F489167
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1055 | 662 | 720 | 279 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2871435913|2871441915 |
| Length | 336 |
| Sequence | PRKDILKKFRGMIDKGVPIVGGGAGTGLSAKAEEAGGIDLIIIYNSGRYRMAGRGSAAGLLAYGNANEIVKEMAYEVLPVVRHTPVLAGVNGTDPFVIMPLLLAELKTMGFSGVQNFPTIGLFDGSMRQSFEETGMGFGLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLEVDMIAEAHKLDLLTTPYVFNPDEARAMTKAGADIVVAHMGVTTGGSIGATSAKSLDDCVVEIDAIANAARSVRKDVILLCHGGPISMPDDARYILSHAKGLHGFYGASSMERLPAEAAIARQTADFKSVTLGGQK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 3 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 4 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 5 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 6 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 7 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 8 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 9 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 10 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 11 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 12 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 13 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 14 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 15 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 16 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 17 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 18 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 19 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 20 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 21 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 22 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 23 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 24 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 25 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 26 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 27 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 28 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 29 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 30 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 31 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 32 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 33 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 34 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 35 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 36 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 37 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 38 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 39 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 40 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 41 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 42 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 43 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 44 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 45 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 46 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 47 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 48 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 49 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 50 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 51 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 52 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 53 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 54 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 55 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 56 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 57 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 58 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 59 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 60 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 61 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 62 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 63 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 64 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 65 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 66 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 67 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 68 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 69 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 70 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 71 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 72 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 73 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 74 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 75 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 76 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 77 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 78 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 79 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 80 | 2855195626 | Pectobacterium atrosepticum SS26 | Isolate | Stem Tuber |
| 81 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 82 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 83 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 84 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 85 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 86 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 87 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 88 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 89 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 90 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 91 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 92 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 93 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 94 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 95 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 96 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 97 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 98 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 99 | 2871282230 | Pectobacterium parmentieri SS90 | Isolate | Stem Tuber |
| 100 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 101 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 102 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 103 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 104 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 105 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 106 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 107 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 108 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 109 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 110 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 111 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 112 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 113 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 114 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 115 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 116 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 117 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 118 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 119 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 120 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 121 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 122 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 123 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 124 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 125 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 126 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 127 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 128 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 129 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 130 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 131 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 132 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 133 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 134 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 135 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 136 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 137 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 138 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 139 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 140 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 141 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 142 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 143 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 144 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 145 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 146 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 147 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 148 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 149 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 150 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 151 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 152 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 153 | 2900051742 | Pectobacterium zantedeschiae 2M | Isolate | Stem Tuber |
| 154 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 155 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 156 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 157 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 158 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 159 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 160 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 161 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 162 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 163 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 164 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 165 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 166 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 167 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 168 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 169 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 170 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 171 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 172 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 173 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 174 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 175 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 176 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 177 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 178 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 179 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 180 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 181 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 182 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 183 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 184 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 185 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 186 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 187 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 188 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 189 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 190 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 191 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 192 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 193 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 194 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 195 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 196 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 197 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 198 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 199 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 200 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 201 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 202 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 203 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 204 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 205 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 206 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 207 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 208 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 209 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 210 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 211 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 212 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 213 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 214 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 215 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 216 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 217 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 218 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 219 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 220 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 221 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 222 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 223 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 224 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 225 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 226 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 227 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 228 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 229 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 230 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 231 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 232 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 233 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 234 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 235 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 236 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 237 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 238 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 239 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 240 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 241 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 242 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 243 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 244 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 245 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 246 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 247 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 248 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 249 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 250 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 251 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 252 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 253 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 254 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 255 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 256 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 257 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 258 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 259 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 260 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 261 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 262 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 263 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 264 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 265 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 266 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 267 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 268 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 269 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 270 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 271 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 272 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 273 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 274 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 275 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 276 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 277 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 278 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 279 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 280 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 281 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 282 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 283 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 284 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 285 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 286 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 287 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 288 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 289 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 290 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 291 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 292 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 293 