046689 Bacteria 1010
891 Ga0495613_0376786 3300046689 Bacteria 971
892 Ga0495624_0042733 3300046690 Bacteria 2896
893 Ga0495624_0094737 3300046690 Bacteria 1840
894 Ga0495600_0012117 3300046809 Bacteria 5385
895 Ga0495600_0055361 3300046809 Unclassified 2590
896 Ga0495600_0145311 3300046809 Unclassified 1537
897 Ga0495600_0295832 3300046809 Bacteria 1022
898 Ga0495600_0487623 3300046809 Bacteria 759
899 Ga0495581_0081687 3300047315 Bacteria 1871
900 Ga0495581_0196616 3300047315 Bacteria 1180
901 Ga0495581_0283140 3300047315 Bacteria 969
902 Ga0495604_0003773 3300047317 Bacteria 12062
903 Ga0495604_0015747 3300047317 Bacteria 6035
904 Ga0495604_0025833 3300047317 Bacteria 4677
905 Ga0495604_0039876 3300047317 Unclassified 3690
906 Ga0495604_0049716 3300047317 Bacteria 3256
907 Ga0495604_0084045 3300047317 Bacteria 2378
908 Ga0495604_0148503 3300047317 Unclassified 1668
909 Ga0495604_0326320 3300047317 Bacteria 1025
910 Ga0495604_0797201 3300047317 Bacteria 595
911 Ga0495674_0043126 3300047319 Bacteria 4017
912 Ga0495674_0087120 3300047319 Bacteria 2673
913 Ga0495674_0128153 3300047319 Bacteria 2139
914 Ga0495674_0231324 3300047319 Bacteria 1526
915 Ga0495674_0256992 3300047319 Bacteria 1436
916 Ga0495674_0333042 3300047319 Bacteria 1235
917 Ga0495674_0506097 3300047319 Bacteria 966
918 Ga0495676_0195790 3300047321 Bacteria 1407
919 Ga0495680_0001389 3300047322 Bacteria 26131
920 Ga0495680_0006947 3300047322 Bacteria 10447
921 Ga0495680_0063404 3300047322 Bacteria 2838
922 Ga0495680_0299778 3300047322 Unclassified 1129
923 Ga0495680_0312475 3300047322 Bacteria 1101
924 Ga0495680_0569469 3300047322 Bacteria 761
925 Ga0495675_0000027 3300047444 Bacteria 106917
926 Ga0495675_0036543 3300047444 Bacteria 3132
927 Ga0495675_0084867 3300047444 Bacteria 1992
928 Ga0495675_0108337 3300047444 Unclassified 1735
929 Ga0495675_0138227 3300047444 Bacteria 1511
930 Ga0495675_0198097 3300047444 Bacteria 1223
931 Ga0495675_0283664 3300047444 Bacteria 987
932 Ga0495675_0288185 3300047444 Bacteria 978
933 Ga0495684_0001664 3300047471 Bacteria 17850
934 Ga0495684_0027070 3300047471 Bacteria 4403
935 Ga0495684_0032393 3300047471 Bacteria 4013
936 Ga0495684_0048348 3300047471 Bacteria 3253
937 Ga0495684_0061294 3300047471 Bacteria 2862
938 Ga0495684_0215853 3300047471 Bacteria 1408
939 Ga0495684_0298357 3300047471 Bacteria 1158
940 Ga0495684_0361400 3300047471 Bacteria 1028
941 Ga0495684_0497824 3300047471 Unclassified 838
942 Ga0495684_0578425 3300047471 Bacteria 761
943 Ga0495684_0948637 3300047471 Bacteria 550
944 Ga0495593_0029583 3300047673 Bacteria 3002
945 Ga0495602_0016267 3300048088 Bacteria 7484
946 Ga0495602_0117354 3300048088 Bacteria 2148
947 Ga0495602_0205128 3300048088 Bacteria 1501
948 Ga0495602_0571575 3300048088 Bacteria 781
949 Ga0495614_0030737 3300048089 Bacteria 2312
950 Ga0495614_0470925 3300048089 Bacteria 596
951 Ga0496100_0266033 3300048903 Bacteria 1273
952 Ga0496101_0050632 3300048904 Bacteria 2991
953 Ga0496101_0124707 3300048904 Bacteria 1951
954 Ga0496101_0753187 3300048904 Bacteria 769
955 Ga0496102_0001855 3300048905 Bacteria 18206
956 Ga0496102_0015217 3300048905 Bacteria 6698
957 Ga0496102_0789944 3300048905 Unclassified 872
958 Ga0496102_0791297 3300048905 Bacteria 871
959 Ga0496103_0325240 3300048906 Bacteria 989
960 Ga0496104_0048814 3300048907 Bacteria 3991
961 Ga0496104_0096337 3300048907 Bacteria 2831
962 Ga0496104_0242959 3300048907 Unclassified 1713
963 Ga0496104_0257788 3300048907 Bacteria 1657
964 Ga0496104_0377146 3300048907 Bacteria 1331
965 Ga0496104_0573247 3300048907 Bacteria 1039
966 Ga0496104_0794308 3300048907 Bacteria 853
967 Ga0496105_0017445 3300048908 Bacteria 5757
968 Ga0496105_0240473 3300048908 Bacteria 1469
969 Ga0496106_0062226 3300048909 Bacteria 2833
970 Ga0496106_0878594 3300048909 Bacteria 709
971 Ga0496107_0049551 3300048910 Bacteria 3027
972 Ga0496107_0260138 3300048910 Bacteria 1291
973 Ga0496107_1066918 3300048910 Bacteria 584
974 Ga0496108_0000023 3300048911 Bacteria 186204
975 Ga0496108_0064034 3300048911 Bacteria 3097
976 Ga0496109_0007044 3300048912 Bacteria 9487
977 Ga0496109_0020189 3300048912 Bacteria 5885
978 Ga0496109_0039058 3300048912 Bacteria 4295
979 Ga0496109_0563195 3300048912 Bacteria 1075
980 Ga0496109_0900171 3300048912 Unclassified 823
981 Ga0496109_1187295 3300048912 Bacteria 700
982 Ga0496110_0089341 3300048913 Bacteria 2754
983 Ga0496110_0110333 3300048913 Bacteria 2472
984 Ga0496110_0239470 3300048913 Bacteria 1651
985 Ga0496110_0337326 3300048913 Bacteria 1373
986 Ga0496110_0864357 3300048913 Bacteria 810
987 Ga0496111_0039135 3300048914 Bacteria 3399
988 Ga0496111_0948661 3300048914 Bacteria 618
989 Ga0496112_0018511 3300048915 Bacteria 6558
990 Ga0496112_0051649 3300048915 Bacteria 4032
991 Ga0496112_0087811 3300048915 Bacteria 3077
992 Ga0496113_0003630 3300048916 Bacteria 9273
993 Ga0496113_0008760 3300048916 Bacteria 6607
994 Ga0496113_1222332 3300048916 Bacteria 586
995 Ga0496114_0083288 3300048917 Bacteria 2706
996 Ga0496115_0003887 3300048918 Bacteria 10768
997 Ga0496115_0009647 3300048918 Bacteria 7183
998 Ga0496115_0065104 3300048918 Bacteria 2944
999 Ga0496115_0102547 3300048918 Bacteria 2347
1000 Ga0496115_0141122 3300048918 Bacteria 1988
1001 Ga0496115_1468003 3300048918 Unclassified 501
1002 Ga0496119_0083333 3300048922 Bacteria 1837
1003 Ga0496126_0035643 3300048929 Bacteria 4661
1004 Ga0496126_0997129 3300048929 Bacteria 629
1005 Ga0501040_0159936 3300049576 Bacteria 1592
1006 Ga0501040_0623311 3300049576 Bacteria 779
1007 Ga0501041_0092465 3300049577 Bacteria 1868
1008 Ga0501042_0086739 3300049578 Bacteria 2245
1009 Ga0501046_0542766 3300049580 Bacteria 829
1010 Ga0501048_0291263 3300049582 Bacteria 1161
1011 Ga0501070_0904588 3300049586 Bacteria 688
1012 Ga0501071_0006921 3300049587 Bacteria 7398
1013 Ga0501075_0230192 3300049591 Bacteria 1413
1014 Ga0501076_0322278 3300049592 Bacteria 1267
1015 Ga0501209_285722 3300049656 Bacteria 518
1016 Ga0501216_070093 3300049660 Bacteria 723
1017 Ga0501233_256974 3300049668 Unclassified 527
1018 Ga0501253_053429 3300049683 Unclassified 853
1019 Ga0501257_085556 3300049686 Unclassified 816
1020 Ga0501079_0067835 3300049741 Bacteria 2753
1021 Ga0501045_0434668 3300049824 Bacteria 976
1022 nmdc:mga05p37_1761964_c1 3300050507 Bacteria 600
1023 nmdc:mga05p37_2027_c1 3300050507 Bacteria 23615
1024 nmdc:mga05p37_471620_c1 3300050507 Bacteria 1448
1025 nmdc:mga05p37_515768_c1 3300050507 Bacteria 1368
1026 nmdc:mga05p37_607564_c1 3300050507 Bacteria 1233
1027 nmdc:mga05p37_627276_c1 3300050507 Bacteria 1208
1028 nmdc:mga05p37_719617_c1 3300050507 Bacteria 1106
1029 nmdc:mga05p37_814509_c1 3300050507 Bacteria 1019
1030 nmdc:mga0qj67_250611_c1 3300050509 Bacteria 1437
1031 nmdc:mga0qj67_49405_c1 3300050509 Unclassified 3325
1032 nmdc:mga06r32_199346_c1 3300050510 Bacteria 1989
1033 nmdc:mga06r32_208987_c1 3300050510 Bacteria 1940
1034 nmdc:mga06r32_303317_c1 3300050510 Bacteria 1583
1035 nmdc:mga0n895_27838_c1 3300050512 Bacteria 5372
1036 nmdc:mga0n895_533000_c1 3300050512 Bacteria 1181
1037 nmdc:mga0n895_86741_c1 3300050512 Bacteria 3127
1038 nmdc:mga0rr50_120778_c1 3300050513 Bacteria 2085
1039 nmdc:mga0rr50_31205_c1 3300050513 Bacteria 3782
1040 nmdc:mga08x19_950244_c1 3300050514 Bacteria 611
1041 nmdc:mga0a205_11560_c1 3300050515 Bacteria 8132
1042 nmdc:mga0a205_240459_c1 3300050515 Bacteria 1691
1043 nmdc:mga0a205_56593_c1 3300050515 Bacteria 3786
1044 nmdc:mga0a205_795089_c1 3300050515 Bacteria 794
1045 Ga0495601_0486419 3300053077 Unclassified 797
1046 Ga0495612_0032801 3300053078 Bacteria 2099
1047 Ga0495612_0386941 3300053078 Bacteria 634
1048 Ga0495619_0016662 3300053085 Bacteria 4650
1049 Ga0495619_0707732 3300053085 Bacteria 685
1050 Ga0495619_0849292 3300053085 Bacteria 616
1051 Ga0495619_1025648 3300053085 Bacteria 551
1052 Ga0500577_0013890 3300053142 Bacteria 2474
1053 Ga0501084_0023317 3300054114 Bacteria 5167
1054 Ga0501084_1188506 3300054114 Bacteria 640
1055 Ga0530510_0129790 3300061734 Bacteria 1854

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046526 Ga0495666_0158460 Ga0495666_0158460_583_1008 118
2 3300005327 Ga0070658_10112111 Ga0070658_101121112 122
3 3300005337 Ga0070682_100115730 Ga0070682_1001157302 122
4 3300005548 Ga0070665_100031655 Ga0070665_1000316556 122
5 3300026067 Ga0207678_10281895 Ga0207678_102818953 122
6 3300028379 Ga0268266_10041127 Ga0268266_100411275 122
7 3300048903 Ga0496100_0266033 Ga0496100_0266033_43_480 122
8 3300048918 Ga0496115_0009647 Ga0496115_0009647_6705_7142 122
9 3300009176 Ga0105242_10543449 Ga0105242_105434491 126
10 3300050507 nmdc:mga05p37_814509_c1 nmdc:mga05p37_814509_c1_597_992 127
11 3300039437 Ga0436365_1526227 Ga0436365_1526227_23_448 130
12 3300005339 Ga0070660_100221281 Ga0070660_1002212811 133
13 3300005437 Ga0070710_10360148 Ga0070710_103601481 133
14 3300009545 Ga0105237_10171538 Ga0105237_101715382 133
15 3300009551 Ga0105238_10238950 Ga0105238_102389502 133
16 3300013105 Ga0157369_10032835 Ga0157369_100328357 133
17 3300013296 Ga0157374_10039582 Ga0157374_100395826 133
18 3300014325 Ga0163163_10034711 Ga0163163_100347117 133
19 3300014969 Ga0157376_10003293 Ga0157376_100032938 133
20 3300025904 Ga0207647_10019106 Ga0207647_100191065 133
21 3300048904 Ga0496101_0050632 Ga0496101_0050632_2420_2911 133