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 294 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 295 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 296 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 297 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 298 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 299 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 300 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 301 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 302 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 303 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 304 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 305 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 306 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 307 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 308 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 309 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 310 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 311 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 312 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 313 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 314 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 315 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 316 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 317 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 318 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 319 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 320 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 321 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 322 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 323 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 324 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 325 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 326 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 327 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 328 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 329 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 330 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 331 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 332 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 333 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 334 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 335 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 336 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 337 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 338 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 339 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 340 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 341 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 342 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 343 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 344 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 345 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 346 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 347 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 348 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 349 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 350 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 351 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 352 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 353 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 354 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 355 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 356 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 357 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 358 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 359 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 360 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 361 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 362 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 363 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 364 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 365 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 366 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 367 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 368 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 369 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 370 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 371 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 372 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 373 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 375 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 376 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 377 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 379 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 380 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 381 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 382 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 383 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 384 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 386 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 387 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 388 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 389 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 390 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 391 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 392 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 393 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 394 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 395 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 396 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 397 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 398 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 399 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 400 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 401 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 402 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 403 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 404 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 405 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 406 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 407 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 408 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 409 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 410 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 411 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 412 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 413 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 414 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 415 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 416 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 417 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 418 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 419 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 420 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 421 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 422 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 423 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 424 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 425 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 426 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 427 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 428 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 429 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 430 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 431 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 432 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 433 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 434 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 435 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 436 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 437 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 438 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 439 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 440 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 441 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 442 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 443 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 444 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 445 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 446 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 447 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 448 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 449 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 450 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 451 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 452 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 453 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 454 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 455 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 456 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 457 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 458 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 459 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 460 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 461 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 462 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 463 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 464 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 465 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 466 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 467 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 468 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 469 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 470 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 471 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 472 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 473 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 474 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 475 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 476 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 477 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 478 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 479 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 480 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 481 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 482 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 483 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 484 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 485 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 486 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 487 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 488 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 489 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 490 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 491 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 492 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 493 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 494 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 495 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 496 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 497 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 498 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 499 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 500 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 501 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 502 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 503 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 504 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 505 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 506 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 507 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 508 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 509 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 510 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 511 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 512 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 513 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 514 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 515 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 516 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 517 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 518 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 519 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 520 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 564 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 565 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 566 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 567 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 568 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 569 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 570 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 571 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 572 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 573 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 574 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 575 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 576 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 577 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 578 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 579 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 580 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 581 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 584 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 585 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 586 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 587 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 588 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 589 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 590 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 591 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 592 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 593 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 594 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 595 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 596 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 597 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 598 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 599 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 600 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 601 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 602 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 603 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 604 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 605 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 606 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 607 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 608 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 609 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 610 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 611 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 612 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 613 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 614 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 615 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 616 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 617 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 618 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 619 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 620 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 621 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 622 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 623 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 624 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 625 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 626 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 627 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 628 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 629 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 630 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 631 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 632 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 633 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 634 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 635 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 636 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 637 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 638 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 639 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 640 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 641 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 642 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 643 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 644 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 645 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 646 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 647 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 648 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 649 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 650 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 651 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 652 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 653 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 654 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 655 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 656 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 657 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 658 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 659 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 660 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 661 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 662 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 68.25 |