22 3300048905 Ga0496102_0015217 Ga0496102_0015217_5205_5696 133
23 3300048906 Ga0496103_0325240 Ga0496103_0325240_79_570 133
24 3300048907 Ga0496104_0048814 Ga0496104_0048814_1708_2199 133
25 3300048908 Ga0496105_0017445 Ga0496105_0017445_206_697 133
26 3300048912 Ga0496109_0007044 Ga0496109_0007044_6574_7065 133
27 3300048913 Ga0496110_0337326 Ga0496110_0337326_563_1054 133
28 3300048914 Ga0496111_0039135 Ga0496111_0039135_332_823 133
29 3300048915 Ga0496112_0018511 Ga0496112_0018511_4914_5405 133
30 3300048916 Ga0496113_0003630 Ga0496113_0003630_1229_1720 133
31 3300048922 Ga0496119_0083333 Ga0496119_0083333_1297_1788 133
32 3300048929 Ga0496126_0997129 Ga0496126_0997129_75_557 133
33 3300005434 Ga0070709_10098765 Ga0070709_100987652 134
34 3300005439 Ga0070711_100750712 Ga0070711_1007507121 134
35 3300006173 Ga0070716_100431208 Ga0070716_1004312082 134
36 3300005434 Ga0070709_10432040 Ga0070709_104320402 136
37 3300036401 Ga0373937_0612959 Ga0373937_0612959_380_865 136
38 3300046473 Ga0495582_0047345 Ga0495582_0047345_610_1095 136
39 3300046517 Ga0495630_0308867 Ga0495630_0308867_90_575 136
40 3300046689 Ga0495613_0032585 Ga0495613_0032585_3024_3509 136
41 3300047444 Ga0495675_0283664 Ga0495675_0283664_83_568 136
42 3300005468 Ga0070707_101804062 Ga0070707_1018040621 137
43 3300005841 Ga0068863_100382531 Ga0068863_1003825312 137
44 3300010375 Ga0105239_12232423 Ga0105239_122324232 137
45 3300025916 Ga0207663_10312894 Ga0207663_103128942 137
46 3300026142 Ga0207698_10340733 Ga0207698_103407332 137
47 3300032002 Ga0307416_100841999 Ga0307416_1008419992 137
48 3300032126 Ga0307415_100074170 Ga0307415_1000741703 137
49 3300035118 Ga0373954_0328195 Ga0373954_0328195_289_732 137
50 3300039437 Ga0436365_0186607 Ga0436365_0186607_1917_2363 137
51 3300048912 Ga0496109_0039058 Ga0496109_0039058_2809_3276 137
52 3300048913 Ga0496110_0864357 Ga0496110_0864357_85_552 137
53 3300048914 Ga0496111_0948661 Ga0496111_0948661_109_576 137
54 3300049586 Ga0501070_0904588 Ga0501070_0904588_40_495 137
55 3300005367 Ga0070667_100126251 Ga0070667_1001262512 138
56 3300005841 Ga0068863_100453238 Ga0068863_1004532382 138
57 3300005843 Ga0068860_100199313 Ga0068860_1001993132 138
58 3300007788 Ga0099795_10037425 Ga0099795_100374251 138
59 3300009177 Ga0105248_10023999 Ga0105248_100239995 138
60 3300025900 Ga0207710_10029613 Ga0207710_100296133 138
61 3300025906 Ga0207699_10061227 Ga0207699_100612272 138
62 3300025914 Ga0207671_11099217 Ga0207671_110992171 138
63 3300025939 Ga0207665_10482390 Ga0207665_104823902 138
64 3300025961 Ga0207712_10139261 Ga0207712_101392611 138
65 3300025972 Ga0207668_10075779 Ga0207668_100757793 138
66 3300025986 Ga0207658_10869976 Ga0207658_108699761 138
67 3300026035 Ga0207703_10256979 Ga0207703_102569792 138
68 3300026089 Ga0207648_10255398 Ga0207648_102553981 138
69 3300028380 Ga0268265_11332614 Ga0268265_113326142 138
70 3300028381 Ga0268264_10019401 Ga0268264_100194014 138
71 3300046663 Ga0495635_0167409 Ga0495635_0167409_550_1080 138
72 3300005344 Ga0070661_100746171 Ga0070661_1007461712 139
73 3300005434 Ga0070709_10017253 Ga0070709_100172534 139
74 3300005436 Ga0070713_100037923 Ga0070713_1000379234 139
75 3300005436 Ga0070713_100194876 Ga0070713_1001948761 139
76 3300005563 Ga0068855_100632267 Ga0068855_1006322672 139
77 3300005616 Ga0068852_100017342 Ga0068852_1000173428 139
78 3300006028 Ga0070717_10029546 Ga0070717_100295463 139
79 3300009147 Ga0114129_10000566 Ga0114129_1000056640 139
80 3300009147 Ga0114129_10046469 Ga0114129_100464697 139
81 3300009147 Ga0114129_10309270 Ga0114129_103092703 139
82 3300009147 Ga0114129_10656859 Ga0114129_106568592 139
83 3300010159 Ga0099796_10172497 Ga0099796_101724972 139
84 3300014969 Ga0157376_10117350 Ga0157376_101173501 139
85 3300014969 Ga0157376_10523703 Ga0157376_105237032 139
86 3300021358 Ga0213873_10256813 Ga0213873_102568131 139
87 3300025904 Ga0207647_10668597 Ga0207647_106685971 139
88 3300025912 Ga0207707_10000372 Ga0207707_1000037210 139
89 3300025913 Ga0207695_10000563 Ga0207695_1000056339 139
90 3300025921 Ga0207652_10008525 Ga0207652_1000852510 139
91 3300025924 Ga0207694_10002271 Ga0207694_1000227118 139
92 3300025927 Ga0207687_10032204 Ga0207687_100322042 139
93 3300025928 Ga0207700_11082883 Ga0207700_110828831 139
94 3300025949 Ga0207667_10001746 Ga0207667_1000174617 139
95 3300026041 Ga0207639_10686114 Ga0207639_106861142 139
96 3300026078 Ga0207702_10003891 Ga0207702_1000389112 139
97 3300026116 Ga0207674_10000503 Ga0207674_1000050347 139
98 3300031595 Ga0265313_10064095 Ga0265313_100640952 139
99 3300035088 Ga0373940_0340705 Ga0373940_0340705_56_481 139
100 3300035113 Ga0373936_0565896 Ga0373936_0565896_76_510 139
101 3300035114 Ga0373939_0506748 Ga0373939_0506748_26_451 139
102 3300035172 Ga0373955_0889383 Ga0373955_0889383_22_453 139
103 3300035724 Ga0373933_0810115 Ga0373933_0810115_164_598 139
104 3300046499 Ga0495594_0249716 Ga0495594_0249716_39_473 139
105 3300046516 Ga0495628_0074490 Ga0495628_0074490_98_556 139
106 3300046517 Ga0495630_0015008 Ga0495630_0015008_3808_4281 139
107 3300046683 Ga0495658_0003568 Ga0495658_0003568_4201_4626 139
108 3300046689 Ga0495613_0235283 Ga0495613_0235283_829_1263 139
109 3300047317 Ga0495604_0025833 Ga0495604_0025833_1607_2065 139
110 3300047319 Ga0495674_0231324 Ga0495674_0231324_496_969 139
111 3300047322 Ga0495680_0299778 Ga0495680_0299778_304_762 139
112 3300047444 Ga0495675_0084867 Ga0495675_0084867_1451_1924 139
113 3300047471 Ga0495684_0948637 Ga0495684_0948637_17_451 139
114 3300048907 Ga0496104_0242959 Ga0496104_0242959_558_992 139
115 3300048918 Ga0496115_1468003 Ga0496115_1468003_22_447 139
116 3300050507 nmdc:mga05p37_2027_c1 nmdc:mga05p37_2027_c1_20536_20967 139
117 3300050507 nmdc:mga05p37_627276_c1 nmdc:mga05p37_627276_c1_263_688 139
118 3300050507 nmdc:mga05p37_719617_c1 nmdc:mga05p37_719617_c1_77_508 139
119 3300050510 nmdc:mga06r32_303317_c1 nmdc:mga06r32_303317_c1_373_804 139
120 3300050512 nmdc:mga0n895_27838_c1 nmdc:mga0n895_27838_c1_4662_5093 139
121 3300050512 nmdc:mga0n895_533000_c1 nmdc:mga0n895_533000_c1_38_463 139
122 3300050512 nmdc:mga0n895_86741_c1 nmdc:mga0n895_86741_c1_932_1363 139
123 3300050513 nmdc:mga0rr50_120778_c1 nmdc:mga0rr50_120778_c1_1392_1823 139
124 3300050513 nmdc:mga0rr50_31205_c1 nmdc:mga0rr50_31205_c1_233_664 139
125 3300050515 nmdc:mga0a205_56593_c1 nmdc:mga0a205_56593_c1_2040_2471 139
126 3300050515 nmdc:mga0a205_795089_c1 nmdc:mga0a205_795089_c1_184_615 139
127 3300053077 Ga0495601_0486419 Ga0495601_0486419_112_570 139
128 3300053085 Ga0495619_0016662 Ga0495619_0016662_2762_3220 139
129 3300053085 Ga0495619_0849292 Ga0495619_0849292_17_448 139
130 3300005445 Ga0070708_100031899 Ga0070708_1000318992 140
131 3300039450 Ga0436363_0599044 Ga0436363_0599044_72_554 140
132 3300005340 Ga0070689_100637155 Ga0070689_1006371551 141
133 3300009147 Ga0114129_10363515 Ga0114129_103635152 141
134 3300009176 Ga0105242_10423348 Ga0105242_104233482 141
135 3300035691 Ga0373931_1012677 Ga0373931_1012677_25_459 141
136 3300035725 Ga0373947_0183384 Ga0373947_0183384_870_1313 141
137 3300048912 Ga0496109_0563195 Ga0496109_0563195_611_1048 141
138 3300049576 Ga0501040_0159936 Ga0501040_0159936_187_612 141
139 3300049591 Ga0501075_0230192 Ga0501075_0230192_507_932 141
140 3300049656 Ga0501209_285722 Ga0501209_285722_73_498 141
141 3300050507 nmdc:mga05p37_471620_c1 nmdc:mga05p37_471620_c1_983_1420 141
142 3300054114 Ga0501084_1188506 Ga0501084_1188506_19_444 141
143 3300031241 Ga0265325_10001493 Ga0265325_100014934 143
144 3300032005 Ga0307411_11390963 Ga0307411_113909631 143
145 3300005331 Ga0070670_100204356 Ga0070670_1002043562 144
146 3300025925 Ga0207650_10221852 Ga0207650_102218522 144
147 3300044673 Ga0453683_0002862 Ga0453683_0002862_8920_9387 144
148 3300048911 Ga0496108_0000023 Ga0496108_0000023_143375_143854 144
149 3300050515 nmdc:mga0a205_11560_c1 nmdc:mga0a205_11560_c1_6811_7290 144
150 3300009148 Ga0105243_11877135 Ga0105243_118771352 146
151 3300009177 Ga0105248_10517493 Ga0105248_105174932 146
152 3300013306 Ga0163162_10434440 Ga0163162_104344402 146
153 3300014969 Ga0157376_10541897 Ga0157376_105418972 146
154 3300048910 Ga0496107_1066918 Ga0496107_1066918_115_567 146
155 3300048917 Ga0496114_0083288 Ga0496114_0083288_1762_2214 146
156 3300005327 Ga0070658_10088066 Ga0070658_100880662 148
157 3300005327 Ga0070658_10995641 Ga0070658_109956412 148
158 3300005329 Ga0070683_100000051 Ga0070683_10000005135 148
159 3300005329 Ga0070683_100013688 Ga0070683_1000136883 148
160 3300005329 Ga0070683_100034270 Ga0070683_1000342705 148
161 3300005329 Ga0070683_100061409 Ga0070683_1000614092 148
162 3300005329 Ga0070683_100398021 Ga0070683_1003980212 148
163 3300005329 Ga0070683_100480833 Ga0070683_1004808332 148
164 3300005331 Ga0070670_100995684 Ga0070670_1009956841 148
165 3300005331 Ga0070670_101629465 Ga0070670_1016294651 148
166 3300005333 Ga0070677_10461993 Ga0070677_104619932 148
167 3300005334 Ga0068869_100010065 Ga0068869_1000100653 148
168 3300005335 Ga0070666_10133786 Ga0070666_101337862 148
169 3300005336 Ga0070680_100143936 Ga0070680_1001439363 148
170 3300005336 Ga0070680_100952131 Ga0070680_1009521311 148
171 3300005337 Ga0070682_100104446 Ga0070682_1001044462 148
172 3300005338 Ga0068868_100695108 Ga0068868_1006951082 148