| Metatranscriptomes | 0 |
| Isolates | 31.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.69 |
| Nodule | 26.45 |
| Rhizoplane | 1.52 |
| Rhizosphere | 59.05 |
| Stem | 0 |
| Stem Tuber | 0.38 |
| Unclassified | 6.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10022936 | 3300001989 | Bacteria | 2211 |
| 2 | JGI25159J45721_1000461 | 3300002987 | Bacteria | 18823 |
| 3 | JGI25165J46597_1000034 | 3300003214 | Bacteria | 292458 |
| 4 | rootH2_10130272 | 3300003320 | Bacteria | 1771 |
| 5 | JGI25160J50197_1000248 | 3300003354 | Bacteria | 41777 |
| 6 | JGI25160J50197_1002309 | 3300003354 | Bacteria | 8942 |
| 7 | JGI25161J50226_1000183 | 3300003374 | Bacteria | 41777 |
| 8 | Ga0055542_1001063 | 3300003762 | Bacteria | 16922 |
| 9 | Ga0055529_1003010 | 3300003763 | Bacteria | 2960 |
| 10 | Ga0055524_1000850 | 3300003775 | Bacteria | 20030 |
| 11 | Ga0055528_1001807 | 3300003790 | Bacteria | 12257 |
| 12 | Ga0055543_1000245 | 3300004625 | Bacteria | 41815 |
| 13 | Ga0065165_1001012 | 3300005262 | Bacteria | 34230 |
| 14 | Ga0070658_10147445 | 3300005327 | Bacteria | 1968 |
| 15 | Ga0070658_10290359 | 3300005327 | Bacteria | 1393 |
| 16 | Ga0070658_10332977 | 3300005327 | Bacteria | 1298 |
| 17 | Ga0070676_10068798 | 3300005328 | Bacteria | 2120 |
| 18 | Ga0070683_100200023 | 3300005329 | Bacteria | 1897 |
| 19 | Ga0070690_100001510 | 3300005330 | Bacteria | 12195 |
| 20 | Ga0070690_100148394 | 3300005330 | Bacteria | 1598 |
| 21 | Ga0068869_100001072 | 3300005334 | Bacteria | 15972 |
| 22 | Ga0068869_100091578 | 3300005334 | Bacteria | 2287 |
| 23 | Ga0068869_100173041 | 3300005334 | Bacteria | 1688 |
| 24 | Ga0068869_100287153 | 3300005334 | Bacteria | 1324 |
| 25 | Ga0070666_10007488 | 3300005335 | Bacteria | 6729 |
| 26 | Ga0068868_100058831 | 3300005338 | Bacteria | 3038 |
| 27 | Ga0068868_100152931 | 3300005338 | Bacteria | 1901 |
| 28 | Ga0068868_100211375 | 3300005338 | Bacteria | 1621 |
| 29 | Ga0068868_100462246 | 3300005338 | Bacteria | 1105 |
| 30 | Ga0068868_100484783 | 3300005338 | Bacteria | 1081 |
| 31 | Ga0070660_100235649 | 3300005339 | Bacteria | 1490 |
| 32 | Ga0070660_100332888 | 3300005339 | Bacteria | 1249 |
| 33 | Ga0070689_100011792 | 3300005340 | Bacteria | 6271 |
| 34 | Ga0070689_100165543 | 3300005340 | Bacteria | 1789 |
| 35 | Ga0070661_100001089 | 3300005344 | Bacteria | 19198 |
| 36 | Ga0070661_100077522 | 3300005344 | Bacteria | 2450 |
| 37 | Ga0070661_100093694 | 3300005344 | Bacteria | 2225 |
| 38 | Ga0070661_100183246 | 3300005344 | Bacteria | 1594 |
| 39 | Ga0070692_10101388 | 3300005345 | Bacteria | 1578 |
| 40 | Ga0070668_100105638 | 3300005347 | Bacteria | 2236 |
| 41 | Ga0070668_100337545 | 3300005347 | Bacteria | 1272 |
| 42 | Ga0070669_100030183 | 3300005353 | Bacteria | 3910 |
| 43 | Ga0070669_100077937 | 3300005353 | Bacteria | 2463 |
| 44 | Ga0070669_100099619 | 3300005353 | Bacteria | 2190 |
| 45 | Ga0070675_100002305 | 3300005354 | Bacteria | 14175 |
| 46 | Ga0070671_100086319 | 3300005355 | Bacteria | 2625 |
| 47 | Ga0070671_100180420 | 3300005355 | Bacteria | 1787 |
| 48 | Ga0070674_100017239 | 3300005356 | Bacteria | 4539 |
| 49 | Ga0070674_100024016 | 3300005356 | Bacteria | 3954 |
| 50 | Ga0070673_100164516 | 3300005364 | Bacteria | 1889 |
| 51 | Ga0070659_100069612 | 3300005366 | Bacteria | 2793 |
| 52 | Ga0070659_100083833 | 3300005366 | Bacteria | 2548 |
| 53 | Ga0070667_100001504 | 3300005367 | Bacteria | 20851 |
| 54 | Ga0070667_100047622 | 3300005367 | Bacteria | 3607 |
| 55 | Ga0070667_100133328 | 3300005367 | Bacteria | 2170 |
| 56 | Ga0070667_100163109 | 3300005367 | Bacteria | 1964 |
| 57 | Ga0070667_100342299 | 3300005367 | Bacteria | 1353 |
| 58 | Ga0070701_10021078 | 3300005438 | Bacteria | 3104 |
| 59 | Ga0070705_100054268 | 3300005440 | Bacteria | 2350 |
| 60 | Ga0070700_100102045 | 3300005441 | Bacteria | 1892 |
| 61 | Ga0070694_100277084 | 3300005444 | Bacteria | 1277 |
| 62 | Ga0070663_100120191 | 3300005455 | Bacteria | 1983 |
| 63 | Ga0070678_100044742 | 3300005456 | Bacteria | 3163 |
| 64 | Ga0070678_100103935 | 3300005456 | Bacteria | 2208 |
| 65 | Ga0070678_100108089 | 3300005456 | Bacteria | 2171 |
| 66 | Ga0070678_100401568 | 3300005456 | Bacteria | 1191 |
| 67 | Ga0070662_100007515 | 3300005457 | Bacteria | 7069 |
| 68 | Ga0070662_100023880 | 3300005457 | Bacteria | 4206 |
| 69 | Ga0070681_10024387 | 3300005458 | Bacteria | 6088 |
| 70 | Ga0068867_100015891 | 3300005459 | Bacteria | 5343 |
| 71 | Ga0068867_100020391 | 3300005459 | Bacteria | 4723 |
| 72 | Ga0068867_100165982 | 3300005459 | Bacteria | 1745 |
| 73 | Ga0070685_10209442 | 3300005466 | Bacteria | 1272 |
| 74 | Ga0070679_100225219 | 3300005530 | Bacteria | 1835 |
| 75 | Ga0070684_100109601 | 3300005535 | Bacteria | 2474 |
| 76 | Ga0068853_100006106 | 3300005539 | Bacteria | 9539 |
| 77 | Ga0068853_100009175 | 3300005539 | Bacteria | 7968 |
| 78 | Ga0068853_100027399 | 3300005539 | Bacteria | 4787 |
| 79 | Ga0068853_100074345 | 3300005539 | Bacteria | 2965 |
| 80 | Ga0070672_100067901 | 3300005543 | Bacteria | 2826 |
| 81 | Ga0070672_100097962 | 3300005543 | Bacteria | 2374 |
| 82 | Ga0070686_100012181 | 3300005544 | Bacteria | 4892 |
| 83 | Ga0070686_100080814 | 3300005544 | Bacteria | 2151 |
| 84 | Ga0070695_100366935 | 3300005545 | Bacteria | 1083 |
| 85 | Ga0070665_100023505 | 3300005548 | Bacteria | 6205 |
| 86 | Ga0070665_100031128 | 3300005548 | Bacteria | 5370 |
| 87 | Ga0070665_100032562 | 3300005548 | Bacteria | 5246 |
| 88 | Ga0070665_100063348 | 3300005548 | Bacteria | 3707 |
| 89 | Ga0070665_100099653 | 3300005548 | Bacteria | 2910 |
| 90 | Ga0070665_100197127 | 3300005548 | Bacteria | 2014 |
| 91 | Ga0070665_100237090 | 3300005548 | Bacteria | 1825 |
| 92 | Ga0070665_100477974 | 3300005548 | Bacteria | 1257 |
| 93 | Ga0070664_100065451 | 3300005564 | Bacteria | 3101 |
| 94 | Ga0070664_100528939 | 3300005564 | Bacteria | 1089 |
| 95 | Ga0068857_100031257 | 3300005577 | Bacteria | 4704 |
| 96 | Ga0068857_100032013 | 3300005577 | Bacteria | 4648 |
| 97 | Ga0068854_100049679 | 3300005578 | Bacteria | 2997 |
| 98 | Ga0068854_100152807 | 3300005578 | Bacteria | 1781 |
| 99 | Ga0068854_100193943 | 3300005578 | Bacteria | 1593 |
| 100 | Ga0068856_100034379 | 3300005614 | Bacteria | 4964 |
| 101 | Ga0068856_100034534 | 3300005614 | Bacteria | 4953 |
| 102 | Ga0068856_100198757 | 3300005614 | Bacteria | 2019 |
| 103 | Ga0068852_100007354 | 3300005616 | Bacteria | 8035 |
| 104 | Ga0068852_100205312 | 3300005616 | Bacteria | 1866 |
| 105 | Ga0068852_100349477 | 3300005616 | Bacteria | 1443 |
| 106 | Ga0068852_100505746 | 3300005616 | Bacteria | 1204 |
| 107 | Ga0068859_100006383 | 3300005617 | Bacteria | 11961 |
| 108 | Ga0068859_100028370 | 3300005617 | Bacteria | 5611 |
| 109 | Ga0068859_100032249 | 3300005617 | Bacteria | 5262 |
| 110 | Ga0068859_100041599 | 3300005617 | Bacteria | 4616 |
| 111 | Ga0068859_100204119 | 3300005617 | Bacteria | 2061 |
| 112 | Ga0068864_100028037 | 3300005618 | Bacteria | 4758 |
| 113 | Ga0068864_100036087 | 3300005618 | Bacteria | 4212 |
| 114 | Ga0068864_100048815 | 3300005618 | Bacteria | 3639 |
| 115 | Ga0068864_100061768 | 3300005618 | Bacteria | 3245 |
| 116 | Ga0068864_100125087 | 3300005618 | Bacteria | 2303 |
| 117 | Ga0068866_10011237 | 3300005718 | Bacteria | 3866 |
| 118 | Ga0068866_10075384 | 3300005718 | Bacteria | 1796 |
| 119 | Ga0068861_100002678 | 3300005719 | Bacteria | 11666 |
| 120 | Ga0068861_100018125 | 3300005719 | Bacteria | 5008 |
| 121 | Ga0068851_10000365 | 3300005834 | Bacteria | 20408 |
| 122 | Ga0068870_10124723 | 3300005840 | Bacteria | 1488 |
| 123 | Ga0068863_100006580 | 3300005841 | Bacteria | 11405 |
| 124 | Ga0068863_100080476 | 3300005841 | Bacteria | 3085 |
| 125 | Ga0068863_100096878 | 3300005841 | Bacteria | 2801 |
| 126 | Ga0068858_100004441 | 3300005842 | Bacteria | 13757 |
| 127 | Ga0068858_100028194 | 3300005842 | Bacteria | 5217 |
| 128 | Ga0068858_100035188 | 3300005842 | Bacteria | 4645 |
| 129 | Ga0068858_100231277 | 3300005842 | Bacteria | 1753 |
| 130 | Ga0068858_100478235 | 3300005842 | Bacteria | 1202 |
| 131 | Ga0068860_100004331 | 3300005843 | Bacteria | 14508 |
| 132 | Ga0068860_100022924 | 3300005843 | Bacteria | 6037 |
| 133 | Ga0068862_100033418 | 3300005844 | Bacteria | 4348 |
| 134 | Ga0068862_100043996 | 3300005844 | Bacteria | 3808 |
| 135 | Ga0068862_100064488 | 3300005844 | Bacteria | 3153 |
| 136 | Ga0068862_100121394 | 3300005844 | Bacteria | 2304 |
| 137 | Ga0068862_100375484 | 3300005844 | Bacteria | 1325 |
| 138 | Ga0081455_10080898 | 3300005937 | Bacteria | 2662 |
| 139 | Ga0081455_10146886 | 3300005937 | Bacteria | 1823 |
| 140 | Ga0081538_10004363 | 3300005981 | Bacteria | 13069 |
| 141 | Ga0081540_1096763 | 3300005983 | Bacteria | 1283 |
| 142 | Ga0081539_10002732 | 3300005985 | Bacteria | 23848 |
| 143 | Ga0081539_10005538 | 3300005985 | Bacteria | 12799 |
| 144 | Ga0081539_10006723 | 3300005985 | Bacteria | 10828 |
| 145 | Ga0075365_10002114 | 3300006038 | Bacteria | 9514 |
| 146 | Ga0075365_10044625 | 3300006038 | Bacteria | 2906 |
| 147 | Ga0075365_10145851 | 3300006038 | Bacteria | 1644 |
| 148 | Ga0075365_10271373 | 3300006038 | Bacteria | 1193 |
| 149 | Ga0075368_10028307 | 3300006042 | Bacteria | 2165 |
| 150 | Ga0075368_10062340 | 3300006042 | Bacteria | 1495 |
| 151 | Ga0075368_10125673 | 3300006042 | Bacteria | 1064 |
| 152 | Ga0075363_100163877 | 3300006048 | Bacteria | 1260 |
| 153 | Ga0075362_10048050 | 3300006177 | Bacteria | 1903 |
| 154 | Ga0075367_10111633 | 3300006178 | Bacteria | 1678 |
| 155 | Ga0075367_10122285 | 3300006178 | Bacteria | 1604 |
| 156 | Ga0075367_10125863 | 3300006178 | Bacteria | 1582 |
| 157 | Ga0075369_10131423 | 3300006186 | Bacteria | 1138 |
| 158 | Ga0097621_100028453 | 3300006237 | Bacteria | 4404 |
| 159 | Ga0097621_100035235 | 3300006237 | Bacteria | 3998 |
| 160 | Ga0097621_100040781 | 3300006237 | Bacteria | 3734 |
| 161 | Ga0097621_100048996 | 3300006237 | Bacteria | 3430 |
| 162 | Ga0075370_10002495 | 3300006353 | Bacteria | 8542 |
| 163 | Ga0075370_10022024 | 3300006353 | Bacteria | 3495 |
| 164 | Ga0075370_10181913 | 3300006353 | Bacteria | 1237 |
| 165 | Ga0068871_100002664 | 3300006358 | Bacteria | 12194 |
| 166 | Ga0068871_100042592 | 3300006358 | Bacteria | 3645 |
| 167 | Ga0068871_100114905 | 3300006358 | Bacteria | 2268 |
| 168 | Ga0068871_100373297 | 3300006358 | Bacteria | 1265 |
| 169 | Ga0068865_100687602 | 3300006881 | Bacteria | 873 |
| 170 | Ga0097620_100006383 | 3300006931 | Bacteria | 11961 |
| 171 | Ga0097620_100028370 | 3300006931 | Bacteria | 5611 |
| 172 | Ga0097620_100032249 | 3300006931 | Bacteria | 5262 |
| 173 | Ga0097620_100041599 | 3300006931 | Bacteria | 4616 |
| 174 | Ga0097620_100204114 | 3300006931 | Bacteria | 2061 |
| 175 | Ga0099794_10058192 | 3300007265 | Bacteria | 1873 |
| 176 | Ga0105251_10023093 | 3300009011 | Bacteria | 3217 |
| 177 | Ga0105244_10000008 | 3300009036 | Bacteria | 302297 |
| 178 | Ga0105244_10044571 | 3300009036 | Bacteria | 2285 |
| 179 | Ga0105240_10033261 | 3300009093 | Bacteria | 6665 |
| 180 | Ga0105240_10066593 | 3300009093 | Bacteria | 4467 |
| 181 | Ga0105240_10356120 | 3300009093 | Bacteria | 1659 |
| 182 | Ga0105240_10398424 | 3300009093 | Bacteria | 1551 |
| 183 | Ga0105240_10679558 | 3300009093 | Bacteria | 1126 |
| 184 | Ga0105245_10036163 | 3300009098 | Bacteria | 4386 |
| 185 | Ga0105245_10138735 | 3300009098 | Bacteria | 2288 |
| 186 | Ga0105245_10225969 | 3300009098 | Bacteria | 1808 |
| 187 | Ga0105245_10319392 | 3300009098 | Bacteria | 1529 |
| 188 | Ga0105245_10458339 | 3300009098 | Bacteria | 1285 |
| 189 | Ga0105247_10008662 | 3300009101 | Bacteria | 6199 |
| 190 | Ga0114129_10414989 | 3300009147 | Bacteria | 1772 |
| 191 | Ga0114129_10454489 | 3300009147 | Bacteria | 1679 |
| 192 | Ga0114129_10773577 | 3300009147 | Bacteria | 1227 |
| 193 | Ga0105243_10091923 | 3300009148 | Bacteria | 2500 |
| 194 | Ga0105243_10361206 | 3300009148 | Bacteria | 1337 |
| 195 | Ga0105241_10036083 | 3300009174 | Bacteria | 3720 |
| 196 | Ga0105241_10157185 | 3300009174 | Bacteria | 1865 |
| 197 | Ga0105242_10208879 | 3300009176 | Bacteria | 1738 |
| 198 | Ga0105248_10041378 | 3300009177 | Bacteria | 5166 |
| 199 | Ga0105248_10061180 | 3300009177 | Bacteria | 4227 |
| 200 | Ga0105248_10088563 | 3300009177 | Bacteria | 3484 |
| 201 | Ga0105248_10364460 | 3300009177 | Bacteria | 1627 |
| 202 | Ga0105248_10447472 | 3300009177 | Bacteria | 1455 |
| 203 | Ga0105248_10689781 | 3300009177 | Bacteria | 1152 |
| 204 | Ga0105237_10000397 | 3300009545 | Bacteria | 61927 |
| 205 | Ga0105237_10009247 | 3300009545 | Bacteria | 10567 |
| 206 | Ga0105237_10019781 | 3300009545 | Bacteria | 6951 |
| 207 | Ga0105237_10054607 | 3300009545 | Bacteria | 4003 |
| 208 | Ga0105238_10001007 | 3300009551 | Bacteria | 28742 |
| 209 | Ga0105238_10038235 | 3300009551 | Bacteria | 4874 |
| 210 | Ga0105238_10105265 | 3300009551 | Bacteria | 2803 |
| 211 | Ga0105238_10158573 | 3300009551 | Bacteria | 2238 |
| 212 | Ga0105238_10314728 | 3300009551 | Bacteria | 1551 |
| 213 | Ga0105238_10405995 | 3300009551 | Bacteria | 1356 |
| 214 | Ga0105249_10028900 | 3300009553 | Bacteria | 5004 |
| 215 | Ga0105249_10161350 | 3300009553 | Bacteria | 2167 |
| 216 | Ga0105249_10388482 | 3300009553 | Bacteria | 1423 |
| 217 | Ga0123341_1000002 | 3300009765 | Bacteria | 191257 |
| 218 | Ga0123342_1030249 | 3300009766 | Bacteria | 2736 |
| 219 | Ga0105239_10014766 | 3300010375 | Bacteria | 8662 |
| 220 | Ga0105239_10050615 | 3300010375 | Bacteria | 4556 |
| 221 | Ga0105239_10161991 | 3300010375 | Bacteria | 2500 |
| 222 | Ga0105239_10572027 | 3300010375 | Bacteria | 1288 |
| 223 | Ga0157373_10107585 | 3300013100 | Bacteria | 1960 |
| 224 | Ga0157370_10009932 | 3300013104 | Bacteria | 10080 |
| 225 | Ga0157370_10075580 | 3300013104 | Bacteria | 3175 |
| 226 | Ga0157369_10082358 | 3300013105 | Bacteria | 3443 |
| 227 | Ga0157369_10188646 | 3300013105 | Bacteria | 2167 |
| 228 | Ga0157374_10025942 | 3300013296 | Bacteria | 5268 |
| 229 | Ga0157374_10033943 | 3300013296 | Bacteria | 4658 |
| 230 | Ga0157374_10167215 | 3300013296 | Bacteria | 2144 |
| 231 | Ga0157378_10045061 | 3300013297 | Bacteria | 3918 |
| 232 | Ga0157378_10136529 | 3300013297 | Bacteria | 2274 |
| 233 | Ga0163162_10024703 | 3300013306 | Bacteria | 5935 |
| 234 | Ga0163162_10045548 | 3300013306 | Bacteria | 4395 |
| 235 | Ga0163162_10057983 | 3300013306 | Bacteria | 3900 |
| 236 | Ga0163162_10423131 | 3300013306 | Bacteria | 1464 |
| 237 | Ga0163162_10739421 | 3300013306 | Bacteria | 1103 |
| 238 | Ga0157372_10011373 | 3300013307 | Bacteria | 9468 |
| 239 | Ga0157372_10708737 | 3300013307 | Bacteria | 1171 |
| 240 | Ga0157375_10008005 | 3300013308 | Bacteria | 9255 |
| 241 | Ga0157375_10023236 | 3300013308 | Bacteria | 5717 |
| 242 | Ga0157375_10356582 | 3300013308 | Bacteria | 1628 |
| 243 | Ga0163163_10261173 | 3300014325 | Bacteria | 1783 |
| 244 | Ga0157380_10014846 | 3300014326 | Bacteria | 5706 |
| 245 | Ga0157380_10069262 | 3300014326 | Bacteria | 2846 |
| 246 | Ga0157380_10240615 | 3300014326 | Bacteria | 1631 |
| 247 | Ga0157380_10359558 | 3300014326 | Bacteria | 1365 |
| 248 | Ga0182008_10036580 | 3300014497 | Bacteria | 2456 |
| 249 | Ga0157377_10040065 | 3300014745 | Bacteria | 2593 |
| 250 | Ga0157379_10032980 | 3300014968 | Bacteria | 4618 |
| 251 | Ga0157379_10048368 | 3300014968 | Bacteria | 3796 |
| 252 | Ga0157379_10079481 | 3300014968 | Bacteria | 2936 |
| 253 | Ga0157379_10110685 | 3300014968 | Bacteria | 2466 |
| 254 | Ga0157379_10146008 | 3300014968 | Bacteria | 2133 |
| 255 | Ga0157379_10172661 | 3300014968 | Bacteria | 1951 |
| 256 | Ga0157379_10188227 | 3300014968 | Bacteria | 1865 |
| 257 | Ga0157376_10017989 | 3300014969 | Bacteria | 5407 |
| 258 | Ga0157376_10300346 | 3300014969 | Bacteria | 1520 |
| 259 | Ga0157376_10415360 | 3300014969 | Bacteria | 1304 |
| 260 | Ga0163161_10000375 | 3300017792 | Bacteria | 37352 |
| 261 | Ga0163161_10015393 | 3300017792 | Bacteria | 5332 |
| 262 | Ga0163161_10046661 | 3300017792 | Bacteria | 3126 |
| 263 | Ga0163161_10473372 | 3300017792 | Bacteria | 1016 |
| 264 | Ga0214544_1000010 | 3300021320 | Bacteria | 270164 |
| 265 | Ga0214542_1000023 | 3300021321 | Bacteria | 191557 |
| 266 | Ga0214543_1000019 | 3300021327 | Bacteria | 267908 |
| 267 | Ga0214543_1000132 | 3300021327 | Bacteria | 102506 |
| 268 | Ga0213872_10025047 | 3300021361 | Bacteria | 2744 |
| 269 | Ga0213872_10065659 | 3300021361 | Bacteria | 1638 |
| 270 | Ga0213876_10007178 | 3300021384 | Bacteria | 6072 |
| 271 | Ga0209026_1000100 | 3300025250 | Bacteria | 156131 |
| 272 | Ga0209148_1000069 | 3300025254 | Bacteria | 334444 |
| 273 | Ga0209148_1003960 | 3300025254 | Bacteria | 3806 |
| 274 | Ga0209759_1000549 | 3300025256 | Bacteria | 38630 |
| 275 | Ga0209233_1000028 | 3300025261 | Bacteria | 642062 |
| 276 | Ga0209455_1000135 | 3300025272 | Bacteria | 148007 |
| 277 | Ga0209130_1000098 | 3300025284 | Bacteria | 142506 |
| 278 | Ga0207426_1000069 | 3300025302 | Bacteria | 334513 |
| 279 | Ga0207656_10033061 | 3300025321 | Bacteria | 2152 |
| 280 | Ga0207656_10093293 | 3300025321 | Bacteria | 1369 |
| 281 | Ga0207655_1000083 | 3300025728 | Bacteria | 213295 |
| 282 | Ga0207642_10003301 | 3300025899 | Bacteria | 5072 |
| 283 | Ga0207642_10017892 | 3300025899 | Bacteria | 2707 |
| 284 | Ga0207642_10079957 | 3300025899 | Bacteria | 1584 |
| 285 | Ga0207642_10306952 | 3300025899 | Bacteria | 922 |
| 286 | Ga0207710_10020079 | 3300025900 | Bacteria | 2854 |
| 287 | Ga0207688_10048621 | 3300025901 | Bacteria | 2370 |
| 288 | Ga0207680_10008233 | 3300025903 | Bacteria | 5111 |
| 289 | Ga0207680_10037305 | 3300025903 | Bacteria | 2805 |
| 290 | Ga0207645_10014615 | 3300025907 | Bacteria | 5247 |
| 291 | Ga0207645_10063671 | 3300025907 | Bacteria | 2356 |
| 292 | Ga0207645_10080212 | 3300025907 | Bacteria | 2092 |
| 293 | Ga0207645_10111210 | 3300025907 | Bacteria | 1773 |
| 294 | Ga0207645_10150484 | 3300025907 | Bacteria | 1519 |
| 295 | Ga0207643_10037483 | 3300025908 | Bacteria | 2721 |
| 296 | Ga0207705_10193299 | 3300025909 | Bacteria | 1540 |
| 297 | Ga0207707_10013657 | 3300025912 | Bacteria | 7081 |
| 298 | Ga0207695_10038212 | 3300025913 | Bacteria | 5171 |
| 299 | Ga0207695_10076226 | 3300025913 | Bacteria | 3410 |
| 300 | Ga0207695_10096031 | 3300025913 | Bacteria | 2966 |
| 301 | Ga0207695_10253863 | 3300025913 | Bacteria | 1657 |
| 302 | Ga0207671_10001048 | 3300025914 | Bacteria | 33586 |
| 303 | Ga0207671_10011147 | 3300025914 | Bacteria | 7344 |
| 304 | Ga0207671_10048066 | 3300025914 | Bacteria | 3158 |
| 305 | Ga0207671_10107859 | 3300025914 | Bacteria | 2116 |
| 306 | Ga0207671_10206365 | 3300025914 | Bacteria | 1536 |
| 307 | Ga0207660_10152323 | 3300025917 | Bacteria | 1777 |
| 308 | Ga0207662_10091224 | 3300025918 | Bacteria | 1874 |
| 309 | Ga0207657_10126788 | 3300025919 | Bacteria | 2096 |
| 310 | Ga0207649_10016189 | 3300025920 | Bacteria | 4200 |
| 311 | Ga0207649_10046174 | 3300025920 | Bacteria | 2674 |
| 312 | Ga0207649_10092468 | 3300025920 | Bacteria | 1983 |
| 313 | Ga0207652_10209720 | 3300025921 | Bacteria | 1754 |
| 314 | Ga0207681_10002332 | 3300025923 | Bacteria | 12077 |
| 315 | Ga0207681_10153866 | 3300025923 | Bacteria | 1726 |
| 316 | Ga0207694_10000939 | 3300025924 | Bacteria | 25682 |
| 317 | Ga0207694_10024125 | 3300025924 | Bacteria | 4618 |
| 318 | Ga0207694_10041236 | 3300025924 | Bacteria | 3556 |
| 319 | Ga0207650_10003921 | 3300025925 | Bacteria | 10179 |
| 320 | Ga0207650_10329831 | 3300025925 | Bacteria | 1251 |
| 321 | Ga0207659_10002102 | 3300025926 | Bacteria | 11796 |
| 322 | Ga0207659_10004947 | 3300025926 | Bacteria | 8080 |
| 323 | Ga0207659_10112987 | 3300025926 | Bacteria | 2068 |
| 324 | Ga0207644_10000391 | 3300025931 | Bacteria | 28488 |
| 325 | Ga0207644_10148455 | 3300025931 | Bacteria | 1812 |
| 326 | Ga0207706_10012440 | 3300025933 | Bacteria | 7753 |
| 327 | Ga0207706_10117616 | 3300025933 | Bacteria | 2338 |
| 328 | Ga0207686_10061306 | 3300025934 | Bacteria | 2384 |
| 329 | Ga0207686_10129417 | 3300025934 | Bacteria | 1729 |
| 330 | Ga0207709_10040090 | 3300025935 | Bacteria | 2802 |
| 331 | Ga0207709_10331959 | 3300025935 | Bacteria | 1142 |
| 332 | Ga0207670_10363940 | 3300025936 | Bacteria | 1148 |
| 333 | Ga0207669_10230800 | 3300025937 | Bacteria | 1365 |
| 334 | Ga0207704_10002411 | 3300025938 | Bacteria | 8409 |
| 335 | Ga0207704_10003969 | 3300025938 | Bacteria | 6732 |
| 336 | Ga0207704_10156931 | 3300025938 | Bacteria | 1614 |
| 337 | Ga0207704_10253923 | 3300025938 | Bacteria | 1322 |
| 338 | Ga0207691_10106812 | 3300025940 | Bacteria | 2493 |
| 339 | Ga0207691_10416751 | 3300025940 | Bacteria | 1145 |
| 340 | Ga0207711_10075706 | 3300025941 | Bacteria | 2930 |
| 341 | Ga0207711_10135078 | 3300025941 | Bacteria | 2215 |
| 342 | Ga0207711_10259726 | 3300025941 | Bacteria | 1596 |
| 343 | Ga0207711_10293817 | 3300025941 | Bacteria | 1498 |
| 344 | Ga0207689_10001138 | 3300025942 | Bacteria | 25663 |
| 345 | Ga0207689_10001210 | 3300025942 | Bacteria | 24834 |
| 346 | Ga0207689_10025123 | 3300025942 | Bacteria | 4993 |
| 347 | Ga0207689_10046936 | 3300025942 | Bacteria | 3568 |
| 348 | Ga0207689_10068759 | 3300025942 | Bacteria | 2910 |
| 349 | Ga0207679_10115679 | 3300025945 | Bacteria | 2125 |
| 350 | Ga0207679_10406468 | 3300025945 | Bacteria | 1199 |
| 351 | Ga0207667_10070326 | 3300025949 | Bacteria | 3642 |
| 352 | Ga0207667_10168889 | 3300025949 | Bacteria | 2248 |
| 353 | Ga0207667_10703046 | 3300025949 | Bacteria | 1013 |
| 354 | Ga0207712_10014157 | 3300025961 | Bacteria | 5121 |
| 355 | Ga0207712_10149895 | 3300025961 | Bacteria | 1800 |
| 356 | Ga0207668_10081767 | 3300025972 | Bacteria | 2344 |
| 357 | Ga0207658_10014043 | 3300025986 | Bacteria | 5481 |
| 358 | Ga0207658_10041836 | 3300025986 | Bacteria | 3320 |
| 359 | Ga0207658_10060711 | 3300025986 | Bacteria | 2822 |
| 360 | Ga0207677_10002667 | 3300026023 | Bacteria | 9401 |
| 361 | Ga0207677_10050917 | 3300026023 | Bacteria | 2804 |
| 362 | Ga0207677_10057425 | 3300026023 | Bacteria | 2672 |
| 363 | Ga0207703_10009260 | 3300026035 | Bacteria | 7744 |
| 364 | Ga0207703_10021839 | 3300026035 | Bacteria | 5011 |
| 365 | Ga0207703_10184954 | 3300026035 | Bacteria | 1841 |
| 366 | Ga0207703_10186380 | 3300026035 | Bacteria | 1835 |
| 367 | Ga0207703_10415708 | 3300026035 | Bacteria | 1250 |
| 368 | Ga0207639_10007355 | 3300026041 | Bacteria | 7504 |
| 369 | Ga0207639_10024149 | 3300026041 | Bacteria | 4395 |
| 370 | Ga0207639_10043661 | 3300026041 | Bacteria | 3367 |
| 371 | Ga0207639_10083123 | 3300026041 | Bacteria | 2541 |
| 372 | Ga0207639_10188821 | 3300026041 | Bacteria | 1758 |
| 373 | Ga0207639_10694793 | 3300026041 | Bacteria | 943 |
| 374 | Ga0207678_10028557 | 3300026067 | Bacteria | 4869 |
| 375 | Ga0207678_10043551 | 3300026067 | Bacteria | 3884 |
| 376 | Ga0207678_10322066 | 3300026067 | Bacteria | 1330 |
| 377 | Ga0207708_10007488 | 3300026075 | Bacteria | 8069 |
| 378 | Ga0207708_10077668 | 3300026075 | Bacteria | 2548 |
| 379 | Ga0207708_10101084 | 3300026075 | Bacteria | 2232 |
| 380 | Ga0207708_10551199 | 3300026075 | Bacteria | 972 |
| 381 | Ga0207641_10003042 | 3300026088 | Bacteria | 15111 |
| 382 | Ga0207641_10064788 | 3300026088 | Bacteria | 3124 |
| 383 | Ga0207641_10106666 | 3300026088 | Bacteria | 2477 |
| 384 | Ga0207641_10171221 | 3300026088 | Bacteria | 1982 |
| 385 | Ga0207648_10002672 | 3300026089 | Bacteria | 18989 |
| 386 | Ga0207648_10020858 | 3300026089 | Bacteria | 5900 |
| 387 | Ga0207648_10023482 | 3300026089 | Bacteria | 5523 |
| 388 | Ga0207648_10082941 | 3300026089 | Bacteria | 2796 |
| 389 | Ga0207648_10115887 | 3300026089 | Bacteria | 2355 |
| 390 | Ga0207648_10651299 | 3300026089 | Bacteria | 974 |
| 391 | Ga0207676_10020763 | 3300026095 | Bacteria | 4809 |
| 392 | Ga0207676_10103059 | 3300026095 | Bacteria | 2370 |
| 393 | Ga0207676_10214101 | 3300026095 | Bacteria | 1711 |
| 394 | Ga0207674_10021614 | 3300026116 | Bacteria | 6927 |
| 395 | Ga0207674_10028028 | 3300026116 | Bacteria | 5951 |
| 396 | Ga0207674_10041929 | 3300026116 | Bacteria | 4730 |
| 397 | Ga0207674_10042765 | 3300026116 | Bacteria | 4676 |
| 398 | Ga0207674_10043491 | 3300026116 | Bacteria | 4631 |
| 399 | Ga0207675_100006819 | 3300026118 | Bacteria | 10814 |
| 400 | Ga0207675_100013077 | 3300026118 | Bacteria | 7747 |
| 401 | Ga0207675_100013316 | 3300026118 | Bacteria | 7676 |
| 402 | Ga0207675_100027523 | 3300026118 | Bacteria | 5295 |
| 403 | Ga0207683_10066240 | 3300026121 | Bacteria | 3185 |
| 404 | Ga0207683_10087595 | 3300026121 | Bacteria | 2769 |
| 405 | Ga0207698_10012540 | 3300026142 | Bacteria | 5553 |
| 406 | Ga0207698_10110387 | 3300026142 | Bacteria | 2304 |
| 407 | Ga0207428_10088859 | 3300027907 | Bacteria | 2402 |
| 408 | Ga0268266_10000257 | 3300028379 | Bacteria | 89384 |
| 409 | Ga0268266_10033856 | 3300028379 | Bacteria | 4342 |
| 410 | Ga0268266_10067552 | 3300028379 | Bacteria | 3094 |
| 411 | Ga0268266_10099515 | 3300028379 | Bacteria | 2560 |
| 412 | Ga0268266_10123949 | 3300028379 | Bacteria | 2303 |
| 413 | Ga0268266_10181019 | 3300028379 | Bacteria | 1919 |
| 414 | Ga0268265_10101967 | 3300028380 | Bacteria | 2320 |
| 415 | Ga0268265_10119785 | 3300028380 | Bacteria | 2166 |
| 416 | Ga0268265_10136798 | 3300028380 | Bacteria | 2045 |
| 417 | Ga0268265_10165509 | 3300028380 | Bacteria | 1884 |
| 418 | Ga0268265_10241758 | 3300028380 | Bacteria | 1593 |
| 419 | Ga0268264_10001001 | 3300028381 | Bacteria | 28672 |
| 420 | Ga0268264_10003066 | 3300028381 | Bacteria | 14474 |
| 421 | Ga0268264_10023023 | 3300028381 | Bacteria | 5083 |
| 422 | Ga0268264_10081093 | 3300028381 | Bacteria | 2772 |
| 423 | Ga0268264_10198848 | 3300028381 | Bacteria | 1832 |
| 424 | Ga0307515_10001956 | 3300028794 | Bacteria | 45627 |
| 425 | Ga0265332_10070180 | 3300031238 | Bacteria | 1493 |
| 426 | Ga0265325_10012043 | 3300031241 | Bacteria | 4955 |
| 427 | Ga0265340_10103457 | 3300031247 | Bacteria | 1322 |
| 428 | Ga0265339_10215540 | 3300031249 | Bacteria | 941 |
| 429 | Ga0265331_10021115 | 3300031250 | Bacteria | 3336 |
| 430 | Ga0265331_10092429 | 3300031250 | Bacteria | 1397 |
| 431 | Ga0265316_10448039 | 3300031344 | Bacteria | 926 |
| 432 | Ga0307513_10154305 | 3300031456 | Bacteria | 2199 |
| 433 | Ga0307408_100184963 | 3300031548 | Bacteria | 1674 |
| 434 | Ga0265313_10066804 | 3300031595 | Bacteria | 1665 |
| 435 | Ga0265314_10036505 | 3300031711 | Bacteria | 3571 |
| 436 | Ga0265314_10207403 | 3300031711 | Bacteria | 1153 |
| 437 | Ga0307405_10055754 | 3300031731 | Bacteria | 2475 |
| 438 | Ga0307413_10154821 | 3300031824 | Bacteria | 1602 |
| 439 | Ga0307413_10391905 | 3300031824 | Bacteria | 1085 |
| 440 | Ga0307406_10165481 | 3300031901 | Bacteria | 1595 |
| 441 | Ga0307406_10182726 | 3300031901 | Bacteria | 1528 |
| 442 | Ga0307406_10212650 | 3300031901 | Bacteria | 1432 |
| 443 | Ga0307407_10135268 | 3300031903 | Bacteria | 1583 |
| 444 | Ga0307412_10364108 | 3300031911 | Bacteria | 1165 |
| 445 | Ga0307409_100071106 | 3300031995 | Bacteria | 2765 |
| 446 | Ga0307409_100435895 | 3300031995 | Bacteria | 1261 |
| 447 | Ga0307416_100011529 | 3300032002 | Bacteria | 5903 |
| 448 | Ga0307416_100025422 | 3300032002 | Bacteria | 4340 |
| 449 | Ga0307411_10175938 | 3300032005 | Bacteria | 1619 |
| 450 | Ga0307415_100112335 | 3300032126 | Bacteria | 2024 |
| 451 | Ga0307415_100271516 | 3300032126 | Bacteria | 1389 |
| 452 | Ga0373962_0019366 | 3300035242 | Bacteria | 1780 |
| 453 | Ga0373931_0030437 | 3300035691 | Bacteria | 2778 |
| 454 | Ga0395899_0084472 | 3300037312 | Bacteria | 2308 |
| 455 | Ga0395900_0014410 | 3300037418 | Bacteria | 8069 |
| 456 | Ga0395900_0117317 | 3300037418 | Bacteria | 2731 |
| 457 | Ga0395898_0250599 | 3300037466 | Bacteria | 1689 |
| 458 | Ga0395905_0015692 | 3300037471 | Bacteria | 7196 |
| 459 | Ga0395905_0133797 | 3300037471 | Bacteria | 2332 |
| 460 | Ga0395905_0252820 | 3300037471 | Bacteria | 1646 |
| 461 | Ga0395905_0344751 | 3300037471 | Bacteria | 1381 |
| 462 | Ga0395901_0047074 | 3300038443 | Bacteria | 4479 |
| 463 | Ga0395901_0076932 | 3300038443 | Bacteria | 3482 |
| 464 | Ga0395901_0151688 | 3300038443 | Bacteria | 2435 |
| 465 | Ga0436365_0551841 | 3300039437 | Bacteria | 1251 |
| 466 | Ga0436365_1295259 | 3300039437 | Bacteria | 8569 |
| 467 | Ga0436361_0060394 | 3300039447 | Bacteria | 4673 |
| 468 | Ga0436361_0845671 | 3300039447 | Bacteria | 3085 |
| 469 | Ga0439438_000021 | 3300041405 | Bacteria | 109330 |
| 470 | Ga0439447_002674 | 3300041407 | Bacteria | 6453 |
| 471 | Ga0439465_0035766 | 3300041413 | Bacteria | 1593 |
| 472 | Ga0451841_0277328 | 3300041498 | Bacteria | 1627 |
| 473 | Ga0451843_1665491 | 3300041509 | Bacteria | 1372 |
| 474 | Ga0451855_1135979 | 3300041511 | Bacteria | 1792 |
| 475 | Ga0451853_1535672 | 3300041512 | Bacteria | 1966 |
| 476 | Ga0451853_3126826 | 3300041512 | Bacteria | 2691 |
| 477 | Ga0439445_0079000 | 3300042004 | Bacteria | 918 |
| 478 | Ga0439432_020645 | 3300042006 | Bacteria | 2187 |
| 479 | Ga0439450_033059 | 3300042008 | Bacteria | 1171 |
| 480 | Ga0450908_012082 | 3300042184 | Bacteria | 1571 |
| 481 | Ga0439435_0050826 | 3300042436 | Bacteria | 1186 |
| 482 | Ga0439464_0006733 | 3300042439 | Bacteria | 2996 |
| 483 | Ga0466972_0029385 | 3300044658 | Bacteria | 2706 |
| 484 | Ga0451576_0064685 | 3300045051 | Bacteria | 3809 |
| 485 | Ga0466958_0157855 | 3300045836 | Bacteria | 1432 |
| 486 | Ga0466967_0306169 | 3300045976 | Bacteria | 1530 |
| 487 | Ga0495627_001317 | 3300046453 | Bacteria | 15130 |
| 488 | Ga0495591_002496 | 3300046458 | Bacteria | 10186 |
| 489 | Ga0495629_0199720 | 3300046459 | Bacteria | 1383 |
| 490 | Ga0495638_0042235 | 3300046460 | Bacteria | 2881 |
| 491 | Ga0495638_0215387 | 3300046460 | Bacteria | 1076 |
| 492 | Ga0495650_0000008 | 3300046471 | Bacteria | 688246 |
| 493 | Ga0495650_0013567 | 3300046471 | Bacteria | 4299 |
| 494 | Ga0495650_0062159 | 3300046471 | Bacteria | 1493 |
| 495 | Ga0495580_0016298 | 3300046472 | Bacteria | 5580 |
| 496 | Ga0495605_0019290 | 3300046474 | Bacteria | 3647 |
| 497 | Ga0495605_0031401 | 3300046474 | Bacteria | 2713 |
| 498 | Ga0495584_0022473 | 3300046491 | Bacteria | 3200 |
| 499 | Ga0495596_0112964 | 3300046500 | Bacteria | 1055 |
| 500 | Ga0495607_0009540 | 3300046501 | Bacteria | 6560 |
| 501 | Ga0495607_0148138 | 3300046501 | Bacteria | 1204 |
| 502 | Ga0495606_0001619 | 3300046507 | Bacteria | 29382 |
| 503 | Ga0495610_0018917 | 3300046512 | Bacteria | 3872 |
| 504 | Ga0495616_0013102 | 3300046513 | Bacteria | 4688 |
| 505 | Ga0495620_0016163 | 3300046515 | Bacteria | 3754 |
| 506 | Ga0495628_0532409 | 3300046516 | Bacteria | 845 |
| 507 | Ga0495631_0056290 | 3300046518 | Bacteria | 1712 |
| 508 | Ga0495631_0078236 | 3300046518 | Bacteria | 1428 |
| 509 | Ga0495632_0024918 | 3300046519 | Bacteria | 3171 |
| 510 | Ga0495637_0078976 | 3300046520 | Bacteria | 1315 |
| 511 | Ga0495643_0128851 | 3300046522 | Bacteria | 1272 |
| 512 | Ga0495644_0025575 | 3300046523 | Bacteria | 2240 |
| 513 | Ga0495648_0007216 | 3300046524 | Bacteria | 8929 |
| 514 | Ga0495648_0014184 | 3300046524 | Bacteria | 5846 |
| 515 | Ga0495648_0031408 | 3300046524 | Bacteria | 3497 |
| 516 | Ga0495654_0076200 | 3300046530 | Bacteria | 1581 |
| 517 | Ga0495621_0047296 | 3300046539 | Bacteria | 1529 |
| 518 | Ga0495597_0013170 | 3300046542 | Bacteria | 3969 |
| 519 | Ga0495597_0091737 | 3300046542 | Bacteria | 1289 |
| 520 | Ga0495656_0000137 | 3300046615 | Bacteria | 27177 |
| 521 | Ga0495656_0012841 | 3300046615 | Bacteria | 3102 |
| 522 | Ga0495668_0036681 | 3300046616 | Bacteria | 2746 |
| 523 | Ga0495668_0044095 | 3300046616 | Bacteria | 2479 |
| 524 | Ga0495625_0005544 | 3300046660 | Bacteria | 11461 |
| 525 | Ga0495625_0021804 | 3300046660 | Bacteria | 4921 |
| 526 | Ga0495625_0145329 | 3300046660 | Bacteria | 1597 |
| 527 | Ga0495625_0247566 | 3300046660 | Bacteria | 1158 |
| 528 | Ga0495624_0097942 | 3300046690 | Bacteria | 1807 |
| 529 | Ga0495671_0009568 | 3300046692 | Bacteria | 5409 |
| 530 | Ga0495649_0003827 | 3300046694 | Bacteria | 9962 |
| 531 | Ga0495649_0051331 | 3300046694 | Bacteria | 2237 |
| 532 | Ga0495589_0016275 | 3300046794 | Bacteria | 3823 |
| 533 | Ga0495660_0000019 | 3300046810 | Bacteria | 311047 |
| 534 | Ga0495660_0053584 | 3300046810 | Bacteria | 2189 |
| 535 | Ga0495672_0000003 | 3300047320 | Bacteria | 728845 |
| 536 | Ga0495676_0041260 | 3300047321 | Bacteria | 3800 |
| 537 | Ga0495680_0199987 | 3300047322 | Bacteria | 1434 |
| 538 | Ga0495683_0060105 | 3300047323 | Bacteria | 1884 |
| 539 | Ga0495687_000315 | 3300047443 | Bacteria | 62841 |
| 540 | Ga0495687_004781 | 3300047443 | Bacteria | 8944 |
| 541 | Ga0495673_0000011 | 3300047469 | Bacteria | 674140 |
| 542 | Ga0495681_0046366 | 3300047470 | Bacteria | 2073 |
| 543 | Ga0495686_0024783 | 3300047472 | Bacteria | 3937 |
| 544 | Ga0495686_0025877 | 3300047472 | Bacteria | 3843 |
| 545 | Ga0495686_0052543 | 3300047472 | Bacteria | 2555 |
| 546 | Ga0495686_0058797 | 3300047472 | Bacteria | 2395 |
| 547 | Ga0495593_0034342 | 3300047673 | Bacteria | 2759 |
| 548 | Ga0495602_0349358 | 3300048088 | Bacteria | 1068 |
| 549 | Ga0495615_0019143 | 3300048090 | Bacteria | 1517 |
| 550 | Ga0495615_0031301 | 3300048090 | Bacteria | 1275 |
| 551 | Ga0496102_0031944 | 3300048905 | Bacteria | 4727 |
| 552 | Ga0496105_0431673 | 3300048908 | Bacteria | 1042 |