173 3300005339 Ga0070660_100036846 Ga0070660_1000368462 148
174 3300005339 Ga0070660_100349242 Ga0070660_1003492422 148
175 3300005345 Ga0070692_10059267 Ga0070692_100592673 148
176 3300005345 Ga0070692_10097797 Ga0070692_100977972 148
177 3300005366 Ga0070659_100641206 Ga0070659_1006412061 148
178 3300005367 Ga0070667_100201538 Ga0070667_1002015381 148
179 3300005367 Ga0070667_101124904 Ga0070667_1011249042 148
180 3300005367 Ga0070667_101137263 Ga0070667_1011372631 148
181 3300005435 Ga0070714_100000386 Ga0070714_10000038611 148
182 3300005435 Ga0070714_100760365 Ga0070714_1007603652 148
183 3300005436 Ga0070713_100078111 Ga0070713_1000781112 148
184 3300005436 Ga0070713_100099516 Ga0070713_1000995162 148
185 3300005436 Ga0070713_100171742 Ga0070713_1001717422 148
186 3300005437 Ga0070710_10015779 Ga0070710_100157794 148
187 3300005437 Ga0070710_10452193 Ga0070710_104521932 148
188 3300005439 Ga0070711_100186534 Ga0070711_1001865343 148
189 3300005439 Ga0070711_100971110 Ga0070711_1009711102 148
190 3300005444 Ga0070694_100647108 Ga0070694_1006471082 148
191 3300005456 Ga0070678_100059833 Ga0070678_1000598332 148
192 3300005457 Ga0070662_100196739 Ga0070662_1001967392 148
193 3300005458 Ga0070681_10002652 Ga0070681_1000265212 148
194 3300005458 Ga0070681_10019182 Ga0070681_100191822 148
195 3300005459 Ga0068867_100508755 Ga0068867_1005087552 148
196 3300005467 Ga0070706_100252976 Ga0070706_1002529762 148
197 3300005467 Ga0070706_101061849 Ga0070706_1010618492 148
198 3300005467 Ga0070706_101385274 Ga0070706_1013852741 148
199 3300005518 Ga0070699_100022533 Ga0070699_1000225337 148
200 3300005518 Ga0070699_100761183 Ga0070699_1007611832 148
201 3300005530 Ga0070679_100017372 Ga0070679_1000173727 148
202 3300005535 Ga0070684_100000061 Ga0070684_10000006150 148
203 3300005535 Ga0070684_100028501 Ga0070684_1000285012 148
204 3300005535 Ga0070684_100072418 Ga0070684_1000724184 148
205 3300005535 Ga0070684_100210882 Ga0070684_1002108822 148
206 3300005535 Ga0070684_100706194 Ga0070684_1007061941 148
207 3300005535 Ga0070684_100731726 Ga0070684_1007317262 148
208 3300005536 Ga0070697_100443508 Ga0070697_1004435082 148
209 3300005536 Ga0070697_100630723 Ga0070697_1006307232 148
210 3300005543 Ga0070672_100614830 Ga0070672_1006148302 148
211 3300005547 Ga0070693_100208695 Ga0070693_1002086952 148
212 3300005547 Ga0070693_100399839 Ga0070693_1003998392 148
213 3300005548 Ga0070665_100443090 Ga0070665_1004430902 148
214 3300005548 Ga0070665_100671817 Ga0070665_1006718172 148
215 3300005563 Ga0068855_100001633 Ga0068855_1000016335 148
216 3300005563 Ga0068855_100007832 Ga0068855_1000078325 148
217 3300005563 Ga0068855_100031981 Ga0068855_1000319812 148
218 3300005563 Ga0068855_100163150 Ga0068855_1001631503 148
219 3300005563 Ga0068855_100251190 Ga0068855_1002511903 148
220 3300005563 Ga0068855_100274674 Ga0068855_1002746742 148
221 3300005564 Ga0070664_100466001 Ga0070664_1004660012 148
222 3300005564 Ga0070664_101141143 Ga0070664_1011411431 148
223 3300005577 Ga0068857_100061655 Ga0068857_1000616553 148
224 3300005577 Ga0068857_100238329 Ga0068857_1002383292 148
225 3300005578 Ga0068854_100121973 Ga0068854_1001219733 148
226 3300005614 Ga0068856_100097875 Ga0068856_1000978752 148
227 3300005614 Ga0068856_100203541 Ga0068856_1002035411 148
228 3300005614 Ga0068856_100754273 Ga0068856_1007542732 148
229 3300005614 Ga0068856_101111460 Ga0068856_1011114601 148
230 3300005616 Ga0068852_100031322 Ga0068852_1000313222 148
231 3300005616 Ga0068852_100184359 Ga0068852_1001843592 148
232 3300005616 Ga0068852_100295873 Ga0068852_1002958732 148
233 3300005616 Ga0068852_100350099 Ga0068852_1003500992 148
234 3300005617 Ga0068859_100140769 Ga0068859_1001407693 148
235 3300005617 Ga0068859_101030168 Ga0068859_1010301681 148
236 3300005617 Ga0068859_101567583 Ga0068859_1015675831 148
237 3300005618 Ga0068864_100052484 Ga0068864_1000524843 148
238 3300005841 Ga0068863_100019220 Ga0068863_1000192202 148
239 3300005841 Ga0068863_100523876 Ga0068863_1005238762 148
240 3300005841 Ga0068863_100613615 Ga0068863_1006136152 148
241 3300005841 Ga0068863_101864038 Ga0068863_1018640382 148
242 3300005842 Ga0068858_100013721 Ga0068858_1000137213 148
243 3300005842 Ga0068858_100239136 Ga0068858_1002391362 148
244 3300005842 Ga0068858_100482312 Ga0068858_1004823122 148
245 3300005843 Ga0068860_100356335 Ga0068860_1003563352 148
246 3300005843 Ga0068860_101123432 Ga0068860_1011234322 148
247 3300005985 Ga0081539_10017275 Ga0081539_100172755 148
248 3300006028 Ga0070717_10027358 Ga0070717_100273582 148
249 3300006028 Ga0070717_10137100 Ga0070717_101371003 148
250 3300006028 Ga0070717_10305381 Ga0070717_103053811 148
251 3300006028 Ga0070717_10547250 Ga0070717_105472502 148
252 3300006163 Ga0070715_10180463 Ga0070715_101804632 148
253 3300006175 Ga0070712_100093528 Ga0070712_1000935283 148
254 3300006237 Ga0097621_100030891 Ga0097621_1000308913 148
255 3300006237 Ga0097621_100107956 Ga0097621_1001079562 148
256 3300006237 Ga0097621_100219441 Ga0097621_1002194413 148
257 3300006237 Ga0097621_100398349 Ga0097621_1003983492 148
258 3300006237 Ga0097621_100438368 Ga0097621_1004383683 148
259 3300006237 Ga0097621_100972286 Ga0097621_1009722862 148
260 3300006358 Ga0068871_100129353 Ga0068871_1001293532 148
261 3300006358 Ga0068871_100355858 Ga0068871_1003558582 148
262 3300006358 Ga0068871_100607311 Ga0068871_1006073112 148
263 3300006358 Ga0068871_100620271 Ga0068871_1006202712 148
264 3300006358 Ga0068871_101036766 Ga0068871_1010367662 148
265 3300006358 Ga0068871_101179144 Ga0068871_1011791442 148
266 3300006846 Ga0075430_100036376 Ga0075430_1000363762 148
267 3300006846 Ga0075430_100055664 Ga0075430_1000556642 148
268 3300006847 Ga0075431_100022732 Ga0075431_1000227322 148
269 3300006880 Ga0075429_101281910 Ga0075429_1012819102 148
270 3300006881 Ga0068865_101363481 Ga0068865_1013634812 148
271 3300006914 Ga0075436_100335292 Ga0075436_1003352921 148
272 3300006931 Ga0097620_100140775 Ga0097620_1001407753 148
273 3300006931 Ga0097620_100747232 Ga0097620_1007472322 148
274 3300006931 Ga0097620_101030339 Ga0097620_1010303391 148
275 3300006931 Ga0097620_101567370 Ga0097620_1015673701 148
276 3300009036 Ga0105244_10324366 Ga0105244_103243662 148
277 3300009093 Ga0105240_10003450 Ga0105240_100034509 148
278 3300009093 Ga0105240_10006166 Ga0105240_1000616615 148
279 3300009093 Ga0105240_10017854 Ga0105240_100178545 148
280 3300009093 Ga0105240_10023379 Ga0105240_100233796 148
281 3300009093 Ga0105240_10129063 Ga0105240_101290633 148
282 3300009093 Ga0105240_10144007 Ga0105240_101440075 148
283 3300009093 Ga0105240_10354356 Ga0105240_103543562 148
284 3300009093 Ga0105240_10433926 Ga0105240_104339262 148
285 3300009093 Ga0105240_11124324 Ga0105240_111243241 148
286 3300009093 Ga0105240_11611121 Ga0105240_116111211 148
287 3300009098 Ga0105245_10005590 Ga0105245_1000559011 148
288 3300009098 Ga0105245_10011857 Ga0105245_100118578 148
289 3300009098 Ga0105245_10042372 Ga0105245_100423723 148
290 3300009098 Ga0105245_10155998 Ga0105245_101559982 148
291 3300009098 Ga0105245_10543839 Ga0105245_105438392 148
292 3300009098 Ga0105245_10632212 Ga0105245_106322122 148
293 3300009147 Ga0114129_10404112 Ga0114129_104041122 148
294 3300009147 Ga0114129_11198739 Ga0114129_111987392 148
295 3300009147 Ga0114129_11344621 Ga0114129_113446212 148
296 3300009147 Ga0114129_12365488 Ga0114129_123654882 148
297 3300009148 Ga0105243_10052143 Ga0105243_100521434 148
298 3300009148 Ga0105243_10146361 Ga0105243_101463612 148
299 3300009148 Ga0105243_10670369 Ga0105243_106703692 148
300 3300009148 Ga0105243_10672856 Ga0105243_106728561 148
301 3300009148 Ga0105243_11507300 Ga0105243_115073002 148
302 3300009174 Ga0105241_10051974 Ga0105241_100519743 148
303 3300009174 Ga0105241_10053332 Ga0105241_100533322 148
304 3300009174 Ga0105241_10326102 Ga0105241_103261022 148
305 3300009174 Ga0105241_10980062 Ga0105241_109800622 148
306 3300009174 Ga0105241_11055750 Ga0105241_110557501 148
307 3300009176 Ga0105242_10027196 Ga0105242_100271963 148
308 3300009176 Ga0105242_10058237 Ga0105242_100582373 148
309 3300009176 Ga0105242_10115850 Ga0105242_101158503 148
310 3300009176 Ga0105242_10349641 Ga0105242_103496411 148
311 3300009177 Ga0105248_10031143 Ga0105248_100311434 148
312 3300009177 Ga0105248_10070780 Ga0105248_100707803 148
313 3300009177 Ga0105248_10482909 Ga0105248_104829092 148
314 3300009177 Ga0105248_10483744 Ga0105248_104837443 148
315 3300009177 Ga0105248_11101824 Ga0105248_111018242 148
316 3300009177 Ga0105248_11324386 Ga0105248_113243862 148
317 3300009177 Ga0105248_11496530 Ga0105248_114965302 148
318 3300009177 Ga0105248_11931346 Ga0105248_119313461 148
319 3300009545 Ga0105237_10040373 Ga0105237_100403733 148
320 3300009545 Ga0105237_10167903 Ga0105237_101679033 148
321 3300009545 Ga0105237_10419516 Ga0105237_104195162 148
322 3300009545 Ga0105237_11529735 Ga0105237_115297351 148
323 3300009551 Ga0105238_10006344 Ga0105238_100063449 148
324 3300009551 Ga0105238_10065643 Ga0105238_100656432 148
325 3300009551 Ga0105238_11250008 Ga0105238_112500082 148
326 3300009551 Ga0105238_11599246 Ga0105238_115992462 148
327 3300009553 Ga0105249_10017122 Ga0105249_100171228 148
328 3300009553 Ga0105249_10192926 Ga0105249_101929263 148
329 3300010375 Ga0105239_10015915 Ga0105239_100159155 148