| 553 | Ga0496106_0015363 | 3300048909 | Bacteria | 5666 |
| 554 | Ga0496107_0057456 | 3300048910 | Bacteria | 2812 |
| 555 | Ga0496108_0083530 | 3300048911 | Bacteria | 2709 |
| 556 | Ga0496108_0137129 | 3300048911 | Bacteria | 2106 |
| 557 | Ga0496108_0559098 | 3300048911 | Bacteria | 998 |
| 558 | Ga0496109_0275367 | 3300048912 | Bacteria | 1586 |
| 559 | Ga0496110_0008710 | 3300048913 | Bacteria | 8172 |
| 560 | Ga0496111_0082657 | 3300048914 | Bacteria | 2346 |
| 561 | Ga0496112_0001731 | 3300048915 | Bacteria | 17084 |
| 562 | Ga0496112_0690544 | 3300048915 | Bacteria | 949 |
| 563 | Ga0496113_0165586 | 3300048916 | Bacteria | 1749 |
| 564 | Ga0496114_0280180 | 3300048917 | Bacteria | 1470 |
| 565 | Ga0496116_0000076 | 3300048919 | Bacteria | 229670 |
| 566 | Ga0496119_0000044 | 3300048922 | Bacteria | 191820 |
| 567 | Ga0496119_0001021 | 3300048922 | Bacteria | 35860 |
| 568 | Ga0496119_0010974 | 3300048922 | Bacteria | 7562 |
| 569 | Ga0496120_0000044 | 3300048923 | Bacteria | 192292 |
| 570 | Ga0496120_0000073 | 3300048923 | Bacteria | 164280 |
| 571 | Ga0496120_0002155 | 3300048923 | Bacteria | 20986 |
| 572 | Ga0496120_0020849 | 3300048923 | Bacteria | 4153 |
| 573 | Ga0496121_0154062 | 3300048924 | Bacteria | 1688 |
| 574 | Ga0496121_0167571 | 3300048924 | Bacteria | 1599 |
| 575 | Ga0496124_0392689 | 3300048927 | Bacteria | 966 |
| 576 | Ga0496125_0066554 | 3300048928 | Bacteria | 2846 |
| 577 | Ga0496126_0046351 | 3300048929 | Bacteria | 3988 |
| 578 | Ga0496126_0152871 | 3300048929 | Bacteria | 1977 |
| 579 | Ga0495678_000479 | 3300049459 | Bacteria | 39762 |
| 580 | Ga0495682_0000006 | 3300049460 | Bacteria | 316373 |
| 581 | Ga0501031_0026318 | 3300049568 | Bacteria | 3793 |
| 582 | Ga0501031_0058101 | 3300049568 | Bacteria | 2520 |
| 583 | Ga0501032_0000018 | 3300049569 | Bacteria | 156275 |
| 584 | Ga0501032_0012010 | 3300049569 | Bacteria | 6200 |
| 585 | Ga0501032_0016409 | 3300049569 | Bacteria | 5209 |
| 586 | Ga0501032_0145442 | 3300049569 | Bacteria | 1560 |
| 587 | Ga0501033_0000032 | 3300049570 | Bacteria | 156304 |
| 588 | Ga0501033_0010055 | 3300049570 | Bacteria | 7263 |
| 589 | Ga0501033_0022431 | 3300049570 | Bacteria | 4762 |
| 590 | Ga0501033_0048959 | 3300049570 | Bacteria | 3138 |
| 591 | Ga0501034_0000103 | 3300049571 | Bacteria | 156304 |
| 592 | Ga0501034_0000444 | 3300049571 | Bacteria | 68426 |
| 593 | Ga0501034_0013483 | 3300049571 | Bacteria | 8413 |
| 594 | Ga0501034_0026618 | 3300049571 | Bacteria | 5888 |
| 595 | Ga0501034_0043168 | 3300049571 | Bacteria | 4564 |
| 596 | Ga0501034_0050527 | 3300049571 | Bacteria | 4193 |
| 597 | Ga0501034_0051840 | 3300049571 | Bacteria | 4136 |
| 598 | Ga0501034_0053228 | 3300049571 | Bacteria | 4077 |
| 599 | Ga0501034_0085368 | 3300049571 | Bacteria | 3158 |
| 600 | Ga0501034_0176639 | 3300049571 | Bacteria | 2101 |
| 601 | Ga0501034_0177927 | 3300049571 | Bacteria | 2093 |
| 602 | Ga0501034_0201026 | 3300049571 | Bacteria | 1951 |
| 603 | Ga0501034_0371386 | 3300049571 | Bacteria | 1356 |
| 604 | Ga0501034_0584761 | 3300049571 | Bacteria | 1023 |
| 605 | Ga0501036_0000012 | 3300049572 | Bacteria | 156304 |
| 606 | Ga0501036_0021735 | 3300049572 | Bacteria | 5393 |
| 607 | Ga0501036_0357484 | 3300049572 | Bacteria | 1219 |
| 608 | Ga0501037_0000018 | 3300049573 | Bacteria | 156304 |
| 609 | Ga0501037_0070785 | 3300049573 | Bacteria | 2537 |
| 610 | Ga0501037_0361101 | 3300049573 | Bacteria | 1001 |
| 611 | Ga0501038_0000017 | 3300049574 | Bacteria | 156304 |
| 612 | Ga0501038_0035575 | 3300049574 | Bacteria | 4371 |
| 613 | Ga0501039_0000024 | 3300049575 | Bacteria | 156304 |
| 614 | Ga0501039_0085075 | 3300049575 | Bacteria | 2463 |
| 615 | Ga0501039_0095117 | 3300049575 | Bacteria | 2322 |
| 616 | Ga0501040_0040528 | 3300049576 | Bacteria | 3169 |
| 617 | Ga0501043_0004332 | 3300049579 | Bacteria | 11551 |
| 618 | Ga0501043_0035219 | 3300049579 | Bacteria | 3938 |
| 619 | Ga0501043_0040158 | 3300049579 | Bacteria | 3678 |
| 620 | Ga0501043_0047170 | 3300049579 | Bacteria | 3387 |
| 621 | Ga0501043_0126877 | 3300049579 | Bacteria | 2001 |
| 622 | Ga0501043_0210059 | 3300049579 | Bacteria | 1509 |
| 623 | Ga0501046_0020293 | 3300049580 | Bacteria | 5498 |
| 624 | Ga0501047_0004558 | 3300049581 | Bacteria | 13028 |
| 625 | Ga0501047_0008752 | 3300049581 | Bacteria | 9553 |
| 626 | Ga0501047_0075346 | 3300049581 | Bacteria | 3247 |
| 627 | Ga0501047_0084654 | 3300049581 | Bacteria | 3047 |
| 628 | Ga0501047_0086899 | 3300049581 | Bacteria | 3004 |
| 629 | Ga0501047_0134003 | 3300049581 | Bacteria | 2357 |
| 630 | Ga0501047_0242319 | 3300049581 | Bacteria | 1653 |
| 631 | Ga0501047_0289007 | 3300049581 | Bacteria | 1483 |
| 632 | Ga0501067_0017674 | 3300049583 | Bacteria | 3948 |
| 633 | Ga0501068_0000614 | 3300049584 | Bacteria | 18139 |
| 634 | Ga0501068_0026011 | 3300049584 | Bacteria | 3445 |
| 635 | Ga0501069_0010352 | 3300049585 | Bacteria | 4935 |
| 636 | Ga0501069_0013466 | 3300049585 | Bacteria | 4361 |
| 637 | Ga0501069_0043505 | 3300049585 | Bacteria | 2486 |
| 638 | Ga0501070_0007753 | 3300049586 | Bacteria | 9100 |
| 639 | Ga0501070_0026001 | 3300049586 | Bacteria | 4911 |
| 640 | Ga0501070_0093477 | 3300049586 | Bacteria | 2488 |
| 641 | Ga0501070_0145407 | 3300049586 | Bacteria | 1957 |
| 642 | Ga0501070_0364503 | 3300049586 | Bacteria | 1172 |
| 643 | Ga0501071_0014047 | 3300049587 | Bacteria | 5472 |
| 644 | Ga0501072_0274843 | 3300049588 | Bacteria | 1340 |
| 645 | Ga0501073_0000143 | 3300049589 | Bacteria | 47217 |
| 646 | Ga0501073_0016948 | 3300049589 | Bacteria | 5276 |
| 647 | Ga0501073_0025527 | 3300049589 | Bacteria | 4236 |
| 648 | Ga0501073_0031477 | 3300049589 | Bacteria | 3785 |
| 649 | Ga0501073_0087298 | 3300049589 | Bacteria | 2169 |
| 650 | Ga0501073_0090803 | 3300049589 | Bacteria | 2123 |
| 651 | Ga0501073_0099760 | 3300049589 | Bacteria | 2016 |
| 652 | Ga0501073_0144825 | 3300049589 | Bacteria | 1646 |
| 653 | Ga0501073_0248679 | 3300049589 | Bacteria | 1227 |
| 654 | Ga0501074_0031683 | 3300049590 | Bacteria | 3830 |
| 655 | Ga0501074_0043632 | 3300049590 | Bacteria | 3246 |
| 656 | Ga0501074_0185745 | 3300049590 | Bacteria | 1482 |
| 657 | Ga0501076_0069235 | 3300049592 | Bacteria | 2820 |
| 658 | Ga0501077_0004814 | 3300049593 | Bacteria | 8204 |
| 659 | Ga0501079_0172456 | 3300049741 | Bacteria | 1687 |
| 660 | Ga0501080_0000955 | 3300049742 | Bacteria | 23659 |
| 661 | Ga0501080_0016628 | 3300049742 | Bacteria | 6796 |
| 662 | Ga0501080_0035296 | 3300049742 | Bacteria | 4667 |
| 663 | Ga0501080_0290864 | 3300049742 | Bacteria | 1483 |
| 664 | Ga0501080_0311304 | 3300049742 | Bacteria | 1427 |
| 665 | Ga0501080_0408157 | 3300049742 | Bacteria | 1221 |
| 666 | Ga0501080_0691419 | 3300049742 | Bacteria | 900 |
| 667 | Ga0501083_0008455 | 3300049744 | Bacteria | 7274 |
| 668 | Ga0501083_0044759 | 3300049744 | Bacteria | 2996 |
| 669 | Ga0501083_0064134 | 3300049744 | Bacteria | 2448 |
| 670 | Ga0501083_0080260 | 3300049744 | Bacteria | 2163 |
| 671 | Ga0501035_0000040 | 3300049822 | Bacteria | 156262 |
| 672 | Ga0501035_0005942 | 3300049822 | Bacteria | 11492 |
| 673 | Ga0501035_0010917 | 3300049822 | Bacteria | 8410 |
| 674 | Ga0501035_0013756 | 3300049822 | Bacteria | 7469 |
| 675 | Ga0501035_0031169 | 3300049822 | Bacteria | 4856 |
| 676 | Ga0501035_0047332 | 3300049822 | Bacteria | 3861 |
| 677 | Ga0501035_0108123 | 3300049822 | Bacteria | 2438 |
| 678 | Ga0501035_0155127 | 3300049822 | Bacteria | 1985 |
| 679 | Ga0501044_0000040 | 3300049823 | Bacteria | 156304 |
| 680 | Ga0501044_0007916 | 3300049823 | Bacteria | 11685 |
| 681 | Ga0501044_0013108 | 3300049823 | Bacteria | 8975 |
| 682 | Ga0501044_0059837 | 3300049823 | Bacteria | 3902 |
| 683 | Ga0501044_0061348 | 3300049823 | Bacteria | 3846 |
| 684 | Ga0501044_0064588 | 3300049823 | Bacteria | 3736 |
| 685 | Ga0501044_0395455 | 3300049823 | Bacteria | 1295 |
| 686 | nmdc:mga03683_114917_c1 | 3300050489 | Bacteria | 1193 |
| 687 | nmdc:mga03683_57021_c1 | 3300050489 | Bacteria | 1643 |
| 688 | nmdc:mga0yw44_177287_c1 | 3300050492 | Bacteria | 1401 |
| 689 | nmdc:mga0yw44_315155_c1 | 3300050492 | Bacteria | 1050 |
| 690 | nmdc:mga0yw44_82007_c1 | 3300050492 | Bacteria | 2023 |
| 691 | nmdc:mga0k408_45484_c1 | 3300050493 | Bacteria | 2533 |
| 692 | nmdc:mga0k408_68018_c1 | 3300050493 | Bacteria | 2077 |
| 693 | nmdc:mga06z11_257117_c1 | 3300050494 | Bacteria | 1030 |
| 694 | nmdc:mga06z11_308338_c1 | 3300050494 | Bacteria | 942 |
| 695 | nmdc:mga04h51_79090_c1 | 3300050495 | Bacteria | 1163 |
| 696 | nmdc:mga07m45_17151_c1 | 3300050496 | Bacteria | 3884 |
| 697 | nmdc:mga07m45_378_c1 | 3300050496 | Bacteria | 18230 |
| 698 | nmdc:mga05p37_346908_c1 | 3300050507 | Bacteria | 1749 |
| 699 | nmdc:mga06r32_15012_c1 | 3300050510 | Bacteria | 7030 |
| 700 | nmdc:mga06r32_212448_c1 | 3300050510 | Bacteria | 1922 |
| 701 | nmdc:mga08y16_430057_c1 | 3300050511 | Bacteria | 1348 |
| 702 | nmdc:mga0sz30_116209_c1 | 3300050516 | Bacteria | 1174 |
| 703 | nmdc:mga0sz30_41876_c1 | 3300050516 | Bacteria | 1926 |
| 704 | Ga0495619_0314681 | 3300053085 | Bacteria | 1084 |
| 705 | Ga0500643_022254 | 3300053087 | Bacteria | 2043 |
| 706 | Ga0500555_021183 | 3300053103 | Bacteria | 1871 |
| 707 | Ga0500562_055410 | 3300053108 | Bacteria | 1063 |
| 708 | Ga0500621_000004 | 3300053126 | Bacteria | 485792 |
| 709 | Ga0500568_0000010 | 3300053139 | Bacteria | 249043 |
| 710 | Ga0500568_0017450 | 3300053139 | Bacteria | 3169 |
| 711 | Ga0500616_0055079 | 3300053153 | Bacteria | 2081 |
| 712 | Ga0500616_0145217 | 3300053153 | Bacteria | 1104 |
| 713 | Ga0500620_000598 | 3300053155 | Bacteria | 6198 |
| 714 | Ga0500622_0000734 | 3300053156 | Bacteria | 28647 |
| 715 | Ga0500622_0045878 | 3300053156 | Bacteria | 2261 |
| 716 | Ga0500627_0161288 | 3300053158 | Bacteria | 1011 |
| 717 | Ga0500645_002075 | 3300053730 | Bacteria | 9285 |
| 718 | Ga0501084_0086241 | 3300054114 | Bacteria | 2636 |
| 719 | Ga0501082_0017173 | 3300060353 | Bacteria | 6234 |
| 720 | Ga0501082_0442417 | 3300060353 | Bacteria | 1135 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045836 | Ga0466958_0157855 | Ga0466958_0157855_243_1007 | 219 |
| 2 | 3300026041 | Ga0207639_10694793 | Ga0207639_106947931 | 230 |
| 3 | iso_pu_bacteria | 3003930520 | 3003931263 | 242 |
| 4 | 3300053085 | Ga0495619_0314681 | Ga0495619_0314681_202_939 | 243 |
| 5 | iso_pu_bacteria | 2938014810 | 2938016112 | 243 |
| 6 | 3300005344 | Ga0070661_100001089 | Ga0070661_1000010896 | 251 |
| 7 | 3300005539 | Ga0068853_100006106 | Ga0068853_1000061068 | 251 |
| 8 | 3300005614 | Ga0068856_100034379 | Ga0068856_1000343793 | 251 |
| 9 | 3300005616 | Ga0068852_100007354 | Ga0068852_1000073546 | 251 |
| 10 | 3300005834 | Ga0068851_10000365 | Ga0068851_100003658 | 251 |
| 11 | 3300009093 | Ga0105240_10066593 | Ga0105240_100665934 | 251 |
| 12 | 3300009174 | Ga0105241_10036083 | Ga0105241_100360834 | 251 |
| 13 | 3300009545 | Ga0105237_10019781 | Ga0105237_100197818 | 251 |
| 14 | 3300009551 | Ga0105238_10038235 | Ga0105238_100382354 | 251 |
| 15 | 3300025913 | Ga0207695_10096031 | Ga0207695_100960314 | 251 |
| 16 | 3300025914 | Ga0207671_10011147 | Ga0207671_100111478 | 251 |
| 17 | 3300025920 | Ga0207649_10016189 | Ga0207649_100161895 | 251 |
| 18 | 3300025949 | Ga0207667_10168889 | Ga0207667_101688892 | 251 |
| 19 | 3300026041 | Ga0207639_10024149 | Ga0207639_100241492 | 251 |
| 20 | 3300026116 | Ga0207674_10043491 | Ga0207674_100434916 | 251 |
| 21 | 3300049579 | Ga0501043_0047170 | Ga0501043_0047170_2246_3076 | 256 |
| 22 | 3300049581 | Ga0501047_0075346 | Ga0501047_0075346_2111_2941 | 256 |
| 23 | 3300049575 | Ga0501039_0095117 | Ga0501039_0095117_852_1637 | 258 |
| 24 | iso_pu_bacteria | 2513237351 | 2514585981 | 258 |
| 25 | 3300005364 | Ga0070673_100164516 | Ga0070673_1001645162 | 259 |
| 26 | 3300006042 | Ga0075368_10062340 | Ga0075368_100623402 | 259 |
| 27 | 3300006881 | Ga0068865_100687602 | Ga0068865_1006876021 | 259 |
| 28 | 3300013296 | Ga0157374_10033943 | Ga0157374_100339433 | 259 |
| 29 | 3300013297 | Ga0157378_10045061 | Ga0157378_100450612 | 259 |
| 30 | 3300013306 | Ga0163162_10423131 | Ga0163162_104231311 | 259 |
| 31 | 3300014969 | Ga0157376_10017989 | Ga0157376_100179895 | 259 |
| 32 | 3300021384 | Ga0213876_10007178 | Ga0213876_100071782 | 259 |
| 33 | 3300049569 | Ga0501032_0145442 | Ga0501032_0145442_735_1526 | 259 |
| 34 | 3300049579 | Ga0501043_0126877 | Ga0501043_0126877_12_797 | 259 |
| 35 | 3300050495 | nmdc:mga04h51_79090_c1 | nmdc:mga04h51_79090_c1_276_1061 | 259 |
| 36 | 3300005578 | Ga0068854_100193943 | Ga0068854_1001939432 | 260 |
| 37 | 3300009098 | Ga0105245_10319392 | Ga0105245_103193921 | 260 |
| 38 | 3300041511 | Ga0451855_1135979 | Ga0451855_1135979_19_816 | 260 |
| 39 | 3300046516 | Ga0495628_0532409 | Ga0495628_0532409_18_821 | 260 |
| 40 | 3300047321 | Ga0495676_0041260 | Ga0495676_0041260_2985_3788 | 260 |
| 41 | 3300050510 | nmdc:mga06r32_15012_c1 | nmdc:mga06r32_15012_c1_3034_3831 | 260 |
| 42 | iso_pu_bacteria | 2871466892 | 2871473272 | 260 |
| 43 | iso_pu_bacteria | 2906378014 | 2906384876 | 260 |
| 44 | 3300025909 | Ga0207705_10193299 | Ga0207705_101932992 | 262 |
| 45 | 3300049573 | Ga0501037_0361101 | Ga0501037_0361101_172_966 | 262 |
| 46 | 3300049586 | Ga0501070_0364503 | Ga0501070_0364503_36_824 | 262 |
| 47 | 3300005985 | Ga0081539_10002732 | Ga0081539_1000273219 | 263 |
| 48 | 3300044658 | Ga0466972_0029385 | Ga0466972_0029385_11_814 | 263 |
| 49 | 3300013104 | Ga0157370_10075580 | Ga0157370_100755802 | 264 |
| 50 | 3300048927 | Ga0496124_0392689 | Ga0496124_0392689_128_937 | 264 |
| 51 | 3300013306 | Ga0163162_10045548 | Ga0163162_100455482 | 265 |
| 52 | 3300048912 | Ga0496109_0275367 | Ga0496109_0275367_704_1507 | 265 |
| 53 | iso_pu_bacteria | 2977957713 | 2977964757 | 265 |
| 54 | 3300047472 | Ga0495686_0024783 | Ga0495686_0024783_845_1654 | 266 |
| 55 | iso_pu_bacteria | 8054563764 | 8054568395 | 267 |
| 56 | 3300025933 | Ga0207706_10117616 | Ga0207706_101176162 | 268 |
| 57 | 3300048088 | Ga0495602_0349358 | Ga0495602_0349358_99_932 | 268 |
| 58 | 3300048929 | Ga0496126_0046351 | Ga0496126_0046351_2862_3695 | 268 |
| 59 | 3300049583 | Ga0501067_0017674 | Ga0501067_0017674_1230_2054 | 269 |
| 60 | 3300049593 | Ga0501077_0004814 | Ga0501077_0004814_3613_4437 | 269 |
| 61 | 3300060353 | Ga0501082_0017173 | Ga0501082_0017173_4852_5676 | 269 |
| 62 | iso_pu_bacteria | 2513237084 | 2513571888 | 269 |
| 63 | iso_pu_bacteria | 2791355260 | 2793322548 | 269 |
| 64 | iso_pu_bacteria | 2791355265 | 2793356265 | 269 |
| 65 | iso_pu_bacteria | 2838022645 | 2838024757 | 269 |
| 66 | iso_pu_bacteria | 2838042994 | 2838046870 | 269 |
| 67 | iso_pu_bacteria | 2838668709 | 2838668896 | 269 |
| 68 | iso_pu_bacteria | 2838701080 | 2838701444 | 269 |
| 69 | iso_pu_bacteria | 2842146304 | 2842146491 | 269 |
| 70 | iso_pu_bacteria | 2842192696 | 2842194118 | 269 |
| 71 | iso_pu_bacteria | 2842198810 | 2842200138 | 269 |
| 72 | iso_pu_bacteria | 2842250916 | 2842251279 | 269 |
| 73 | iso_pu_bacteria | 2842285085 | 2842288119 | 269 |
| 74 | iso_pu_bacteria | 2842402390 | 2842405385 | 269 |
| 75 | iso_pu_bacteria | 2842409023 | 2842411858 | 269 |
| 76 | iso_pu_bacteria | 2842415677 | 2842418615 | 269 |
| 77 | iso_pu_bacteria | 2851182111 | 2851186195 | 269 |
| 78 | iso_pu_bacteria | 2894023352 | 2894026861 | 269 |
| 79 | iso_pu_bacteria | 2904541872 | 2904542417 | 269 |
| 80 | iso_pu_bacteria | 2919171160 | 2919173906 | 269 |
| 81 | iso_pu_bacteria | 2929160207 | 2929167669 | 269 |
| 82 | iso_pu_bacteria | 2936367885 | 2936373589 | 269 |
| 83 | iso_pu_bacteria | 2958092219 | 2958093536 | 269 |
| 84 | iso_pu_bacteria | 2996893221 | 2996895732 | 269 |
| 85 | iso_pu_bacteria | 8005382845 | 8005384501 | 269 |
| 86 | iso_pu_bacteria | 8005395548 | 8005397813 | 269 |
| 87 | iso_pu_bacteria | 8024501048 | 8024501837 | 269 |
| 88 | 3300032126 | Ga0307415_100112335 | Ga0307415_1001123353 | 270 |
| 89 | 3300037466 | Ga0395898_0250599 | Ga0395898_0250599_25_852 | 270 |
| 90 | iso_pu_bacteria | 2506520007 | 2506580941 | 270 |
| 91 | iso_pu_bacteria | 2506520008 | 2506586080 | 270 |
| 92 | iso_pu_bacteria | 2515154155 | 2515853372 | 270 |
| 93 | iso_pu_bacteria | 2643221629 | 2644169376 | 270 |
| 94 | iso_pu_bacteria | 2643221662 | 2644350773 | 270 |
| 95 | iso_pu_bacteria | 2654587920 | 2656276776 | 270 |
| 96 | iso_pu_bacteria | 2687453601 | 2689447492 | 270 |
| 97 | iso_pu_bacteria | 2739367655 | 2739612373 | 270 |
| 98 | iso_pu_bacteria | 2854916844 | 2854917309 | 270 |
| 99 | iso_pu_bacteria | 2871282230 | 2871284461 | 270 |
| 100 | iso_pu_bacteria | 2900051742 | 2900053985 | 270 |
| 101 | iso_pu_bacteria | 2900051742 | 2900054458 | 270 |
| 102 | iso_pu_bacteria | 2937843397 | 2937847024 | 270 |
| 103 | iso_pu_bacteria | 2996310559 | 2996316552 | 270 |
| 104 | iso_pu_bacteria | 2996336353 | 2996341633 | 270 |
| 105 | 3300005548 | Ga0070665_100197127 | Ga0070665_1001971272 | 271 |
| 106 | 3300028379 | Ga0268266_10181019 | Ga0268266_101810193 | 271 |
| 107 | 3300041512 | Ga0451853_1535672 | Ga0451853_1535672_272_1102 | 271 |
| 108 | 3300042184 | Ga0450908_012082 | Ga0450908_012082_194_1069 | 271 |
| 109 | 3300046459 | Ga0495629_0199720 | Ga0495629_0199720_124_954 | 271 |
| 110 | 3300048908 | Ga0496105_0431673 | Ga0496105_0431673_171_1001 | 271 |
| 111 | iso_pu_bacteria | 2510065019 | 2510136115 | 271 |
| 112 | iso_pu_bacteria | 2510461076 | 2510892882 | 271 |
| 113 | iso_pu_bacteria | 2513237084 | 2513568416 | 271 |
| 114 | iso_pu_bacteria | 2513237093 | 2513630727 | 271 |
| 115 | iso_pu_bacteria | 2513237103 | 2513711921 | 271 |
| 116 | iso_pu_bacteria | 2513237162 | 2514018250 | 271 |
| 117 | iso_pu_bacteria | 2515075009 | 2515108958 | 271 |
| 118 | iso_pu_bacteria | 2515154113 | 2515633037 | 271 |
| 119 | iso_pu_bacteria | 2515154114 | 2515640242 | 271 |
| 120 | iso_pu_bacteria | 2515154116 | 2515656323 | 271 |
| 121 | iso_pu_bacteria | 2516653077 | 2517040899 | 271 |
| 122 | iso_pu_bacteria | 2517093000 | 2517098499 | 271 |
| 123 | iso_pu_bacteria | 2615840624 | 2616297886 | 271 |
| 124 | iso_pu_bacteria | 2643221629 | 2644169825 | 271 |
| 125 | iso_pu_bacteria | 2643221634 | 2644195208 | 271 |
| 126 | iso_pu_bacteria | 2643221643 | 2644241132 | 271 |
| 127 | iso_pu_bacteria | 2643221662 | 2644350461 | 271 |
| 128 | iso_pu_bacteria | 2724679232 | 2725949384 | 271 |
| 129 | iso_pu_bacteria | 2765235802 | 2765464463 | 271 |
| 130 | iso_pu_bacteria | 2765235942 | 2766064607 | 271 |
| 131 | iso_pu_bacteria | 2775506902 | 2776267091 | 271 |
| 132 | iso_pu_bacteria | 2775506904 | 2776283434 | 271 |
| 133 | iso_pu_bacteria | 2791355259 | 2793315014 | 271 |
| 134 | iso_pu_bacteria | 2839993093 | 2839997337 | 271 |
| 135 | iso_pu_bacteria | 2840764183 | 2840765801 | 271 |
| 136 | iso_pu_bacteria | 2842110456 | 2842113798 | 271 |
| 137 | iso_pu_bacteria | 2842205361 | 2842209930 | 271 |
| 138 | iso_pu_bacteria | 2842217011 | 2842219644 | 271 |
| 139 | iso_pu_bacteria | 2842278818 | 2842283384 | 271 |
| 140 | iso_pu_bacteria | 2842489311 | 2842494805 | 271 |
| 141 | iso_pu_bacteria | 2842495871 | 2842500841 | 271 |
| 142 | iso_pu_bacteria | 2855195626 | 2855196576 | 271 |
| 143 | iso_pu_bacteria | 2857516855 | 2857523132 | 271 |
| 144 | iso_pu_bacteria | 2885305155 | 2885307950 | 271 |
| 145 | iso_pu_bacteria | 2885326080 | 2885326734 | 271 |
| 146 | iso_pu_bacteria | 2885334103 | 2885340995 | 271 |
| 147 | iso_pu_bacteria | 2913295892 | 2913301660 | 271 |
| 148 | iso_pu_bacteria | 2933586486 | 2933589566 | 271 |
| 149 | iso_pu_bacteria | 2936367885 | 2936374699 | 271 |
| 150 | iso_pu_bacteria | 2936375103 | 2936375866 | 271 |
| 151 | iso_pu_bacteria | 639633055 | 639645356 | 271 |
| 152 | iso_pu_bacteria | 8005289223 | 8005290826 | 271 |
| 153 | iso_pu_bacteria | 8005301065 | 8005301296 | 271 |
| 154 | iso_pu_bacteria | 8005376324 | 8005380540 | 271 |
| 155 | iso_pu_bacteria | 8005460587 | 8005467551 | 271 |
| 156 | iso_pu_bacteria | 8005556819 | 8005559466 | 271 |
| 157 | iso_pu_bacteria | 8005563573 | 8005566487 | 271 |
| 158 | iso_pu_bacteria | 8005688590 | 8005688889 | 271 |
| 159 | iso_pu_bacteria | 8018127388 | 8018132315 | 271 |
| 160 | iso_pu_bacteria | 8018163183 | 8018163761 | 271 |
| 161 | iso_pu_bacteria | 8024479707 | 8024481423 | 271 |
| 162 | iso_pu_bacteria | 8054558443 | 8054560632 | 271 |
| 163 | iso_pu_bacteria | 8057874678 | 8057881284 | 271 |
| 164 | 3300009176 | Ga0105242_10208879 | Ga0105242_102088792 | 272 |
| 165 | 3300009551 | Ga0105238_10001007 | Ga0105238_1000100721 | 272 |
| 166 | 3300025924 | Ga0207694_10000939 | Ga0207694_1000093923 | 272 |
| 167 | 3300049571 | Ga0501034_0053228 | Ga0501034_0053228_2970_3794 | 272 |
| 168 | 3300049581 | Ga0501047_0084654 | Ga0501047_0084654_788_1612 | 272 |
| 169 | 3300049585 | Ga0501069_0010352 | Ga0501069_0010352_3864_4688 | 272 |
| 170 | 3300049589 | Ga0501073_0016948 | Ga0501073_0016948_3677_4501 | 272 |
| 171 | 3300049592 | Ga0501076_0069235 | Ga0501076_0069235_745_1569 | 272 |
| 172 | 3300049742 | Ga0501080_0290864 | Ga0501080_0290864_38_862 | 272 |
| 173 | 3300049742 | Ga0501080_0408157 | Ga0501080_0408157_258_1082 | 272 |
| 174 | 3300049744 | Ga0501083_0064134 | Ga0501083_0064134_1572_2396 | 272 |
| 175 | 3300049822 | Ga0501035_0155127 | Ga0501035_0155127_985_1809 | 272 |
| 176 | 3300049823 | Ga0501044_0059837 | Ga0501044_0059837_613_1437 | 272 |
| 177 | 3300060353 | Ga0501082_0442417 | Ga0501082_0442417_234_1058 | 272 |
| 178 | iso_pu_bacteria | 2876392853 | 2876397708 | 272 |
| 179 | iso_pu_bacteria | 2904659560 | 2904664359 | 272 |
| 180 | iso_pu_bacteria | 2961114664 | 2961119358 | 272 |
| 181 | iso_pu_bacteria | 2968110612 | 2968115613 | 272 |
| 182 | 3300003320 | rootH2_10130272 | rootH2_101302722 | 273 |
| 183 | 3300003354 | JGI25160J50197_1002309 | JGI25160J50197_10023097 | 273 |
| 184 | 3300003775 | Ga0055524_1000850 | Ga0055524_100085011 | 273 |
| 185 | 3300003790 | Ga0055528_1001807 | Ga0055528_10018072 | 273 |
| 186 | 3300005456 | Ga0070678_100108089 | Ga0070678_1001080892 | 273 |
| 187 | 3300005548 | Ga0070665_100063348 | Ga0070665_1000633482 | 273 |
| 188 | 3300005577 | Ga0068857_100032013 | Ga0068857_1000320132 | 273 |
| 189 | 3300005616 | Ga0068852_100505746 | Ga0068852_1005057462 | 273 |
| 190 | 3300005617 | Ga0068859_100204119 | Ga0068859_1002041192 | 273 |
| 191 | 3300005618 | Ga0068864_100036087 | Ga0068864_1000360872 | 273 |
| 192 | 3300005844 | Ga0068862_100043996 | Ga0068862_1000439962 | 273 |
| 193 | 3300005937 | Ga0081455_10080898 | Ga0081455_100808982 | 273 |
| 194 | 3300005985 | Ga0081539_10005538 | Ga0081539_1000553811 | 273 |
| 195 | 3300006178 | Ga0075367_10111633 | Ga0075367_101116332 | 273 |
| 196 | 3300006178 | Ga0075367_10125863 | Ga0075367_101258632 | 273 |
| 197 | 3300006353 | Ga0075370_10002495 | Ga0075370_100024956 | 273 |
| 198 | 3300006353 | Ga0075370_10181913 | Ga0075370_101819132 | 273 |
| 199 | 3300006931 | Ga0097620_100204114 | Ga0097620_1002041142 | 273 |
| 200 | 3300009093 | Ga0105240_10033261 | Ga0105240_100332614 | 273 |
| 201 | 3300009093 | Ga0105240_10679558 | Ga0105240_106795581 | 273 |
| 202 | 3300009148 | Ga0105243_10361206 | Ga0105243_103612062 | 273 |
| 203 | 3300009174 | Ga0105241_10157185 | Ga0105241_101571852 | 273 |
| 204 | 3300009545 | Ga0105237_10009247 | Ga0105237_100092475 | 273 |
| 205 | 3300009553 | Ga0105249_10161350 | Ga0105249_101613502 | 273 |
| 206 | 3300014326 | Ga0157380_10240615 | Ga0157380_102406152 | 273 |
| 207 | 3300014968 | Ga0157379_10188227 | Ga0157379_101882272 | 273 |
| 208 | 3300017792 | Ga0163161_10473372 | Ga0163161_104733721 | 273 |
| 209 | 3300021327 | Ga0214543_1000132 | Ga0214543_100013284 | 273 |
| 210 | 3300025907 | Ga0207645_10080212 | Ga0207645_100802122 | 273 |
| 211 | 3300025913 | Ga0207695_10038212 | Ga0207695_100382123 | 273 |
| 212 | 3300025914 | Ga0207671_10107859 | Ga0207671_101078591 | 273 |
| 213 | 3300025961 | Ga0207712_10149895 | Ga0207712_101498952 | 273 |
| 214 | 3300026023 | Ga0207677_10050917 | Ga0207677_100509172 | 273 |
| 215 | 3300026067 | Ga0207678_10043551 | Ga0207678_100435513 | 273 |
| 216 | 3300026089 | Ga0207648_10115887 | Ga0207648_101158872 | 273 |
| 217 | 3300026116 | Ga0207674_10028028 | Ga0207674_100280282 | 273 |
| 218 | 3300027907 | Ga0207428_10088859 | Ga0207428_100888592 | 273 |
| 219 | 3300028380 | Ga0268265_10241758 | Ga0268265_102417582 | 273 |
| 220 | 3300031903 | Ga0307407_10135268 | Ga0307407_101352682 | 273 |
| 221 | 3300031995 | Ga0307409_100435895 | Ga0307409_1004358952 | 273 |
| 222 | 3300046458 | Ga0495591_002496 | Ga0495591_002496_3023_3850 | 273 |
| 223 | 3300046471 | Ga0495650_0000008 | Ga0495650_0000008_436873_437700 | 273 |
| 224 | 3300046471 | Ga0495650_0062159 | Ga0495650_0062159_249_1079 | 273 |
| 225 | 3300046474 | Ga0495605_0031401 | Ga0495605_0031401_556_1383 | 273 |
| 226 | 3300046491 | Ga0495584_0022473 | Ga0495584_0022473_470_1297 | 273 |
| 227 | 3300046501 | Ga0495607_0009540 | Ga0495607_0009540_5207_6034 | 273 |
| 228 | 3300046507 | Ga0495606_0001619 | Ga0495606_0001619_15276_16103 | 273 |
| 229 | 3300046513 | Ga0495616_0013102 | Ga0495616_0013102_461_1288 | 273 |
| 230 | 3300046520 | Ga0495637_0078976 | Ga0495637_0078976_468_1295 | 273 |
| 231 | 3300046523 | Ga0495644_0025575 | Ga0495644_0025575_1333_2160 | 273 |
| 232 | 3300046524 | Ga0495648_0014184 | Ga0495648_0014184_2394_3221 | 273 |
| 233 | 3300046524 | Ga0495648_0031408 | Ga0495648_0031408_1779_2612 | 273 |
| 234 | 3300046539 | Ga0495621_0047296 | Ga0495621_0047296_601_1431 | 273 |
| 235 | 3300046542 | Ga0495597_0013170 | Ga0495597_0013170_1696_2526 | 273 |
| 236 | 3300046615 | Ga0495656_0000137 | Ga0495656_0000137_21478_22308 | 273 |
| 237 | 3300046692 | Ga0495671_0009568 | Ga0495671_0009568_4053_4880 | 273 |
| 238 | 3300046694 | Ga0495649_0003827 | Ga0495649_0003827_5990_6820 | 273 |
| 239 | 3300046694 | Ga0495649_0051331 | Ga0495649_0051331_175_1002 | 273 |
| 240 | 3300046794 | Ga0495589_0016275 | Ga0495589_0016275_2729_3556 | 273 |
| 241 | 3300046810 | Ga0495660_0000019 | Ga0495660_0000019_60549_61376 | 273 |
| 242 | 3300047320 | Ga0495672_0000003 | Ga0495672_0000003_282480_283307 | 273 |
| 243 | 3300047323 | Ga0495683_0060105 | Ga0495683_0060105_104_931 | 273 |
| 244 | 3300047443 | Ga0495687_000315 | Ga0495687_000315_35876_36706 | 273 |
| 245 | 3300047443 | Ga0495687_004781 | Ga0495687_004781_3438_4268 | 273 |
| 246 | 3300047469 | Ga0495673_0000011 | Ga0495673_0000011_422910_423737 | 273 |
| 247 | 3300048090 | Ga0495615_0031301 | Ga0495615_0031301_434_1264 | 273 |
| 248 | 3300048917 | Ga0496114_0280180 | Ga0496114_0280180_507_1337 | 273 |
| 249 | 3300049459 | Ga0495678_000479 | Ga0495678_000479_23448_24275 | 273 |
| 250 | 3300049460 | Ga0495682_0000006 | Ga0495682_0000006_17252_18079 | 273 |
| 251 | 3300050489 | nmdc:mga03683_57021_c1 | nmdc:mga03683_57021_c1_578_1408 | 273 |
| 252 | 3300050492 | nmdc:mga0yw44_82007_c1 | nmdc:mga0yw44_82007_c1_751_1581 | 273 |
| 253 | 3300050493 | nmdc:mga0k408_45484_c1 | nmdc:mga0k408_45484_c1_1648_2478 | 273 |
| 254 | 3300050493 | nmdc:mga0k408_68018_c1 | nmdc:mga0k408_68018_c1_960_1790 | 273 |
| 255 | 3300050494 | nmdc:mga06z11_308338_c1 | nmdc:mga06z11_308338_c1_33_875 | 273 |
| 256 | 3300050496 | nmdc:mga07m45_17151_c1 | nmdc:mga07m45_17151_c1_2452_3282 | 273 |
| 257 | 3300050496 | nmdc:mga07m45_378_c1 | nmdc:mga07m45_378_c1_1417_2247 | 273 |
| 258 | 3300053126 | Ga0500621_000004 | Ga0500621_000004_237606_238433 | 273 |
| 259 | 3300053139 | Ga0500568_0017450 | Ga0500568_0017450_1017_1847 | 273 |
| 260 | 3300053156 | Ga0500622_0045878 | Ga0500622_0045878_179_1009 | 273 |
| 261 | 3300053730 | Ga0500645_002075 | Ga0500645_002075_8317_9165 | 273 |
| 262 | iso_pu_bacteria | 2508501127 | 2509142467 | 273 |
| 263 | iso_pu_bacteria | 2509276022 | 2509394643 | 273 |
| 264 | iso_pu_bacteria | 2597489875 | 2597811080 | 273 |
| 265 | iso_pu_bacteria | 2841734538 | 2841737462 | 273 |
| 266 | iso_pu_bacteria | 2847670302 | 2847674706 | 273 |
| 267 | iso_pu_bacteria | 2856314179 | 2856317408 | 273 |
| 268 | iso_pu_bacteria | 2856342000 | 2856349200 | 273 |
| 269 | iso_pu_bacteria | 2869162929 | 2869168561 | 273 |
| 270 | iso_pu_bacteria | 2871435913 | 2871441915 | 273 |
| 271 | iso_pu_bacteria | 2871474448 | 2871480887 | 273 |
| 272 | iso_pu_bacteria | 2878035449 | 2878038446 | 273 |
| 273 | iso_pu_bacteria | 2878788777 | 2878794336 | 273 |
| 274 | iso_pu_bacteria | 2885312484 | 2885313128 | 273 |
| 275 | iso_pu_bacteria | 2889790730 | 2889794442 | 273 |
| 276 | iso_pu_bacteria | 2889914905 | 2889914953 | 273 |
| 277 | iso_pu_bacteria | 2906414383 | 2906417473 | 273 |
| 278 | iso_pu_bacteria | 2937836603 | 2937840302 | 273 |
| 279 | iso_pu_bacteria | 2958071322 | 2958071511 | 273 |
| 280 | iso_pu_bacteria | 2970524798 | 2970527094 | 273 |
| 281 | iso_pu_bacteria | 2970540015 | 2970544535 | 273 |
| 282 | iso_pu_bacteria | 2977864932 | 2977871925 | 273 |
| 283 | iso_pu_bacteria | 8004395343 | 8004402195 | 273 |
| 284 | iso_pu_bacteria | 8004633249 | 8004637406 | 273 |
| 285 | iso_pu_bacteria | 8055617313 | 8055619183 | 273 |
| 286 | 3300005327 | Ga0070658_10147445 | Ga0070658_101474452 | 274 |
| 287 | 3300005328 | Ga0070676_10068798 | Ga0070676_100687982 | 274 |
| 288 | 3300005329 | Ga0070683_100200023 | Ga0070683_1002000232 | 274 |
| 289 | 3300005330 | Ga0070690_100001510 | Ga0070690_1000015108 | 274 |
| 290 | 3300005330 | Ga0070690_100148394 | Ga0070690_1001483942 | 274 |
| 291 | 3300005334 | Ga0068869_100001072 | Ga0068869_1000010727 | 274 |
| 292 | 3300005334 | Ga0068869_100091578 | Ga0068869_1000915782 | 274 |
| 293 | 3300005334 | Ga0068869_100173041 | Ga0068869_1001730412 | 274 |
| 294 | 3300005334 | Ga0068869_100287153 | Ga0068869_1002871531 | 274 |
| 295 | 3300005335 | Ga0070666_10007488 | Ga0070666_100074882 | 274 |
| 296 | 3300005338 | Ga0068868_100058831 | Ga0068868_1000588314 | 274 |
| 297 | 3300005338 | Ga0068868_100152931 | Ga0068868_1001529312 | 274 |
| 298 | 3300005338 | Ga0068868_100211375 | Ga0068868_1002113752 | 274 |
| 299 | 3300005338 | Ga0068868_100462246 | Ga0068868_1004622461 | 274 |
| 300 | 3300005339 | Ga0070660_100235649 | Ga0070660_1002356491 | 274 |
| 301 | 3300005340 | Ga0070689_100011792 | Ga0070689_1000117922 | 274 |
| 302 | 3300005340 | Ga0070689_100165543 | Ga0070689_1001655432 | 274 |
| 303 | 3300005344 | Ga0070661_100077522 | Ga0070661_1000775222 | 274 |
| 304 | 3300005344 | Ga0070661_100093694 | Ga0070661_1000936942 | 274 |
| 305 | 3300005345 | Ga0070692_10101388 | Ga0070692_101013882 | 274 |
| 306 | 3300005347 | Ga0070668_100105638 | Ga0070668_1001056382 | 274 |
| 307 | 3300005347 | Ga0070668_100337545 | Ga0070668_1003375451 | 274 |
| 308 | 3300005353 | Ga0070669_100030183 | Ga0070669_1000301832 | 274 |
| 309 | 3300005353 | Ga0070669_100077937 | Ga0070669_1000779372 | 274 |
| 310 | 3300005353 | Ga0070669_100099619 | Ga0070669_1000996192 | 274 |
| 311 | 3300005354 | Ga0070675_100002305 | Ga0070675_1000023056 | 274 |
| 312 | 3300005355 | Ga0070671_100086319 | Ga0070671_1000863192 | 274 |
| 313 | 3300005355 | Ga0070671_100180420 | Ga0070671_1001804202 | 274 |
| 314 | 3300005356 | Ga0070674_100017239 | Ga0070674_1000172395 | 274 |
| 315 | 3300005366 | Ga0070659_100069612 | Ga0070659_1000696122 | 274 |
| 316 | 3300005366 | Ga0070659_100083833 | Ga0070659_1000838332 | 274 |
| 317 | 3300005367 | Ga0070667_100001504 | Ga0070667_1000015047 | 274 |
| 318 | 3300005367 | Ga0070667_100047622 | Ga0070667_1000476223 | 274 |
| 319 | 3300005367 | Ga0070667_100133328 | Ga0070667_1001333282 | 274 |
| 320 | 3300005367 | Ga0070667_100163109 | Ga0070667_1001631092 | 274 |
| 321 | 3300005367 | Ga0070667_100342299 | Ga0070667_1003422992 | 274 |
| 322 | 3300005438 | Ga0070701_10021078 | Ga0070701_100210782 | 274 |
| 323 | 3300005440 | Ga0070705_100054268 | Ga0070705_1000542682 | 274 |
| 324 | 3300005441 | Ga0070700_100102045 | Ga0070700_1001020452 | 274 |
| 325 | 3300005444 | Ga0070694_100277084 | Ga0070694_1002770841 | 274 |
| 326 | 3300005455 | Ga0070663_100120191 | Ga0070663_1001201912 | 274 |
| 327 | 3300005456 | Ga0070678_100044742 | Ga0070678_1000447422 | 274 |
| 328 | 3300005456 | Ga0070678_100103935 | Ga0070678_1001039353 | 274 |
| 329 | 3300005457 | Ga0070662_100007515 | Ga0070662_1000075154 | 274 |
| 330 | 3300005457 | Ga0070662_100023880 | Ga0070662_1000238803 | 274 |
| 331 | 3300005458 | Ga0070681_10024387 | Ga0070681_100243872 | 274 |
| 332 | 3300005459 | Ga0068867_100015891 | Ga0068867_1000158914 | 274 |
| 333 | 3300005459 | Ga0068867_100020391 | Ga0068867_1000203912 | 274 |
| 334 | 3300005459 | Ga0068867_100165982 | Ga0068867_1001659822 | 274 |
| 335 | 3300005466 | Ga0070685_10209442 | Ga0070685_102094422 | 274 |
| 336 | 3300005530 | Ga0070679_100225219 | Ga0070679_1002252192 | 274 |
| 337 | 3300005535 | Ga0070684_100109601 | Ga0070684_1001096012 | 274 |
| 338 | 3300005539 | Ga0068853_100027399 | Ga0068853_1000273994 | 274 |
| 339 | 3300005539 | Ga0068853_100074345 | Ga0068853_1000743452 | 274 |
| 340 | 3300005543 | Ga0070672_100067901 | Ga0070672_1000679012 | 274 |
| 341 | 3300005543 | Ga0070672_100097962 | Ga0070672_1000979622 | 274 |
| 342 | 3300005544 | Ga0070686_100012181 | Ga0070686_1000121814 | 274 |
| 343 | 3300005544 | Ga0070686_100080814 | Ga0070686_1000808142 | 274 |
| 344 | 3300005545 | Ga0070695_100366935 | Ga0070695_1003669352 | 274 |
| 345 | 3300005548 | Ga0070665_100031128 | Ga0070665_1000311284 | 274 |
| 346 | 3300005548 | Ga0070665_100032562 | Ga0070665_1000325622 | 274 |
| 347 | 3300005548 | Ga0070665_100099653 | Ga0070665_1000996532 | 274 |
| 348 | 3300005564 | Ga0070664_100065451 | Ga0070664_1000654512 | 274 |
| 349 | 3300005577 | Ga0068857_100031257 | Ga0068857_1000312573 | 274 |
| 350 | 3300005578 | Ga0068854_100049679 | Ga0068854_1000496792 | 274 |
| 351 | 3300005578 | Ga0068854_100152807 | Ga0068854_1001528072 | 274 |
| 352 | 3300005614 | Ga0068856_100034534 | Ga0068856_1000345342 | 274 |
| 353 | 3300005614 | Ga0068856_100198757 | Ga0068856_1001987572 | 274 |
| 354 | 3300005616 | Ga0068852_100205312 | Ga0068852_1002053122 | 274 |
| 355 | 3300005616 | Ga0068852_100349477 | Ga0068852_1003494772 | 274 |
| 356 | 3300005617 | Ga0068859_100006383 | Ga0068859_1000063838 | 274 |
| 357 | 3300005617 | Ga0068859_100028370 | Ga0068859_1000283702 | 274 |
| 358 | 3300005617 | Ga0068859_100032249 | Ga0068859_1000322492 | 274 |
| 359 | 3300005617 | Ga0068859_100041599 | Ga0068859_1000415994 | 274 |
| 360 | 3300005618 | Ga0068864_100028037 | Ga0068864_1000280372 | 274 |
| 361 | 3300005618 | Ga0068864_100048815 | Ga0068864_1000488152 | 274 |
| 362 | 3300005618 | Ga0068864_100061768 | Ga0068864_1000617682 | 274 |
| 363 | 3300005618 | Ga0068864_100125087 | Ga0068864_1001250872 | 274 |
| 364 | 3300005718 | Ga0068866_10011237 | Ga0068866_100112372 | 274 |
| 365 | 3300005718 | Ga0068866_10075384 | Ga0068866_100753843 | 274 |