330 3300010375 Ga0105239_10623751 Ga0105239_106237512 148
331 3300011119 Ga0105246_10001137 Ga0105246_1000113718 148
332 3300011119 Ga0105246_10566344 Ga0105246_105663442 148
333 3300011119 Ga0105246_10671886 Ga0105246_106718862 148
334 3300013100 Ga0157373_10199304 Ga0157373_101993041 148
335 3300013104 Ga0157370_10002104 Ga0157370_100021042 148
336 3300013104 Ga0157370_10002904 Ga0157370_1000290418 148
337 3300013104 Ga0157370_10048458 Ga0157370_100484582 148
338 3300013104 Ga0157370_10100651 Ga0157370_101006511 148
339 3300013104 Ga0157370_10305475 Ga0157370_103054752 148
340 3300013104 Ga0157370_10630246 Ga0157370_106302462 148
341 3300013105 Ga0157369_10012050 Ga0157369_100120508 148
342 3300013105 Ga0157369_10103620 Ga0157369_101036203 148
343 3300013105 Ga0157369_10180313 Ga0157369_101803132 148
344 3300013105 Ga0157369_10437218 Ga0157369_104372182 148
345 3300013105 Ga0157369_10620925 Ga0157369_106209252 148
346 3300013296 Ga0157374_10007004 Ga0157374_100070046 148
347 3300013296 Ga0157374_10339973 Ga0157374_103399732 148
348 3300013296 Ga0157374_10561612 Ga0157374_105616122 148
349 3300013296 Ga0157374_10789436 Ga0157374_107894361 148
350 3300013297 Ga0157378_10068265 Ga0157378_100682654 148
351 3300013297 Ga0157378_10073479 Ga0157378_100734792 148
352 3300013297 Ga0157378_10314026 Ga0157378_103140263 148
353 3300013297 Ga0157378_11075671 Ga0157378_110756711 148
354 3300013306 Ga0163162_10008346 Ga0163162_1000834610 148
355 3300013306 Ga0163162_10919549 Ga0163162_109195492 148
356 3300013306 Ga0163162_11011700 Ga0163162_110117002 148
357 3300013306 Ga0163162_11074274 Ga0163162_110742742 148
358 3300013306 Ga0163162_11885102 Ga0163162_118851022 148
359 3300013306 Ga0163162_13107852 Ga0163162_131078521 148
360 3300013307 Ga0157372_10003606 Ga0157372_1000360615 148
361 3300013307 Ga0157372_10050104 Ga0157372_100501044 148
362 3300013307 Ga0157372_10064369 Ga0157372_100643693 148
363 3300013307 Ga0157372_10231714 Ga0157372_102317143 148
364 3300013307 Ga0157372_10382822 Ga0157372_103828222 148
365 3300013307 Ga0157372_11981606 Ga0157372_119816062 148
366 3300013308 Ga0157375_10081896 Ga0157375_100818965 148
367 3300013308 Ga0157375_10107742 Ga0157375_101077422 148
368 3300013308 Ga0157375_10169992 Ga0157375_101699922 148
369 3300013308 Ga0157375_10495081 Ga0157375_104950812 148
370 3300013308 Ga0157375_10785054 Ga0157375_107850542 148
371 3300013308 Ga0157375_11285747 Ga0157375_112857472 148
372 3300014325 Ga0163163_10002295 Ga0163163_100022959 148
373 3300014325 Ga0163163_10003230 Ga0163163_100032307 148
374 3300014325 Ga0163163_10004829 Ga0163163_100048296 148
375 3300014325 Ga0163163_10243325 Ga0163163_102433252 148
376 3300014325 Ga0163163_10305347 Ga0163163_103053472 148
377 3300014326 Ga0157380_10062307 Ga0157380_100623072 148
378 3300014326 Ga0157380_11305197 Ga0157380_113051972 148
379 3300014968 Ga0157379_10157363 Ga0157379_101573632 148
380 3300014969 Ga0157376_10254880 Ga0157376_102548803 148
381 3300014969 Ga0157376_10623391 Ga0157376_106233912 148
382 3300014969 Ga0157376_10689816 Ga0157376_106898162 148
383 3300017792 Ga0163161_10565009 Ga0163161_105650092 148
384 3300021358 Ga0213873_10039413 Ga0213873_100394132 148
385 3300021388 Ga0213875_10000018 Ga0213875_10000018101 148
386 3300022730 Ga0224570_100985 Ga0224570_1009852 148
387 3300022732 Ga0224569_101568 Ga0224569_1015682 148
388 3300024227 Ga0228598_1004693 Ga0228598_10046932 148
389 3300025898 Ga0207692_10151189 Ga0207692_101511892 148
390 3300025903 Ga0207680_10452008 Ga0207680_104520081 148
391 3300025903 Ga0207680_10527558 Ga0207680_105275582 148
392 3300025904 Ga0207647_10061055 Ga0207647_100610552 148
393 3300025905 Ga0207685_10189209 Ga0207685_101892092 148
394 3300025906 Ga0207699_10072937 Ga0207699_100729373 148
395 3300025906 Ga0207699_10421337 Ga0207699_104213372 148
396 3300025909 Ga0207705_10043214 Ga0207705_100432142 148
397 3300025909 Ga0207705_10080686 Ga0207705_100806863 148
398 3300025911 Ga0207654_10049076 Ga0207654_100490764 148
399 3300025912 Ga0207707_10043965 Ga0207707_100439654 148
400 3300025912 Ga0207707_10124030 Ga0207707_101240303 148
401 3300025912 Ga0207707_10186868 Ga0207707_101868682 148
402 3300025912 Ga0207707_10270942 Ga0207707_102709422 148
403 3300025912 Ga0207707_11374722 Ga0207707_113747221 148
404 3300025913 Ga0207695_10002828 Ga0207695_100028285 148
405 3300025913 Ga0207695_10004561 Ga0207695_1000456115 148
406 3300025913 Ga0207695_10005869 Ga0207695_100058692 148
407 3300025913 Ga0207695_10029367 Ga0207695_100293674 148
408 3300025913 Ga0207695_10163408 Ga0207695_101634082 148
409 3300025913 Ga0207695_10169270 Ga0207695_101692702 148
410 3300025913 Ga0207695_10404729 Ga0207695_104047292 148
411 3300025915 Ga0207693_10347722 Ga0207693_103477222 148
412 3300025916 Ga0207663_10028977 Ga0207663_100289774 148
413 3300025917 Ga0207660_10607649 Ga0207660_106076492 148
414 3300025919 Ga0207657_10001386 Ga0207657_1000138610 148
415 3300025921 Ga0207652_10260215 Ga0207652_102602152 148
416 3300025924 Ga0207694_10388546 Ga0207694_103885462 148
417 3300025924 Ga0207694_10666481 Ga0207694_106664812 148
418 3300025924 Ga0207694_11235810 Ga0207694_112358101 148
419 3300025925 Ga0207650_11469098 Ga0207650_114690981 148
420 3300025927 Ga0207687_10006608 Ga0207687_100066088 148
421 3300025927 Ga0207687_10017134 Ga0207687_100171345 148
422 3300025927 Ga0207687_10073163 Ga0207687_100731633 148
423 3300025927 Ga0207687_10208403 Ga0207687_102084032 148
424 3300025927 Ga0207687_10255761 Ga0207687_102557612 148
425 3300025927 Ga0207687_10578533 Ga0207687_105785332 148
426 3300025928 Ga0207700_10001086 Ga0207700_100010862 148
427 3300025928 Ga0207700_10140970 Ga0207700_101409703 148
428 3300025928 Ga0207700_10282479 Ga0207700_102824791 148
429 3300025928 Ga0207700_10394656 Ga0207700_103946562 148
430 3300025928 Ga0207700_10728654 Ga0207700_107286542 148
431 3300025929 Ga0207664_10000741 Ga0207664_100007419 148
432 3300025932 Ga0207690_10503493 Ga0207690_105034932 148
433 3300025934 Ga0207686_10015151 Ga0207686_100151513 148
434 3300025934 Ga0207686_10271205 Ga0207686_102712052 148
435 3300025934 Ga0207686_10734616 Ga0207686_107346162 148
436 3300025935 Ga0207709_10138972 Ga0207709_101389721 148
437 3300025935 Ga0207709_10156996 Ga0207709_101569962 148
438 3300025938 Ga0207704_11642725 Ga0207704_116427251 148
439 3300025939 Ga0207665_10085002 Ga0207665_100850023 148
440 3300025939 Ga0207665_10485751 Ga0207665_104857512 148
441 3300025941 Ga0207711_10065883 Ga0207711_100658832 148
442 3300025941 Ga0207711_10105464 Ga0207711_101054642 148
443 3300025942 Ga0207689_10173908 Ga0207689_101739083 148
444 3300025942 Ga0207689_10491664 Ga0207689_104916642 148
445 3300025944 Ga0207661_10000046 Ga0207661_1000004653 148
446 3300025944 Ga0207661_10125524 Ga0207661_101255242 148
447 3300025944 Ga0207661_10448291 Ga0207661_104482912 148
448 3300025945 Ga0207679_10707655 Ga0207679_107076552 148
449 3300025945 Ga0207679_11146759 Ga0207679_111467592 148
450 3300025949 Ga0207667_10001186 Ga0207667_100011865 148
451 3300025949 Ga0207667_10015440 Ga0207667_100154406 148
452 3300025949 Ga0207667_10068619 Ga0207667_100686193 148
453 3300025949 Ga0207667_10081919 Ga0207667_100819192 148
454 3300025949 Ga0207667_10098288 Ga0207667_100982885 148
455 3300025949 Ga0207667_10119246 Ga0207667_101192462 148
456 3300025949 Ga0207667_10224153 Ga0207667_102241532 148
457 3300026023 Ga0207677_10995387 Ga0207677_109953872 148
458 3300026035 Ga0207703_10103455 Ga0207703_101034552 148
459 3300026035 Ga0207703_10235098 Ga0207703_102350982 148
460 3300026035 Ga0207703_11592464 Ga0207703_115924642 148
461 3300026078 Ga0207702_10099606 Ga0207702_100996063 148
462 3300026078 Ga0207702_10192047 Ga0207702_101920472 148
463 3300026078 Ga0207702_10402290 Ga0207702_104022901 148
464 3300026088 Ga0207641_10117373 Ga0207641_101173732 148
465 3300026088 Ga0207641_10380907 Ga0207641_103809072 148
466 3300026088 Ga0207641_10396554 Ga0207641_103965543 148
467 3300026088 Ga0207641_10407972 Ga0207641_104079723 148
468 3300026089 Ga0207648_10515084 Ga0207648_105150842 148
469 3300026095 Ga0207676_10088982 Ga0207676_100889822 148
470 3300026095 Ga0207676_10300111 Ga0207676_103001112 148
471 3300026116 Ga0207674_10006231 Ga0207674_1000623113 148
472 3300026116 Ga0207674_10030990 Ga0207674_100309907 148
473 3300026116 Ga0207674_10910809 Ga0207674_109108092 148
474 3300026142 Ga0207698_10034709 Ga0207698_100347094 148
475 3300026142 Ga0207698_10114346 Ga0207698_101143462 148
476 3300026142 Ga0207698_10287447 Ga0207698_102874472 148
477 3300026142 Ga0207698_11557471 Ga0207698_115574712 148
478 3300028017 Ga0265356_1002962 Ga0265356_10029622 148
479 3300028379 Ga0268266_10201693 Ga0268266_102016932 148
480 3300028379 Ga0268266_10760196 Ga0268266_107601962 148
481 3300028379 Ga0268266_10800347 Ga0268266_108003471 148
482 3300028381 Ga0268264_10394757 Ga0268264_103947572 148
483 3300028381 Ga0268264_11108183 Ga0268264_111081832 148
484 3300028381 Ga0268264_11154766 Ga0268264_111547662 148
485 3300028573 Ga0265334_10051509 Ga0265334_100515092 148
486 3300028577 Ga0265318_10019966 Ga0265318_100199663 148
487 3300028800 Ga0265338_10001726 Ga0265338_1000172620 148
488 3300028800 Ga0265338_10144552 Ga0265338_101445521 148
489 3300028800 Ga0265338_10303457 Ga0265338_103034572 148
490 3300028800 Ga0265338_10844649 Ga0265338_108446492 148
491 3300030760 Ga0265762_1000400 Ga0265762_10004002 148
492 3300031090 Ga0265760_10000559 Ga0265760_1000055910 148
493 3300031235 Ga0265330_10000309 Ga0265330_1000030923 148
494 3300031238 Ga0265332_10017045 Ga0265332_100170453 148
495 3300031238 Ga0265332_10018234 Ga0265332_100182342 148
496 3300031239 Ga0265328_10000459 Ga0265328_100004599 148
497 3300031239 Ga0265328_10036973 Ga0265328_100369732 148
498 3300031241 Ga0265325_10001117 Ga0265325_100011175 148
499 3300031241 Ga0265325_10001276 Ga0265325_100012764 148
500 3300031242 Ga0265329_10007071 Ga0265329_100070713 148
501 3300031247 Ga0265340_10002780 Ga0265340_100027802 148
502 3300031247 Ga0265340_10005849 Ga0265340_100058494 148
503 3300031247 Ga0265340_10072663 Ga0265340_100726631 148
504 3300031249 Ga0265339_10002243 Ga0265339_100022433 148
505 3300031250 Ga0265331_10003170 Ga0265331_100031702 148
506 3300031250 Ga0265331_10026789 Ga0265331_100267892 148
507 3300031250 Ga0265331_10319498 Ga0265331_103194982 148
508 3300031344 Ga0265316_10017595 Ga0265316_100175954 148
509 3300031344 Ga0265316_10062871 Ga0265316_100628715 148
510 3300031344 Ga0265316_10080983 Ga0265316_100809831 148
511 3300031344 Ga0265316_10085222 Ga0265316_100852221 148
512 3300031344 Ga0265316_10194680 Ga0265316_101946803 148
513 3300031344 Ga0265316_10768015 Ga0265316_107680151 148
514 3300031595 Ga0265313_10001182 Ga0265313_1000118220 148
515 3300031595 Ga0265313_10011745 Ga0265313_100117458 148
516 3300031595 Ga0265313_10015469 Ga0265313_100154691 148
517 3300031595 Ga0265313_10044715 Ga0265313_100447151 148
518 3300031711 Ga0265314_10068052 Ga0265314_100680523 148
519 3300031712 Ga0265342_10003719 Ga0265342_1000371910 148
520 3300031712 Ga0265342_10033651 Ga0265342_100336512 148
521 3300031712 Ga0265342_10358141 Ga0265342_103581411 148
522 3300031901 Ga0307406_10347719 Ga0307406_103477192 148
523 3300031995 Ga0307409_100071986 Ga0307409_1000719863 148
524 3300031995 Ga0307409_102040183 Ga0307409_1020401831 148
525 3300032126 Ga0307415_100587581 Ga0307415_1005875812 148
526 3300033545 Ga0316214_1009595 Ga0316214_10095952 148
527 3300035083 Ga0373926_0124657 Ga0373926_0124657_111_578 148
528 3300035086 Ga0373934_0002250 Ga0373934_0002250_4297_4758 148
529 3300035086 Ga0373934_0155418 Ga0373934_0155418_302_769 148
530 3300035089 Ga0373944_0049227 Ga0373944_0049227_425_889 148
531 3300035111 Ga0373923_0031754 Ga0373923_0031754_521_982 148
532 3300035117 Ga0373953_0024283 Ga0373953_0024283_341_838 148
533 3300035118 Ga0373954_0027337 Ga0373954_0027337_795_1256 148
534 3300035118 Ga0373954_0323345 Ga0373954_0323345_17_514 148
535 3300035118 Ga0373954_0450630 Ga0373954_0450630_116_580 148
536 3300035119 Ga0373956_0086971 Ga0373956_0086971_356_817 148
537 3300035119 Ga0373956_0160498 Ga0373956_0160498_456_953 148
538 3300035120 Ga0373957_0083752 Ga0373957_0083752_519_980 148
539 3300035120 Ga0373957_0103022 Ga0373957_0103022_533_1030 148
540 3300035170 Ga0373943_0143454 Ga0373943_0143454_284_748 148
541 3300035172 Ga0373955_0011709 Ga0373955_0011709_1753_2214 148
542 3300035692 Ga0373935_0008083 Ga0373935_0008083_1964_2428 148
543 3300035692 Ga0373935_0283867 Ga0373935_0283867_637_1104 148
544 3300035695 Ga0373927_0060855 Ga0373927_0060855_1393_1860 148
545 3300035695 Ga0373927_0108985 Ga0373927_0108985_832_1296 148
546 3300035695 Ga0373927_0144335 Ga0373927_0144335_49_510 148
547 3300035695 Ga0373927_0895256 Ga0373927_0895256_66_569 148
548 3300035724 Ga0373933_0135705 Ga0373933_0135705_293_754 148
549 3300035724 Ga0373933_0292694 Ga0373933_0292694_155_658 148
550 3300035724 Ga0373933_0418514 Ga0373933_0418514_53_538 148
551 3300035725 Ga0373947_0113154 Ga0373947_0113154_359_823 148
552 3300035725 Ga0373947_0724997 Ga0373947_0724997_84_545 148
553 3300035725 Ga0373947_1119030 Ga0373947_1119030_43_507 148
554 3300036401 Ga0373937_0009922 Ga0373937_0009922_4349_4816 148
555 3300036401 Ga0373937_0037913 Ga0373937_0037913_1583_2044 148
556 3300036401 Ga0373937_0285448 Ga0373937_0285448_227_712 148
557 3300036401 Ga0373937_0395139 Ga0373937_0395139_660_1121 148
558 3300036401 Ga0373937_0524726 Ga0373937_0524726_322_783 148
559 3300036401 Ga0373937_0535139 Ga0373937_0535139_264_755 148
560 3300037068 Ga0373925_0026119 Ga0373925_0026119_1465_1929 148
561 3300037068 Ga0373925_0116921 Ga0373925_0116921_796_1260 148
562 3300037068 Ga0373925_0933010 Ga0373925_0933010_214_693 148
563 3300037471 Ga0395905_0784054 Ga0395905_0784054_76_564 148
564 3300037853 Ga0436364_0158068 Ga0436364_0158068_118659_119135 148
565 3300037853 Ga0436364_0571688 Ga0436364_0571688_334_795 148
566 3300037853 Ga0436364_1087871 Ga0436364_1087871_138_617 148
567 3300037853 Ga0436364_1520900 Ga0436364_1520900_192_695 148
568 3300038443 Ga0395901_0731610 Ga0395901_0731610_400_882 148
569 3300038443 Ga0395901_0972019 Ga0395901_0972019_99_578 148
570 3300038443 Ga0395901_1208229 Ga0395901_1208229_230_712 148
571 3300039437 Ga0436365_1352977 Ga0436365_1352977_809_1288 148
572 3300039453 Ga0436362_0687981 Ga0436362_0687981_522_983 148
573 3300042876 Ga0451577_0081828 Ga0451577_0081828_1085_1555 148
574 3300044694 Ga0466963_0623049 Ga0466963_0623049_48_512 148
575 3300044694 Ga0466963_0888651 Ga0466963_0888651_13_483 148
576 3300044712 Ga0453684_0259977 Ga0453684_0259977_985_1455 148
577 3300044712 Ga0453684_1031754 Ga0453684_1031754_60_530 148
578 3300044712 Ga0453684_1365239 Ga0453684_1365239_77_580 148
579 3300044712 Ga0453684_1708142 Ga0453684_1708142_109_588 148
580 3300044901 Ga0466960_0036131 Ga0466960_0036131_451_933 148
581 3300045049 Ga0466959_0538338 Ga0466959_0538338_174_650 148
582 3300045051 Ga0451576_0201670 Ga0451576_0201670_156_629 148
583 3300045051 Ga0451576_0787145 Ga0451576_0787145_431_907 148
584 3300045051 Ga0451576_0869872 Ga0451576_0869872_306_785 148
585 3300045051 Ga0451576_1339674 Ga0451576_1339674_82_555 148
586 3300045836 Ga0466958_0126509 Ga0466958_0126509_79_585 148
587 3300045836 Ga0466958_0284203 Ga0466958_0284203_534_1010 148
588 3300046454 Ga0495592_0002480 Ga0495592_0002480_3364_3849 148
589 3300046454 Ga0495592_0059096 Ga0495592_0059096_209_670 148
590 3300046462 Ga0495651_0075485 Ga0495651_0075485_685_1170 148
591 3300046462 Ga0495651_0409695 Ga0495651_0409695_127_588 148
592 3300046462 Ga0495651_0680561 Ga0495651_0680561_25_507 148
593 3300046463 Ga0495653_0092896 Ga0495653_0092896_1348_1833 148
594 3300046472 Ga0495580_0008407 Ga0495580_0008407_4915_5385 148
595 3300046472 Ga0495580_0059801 Ga0495580_0059801_1958_2422 148
596 3300046472 Ga0495580_0098411 Ga0495580_0098411_1008_1469 148
597 3300046472 Ga0495580_0142311 Ga0495580_0142311_292_795 148
598 3300046472 Ga0495580_0158267 Ga0495580_0158267_394_876 148
599 3300046472 Ga0495580_0180459 Ga0495580_0180459_342_809 148
600 3300046472 Ga0495580_0253995 Ga0495580_0253995_600_1076 148
601 3300046472 Ga0495580_0347322 Ga0495580_0347322_182_643 148
602 3300046473 Ga0495582_0022635 Ga0495582_0022635_186_689 148
603 3300046473 Ga0495582_0049298 Ga0495582_0049298_71_532 148
604 3300046473 Ga0495582_0384322 Ga0495582_0384322_296_760 148
605 3300046475 Ga0495639_0018201 Ga0495639_0018201_2386_2889 148
606 3300046475 Ga0495639_0357164 Ga0495639_0357164_231_692 148
607 3300046476 Ga0495662_0004202 Ga0495662_0004202_481_966 148
608 3300046477 Ga0495664_0005176 Ga0495664_0005176_208_693 148
609 3300046511 Ga0495608_0141550 Ga0495608_0141550_644_1105 148
610 3300046511 Ga0495608_0436851 Ga0495608_0436851_230_715 148
611 3300046516 Ga0495628_0007182 Ga0495628_0007182_1853_2338 148
612 3300046517 Ga0495630_0100354 Ga0495630_0100354_113_595 148
613 3300046526 Ga0495666_0245043 Ga0495666_0245043_311_775 148
614 3300046529 Ga0495652_0024929 Ga0495652_0024929_3881_4366 148
615 3300046529 Ga0495652_0280667 Ga0495652_0280667_312_773 148
616 3300046531 Ga0495665_0037083 Ga0495665_0037083_571_1035 148
617 3300046531 Ga0495665_0124988 Ga0495665_0124988_233_709 148
618 3300046531 Ga0495665_0133494 Ga0495665_0133494_156_641 148
619 3300046531 Ga0495665_0234064 Ga0495665_0234064_429_932 148
620 3300046533 Ga0495640_0003218 Ga0495640_0003218_6100_6585 148
621 3300046535 Ga0495586_0040405 Ga0495586_0040405_1421_1882 148
622 3300046535 Ga0495586_0106240 Ga0495586_0106240_455_958 148
623 3300046535 Ga0495586_0413981 Ga0495586_0413981_286_747 148
624 3300046535 Ga0495586_0507531 Ga0495586_0507531_30_491 148
625 3300046536 Ga0495587_0003613 Ga0495587_0003613_6768_7229 148
626 3300046536 Ga0495587_0129377 Ga0495587_0129377_880_1365 148
627 3300046543 Ga0495645_0002230 Ga0495645_0002230_11079_11564 148
628 3300046543 Ga0495645_0172413 Ga0495645_0172413_447_926 148
629 3300046543 Ga0495645_0465551 Ga0495645_0465551_295_756 148
630 3300046559 Ga0495667_0035349 Ga0495667_0035349_1987_2472 148
631 3300046559 Ga0495667_0289784 Ga0495667_0289784_66_569 148
632 3300046642 Ga0495634_0048305 Ga0495634_0048305_1880_2365 148
633 3300046663 Ga0495635_0017033 Ga0495635_0017033_2146_2649 148
634 3300046663 Ga0495635_0029780 Ga0495635_0029780_2381_2866 148
635 3300046675 Ga0495657_0567674 Ga0495657_0567674_43_546 148
636 3300046678 Ga0495599_0002263 Ga0495599_0002263_3259_3744 148
637 3300046679 Ga0495623_0091130 Ga0495623_0091130_765_1226 148
638 3300046679 Ga0495623_0161333 Ga0495623_0161333_677_1162 148
639 3300046680 Ga0495646_0017362 Ga0495646_0017362_1979_2464 148