| 366 | 3300005719 | Ga0068861_100002678 | Ga0068861_10000267810 | 274 |
| 367 | 3300005719 | Ga0068861_100018125 | Ga0068861_1000181252 | 274 |
| 368 | 3300005840 | Ga0068870_10124723 | Ga0068870_101247232 | 274 |
| 369 | 3300005841 | Ga0068863_100006580 | Ga0068863_1000065809 | 274 |
| 370 | 3300005841 | Ga0068863_100080476 | Ga0068863_1000804762 | 274 |
| 371 | 3300005841 | Ga0068863_100096878 | Ga0068863_1000968783 | 274 |
| 372 | 3300005842 | Ga0068858_100004441 | Ga0068858_10000444112 | 274 |
| 373 | 3300005842 | Ga0068858_100028194 | Ga0068858_1000281945 | 274 |
| 374 | 3300005842 | Ga0068858_100035188 | Ga0068858_1000351884 | 274 |
| 375 | 3300005842 | Ga0068858_100231277 | Ga0068858_1002312772 | 274 |
| 376 | 3300005843 | Ga0068860_100004331 | Ga0068860_1000043319 | 274 |
| 377 | 3300005843 | Ga0068860_100022924 | Ga0068860_1000229245 | 274 |
| 378 | 3300005844 | Ga0068862_100033418 | Ga0068862_1000334182 | 274 |
| 379 | 3300005844 | Ga0068862_100064488 | Ga0068862_1000644882 | 274 |
| 380 | 3300005844 | Ga0068862_100121394 | Ga0068862_1001213942 | 274 |
| 381 | 3300005844 | Ga0068862_100375484 | Ga0068862_1003754842 | 274 |
| 382 | 3300005981 | Ga0081538_10004363 | Ga0081538_100043634 | 274 |
| 383 | 3300005985 | Ga0081539_10006723 | Ga0081539_100067232 | 274 |
| 384 | 3300006038 | Ga0075365_10145851 | Ga0075365_101458512 | 274 |
| 385 | 3300006042 | Ga0075368_10125673 | Ga0075368_101256732 | 274 |
| 386 | 3300006048 | Ga0075363_100163877 | Ga0075363_1001638771 | 274 |
| 387 | 3300006177 | Ga0075362_10048050 | Ga0075362_100480502 | 274 |
| 388 | 3300006237 | Ga0097621_100028453 | Ga0097621_1000284533 | 274 |
| 389 | 3300006237 | Ga0097621_100035235 | Ga0097621_1000352352 | 274 |
| 390 | 3300006237 | Ga0097621_100040781 | Ga0097621_1000407812 | 274 |
| 391 | 3300006237 | Ga0097621_100048996 | Ga0097621_1000489962 | 274 |
| 392 | 3300006358 | Ga0068871_100002664 | Ga0068871_1000026647 | 274 |
| 393 | 3300006358 | Ga0068871_100042592 | Ga0068871_1000425924 | 274 |
| 394 | 3300006358 | Ga0068871_100114905 | Ga0068871_1001149052 | 274 |
| 395 | 3300006358 | Ga0068871_100373297 | Ga0068871_1003732972 | 274 |
| 396 | 3300006931 | Ga0097620_100006383 | Ga0097620_1000063838 | 274 |
| 397 | 3300006931 | Ga0097620_100028370 | Ga0097620_1000283702 | 274 |
| 398 | 3300006931 | Ga0097620_100032249 | Ga0097620_1000322494 | 274 |
| 399 | 3300006931 | Ga0097620_100041599 | Ga0097620_1000415992 | 274 |
| 400 | 3300007265 | Ga0099794_10058192 | Ga0099794_100581921 | 274 |
| 401 | 3300009011 | Ga0105251_10023093 | Ga0105251_100230933 | 274 |
| 402 | 3300009036 | Ga0105244_10000008 | Ga0105244_10000008158 | 274 |
| 403 | 3300009036 | Ga0105244_10044571 | Ga0105244_100445713 | 274 |
| 404 | 3300009093 | Ga0105240_10356120 | Ga0105240_103561202 | 274 |
| 405 | 3300009098 | Ga0105245_10036163 | Ga0105245_100361633 | 274 |
| 406 | 3300009098 | Ga0105245_10138735 | Ga0105245_101387354 | 274 |
| 407 | 3300009098 | Ga0105245_10225969 | Ga0105245_102259692 | 274 |
| 408 | 3300009101 | Ga0105247_10008662 | Ga0105247_100086623 | 274 |
| 409 | 3300009147 | Ga0114129_10414989 | Ga0114129_104149892 | 274 |
| 410 | 3300009147 | Ga0114129_10454489 | Ga0114129_104544892 | 274 |
| 411 | 3300009148 | Ga0105243_10091923 | Ga0105243_100919232 | 274 |
| 412 | 3300009177 | Ga0105248_10041378 | Ga0105248_100413784 | 274 |
| 413 | 3300009177 | Ga0105248_10061180 | Ga0105248_100611803 | 274 |
| 414 | 3300009177 | Ga0105248_10088563 | Ga0105248_100885632 | 274 |
| 415 | 3300009177 | Ga0105248_10364460 | Ga0105248_103644602 | 274 |
| 416 | 3300009177 | Ga0105248_10447472 | Ga0105248_104474722 | 274 |
| 417 | 3300009177 | Ga0105248_10689781 | Ga0105248_106897812 | 274 |
| 418 | 3300009551 | Ga0105238_10105265 | Ga0105238_101052652 | 274 |
| 419 | 3300009551 | Ga0105238_10158573 | Ga0105238_101585733 | 274 |
| 420 | 3300009551 | Ga0105238_10405995 | Ga0105238_104059952 | 274 |
| 421 | 3300009553 | Ga0105249_10028900 | Ga0105249_100289002 | 274 |
| 422 | 3300009553 | Ga0105249_10388482 | Ga0105249_103884822 | 274 |
| 423 | 3300010375 | Ga0105239_10161991 | Ga0105239_101619912 | 274 |
| 424 | 3300013100 | Ga0157373_10107585 | Ga0157373_101075852 | 274 |
| 425 | 3300013104 | Ga0157370_10009932 | Ga0157370_100099324 | 274 |
| 426 | 3300013105 | Ga0157369_10082358 | Ga0157369_100823582 | 274 |
| 427 | 3300013296 | Ga0157374_10025942 | Ga0157374_100259424 | 274 |
| 428 | 3300013296 | Ga0157374_10167215 | Ga0157374_101672152 | 274 |
| 429 | 3300013297 | Ga0157378_10136529 | Ga0157378_101365292 | 274 |
| 430 | 3300013306 | Ga0163162_10024703 | Ga0163162_100247032 | 274 |
| 431 | 3300013306 | Ga0163162_10057983 | Ga0163162_100579832 | 274 |
| 432 | 3300013307 | Ga0157372_10011373 | Ga0157372_100113732 | 274 |
| 433 | 3300013308 | Ga0157375_10008005 | Ga0157375_100080058 | 274 |
| 434 | 3300013308 | Ga0157375_10023236 | Ga0157375_100232364 | 274 |
| 435 | 3300013308 | Ga0157375_10356582 | Ga0157375_103565822 | 274 |
| 436 | 3300014325 | Ga0163163_10261173 | Ga0163163_102611732 | 274 |
| 437 | 3300014326 | Ga0157380_10014846 | Ga0157380_100148465 | 274 |
| 438 | 3300014326 | Ga0157380_10069262 | Ga0157380_100692622 | 274 |
| 439 | 3300014326 | Ga0157380_10359558 | Ga0157380_103595582 | 274 |
| 440 | 3300014745 | Ga0157377_10040065 | Ga0157377_100400652 | 274 |
| 441 | 3300014968 | Ga0157379_10032980 | Ga0157379_100329802 | 274 |
| 442 | 3300014968 | Ga0157379_10048368 | Ga0157379_100483682 | 274 |
| 443 | 3300014968 | Ga0157379_10079481 | Ga0157379_100794812 | 274 |
| 444 | 3300014968 | Ga0157379_10110685 | Ga0157379_101106851 | 274 |
| 445 | 3300014968 | Ga0157379_10146008 | Ga0157379_101460081 | 274 |
| 446 | 3300014968 | Ga0157379_10172661 | Ga0157379_101726612 | 274 |
| 447 | 3300014969 | Ga0157376_10300346 | Ga0157376_103003462 | 274 |
| 448 | 3300014969 | Ga0157376_10415360 | Ga0157376_104153602 | 274 |
| 449 | 3300017792 | Ga0163161_10000375 | Ga0163161_100003754 | 274 |
| 450 | 3300017792 | Ga0163161_10015393 | Ga0163161_100153934 | 274 |
| 451 | 3300017792 | Ga0163161_10046661 | Ga0163161_100466612 | 274 |
| 452 | 3300021361 | Ga0213872_10065659 | Ga0213872_100656592 | 274 |
| 453 | 3300025321 | Ga0207656_10033061 | Ga0207656_100330612 | 274 |
| 454 | 3300025321 | Ga0207656_10093293 | Ga0207656_100932932 | 274 |
| 455 | 3300025728 | Ga0207655_1000083 | Ga0207655_1000083130 | 274 |
| 456 | 3300025899 | Ga0207642_10003301 | Ga0207642_100033014 | 274 |
| 457 | 3300025899 | Ga0207642_10079957 | Ga0207642_100799572 | 274 |
| 458 | 3300025899 | Ga0207642_10306952 | Ga0207642_103069521 | 274 |
| 459 | 3300025900 | Ga0207710_10020079 | Ga0207710_100200792 | 274 |
| 460 | 3300025901 | Ga0207688_10048621 | Ga0207688_100486212 | 274 |
| 461 | 3300025903 | Ga0207680_10008233 | Ga0207680_100082334 | 274 |
| 462 | 3300025903 | Ga0207680_10037305 | Ga0207680_100373052 | 274 |
| 463 | 3300025907 | Ga0207645_10014615 | Ga0207645_100146152 | 274 |
| 464 | 3300025907 | Ga0207645_10063671 | Ga0207645_100636712 | 274 |
| 465 | 3300025908 | Ga0207643_10037483 | Ga0207643_100374833 | 274 |
| 466 | 3300025912 | Ga0207707_10013657 | Ga0207707_100136574 | 274 |
| 467 | 3300025913 | Ga0207695_10076226 | Ga0207695_100762262 | 274 |
| 468 | 3300025913 | Ga0207695_10253863 | Ga0207695_102538632 | 274 |
| 469 | 3300025914 | Ga0207671_10206365 | Ga0207671_102063652 | 274 |
| 470 | 3300025917 | Ga0207660_10152323 | Ga0207660_101523231 | 274 |
| 471 | 3300025918 | Ga0207662_10091224 | Ga0207662_100912241 | 274 |
| 472 | 3300025919 | Ga0207657_10126788 | Ga0207657_101267882 | 274 |
| 473 | 3300025920 | Ga0207649_10046174 | Ga0207649_100461742 | 274 |
| 474 | 3300025921 | Ga0207652_10209720 | Ga0207652_102097202 | 274 |
| 475 | 3300025923 | Ga0207681_10002332 | Ga0207681_100023322 | 274 |
| 476 | 3300025923 | Ga0207681_10153866 | Ga0207681_101538662 | 274 |
| 477 | 3300025924 | Ga0207694_10024125 | Ga0207694_100241254 | 274 |
| 478 | 3300025925 | Ga0207650_10003921 | Ga0207650_100039217 | 274 |
| 479 | 3300025925 | Ga0207650_10329831 | Ga0207650_103298312 | 274 |
| 480 | 3300025926 | Ga0207659_10002102 | Ga0207659_100021022 | 274 |
| 481 | 3300025926 | Ga0207659_10004947 | Ga0207659_100049475 | 274 |
| 482 | 3300025926 | Ga0207659_10112987 | Ga0207659_101129872 | 274 |
| 483 | 3300025931 | Ga0207644_10000391 | Ga0207644_1000039122 | 274 |
| 484 | 3300025933 | Ga0207706_10012440 | Ga0207706_100124407 | 274 |
| 485 | 3300025934 | Ga0207686_10061306 | Ga0207686_100613062 | 274 |
| 486 | 3300025934 | Ga0207686_10129417 | Ga0207686_101294172 | 274 |
| 487 | 3300025935 | Ga0207709_10040090 | Ga0207709_100400902 | 274 |
| 488 | 3300025935 | Ga0207709_10331959 | Ga0207709_103319592 | 274 |
| 489 | 3300025936 | Ga0207670_10363940 | Ga0207670_103639401 | 274 |
| 490 | 3300025938 | Ga0207704_10002411 | Ga0207704_100024119 | 274 |
| 491 | 3300025938 | Ga0207704_10003969 | Ga0207704_100039696 | 274 |
| 492 | 3300025938 | Ga0207704_10156931 | Ga0207704_101569312 | 274 |
| 493 | 3300025938 | Ga0207704_10253923 | Ga0207704_102539234 | 274 |
| 494 | 3300025940 | Ga0207691_10106812 | Ga0207691_101068122 | 274 |
| 495 | 3300025940 | Ga0207691_10416751 | Ga0207691_104167512 | 274 |
| 496 | 3300025941 | Ga0207711_10075706 | Ga0207711_100757062 | 274 |
| 497 | 3300025941 | Ga0207711_10135078 | Ga0207711_101350782 | 274 |
| 498 | 3300025941 | Ga0207711_10259726 | Ga0207711_102597262 | 274 |
| 499 | 3300025941 | Ga0207711_10293817 | Ga0207711_102938172 | 274 |
| 500 | 3300025942 | Ga0207689_10001138 | Ga0207689_100011387 | 274 |
| 501 | 3300025942 | Ga0207689_10001210 | Ga0207689_1000121023 | 274 |
| 502 | 3300025942 | Ga0207689_10025123 | Ga0207689_100251234 | 274 |
| 503 | 3300025942 | Ga0207689_10046936 | Ga0207689_100469362 | 274 |
| 504 | 3300025942 | Ga0207689_10068759 | Ga0207689_100687592 | 274 |
| 505 | 3300025945 | Ga0207679_10115679 | Ga0207679_101156792 | 274 |
| 506 | 3300025949 | Ga0207667_10070326 | Ga0207667_100703264 | 274 |
| 507 | 3300025961 | Ga0207712_10014157 | Ga0207712_100141572 | 274 |
| 508 | 3300025972 | Ga0207668_10081767 | Ga0207668_100817672 | 274 |
| 509 | 3300025986 | Ga0207658_10014043 | Ga0207658_100140435 | 274 |
| 510 | 3300025986 | Ga0207658_10041836 | Ga0207658_100418361 | 274 |
| 511 | 3300025986 | Ga0207658_10060711 | Ga0207658_100607113 | 274 |
| 512 | 3300026023 | Ga0207677_10002667 | Ga0207677_100026678 | 274 |
| 513 | 3300026023 | Ga0207677_10057425 | Ga0207677_100574252 | 274 |
| 514 | 3300026035 | Ga0207703_10009260 | Ga0207703_100092603 | 274 |
| 515 | 3300026035 | Ga0207703_10021839 | Ga0207703_100218395 | 274 |
| 516 | 3300026035 | Ga0207703_10184954 | Ga0207703_101849542 | 274 |
| 517 | 3300026035 | Ga0207703_10186380 | Ga0207703_101863802 | 274 |
| 518 | 3300026041 | Ga0207639_10007355 | Ga0207639_100073558 | 274 |
| 519 | 3300026041 | Ga0207639_10043661 | Ga0207639_100436614 | 274 |
| 520 | 3300026041 | Ga0207639_10083123 | Ga0207639_100831233 | 274 |
| 521 | 3300026041 | Ga0207639_10188821 | Ga0207639_101888212 | 274 |
| 522 | 3300026067 | Ga0207678_10028557 | Ga0207678_100285572 | 274 |
| 523 | 3300026075 | Ga0207708_10007488 | Ga0207708_100074882 | 274 |
| 524 | 3300026075 | Ga0207708_10077668 | Ga0207708_100776683 | 274 |
| 525 | 3300026075 | Ga0207708_10101084 | Ga0207708_101010842 | 274 |
| 526 | 3300026075 | Ga0207708_10551199 | Ga0207708_105511991 | 274 |
| 527 | 3300026088 | Ga0207641_10003042 | Ga0207641_100030425 | 274 |
| 528 | 3300026088 | Ga0207641_10064788 | Ga0207641_100647882 | 274 |
| 529 | 3300026088 | Ga0207641_10106666 | Ga0207641_101066662 | 274 |
| 530 | 3300026088 | Ga0207641_10171221 | Ga0207641_101712213 | 274 |
| 531 | 3300026089 | Ga0207648_10002672 | Ga0207648_100026727 | 274 |
| 532 | 3300026089 | Ga0207648_10020858 | Ga0207648_100208584 | 274 |
| 533 | 3300026089 | Ga0207648_10023482 | Ga0207648_100234822 | 274 |
| 534 | 3300026089 | Ga0207648_10082941 | Ga0207648_100829412 | 274 |
| 535 | 3300026095 | Ga0207676_10020763 | Ga0207676_100207632 | 274 |
| 536 | 3300026095 | Ga0207676_10103059 | Ga0207676_101030592 | 274 |
| 537 | 3300026095 | Ga0207676_10214101 | Ga0207676_102141012 | 274 |
| 538 | 3300026116 | Ga0207674_10021614 | Ga0207674_100216145 | 274 |
| 539 | 3300026116 | Ga0207674_10041929 | Ga0207674_100419292 | 274 |
| 540 | 3300026118 | Ga0207675_100006819 | Ga0207675_1000068199 | 274 |
| 541 | 3300026118 | Ga0207675_100013077 | Ga0207675_1000130777 | 274 |
| 542 | 3300026118 | Ga0207675_100013316 | Ga0207675_1000133166 | 274 |
| 543 | 3300026118 | Ga0207675_100027523 | Ga0207675_1000275232 | 274 |
| 544 | 3300026121 | Ga0207683_10066240 | Ga0207683_100662404 | 274 |
| 545 | 3300026121 | Ga0207683_10087595 | Ga0207683_100875952 | 274 |
| 546 | 3300026142 | Ga0207698_10012540 | Ga0207698_100125404 | 274 |
| 547 | 3300026142 | Ga0207698_10110387 | Ga0207698_101103872 | 274 |
| 548 | 3300028379 | Ga0268266_10033856 | Ga0268266_100338565 | 274 |
| 549 | 3300028379 | Ga0268266_10067552 | Ga0268266_100675524 | 274 |
| 550 | 3300028379 | Ga0268266_10099515 | Ga0268266_100995152 | 274 |
| 551 | 3300028380 | Ga0268265_10101967 | Ga0268265_101019672 | 274 |
| 552 | 3300028380 | Ga0268265_10119785 | Ga0268265_101197852 | 274 |
| 553 | 3300028380 | Ga0268265_10136798 | Ga0268265_101367981 | 274 |
| 554 | 3300028380 | Ga0268265_10165509 | Ga0268265_101655092 | 274 |
| 555 | 3300028381 | Ga0268264_10001001 | Ga0268264_100010014 | 274 |
| 556 | 3300028381 | Ga0268264_10003066 | Ga0268264_100030669 | 274 |
| 557 | 3300028381 | Ga0268264_10023023 | Ga0268264_100230235 | 274 |
| 558 | 3300028381 | Ga0268264_10081093 | Ga0268264_100810932 | 274 |
| 559 | 3300028381 | Ga0268264_10198848 | Ga0268264_101988482 | 274 |
| 560 | 3300031241 | Ga0265325_10012043 | Ga0265325_100120436 | 274 |
| 561 | 3300031249 | Ga0265339_10215540 | Ga0265339_102155401 | 274 |
| 562 | 3300031250 | Ga0265331_10021115 | Ga0265331_100211152 | 274 |
| 563 | 3300031344 | Ga0265316_10448039 | Ga0265316_104480391 | 274 |
| 564 | 3300031548 | Ga0307408_100184963 | Ga0307408_1001849632 | 274 |
| 565 | 3300031595 | Ga0265313_10066804 | Ga0265313_100668043 | 274 |
| 566 | 3300031711 | Ga0265314_10036505 | Ga0265314_100365052 | 274 |
| 567 | 3300031731 | Ga0307405_10055754 | Ga0307405_100557542 | 274 |
| 568 | 3300031824 | Ga0307413_10154821 | Ga0307413_101548212 | 274 |
| 569 | 3300031824 | Ga0307413_10391905 | Ga0307413_103919052 | 274 |
| 570 | 3300031901 | Ga0307406_10165481 | Ga0307406_101654812 | 274 |
| 571 | 3300031901 | Ga0307406_10182726 | Ga0307406_101827262 | 274 |
| 572 | 3300031911 | Ga0307412_10364108 | Ga0307412_103641082 | 274 |
| 573 | 3300031995 | Ga0307409_100071106 | Ga0307409_1000711063 | 274 |
| 574 | 3300032002 | Ga0307416_100011529 | Ga0307416_1000115292 | 274 |
| 575 | 3300032002 | Ga0307416_100025422 | Ga0307416_1000254222 | 274 |
| 576 | 3300032005 | Ga0307411_10175938 | Ga0307411_101759381 | 274 |
| 577 | 3300032126 | Ga0307415_100271516 | Ga0307415_1002715162 | 274 |
| 578 | 3300035242 | Ga0373962_0019366 | Ga0373962_0019366_386_1225 | 274 |
| 579 | 3300035691 | Ga0373931_0030437 | Ga0373931_0030437_542_1381 | 274 |
| 580 | 3300037471 | Ga0395905_0015692 | Ga0395905_0015692_1028_1867 | 274 |
| 581 | 3300039437 | Ga0436365_0551841 | Ga0436365_0551841_230_1078 | 274 |
| 582 | 3300039437 | Ga0436365_1295259 | Ga0436365_1295259_65_937 | 274 |
| 583 | 3300039447 | Ga0436361_0060394 | Ga0436361_0060394_2471_3313 | 274 |
| 584 | 3300041405 | Ga0439438_000021 | Ga0439438_000021_41080_41910 | 274 |
| 585 | 3300041407 | Ga0439447_002674 | Ga0439447_002674_430_1260 | 274 |
| 586 | 3300041413 | Ga0439465_0035766 | Ga0439465_0035766_419_1267 | 274 |
| 587 | 3300042006 | Ga0439432_020645 | Ga0439432_020645_1263_2093 | 274 |
| 588 | 3300042008 | Ga0439450_033059 | Ga0439450_033059_98_937 | 274 |
| 589 | 3300042439 | Ga0439464_0006733 | Ga0439464_0006733_1294_2133 | 274 |
| 590 | 3300045051 | Ga0451576_0064685 | Ga0451576_0064685_1301_2140 | 274 |
| 591 | 3300046453 | Ga0495627_001317 | Ga0495627_001317_818_1651 | 274 |
| 592 | 3300046471 | Ga0495650_0013567 | Ga0495650_0013567_87_965 | 274 |
| 593 | 3300046472 | Ga0495580_0016298 | Ga0495580_0016298_2502_3332 | 274 |
| 594 | 3300046500 | Ga0495596_0112964 | Ga0495596_0112964_104_952 | 274 |
| 595 | 3300047322 | Ga0495680_0199987 | Ga0495680_0199987_424_1254 | 274 |
| 596 | 3300047472 | Ga0495686_0025877 | Ga0495686_0025877_2027_2857 | 274 |
| 597 | 3300047472 | Ga0495686_0058797 | Ga0495686_0058797_1217_2083 | 274 |
| 598 | 3300048905 | Ga0496102_0031944 | Ga0496102_0031944_2214_3053 | 274 |
| 599 | 3300048909 | Ga0496106_0015363 | Ga0496106_0015363_1378_2217 | 274 |
| 600 | 3300048910 | Ga0496107_0057456 | Ga0496107_0057456_447_1286 | 274 |
| 601 | 3300048911 | Ga0496108_0083530 | Ga0496108_0083530_1483_2322 | 274 |
| 602 | 3300048911 | Ga0496108_0137129 | Ga0496108_0137129_440_1279 | 274 |
| 603 | 3300048911 | Ga0496108_0559098 | Ga0496108_0559098_92_922 | 274 |
| 604 | 3300048913 | Ga0496110_0008710 | Ga0496110_0008710_4072_4911 | 274 |
| 605 | 3300048914 | Ga0496111_0082657 | Ga0496111_0082657_1376_2215 | 274 |
| 606 | 3300048915 | Ga0496112_0690544 | Ga0496112_0690544_74_913 | 274 |
| 607 | 3300048916 | Ga0496113_0165586 | Ga0496113_0165586_687_1526 | 274 |
| 608 | 3300048919 | Ga0496116_0000076 | Ga0496116_0000076_127854_128684 | 274 |
| 609 | 3300048922 | Ga0496119_0000044 | Ga0496119_0000044_173888_174718 | 274 |