640 3300046680 Ga0495646_0258822 Ga0495646_0258822_351_812 148
641 3300046683 Ga0495658_0142275 Ga0495658_0142275_365_829 148
642 3300046683 Ga0495658_0266131 Ga0495658_0266131_244_741 148
643 3300046684 Ga0495669_0018609 Ga0495669_0018609_1852_2355 148
644 3300046689 Ga0495613_0376786 Ga0495613_0376786_243_704 148
645 3300046690 Ga0495624_0042733 Ga0495624_0042733_734_1198 148
646 3300046809 Ga0495600_0012117 Ga0495600_0012117_3760_4245 148
647 3300046809 Ga0495600_0295832 Ga0495600_0295832_464_967 148
648 3300047315 Ga0495581_0081687 Ga0495581_0081687_645_1148 148
649 3300047315 Ga0495581_0283140 Ga0495581_0283140_47_511 148
650 3300047317 Ga0495604_0049716 Ga0495604_0049716_2327_2812 148
651 3300047317 Ga0495604_0084045 Ga0495604_0084045_756_1229 148
652 3300047317 Ga0495604_0326320 Ga0495604_0326320_415_876 148
653 3300047319 Ga0495674_0087120 Ga0495674_0087120_758_1240 148
654 3300047319 Ga0495674_0256992 Ga0495674_0256992_528_989 148
655 3300047322 Ga0495680_0569469 Ga0495680_0569469_204_665 148
656 3300047444 Ga0495675_0036543 Ga0495675_0036543_826_1311 148
657 3300047444 Ga0495675_0288185 Ga0495675_0288185_455_958 148
658 3300047471 Ga0495684_0027070 Ga0495684_0027070_1634_2095 148
659 3300047471 Ga0495684_0061294 Ga0495684_0061294_2355_2819 148
660 3300047471 Ga0495684_0215853 Ga0495684_0215853_856_1341 148
661 3300047471 Ga0495684_0298357 Ga0495684_0298357_146_616 148
662 3300047471 Ga0495684_0497824 Ga0495684_0497824_295_756 148
663 3300047471 Ga0495684_0578425 Ga0495684_0578425_12_491 148
664 3300048088 Ga0495602_0016267 Ga0495602_0016267_4429_4890 148
665 3300048088 Ga0495602_0205128 Ga0495602_0205128_91_576 148
666 3300048088 Ga0495602_0571575 Ga0495602_0571575_199_681 148
667 3300048905 Ga0496102_0791297 Ga0496102_0791297_390_860 148
668 3300048907 Ga0496104_0257788 Ga0496104_0257788_881_1384 148
669 3300048907 Ga0496104_0377146 Ga0496104_0377146_194_658 148
670 3300048907 Ga0496104_0573247 Ga0496104_0573247_14_475 148
671 3300048908 Ga0496105_0240473 Ga0496105_0240473_627_1130 148
672 3300048909 Ga0496106_0878594 Ga0496106_0878594_192_653 148
673 3300048910 Ga0496107_0260138 Ga0496107_0260138_566_1069 148
674 3300048911 Ga0496108_0064034 Ga0496108_0064034_1415_1918 148
675 3300048912 Ga0496109_0020189 Ga0496109_0020189_4736_5239 148
676 3300048912 Ga0496109_0900171 Ga0496109_0900171_235_726 148
677 3300048912 Ga0496109_1187295 Ga0496109_1187295_111_575 148
678 3300048913 Ga0496110_0239470 Ga0496110_0239470_579_1082 148
679 3300048915 Ga0496112_0051649 Ga0496112_0051649_490_993 148
680 3300048916 Ga0496113_0008760 Ga0496113_0008760_4700_5203 148
681 3300048916 Ga0496113_1222332 Ga0496113_1222332_82_546 148
682 3300048918 Ga0496115_0065104 Ga0496115_0065104_46_534 148
683 3300048918 Ga0496115_0102547 Ga0496115_0102547_508_1011 148
684 3300048918 Ga0496115_0141122 Ga0496115_0141122_146_607 148
685 3300048929 Ga0496126_0035643 Ga0496126_0035643_2748_3224 148
686 3300049660 Ga0501216_070093 Ga0501216_070093_58_546 148
687 3300049668 Ga0501233_256974 Ga0501233_256974_11_478 148
688 3300049683 Ga0501253_053429 Ga0501253_053429_347_814 148
689 3300049686 Ga0501257_085556 Ga0501257_085556_305_772 148
690 3300050507 nmdc:mga05p37_1761964_c1 nmdc:mga05p37_1761964_c1_95_577 148
691 3300050507 nmdc:mga05p37_515768_c1 nmdc:mga05p37_515768_c1_858_1322 148
692 3300050509 nmdc:mga0qj67_250611_c1 nmdc:mga0qj67_250611_c1_898_1386 148
693 3300050509 nmdc:mga0qj67_49405_c1 nmdc:mga0qj67_49405_c1_245_706 148
694 3300050510 nmdc:mga06r32_208987_c1 nmdc:mga06r32_208987_c1_95_559 148
695 3300050514 nmdc:mga08x19_950244_c1 nmdc:mga08x19_950244_c1_88_561 148
696 3300053078 Ga0495612_0386941 Ga0495612_0386941_11_475 148
697 3300053085 Ga0495619_1025648 Ga0495619_1025648_16_480 148
698 3300005293 Ga0065715_10529869 Ga0065715_105298692 149
699 3300005329 Ga0070683_100527741 Ga0070683_1005277412 149
700 3300005334 Ga0068869_100300870 Ga0068869_1003008702 149
701 3300005337 Ga0070682_100646689 Ga0070682_1006466891 149
702 3300005338 Ga0068868_100270331 Ga0068868_1002703312 149
703 3300005347 Ga0070668_100599076 Ga0070668_1005990762 149
704 3300005355 Ga0070671_100110263 Ga0070671_1001102631 149
705 3300005365 Ga0070688_100741580 Ga0070688_1007415801 149
706 3300005367 Ga0070667_100296367 Ga0070667_1002963672 149
707 3300005458 Ga0070681_10538907 Ga0070681_105389071 149
708 3300005459 Ga0068867_100275770 Ga0068867_1002757701 149
709 3300005468 Ga0070707_100556620 Ga0070707_1005566201 149
710 3300005615 Ga0070702_100194209 Ga0070702_1001942092 149
711 3300005616 Ga0068852_100156588 Ga0068852_1001565882 149
712 3300005617 Ga0068859_100664517 Ga0068859_1006645172 149
713 3300005617 Ga0068859_101293571 Ga0068859_1012935711 149
714 3300005618 Ga0068864_100038294 Ga0068864_1000382943 149
715 3300005618 Ga0068864_100223924 Ga0068864_1002239242 149
716 3300005841 Ga0068863_100149236 Ga0068863_1001492363 149
717 3300005843 Ga0068860_100074306 Ga0068860_1000743063 149
718 3300005843 Ga0068860_100310755 Ga0068860_1003107553 149
719 3300005844 Ga0068862_100371468 Ga0068862_1003714682 149
720 3300006237 Ga0097621_100220992 Ga0097621_1002209922 149
721 3300006358 Ga0068871_100143395 Ga0068871_1001433952 149
722 3300006931 Ga0097620_100664536 Ga0097620_1006645362 149
723 3300006931 Ga0097620_101293603 Ga0097620_1012936031 149
724 3300009094 Ga0111539_10883125 Ga0111539_108831251 149
725 3300009098 Ga0105245_10626766 Ga0105245_106267661 149
726 3300009101 Ga0105247_10029848 Ga0105247_100298482 149
727 3300009174 Ga0105241_10126772 Ga0105241_101267722 149
728 3300009177 Ga0105248_10026578 Ga0105248_100265783 149
729 3300009177 Ga0105248_10261316 Ga0105248_102613161 149
730 3300009177 Ga0105248_11281469 Ga0105248_112814691 149
731 3300009177 Ga0105248_12154749 Ga0105248_121547491 149
732 3300009553 Ga0105249_10038088 Ga0105249_100380884 149
733 3300009553 Ga0105249_10213984 Ga0105249_102139842 149
734 3300010375 Ga0105239_10585977 Ga0105239_105859772 149
735 3300013296 Ga0157374_10716266 Ga0157374_107162661 149
736 3300013297 Ga0157378_10307441 Ga0157378_103074412 149
737 3300013297 Ga0157378_10641094 Ga0157378_106410942 149
738 3300013306 Ga0163162_10759428 Ga0163162_107594282 149
739 3300013308 Ga0157375_10152200 Ga0157375_101522002 149
740 3300014968 Ga0157379_10323743 Ga0157379_103237432 149
741 3300014969 Ga0157376_10945103 Ga0157376_109451031 149
742 3300025934 Ga0207686_10065427 Ga0207686_100654271 149
743 3300025938 Ga0207704_10819923 Ga0207704_108199231 149
744 3300025941 Ga0207711_10072807 Ga0207711_100728072 149
745 3300025941 Ga0207711_10283370 Ga0207711_102833701 149
746 3300025945 Ga0207679_10943873 Ga0207679_109438731 149
747 3300025986 Ga0207658_11566752 Ga0207658_115667521 149
748 3300026035 Ga0207703_10247184 Ga0207703_102471841 149
749 3300026088 Ga0207641_10133800 Ga0207641_101338002 149
750 3300026095 Ga0207676_10021890 Ga0207676_100218903 149
751 3300026095 Ga0207676_10630469 Ga0207676_106304692 149
752 3300026142 Ga0207698_10060178 Ga0207698_100601782 149
753 3300028381 Ga0268264_10286867 Ga0268264_102868672 149
754 3300031731 Ga0307405_10207501 Ga0307405_102075012 149
755 3300031731 Ga0307405_11878028 Ga0307405_118780281 149
756 3300031852 Ga0307410_10818173 Ga0307410_108181732 149
757 3300031901 Ga0307406_10377665 Ga0307406_103776652 149
758 3300031995 Ga0307409_100018111 Ga0307409_1000181115 149
759 3300032002 Ga0307416_100196894 Ga0307416_1001968942 149
760 3300032004 Ga0307414_11050554 Ga0307414_110505541 149
761 3300044673 Ga0453683_0671371 Ga0453683_0671371_105_572 149
762 3300048904 Ga0496101_0753187 Ga0496101_0753187_124_591 149
763 3300048907 Ga0496104_0794308 Ga0496104_0794308_76_543 149
764 3300005329 Ga0070683_100019789 Ga0070683_1000197895 150
765 3300005329 Ga0070683_100065764 Ga0070683_1000657644 150
766 3300005330 Ga0070690_100664012 Ga0070690_1006640121 150
767 3300005334 Ga0068869_100170892 Ga0068869_1001708922 150
768 3300005336 Ga0070680_100009354 Ga0070680_1000093542 150
769 3300005341 Ga0070691_10009177 Ga0070691_100091776 150
770 3300005434 Ga0070709_10048410 Ga0070709_100484102 150
771 3300005456 Ga0070678_100238520 Ga0070678_1002385202 150
772 3300005458 Ga0070681_10000605 Ga0070681_1000060515 150
773 3300005471 Ga0070698_100576842 Ga0070698_1005768422 150
774 3300005518 Ga0070699_100095222 Ga0070699_1000952223 150
775 3300005530 Ga0070679_100000883 Ga0070679_1000008833 150
776 3300005535 Ga0070684_100002114 Ga0070684_1000021146 150
777 3300005536 Ga0070697_100362927 Ga0070697_1003629272 150
778 3300005536 Ga0070697_100603109 Ga0070697_1006031092 150
779 3300005539 Ga0068853_100761029 Ga0068853_1007610292 150
780 3300005549 Ga0070704_100247052 Ga0070704_1002470522 150
781 3300005577 Ga0068857_100003819 Ga0068857_10000381916 150
782 3300005614 Ga0068856_100075518 Ga0068856_1000755182 150
783 3300005614 Ga0068856_100346035 Ga0068856_1003460352 150
784 3300005843 Ga0068860_100035691 Ga0068860_1000356913 150
785 3300006028 Ga0070717_10059739 Ga0070717_100597393 150
786 3300006173 Ga0070716_100093300 Ga0070716_1000933003 150
787 3300006173 Ga0070716_101171367 Ga0070716_1011713671 150
788 3300007265 Ga0099794_10052393 Ga0099794_100523933 150
789 3300007788 Ga0099795_10066245 Ga0099795_100662452 150
790 3300007788 Ga0099795_10080988 Ga0099795_100809882 150
791 3300007788 Ga0099795_10180297 Ga0099795_101802972 150
792 3300009093 Ga0105240_10005756 Ga0105240_100057566 150
793 3300009093 Ga0105240_10119293 Ga0105240_101192933 150
794 3300009093 Ga0105240_10542221 Ga0105240_105422212 150
795 3300009098 Ga0105245_10028346 Ga0105245_100283462 150
796 3300009098 Ga0105245_10184017 Ga0105245_101840172 150
797 3300009545 Ga0105237_10012111 Ga0105237_100121114 150
798 3300009545 Ga0105237_10383669 Ga0105237_103836692 150
799 3300009551 Ga0105238_10008033 Ga0105238_100080332 150
800 3300010159 Ga0099796_10040988 Ga0099796_100409882 150
801 3300010375 Ga0105239_10011863 Ga0105239_100118638 150
802 3300010375 Ga0105239_10023725 Ga0105239_100237256 150
803 3300013102 Ga0157371_10038416 Ga0157371_100384163 150
804 3300013105 Ga0157369_10013263 Ga0157369_1001326310 150
805 3300013296 Ga0157374_10012288 Ga0157374_100122884 150
806 3300013296 Ga0157374_10014907 Ga0157374_100149079 150
807 3300013297 Ga0157378_10003916 Ga0157378_1000391611 150
808 3300013297 Ga0157378_10024514 Ga0157378_100245144 150
809 3300013306 Ga0163162_10640471 Ga0163162_106404712 150
810 3300013307 Ga0157372_10007318 Ga0157372_1000731812 150
811 3300013307 Ga0157372_10066914 Ga0157372_100669143 150
812 3300013308 Ga0157375_10388744 Ga0157375_103887442 150
813 3300014968 Ga0157379_11149367 Ga0157379_111493672 150
814 3300024227 Ga0228598_1000659 Ga0228598_10006597 150
815 3300024227 Ga0228598_1003820 Ga0228598_10038203 150
816 3300025913 Ga0207695_10092201 Ga0207695_100922014 150
817 3300025914 Ga0207671_10025128 Ga0207671_100251282 150
818 3300025925 Ga0207650_10261490 Ga0207650_102614902 150
819 3300025928 Ga0207700_11536484 Ga0207700_115364841 150
820 3300025929 Ga0207664_10140947 Ga0207664_101409472 150
821 3300025939 Ga0207665_10848692 Ga0207665_108486921 150
822 3300025942 Ga0207689_10075607 Ga0207689_100756073 150
823 3300025944 Ga0207661_10019082 Ga0207661_100190822 150
824 3300026121 Ga0207683_10537273 Ga0207683_105372732 150
825 3300026142 Ga0207698_10018426 Ga0207698_100184264 150
826 3300027512 Ga0209179_1014511 Ga0209179_10145112 150
827 3300027671 Ga0209588_1100648 Ga0209588_11006482 150
828 3300028563 Ga0265319_1011603 Ga0265319_10116035 150
829 3300028577 Ga0265318_10000903 Ga0265318_100009039 150
830 3300028800 Ga0265338_10134159 Ga0265338_101341592 150
831 3300028800 Ga0265338_10151590 Ga0265338_101515902 150
832 3300030760 Ga0265762_1018852 Ga0265762_10188522 150
833 3300030760 Ga0265762_1040157 Ga0265762_10401572 150
834 3300031090 Ga0265760_10022140 Ga0265760_100221403 150
835 3300031239 Ga0265328_10241231 Ga0265328_102412311 150
836 3300031240 Ga0265320_10000377 Ga0265320_1000037724 150
837 3300031241 Ga0265325_10010845 Ga0265325_100108453 150
838 3300031242 Ga0265329_10004080 Ga0265329_100040804 150
839 3300031247 Ga0265340_10003167 Ga0265340_100031673 150
840 3300031249 Ga0265339_10311071 Ga0265339_103110711 150
841 3300031250 Ga0265331_10000172 Ga0265331_1000017259 150
842 3300031250 Ga0265331_10010058 Ga0265331_100100581 150
843 3300031344 Ga0265316_10008573 Ga0265316_1000857310 150
844 3300031344 Ga0265316_10009890 Ga0265316_1000989012 150
845 3300031344 Ga0265316_10089078 Ga0265316_100890782 150
846 3300031595 Ga0265313_10002130 Ga0265313_1000213012 150
847 3300031711 Ga0265314_10209043 Ga0265314_102090432 150
848 3300031712 Ga0265342_10000656 Ga0265342_1000065637 150
849 3300035083 Ga0373926_0076211 Ga0373926_0076211_362_838 150
850 3300035111 Ga0373923_0008415 Ga0373923_0008415_2226_2702 150
851 3300035113 Ga0373936_0110959 Ga0373936_0110959_140_631 150
852 3300035117 Ga0373953_0023029 Ga0373953_0023029_393_866 150
853 3300035117 Ga0373953_0146798 Ga0373953_0146798_507_989 150
854 3300035118 Ga0373954_0142004 Ga0373954_0142004_579_1055 150
855 3300035119 Ga0373956_0091753 Ga0373956_0091753_21_497 150
856 3300035171 Ga0373946_0390571 Ga0373946_0390571_13_492 150
857 3300035172 Ga0373955_0055758 Ga0373955_0055758_545_1021 150
858 3300035410 Ga0373924_0108121 Ga0373924_0108121_452_928 150
859 3300035410 Ga0373924_0227672 Ga0373924_0227672_238_720 150
860 3300035695 Ga0373927_0037285 Ga0373927_0037285_2151_2627 150
861 3300035724 Ga0373933_0102349 Ga0373933_0102349_627_1103 150
862 3300035725 Ga0373947_0029255 Ga0373947_0029255_1825_2301 150
863 3300036401 Ga0373937_0007944 Ga0373937_0007944_1053_1526 150
864 3300036401 Ga0373937_0228267 Ga0373937_0228267_830_1306 150
865 3300036401 Ga0373937_0230707 Ga0373937_0230707_916_1392 150
866 3300036401 Ga0373937_0792492 Ga0373937_0792492_156_638 150
867 3300037068 Ga0373925_0160186 Ga0373925_0160186_715_1245 150
868 3300037068 Ga0373925_1086007 Ga0373925_1086007_168_644 150
869 3300046454 Ga0495592_0130109 Ga0495592_0130109_192_668 150
870 3300046459 Ga0495629_0042327 Ga0495629_0042327_34_564 150
871 3300046462 Ga0495651_0000142 Ga0495651_0000142_14814_15296 150
872 3300046462 Ga0495651_0000738 Ga0495651_0000738_839_1315 150
873 3300046462 Ga0495651_0044271 Ga0495651_0044271_2194_2670 150
874 3300046463 Ga0495653_0037395 Ga0495653_0037395_3080_3556 150
875 3300046463 Ga0495653_0083279 Ga0495653_0083279_834_1310 150
876 3300046472 Ga0495580_0029238 Ga0495580_0029238_1655_2131 150
877 3300046477 Ga0495664_0252071 Ga0495664_0252071_413_889 150
878 3300046511 Ga0495608_0017477 Ga0495608_0017477_3432_3908 150
879 3300046511 Ga0495608_0120537 Ga0495608_0120537_1087_1569 150
880 3300046514 Ga0495618_0080749 Ga0495618_0080749_767_1243 150
881 3300046514 Ga0495618_0274557 Ga0495618_0274557_555_1031 150
882 3300046516 Ga0495628_0002130 Ga0495628_0002130_689_1165 150
883 3300046516 Ga0495628_0034769 Ga0495628_0034769_3444_3926 150
884 3300046516 Ga0495628_0083571 Ga0495628_0083571_1238_1714 150
885 3300046517 Ga0495630_0075176 Ga0495630_0075176_1511_1987 150
886 3300046517 Ga0495630_0332254 Ga0495630_0332254_136_666 150
887 3300046517 Ga0495630_0407230 Ga0495630_0407230_342_818 150
888 3300046529 Ga0495652_0012085 Ga0495652_0012085_830_1306 150
889 3300046529 Ga0495652_0100355 Ga0495652_0100355_1013_1489 150
890 3300046529 Ga0495652_0291215 Ga0495652_0291215_600_1073 150
891 3300046531 Ga0495665_0006278 Ga0495665_0006278_3468_3944 150
892 3300046533 Ga0495640_0074856 Ga0495640_0074856_1576_2106 150
893 3300046533 Ga0495640_0080645 Ga0495640_0080645_902_1378 150
894 3300046535 Ga0495586_0023205 Ga0495586_0023205_2125_2601 150
895 3300046535 Ga0495586_0035594 Ga0495586_0035594_938_1468 150
896 3300046536 Ga0495587_0000996 Ga0495587_0000996_5774_6250 150
897 3300046536 Ga0495587_0091141 Ga0495587_0091141_712_1188 150
898 3300046536 Ga0495587_0400088 Ga0495587_0400088_227_700 150
899 3300046543 Ga0495645_0024408 Ga0495645_0024408_2829_3305 150
900 3300046543 Ga0495645_0025394 Ga0495645_0025394_137_613 150
901 3300046543 Ga0495645_0062331 Ga0495645_0062331_1492_1974 150
902 3300046559 Ga0495667_0003314 Ga0495667_0003314_8752_9228 150
903 3300046559 Ga0495667_0033012 Ga0495667_0033012_2491_2973 150
904 3300046559 Ga0495667_0063785 Ga0495667_0063785_704_1180 150
905 3300046559 Ga0495667_0106175 Ga0495667_0106175_948_1430 150
906 3300046642 Ga0495634_0074553 Ga0495634_0074553_1407_1883 150
907 3300046663 Ga0495635_0016914 Ga0495635_0016914_3580_4056 150
908 3300046663 Ga0495635_0031085 Ga0495635_0031085_539_1015 150
909 3300046675 Ga0495657_0003623 Ga0495657_0003623_10690_11172 150
910 3300046675 Ga0495657_0015047 Ga0495657_0015047_4367_4843 150
911 3300046675 Ga0495657_0065767 Ga0495657_0065767_132_608 150
912 3300046678 Ga0495599_0046531 Ga0495599_0046531_1411_1887 150
913 3300046678 Ga0495599_0109724 Ga0495599_0109724_545_1021 150
914 3300046678 Ga0495599_0180169 Ga0495599_0180169_522_995 150
915 3300046679 Ga0495623_0021497 Ga0495623_0021497_3431_3907 150
916 3300046679 Ga0495623_0159211 Ga0495623_0159211_754_1230 150
917 3300046680 Ga0495646_0025074 Ga0495646_0025074_869_1345 150
918 3300046681 Ga0495647_0083096 Ga0495647_0083096_100_630 150
919 3300046689 Ga0495613_0177300 Ga0495613_0177300_707_1183 150
920 3300046689 Ga0495613_0352533 Ga0495613_0352533_117_593 150
921 3300046690 Ga0495624_0094737 Ga0495624_0094737_132_608 150
922 3300046809 Ga0495600_0055361 Ga0495600_0055361_1301_1777 150
923 3300046809 Ga0495600_0145311 Ga0495600_0145311_186_668 150
924 3300046809 Ga0495600_0487623 Ga0495600_0487623_258_731 150
925 3300047315 Ga0495581_0196616 Ga0495581_0196616_128_604 150
926 3300047317 Ga0495604_0003773 Ga0495604_0003773_10766_11242 150
927 3300047317 Ga0495604_0015747 Ga0495604_0015747_4783_5259 150
928 3300047317 Ga0495604_0039876 Ga0495604_0039876_2732_3214 150
929 3300047317 Ga0495604_0148503 Ga0495604_0148503_438_920 150
930 3300047317 Ga0495604_0797201 Ga0495604_0797201_56_532 150
931 3300047319 Ga0495674_0043126 Ga0495674_0043126_1682_2212 150
932 3300047319 Ga0495674_0128153 Ga0495674_0128153_922_1398 150
933 3300047319 Ga0495674_0333042 Ga0495674_0333042_200_676 150
934 3300047319 Ga0495674_0506097 Ga0495674_0506097_146_622 150
935 3300047321 Ga0495676_0195790 Ga0495676_0195790_538_1014 150
936 3300047322 Ga0495680_0001389 Ga0495680_0001389_24846_25322 150
937 3300047322 Ga0495680_0006947 Ga0495680_0006947_3286_3768 150
938 3300047322 Ga0495680_0063404 Ga0495680_0063404_2036_2512 150
939 3300047322 Ga0495680_0312475 Ga0495680_0312475_362_838 150
940 3300047444 Ga0495675_0000027 Ga0495675_0000027_26392_26868 150
941 3300047444 Ga0495675_0108337 Ga0495675_0108337_893_1375 150
942 3300047444 Ga0495675_0138227 Ga0495675_0138227_869_1345 150
943 3300047444 Ga0495675_0198097 Ga0495675_0198097_392_874 150
944 3300047471 Ga0495684_0001664 Ga0495684_0001664_1572_2054 150
945 3300047471 Ga0495684_0032393 Ga0495684_0032393_834_1310 150
946 3300047471 Ga0495684_0048348 Ga0495684_0048348_869_1345 150
947 3300047471 Ga0495684_0361400 Ga0495684_0361400_207_680 150
948 3300047673 Ga0495593_0029583 Ga0495593_0029583_1361_1837 150
949 3300048088 Ga0495602_0117354 Ga0495602_0117354_1360_1836 150
950 3300048089 Ga0495614_0030737 Ga0495614_0030737_1117_1593 150
951 3300048089 Ga0495614_0470925 Ga0495614_0470925_96_572 150
952 3300048904 Ga0496101_0124707 Ga0496101_0124707_469_984 150
953 3300048905 Ga0496102_0001855 Ga0496102_0001855_7179_7694 150
954 3300048905 Ga0496102_0789944 Ga0496102_0789944_208_684 150
955 3300048909 Ga0496106_0062226 Ga0496106_0062226_1361_1876 150
956 3300048910 Ga0496107_0049551 Ga0496107_0049551_630_1145 150
957 3300048915 Ga0496112_0087811 Ga0496112_0087811_580_1095 150
958 3300048918 Ga0496115_0003887 Ga0496115_0003887_5711_6199 150
959 3300053078 Ga0495612_0032801 Ga0495612_0032801_585_1061 150
960 3300053085 Ga0495619_0707732 Ga0495619_0707732_144_674 150
961 3300053142 Ga0500577_0013890 Ga0500577_0013890_325_801 150
962 3300005329 Ga0070683_100145819 Ga0070683_1001458192 151
963 3300005434 Ga0070709_10736486 Ga0070709_107364861 151
964 3300006844 Ga0075428_100350205 Ga0075428_1003502052 151
965 3300006852 Ga0075433_10004679 Ga0075433_100046793 151
966 3300006852 Ga0075433_10937738 Ga0075433_109377381 151
967 3300006871 Ga0075434_100021744 Ga0075434_1000217443 151
968 3300006871 Ga0075434_100042803 Ga0075434_1000428032 151
969 3300007076 Ga0075435_100037403 Ga0075435_1000374036 151
970 3300007076 Ga0075435_100124806 Ga0075435_1001248062 151
971 3300009147 Ga0114129_11794472 Ga0114129_117944721 151
972 3300026023 Ga0207677_10580578 Ga0207677_105805782 151
973 3300039438 Ga0436360_0070677 Ga0436360_0070677_27_509 151
974 3300039453 Ga0436362_0856096 Ga0436362_0856096_64_546 151
975 3300048907 Ga0496104_0096337 Ga0496104_0096337_1967_2458 151
976 iso_pu_bacteria 2599185359 2600226333 151
977 iso_pu_bacteria 2818991466 2819712423 151
978 iso_pu_bacteria 2928526807 2928526933 151
979 iso_pu_bacteria 2928968154 2928969462 151
980 3300005347 Ga0070668_100286256 Ga0070668_1002862561 152
981 3300005355 Ga0070671_100962886 Ga0070671_1009628861 152
982 3300005466 Ga0070685_10307602 Ga0070685_103076022 152
983 3300005468 Ga0070707_100642203 Ga0070707_1006422031 152
984 3300005471 Ga0070698_101077900 Ga0070698_1010779001 152
985 3300005615 Ga0070702_101733148 Ga0070702_1017331481 152
986 3300005841 Ga0068863_100923000 Ga0068863_1009230002 152
987 3300006871 Ga0075434_101211643 Ga0075434_1012116431 152
988 3300009098 Ga0105245_12094691 Ga0105245_120946911 152
989 3300009147 Ga0114129_10446276 Ga0114129_104462762 152
990 3300009147 Ga0114129_10974250 Ga0114129_109742501 152
991 3300009148 Ga0105243_10090238 Ga0105243_100902384 152
992 3300009545 Ga0105237_10545667 Ga0105237_105456671 152
993 3300009553 Ga0105249_10766740 Ga0105249_107667401 152
994 3300011119 Ga0105246_10211380 Ga0105246_102113803 152
995 3300013297 Ga0157378_10118899 Ga0157378_101188994 152
996 3300013308 Ga0157375_10344453 Ga0157375_103444532 152
997 3300014968 Ga0157379_10016505 Ga0157379_100165058 152
998 3300014968 Ga0157379_10462606 Ga0157379_104626061 152
999 3300025914 Ga0207671_10333689 Ga0207671_103336891 152
1000 3300025931 Ga0207644_10382064 Ga0207644_103820642 152
1001 3300025935 Ga0207709_10337455 Ga0207709_103374552 152
1002 3300026088 Ga0207641_10886666 Ga0207641_108866661 152
1003 3300026118 Ga0207675_100312070 Ga0207675_1003120701 152
1004 3300031090 Ga0265760_10000041 Ga0265760_1000004118 152
1005 3300031548 Ga0307408_100175524 Ga0307408_1001755242 152
1006 3300031731 Ga0307405_10518736 Ga0307405_105187362 152
1007 3300031731 Ga0307405_11191993 Ga0307405_111919931 152
1008 3300031824 Ga0307413_10140699 Ga0307413_101406992 152
1009 3300031852 Ga0307410_10141951 Ga0307410_101419512 152
1010 3300031901 Ga0307406_10353341 Ga0307406_103533412 152
1011 3300032002 Ga0307416_100007450 Ga0307416_1000074507 152
1012 3300032005 Ga0307411_10064166 Ga0307411_100641663 152
1013 3300035170 Ga0373943_0022103 Ga0373943_0022103_608_1105 152
1014 3300035171 Ga0373946_0064348 Ga0373946_0064348_326_823 152
1015 3300035692 Ga0373935_0003584 Ga0373935_0003584_7150_7647 152
1016 3300035695 Ga0373927_0106683 Ga0373927_0106683_795_1292 152
1017 3300035695 Ga0373927_0595616 Ga0373927_0595616_179_658 152
1018 3300037068 Ga0373925_0021124 Ga0373925_0021124_2886_3383 152
1019 3300046454 Ga0495592_0093255 Ga0495592_0093255_167_667 152
1020 3300046472 Ga0495580_0002963 Ga0495580_0002963_8248_8745 152
1021 3300046516 Ga0495628_0211930 Ga0495628_0211930_138_638 152
1022 3300048913 Ga0496110_0089341 Ga0496110_0089341_939_1418 152
1023 3300048913 Ga0496110_0110333 Ga0496110_0110333_772_1251 152
1024 3300050510 nmdc:mga06r32_199346_c1 nmdc:mga06r32_199346_c1_243_755 152
1025 3300006871 Ga0075434_100213825 Ga0075434_1002138253 153
1026 3300006914 Ga0075436_100469306 Ga0075436_1004693063 153
1027 3300049576 Ga0501040_0623311 Ga0501040_0623311_80_580 153
1028 3300049577 Ga0501041_0092465 Ga0501041_0092465_1347_1847 153
1029 3300049578 Ga0501042_0086739 Ga0501042_0086739_94_594 153
1030 3300049580 Ga0501046_0542766 Ga0501046_0542766_238_738 153
1031 3300049582 Ga0501048_0291263 Ga0501048_0291263_480_980 153
1032 3300049587 Ga0501071_0006921 Ga0501071_0006921_6585_7085 153
1033 3300049592 Ga0501076_0322278 Ga0501076_0322278_19_519 153
1034 3300049741 Ga0501079_0067835 Ga0501079_0067835_1300_1800 153
1035 3300049824 Ga0501045_0434668 Ga0501045_0434668_285_785 153
1036 3300054114 Ga0501084_0023317 Ga0501084_0023317_3208_3708 153
1037 3300061734 Ga0530510_0129790 Ga0530510_0129790_1271_1771 153
1038 3300031733 Ga0316577_10020360 Ga0316577_100203602 154
1039 3300031733 Ga0316577_10027058 Ga0316577_100270582 154
1040 3300036647 Ga0316582_0059782 Ga0316582_0059782_793_1278 154
1041 3300036712 Ga0316584_0008958 Ga0316584_0008958_6174_6659 154
1042 3300037588 Ga0316581_0002385 Ga0316581_0002385_1921_2406 154
1043 3300003791 Ga0055530_10000901 Ga0055530_100009019 155
1044 3300003794 Ga0055531_10000583 Ga0055531_100005839 155
1045 3300005329 Ga0070683_100789692 Ga0070683_1007896922 155
1046 3300006852 Ga0075433_10381162 Ga0075433_103811622 155
1047 3300009147 Ga0114129_10767338 Ga0114129_107673382 155
1048 3300020082 Ga0206353_10992914 Ga0206353_109929142 155
1049 3300025250 Ga0209026_1005779 Ga0209026_10057794 155
1050 3300025292 Ga0209676_1087506 Ga0209676_10875061 155
1051 3300025298 Ga0209050_1000010 Ga0209050_1000010428 155
1052 3300025304 Ga0209257_1000009 Ga0209257_1000009687 155
1053 3300031548 Ga0307408_100084919 Ga0307408_1000849193 155
1054 3300031691 Ga0316579_10001174 Ga0316579_100011744 155
1055 3300038705 Ga0237819_00257 Ga0237819_00257_15181_15648 155
1056 3300045051 Ga0451576_0002253 Ga0451576_0002253_8426_8917 155
1057 3300046474 Ga0495605_0174133 Ga0495605_0174133_256_768 155
1058 3300050507 nmdc:mga05p37_607564_c1 nmdc:mga05p37_607564_c1_251_748 155
1059 3300050515 nmdc:mga0a205_240459_c1 nmdc:mga0a205_240459_c1_23_565 155

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01967

MoaC

MoaC family

26

157

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ohd-assembly1.cif.gz_D crystal structure of hypothetical molybdenum cofactor biosynthesis protein c from sulfolobus tokodaii 0.9867 13 143
4fdf-assembly1.cif.gz_B structural insights into putative molybdenum cofactor biosynthesis protein c (moac2) from mycobacterium tuberculosis h37rv 0.9822 12 155
4fdf-assembly1.cif.gz_B structural insights into putative molybdenum cofactor biosynthesis protein c (moac2) from mycobacterium tuberculosis h37rv 0.9753 12 155
4fdf-assembly1.cif.gz_A structural insights into putative molybdenum cofactor biosynthesis protein c (moac2) from mycobacterium tuberculosis h37rv 0.9752 11 145
2ekn-assembly1.cif.gz_A structure of ph1811 protein from pyrococcus horikoshii 0.9751 12 145
ID Description Score Start End Superfamily
af_B4FJH5_64_220_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9868 4 155 3.30.70.640
af_P9WJR7_13_167_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9836 3 155 3.30.70.640
4fdfA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9752 11 145 3.30.70.640
af_Q20624_440_595_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9742 4 155 3.30.70.640
2ohdB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9739 13 143 3.30.70.640
ID Description Score Start End GO Terms
AF-A0A2E5ZGQ7-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 1.001 15 155 GO:0006777
GO:0061799
AF-A0A0C9N681-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.9998 15 155 GO:0006777
GO:0061799
AF-A0A534PQE0-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.998 15 155 GO:0006777
GO:0061799
AF-A0A7C1Z3Q1-F1-model_v4 Cyclic pyranopterin monophosphate synthase MoaC (EC 4.6.1.17) 0.9978 15 146 GO:0006777
GO:0061798
GO:0061799
AF-A0A6G8PVM2-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.9978 15 146 GO:0006777
GO:0061799

Feature Viewer

pLDDT pTM Quality
94.61 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map