| 610 | 3300048922 | Ga0496119_0001021 | Ga0496119_0001021_21287_22117 | 274 |
| 611 | 3300048923 | Ga0496120_0000044 | Ga0496120_0000044_17103_17933 | 274 |
| 612 | 3300048923 | Ga0496120_0000073 | Ga0496120_0000073_15665_16495 | 274 |
| 613 | 3300049568 | Ga0501031_0026318 | Ga0501031_0026318_2710_3546 | 274 |
| 614 | 3300049571 | Ga0501034_0000444 | Ga0501034_0000444_9490_10320 | 274 |
| 615 | 3300049571 | Ga0501034_0026618 | Ga0501034_0026618_2999_3829 | 274 |
| 616 | 3300049571 | Ga0501034_0043168 | Ga0501034_0043168_1903_2814 | 274 |
| 617 | 3300049571 | Ga0501034_0176639 | Ga0501034_0176639_1131_1967 | 274 |
| 618 | 3300049571 | Ga0501034_0177927 | Ga0501034_0177927_984_1823 | 274 |
| 619 | 3300049571 | Ga0501034_0201026 | Ga0501034_0201026_1081_1926 | 274 |
| 620 | 3300049572 | Ga0501036_0357484 | Ga0501036_0357484_252_1163 | 274 |
| 621 | 3300049579 | Ga0501043_0040158 | Ga0501043_0040158_1263_2099 | 274 |
| 622 | 3300049581 | Ga0501047_0008752 | Ga0501047_0008752_723_1559 | 274 |
| 623 | 3300049584 | Ga0501068_0000614 | Ga0501068_0000614_7240_8070 | 274 |
| 624 | 3300049585 | Ga0501069_0043505 | Ga0501069_0043505_1472_2383 | 274 |
| 625 | 3300049586 | Ga0501070_0007753 | Ga0501070_0007753_7238_8149 | 274 |
| 626 | 3300049586 | Ga0501070_0145407 | Ga0501070_0145407_898_1728 | 274 |
| 627 | 3300049588 | Ga0501072_0274843 | Ga0501072_0274843_124_1035 | 274 |
| 628 | 3300049589 | Ga0501073_0000143 | Ga0501073_0000143_4260_5090 | 274 |
| 629 | 3300049589 | Ga0501073_0087298 | Ga0501073_0087298_407_1318 | 274 |
| 630 | 3300049589 | Ga0501073_0099760 | Ga0501073_0099760_817_1647 | 274 |
| 631 | 3300049590 | Ga0501074_0043632 | Ga0501074_0043632_191_1021 | 274 |
| 632 | 3300049742 | Ga0501080_0000955 | Ga0501080_0000955_8452_9282 | 274 |
| 633 | 3300049742 | Ga0501080_0016628 | Ga0501080_0016628_1015_1926 | 274 |
| 634 | 3300049742 | Ga0501080_0311304 | Ga0501080_0311304_243_1079 | 274 |
| 635 | 3300049744 | Ga0501083_0008455 | Ga0501083_0008455_3677_4507 | 274 |
| 636 | 3300049744 | Ga0501083_0044759 | Ga0501083_0044759_1819_2649 | 274 |
| 637 | 3300049744 | Ga0501083_0080260 | Ga0501083_0080260_17_847 | 274 |
| 638 | 3300049822 | Ga0501035_0047332 | Ga0501035_0047332_116_946 | 274 |
| 639 | 3300049822 | Ga0501035_0108123 | Ga0501035_0108123_1344_2180 | 274 |
| 640 | 3300050489 | nmdc:mga03683_114917_c1 | nmdc:mga03683_114917_c1_47_877 | 274 |
| 641 | 3300050507 | nmdc:mga05p37_346908_c1 | nmdc:mga05p37_346908_c1_136_966 | 274 |
| 642 | 3300050510 | nmdc:mga06r32_212448_c1 | nmdc:mga06r32_212448_c1_224_1054 | 274 |
| 643 | 3300053087 | Ga0500643_022254 | Ga0500643_022254_219_1055 | 274 |
| 644 | 3300053103 | Ga0500555_021183 | Ga0500555_021183_236_1066 | 274 |
| 645 | 3300054114 | Ga0501084_0086241 | Ga0501084_0086241_81_911 | 274 |
| 646 | iso_pu_bacteria | 2512875024 | 2512960891 | 274 |
| 647 | iso_pu_bacteria | 2857349434 | 2857352255 | 274 |
| 648 | iso_pu_bacteria | 2924726620 | 2924730220 | 274 |
| 649 | iso_pu_bacteria | 2968083720 | 2968087138 | 274 |
| 650 | iso_pu_bacteria | 2968117919 | 2968118986 | 274 |
| 651 | iso_pu_bacteria | 2977942078 | 2977945674 | 274 |
| 652 | iso_pu_bacteria | 2987636660 | 2987639439 | 274 |
| 653 | iso_pu_bacteria | 3004203850 | 3004204317 | 274 |
| 654 | 3300002987 | JGI25159J45721_1000461 | JGI25159J45721_100046119 | 275 |
| 655 | 3300003354 | JGI25160J50197_1000248 | JGI25160J50197_100024819 | 275 |
| 656 | 3300003374 | JGI25161J50226_1000183 | JGI25161J50226_100018325 | 275 |
| 657 | 3300004625 | Ga0055543_1000245 | Ga0055543_100024525 | 275 |
| 658 | 3300005262 | Ga0065165_1001012 | Ga0065165_100101219 | 275 |
| 659 | 3300005327 | Ga0070658_10290359 | Ga0070658_102903592 | 275 |
| 660 | 3300005338 | Ga0068868_100484783 | Ga0068868_1004847832 | 275 |
| 661 | 3300005339 | Ga0070660_100332888 | Ga0070660_1003328882 | 275 |
| 662 | 3300005344 | Ga0070661_100183246 | Ga0070661_1001832462 | 275 |
| 663 | 3300005356 | Ga0070674_100024016 | Ga0070674_1000240162 | 275 |
| 664 | 3300005456 | Ga0070678_100401568 | Ga0070678_1004015681 | 275 |
| 665 | 3300005548 | Ga0070665_100023505 | Ga0070665_1000235054 | 275 |
| 666 | 3300005548 | Ga0070665_100237090 | Ga0070665_1002370903 | 275 |
| 667 | 3300005564 | Ga0070664_100528939 | Ga0070664_1005289392 | 275 |
| 668 | 3300006038 | Ga0075365_10271373 | Ga0075365_102713732 | 275 |
| 669 | 3300006178 | Ga0075367_10122285 | Ga0075367_101222853 | 275 |
| 670 | 3300006353 | Ga0075370_10022024 | Ga0075370_100220243 | 275 |
| 671 | 3300009147 | Ga0114129_10773577 | Ga0114129_107735772 | 275 |
| 672 | 3300009545 | Ga0105237_10000397 | Ga0105237_1000039727 | 275 |
| 673 | 3300009765 | Ga0123341_1000002 | Ga0123341_100000233 | 275 |
| 674 | 3300009766 | Ga0123342_1030249 | Ga0123342_10302492 | 275 |
| 675 | 3300010375 | Ga0105239_10014766 | Ga0105239_100147668 | 275 |
| 676 | 3300010375 | Ga0105239_10572027 | Ga0105239_105720272 | 275 |
| 677 | 3300021320 | Ga0214544_1000010 | Ga0214544_1000010232 | 275 |
| 678 | 3300021321 | Ga0214542_1000023 | Ga0214542_100002319 | 275 |
| 679 | 3300021327 | Ga0214543_1000019 | Ga0214543_100001994 | 275 |
| 680 | 3300025284 | Ga0209130_1000098 | Ga0209130_1000098122 | 275 |
| 681 | 3300025302 | Ga0207426_1000069 | Ga0207426_1000069138 | 275 |
| 682 | 3300025899 | Ga0207642_10017892 | Ga0207642_100178923 | 275 |
| 683 | 3300025907 | Ga0207645_10111210 | Ga0207645_101112102 | 275 |
| 684 | 3300025914 | Ga0207671_10001048 | Ga0207671_1000104828 | 275 |
| 685 | 3300025920 | Ga0207649_10092468 | Ga0207649_100924683 | 275 |
| 686 | 3300025931 | Ga0207644_10148455 | Ga0207644_101484552 | 275 |
| 687 | 3300025945 | Ga0207679_10406468 | Ga0207679_104064682 | 275 |
| 688 | 3300025949 | Ga0207667_10703046 | Ga0207667_107030462 | 275 |
| 689 | 3300026089 | Ga0207648_10651299 | Ga0207648_106512992 | 275 |
| 690 | 3300026116 | Ga0207674_10042765 | Ga0207674_100427653 | 275 |
| 691 | 3300028379 | Ga0268266_10000257 | Ga0268266_1000025766 | 275 |
| 692 | 3300028794 | Ga0307515_10001956 | Ga0307515_1000195640 | 275 |
| 693 | 3300031238 | Ga0265332_10070180 | Ga0265332_100701802 | 275 |
| 694 | 3300031247 | Ga0265340_10103457 | Ga0265340_101034572 | 275 |
| 695 | 3300031250 | Ga0265331_10092429 | Ga0265331_100924292 | 275 |
| 696 | 3300031456 | Ga0307513_10154305 | Ga0307513_101543052 | 275 |
| 697 | 3300031711 | Ga0265314_10207403 | Ga0265314_102074032 | 275 |
| 698 | 3300031901 | Ga0307406_10212650 | Ga0307406_102126502 | 275 |
| 699 | 3300037312 | Ga0395899_0084472 | Ga0395899_0084472_975_1808 | 275 |
| 700 | 3300037418 | Ga0395900_0014410 | Ga0395900_0014410_6339_7172 | 275 |
| 701 | 3300037471 | Ga0395905_0133797 | Ga0395905_0133797_691_1533 | 275 |
| 702 | 3300037471 | Ga0395905_0344751 | Ga0395905_0344751_334_1173 | 275 |
| 703 | 3300038443 | Ga0395901_0076932 | Ga0395901_0076932_424_1257 | 275 |
| 704 | 3300041498 | Ga0451841_0277328 | Ga0451841_0277328_128_970 | 275 |
| 705 | 3300041509 | Ga0451843_1665491 | Ga0451843_1665491_128_970 | 275 |
| 706 | 3300041512 | Ga0451853_3126826 | Ga0451853_3126826_1235_2077 | 275 |
| 707 | 3300042004 | Ga0439445_0079000 | Ga0439445_0079000_10_852 | 275 |
| 708 | 3300045976 | Ga0466967_0306169 | Ga0466967_0306169_305_1141 | 275 |
| 709 | 3300046460 | Ga0495638_0042235 | Ga0495638_0042235_408_1250 | 275 |
| 710 | 3300046460 | Ga0495638_0215387 | Ga0495638_0215387_112_951 | 275 |
| 711 | 3300046474 | Ga0495605_0019290 | Ga0495605_0019290_769_1611 | 275 |
| 712 | 3300046501 | Ga0495607_0148138 | Ga0495607_0148138_227_1069 | 275 |
| 713 | 3300046512 | Ga0495610_0018917 | Ga0495610_0018917_823_1665 | 275 |
| 714 | 3300046515 | Ga0495620_0016163 | Ga0495620_0016163_1015_1857 | 275 |
| 715 | 3300046518 | Ga0495631_0056290 | Ga0495631_0056290_703_1545 | 275 |
| 716 | 3300046518 | Ga0495631_0078236 | Ga0495631_0078236_479_1321 | 275 |
| 717 | 3300046519 | Ga0495632_0024918 | Ga0495632_0024918_170_1012 | 275 |
| 718 | 3300046522 | Ga0495643_0128851 | Ga0495643_0128851_249_1091 | 275 |
| 719 | 3300046524 | Ga0495648_0007216 | Ga0495648_0007216_2389_3231 | 275 |
| 720 | 3300046530 | Ga0495654_0076200 | Ga0495654_0076200_375_1217 | 275 |
| 721 | 3300046615 | Ga0495656_0012841 | Ga0495656_0012841_1593_2435 | 275 |
| 722 | 3300046616 | Ga0495668_0044095 | Ga0495668_0044095_595_1437 | 275 |
| 723 | 3300046660 | Ga0495625_0005544 | Ga0495625_0005544_7856_8698 | 275 |
| 724 | 3300046660 | Ga0495625_0247566 | Ga0495625_0247566_221_1060 | 275 |
| 725 | 3300046690 | Ga0495624_0097942 | Ga0495624_0097942_929_1777 | 275 |
| 726 | 3300046810 | Ga0495660_0053584 | Ga0495660_0053584_715_1557 | 275 |
| 727 | 3300047470 | Ga0495681_0046366 | Ga0495681_0046366_724_1566 | 275 |
| 728 | 3300047472 | Ga0495686_0052543 | Ga0495686_0052543_138_980 | 275 |
| 729 | 3300047673 | Ga0495593_0034342 | Ga0495593_0034342_1635_2483 | 275 |
| 730 | 3300048090 | Ga0495615_0019143 | Ga0495615_0019143_22_864 | 275 |
| 731 | 3300048922 | Ga0496119_0010974 | Ga0496119_0010974_1900_2742 | 275 |
| 732 | 3300048924 | Ga0496121_0167571 | Ga0496121_0167571_90_932 | 275 |
| 733 | 3300048928 | Ga0496125_0066554 | Ga0496125_0066554_83_925 | 275 |
| 734 | 3300049569 | Ga0501032_0000018 | Ga0501032_0000018_150318_151157 | 275 |
| 735 | 3300049570 | Ga0501033_0000032 | Ga0501033_0000032_150329_151168 | 275 |
| 736 | 3300049570 | Ga0501033_0048959 | Ga0501033_0048959_125_964 | 275 |
| 737 | 3300049571 | Ga0501034_0000103 | Ga0501034_0000103_5137_5976 | 275 |
| 738 | 3300049571 | Ga0501034_0051840 | Ga0501034_0051840_560_1396 | 275 |
| 739 | 3300049571 | Ga0501034_0371386 | Ga0501034_0371386_50_889 | 275 |
| 740 | 3300049571 | Ga0501034_0584761 | Ga0501034_0584761_127_966 | 275 |
| 741 | 3300049572 | Ga0501036_0000012 | Ga0501036_0000012_150329_151168 | 275 |
| 742 | 3300049573 | Ga0501037_0000018 | Ga0501037_0000018_5137_5976 | 275 |
| 743 | 3300049574 | Ga0501038_0000017 | Ga0501038_0000017_5137_5976 | 275 |
| 744 | 3300049575 | Ga0501039_0000024 | Ga0501039_0000024_5137_5976 | 275 |
| 745 | 3300049576 | Ga0501040_0040528 | Ga0501040_0040528_478_1317 | 275 |
| 746 | 3300049579 | Ga0501043_0004332 | Ga0501043_0004332_5288_6127 | 275 |
| 747 | 3300049579 | Ga0501043_0035219 | Ga0501043_0035219_928_1773 | 275 |
| 748 | 3300049579 | Ga0501043_0210059 | Ga0501043_0210059_171_1016 | 275 |
| 749 | 3300049581 | Ga0501047_0004558 | Ga0501047_0004558_5072_5911 | 275 |
| 750 | 3300049581 | Ga0501047_0289007 | Ga0501047_0289007_416_1261 | 275 |
| 751 | 3300049586 | Ga0501070_0026001 | Ga0501070_0026001_3741_4580 | 275 |
| 752 | 3300049589 | Ga0501073_0090803 | Ga0501073_0090803_1139_1984 | 275 |
| 753 | 3300049742 | Ga0501080_0035296 | Ga0501080_0035296_3042_3887 | 275 |
| 754 | 3300049822 | Ga0501035_0000040 | Ga0501035_0000040_5095_5934 | 275 |
| 755 | 3300049822 | Ga0501035_0005942 | Ga0501035_0005942_424_1269 | 275 |
| 756 | 3300049822 | Ga0501035_0031169 | Ga0501035_0031169_653_1492 | 275 |
| 757 | 3300049823 | Ga0501044_0000040 | Ga0501044_0000040_5137_5976 | 275 |
| 758 | 3300049823 | Ga0501044_0013108 | Ga0501044_0013108_824_1663 | 275 |
| 759 | 3300049823 | Ga0501044_0064588 | Ga0501044_0064588_766_1611 | 275 |
| 760 | 3300050492 | nmdc:mga0yw44_177287_c1 | nmdc:mga0yw44_177287_c1_467_1306 | 275 |
| 761 | 3300050511 | nmdc:mga08y16_430057_c1 | nmdc:mga08y16_430057_c1_374_1216 | 275 |
| 762 | 3300053108 | Ga0500562_055410 | Ga0500562_055410_182_1018 | 275 |
| 763 | 3300053153 | Ga0500616_0055079 | Ga0500616_0055079_799_1656 | 275 |
| 764 | 3300053153 | Ga0500616_0145217 | Ga0500616_0145217_89_925 | 275 |
| 765 | 3300053156 | Ga0500622_0000734 | Ga0500622_0000734_22278_23117 | 275 |
| 766 | iso_pu_bacteria | 2503198000 | 2503199714 | 275 |
| 767 | iso_pu_bacteria | 2508501123 | 2509116655 | 275 |
| 768 | iso_pu_bacteria | 2509276018 | 2509372055 | 275 |
| 769 | iso_pu_bacteria | 2510065059 | 2510318778 | 275 |
| 770 | iso_pu_bacteria | 2512875016 | 2512932870 | 275 |
| 771 | iso_pu_bacteria | 2513237090 | 2513608981 | 275 |
| 772 | iso_pu_bacteria | 2513237164 | 2514036663 | 275 |
| 773 | iso_pu_bacteria | 2513237305 | 2514417286 | 275 |
| 774 | iso_pu_bacteria | 2588253730 | 2588518926 | 275 |
| 775 | iso_pu_bacteria | 2599185301 | 2599939860 | 275 |
| 776 | iso_pu_bacteria | 2643221595 | 2643987609 | 275 |
| 777 | iso_pu_bacteria | 2643221627 | 2644157870 | 275 |
| 778 | iso_pu_bacteria | 2687453392 | 2688596966 | 275 |
| 779 | iso_pu_bacteria | 2693429783 | 2694630225 | 275 |
| 780 | iso_pu_bacteria | 2693429784 | 2694634305 | 275 |
| 781 | iso_pu_bacteria | 2721755686 | 2723574116 | 275 |
| 782 | iso_pu_bacteria | 2791355123 | 2792748281 | 275 |
| 783 | iso_pu_bacteria | 2844009547 | 2844012307 | 275 |
| 784 | iso_pu_bacteria | 2847686936 | 2847690815 | 275 |
| 785 | iso_pu_bacteria | 2856328259 | 2856328731 | 275 |
| 786 | iso_pu_bacteria | 2856334872 | 2856338338 | 275 |
| 787 | iso_pu_bacteria | 2856349417 | 2856355334 | 275 |
| 788 | iso_pu_bacteria | 2856364286 | 2856366857 | 275 |
| 789 | iso_pu_bacteria | 2857367948 | 2857370918 | 275 |
| 790 | iso_pu_bacteria | 2869169390 | 2869175169 | 275 |
| 791 | iso_pu_bacteria | 2869234852 | 2869241877 | 275 |
| 792 | iso_pu_bacteria | 2869242130 | 2869249189 | 275 |
| 793 | iso_pu_bacteria | 2869249662 | 2869249922 | 275 |
| 794 | iso_pu_bacteria | 2869256925 | 2869262911 | 275 |
| 795 | iso_pu_bacteria | 2869271264 | 2869276239 | 275 |
| 796 | iso_pu_bacteria | 2869278585 | 2869285653 | 275 |
| 797 | iso_pu_bacteria | 2869285874 | 2869287731 | 275 |
| 798 | iso_pu_bacteria | 2871429161 | 2871435679 | 275 |
| 799 | iso_pu_bacteria | 2871444079 | 2871445479 | 275 |
| 800 | iso_pu_bacteria | 2871451962 | 2871452877 | 275 |
| 801 | iso_pu_bacteria | 2871459585 | 2871460251 | 275 |
| 802 | iso_pu_bacteria | 2871495908 | 2871496544 | 275 |
| 803 | iso_pu_bacteria | 2874102143 | 2874105293 | 275 |
| 804 | iso_pu_bacteria | 2874109183 | 2874115110 | 275 |
| 805 | iso_pu_bacteria | 2874116593 | 2874119248 | 275 |
| 806 | iso_pu_bacteria | 2874131515 | 2874132901 | 275 |
| 807 | iso_pu_bacteria | 2874139085 | 2874142009 | 275 |
| 808 | iso_pu_bacteria | 2874146452 | 2874151362 | 275 |
| 809 | iso_pu_bacteria | 2874155637 | 2874158996 | 275 |
| 810 | iso_pu_bacteria | 2874162495 | 2874163034 | 275 |
| 811 | iso_pu_bacteria | 2874168670 | 2874175073 | 275 |
| 812 | iso_pu_bacteria | 2876363079 | 2876364880 | 275 |
| 813 | iso_pu_bacteria | 2876369609 | 2876377286 | 275 |
| 814 | iso_pu_bacteria | 2876386047 | 2876387077 | 275 |
| 815 | iso_pu_bacteria | 2876399893 | 2876405592 | 275 |
| 816 | iso_pu_bacteria | 2876406927 | 2876413852 | 275 |
| 817 | iso_pu_bacteria | 2876413966 | 2876417415 | 275 |
| 818 | iso_pu_bacteria | 2878730984 | 2878733083 | 275 |
| 819 | iso_pu_bacteria | 2878738818 | 2878744807 | 275 |
| 820 | iso_pu_bacteria | 2878745973 | 2878749242 | 275 |
| 821 | iso_pu_bacteria | 2878753008 | 2878757562 | 275 |
| 822 | iso_pu_bacteria | 2878760144 | 2878760772 | 275 |
| 823 | iso_pu_bacteria | 2878767105 | 2878767603 | 275 |
| 824 | iso_pu_bacteria | 2878781027 | 2878784098 | 275 |
| 825 | iso_pu_bacteria | 2881147464 | 2881149590 | 275 |
| 826 | iso_pu_bacteria | 2881155292 | 2881160771 | 275 |
| 827 | iso_pu_bacteria | 2881161766 | 2881166469 | 275 |
| 828 | iso_pu_bacteria | 2881845957 | 2881849486 | 275 |
| 829 | iso_pu_bacteria | 2881853255 | 2881860505 | 275 |
| 830 | iso_pu_bacteria | 2881861095 | 2881863131 | 275 |
| 831 | iso_pu_bacteria | 2882632389 | 2882639383 | 275 |
| 832 | iso_pu_bacteria | 2882912400 | 2882918380 | 275 |
| 833 | iso_pu_bacteria | 2885318864 | 2885319415 | 275 |
| 834 | iso_pu_bacteria | 2885350715 | 2885356108 | 275 |
| 835 | iso_pu_bacteria | 2888350351 | 2888354698 | 275 |
| 836 | iso_pu_bacteria | 2889010040 | 2889016313 | 275 |
| 837 | iso_pu_bacteria | 2889016732 | 2889018664 | 275 |
| 838 | iso_pu_bacteria | 2903492973 | 2903498706 | 275 |
| 839 | iso_pu_bacteria | 2903492973 | 2903501292 | 275 |
| 840 | iso_pu_bacteria | 2903521522 | 2903522384 | 275 |
| 841 | iso_pu_bacteria | 2903528002 | 2903528763 | 275 |
| 842 | iso_pu_bacteria | 2903540706 | 2903541338 | 275 |
| 843 | iso_pu_bacteria | 2906308376 | 2906310280 | 275 |
| 844 | iso_pu_bacteria | 2906321335 | 2906324345 | 275 |
| 845 | iso_pu_bacteria | 2906328253 | 2906333159 | 275 |
| 846 | iso_pu_bacteria | 2906354277 | 2906355226 | 275 |
| 847 | iso_pu_bacteria | 2906363423 | 2906365978 | 275 |
| 848 | iso_pu_bacteria | 2906370794 | 2906375160 | 275 |
| 849 | iso_pu_bacteria | 2906386501 | 2906387086 | 275 |
| 850 | iso_pu_bacteria | 2906393657 | 2906394381 | 275 |
| 851 | iso_pu_bacteria | 2906401398 | 2906407986 | 275 |
| 852 | iso_pu_bacteria | 2906408224 | 2906414051 | 275 |
| 853 | iso_pu_bacteria | 2922130491 | 2922138325 | 275 |
| 854 | iso_pu_bacteria | 2922151315 | 2922153686 | 275 |
| 855 | iso_pu_bacteria | 2922158528 | 2922159040 | 275 |
| 856 | iso_pu_bacteria | 2922172374 | 2922172652 | 275 |
| 857 | iso_pu_bacteria | 2922178524 | 2922179550 | 275 |
| 858 | iso_pu_bacteria | 2922185730 | 2922188375 | 275 |
| 859 | iso_pu_bacteria | 2924710171 | 2924712192 | 275 |
| 860 | iso_pu_bacteria | 2924733363 | 2924733918 | 275 |
| 861 | iso_pu_bacteria | 2924741084 | 2924743665 | 275 |
| 862 | iso_pu_bacteria | 2924748358 | 2924749216 | 275 |
| 863 | iso_pu_bacteria | 2924762789 | 2924767248 | 275 |
| 864 | iso_pu_bacteria | 2924776078 | 2924782838 | 275 |
| 865 | iso_pu_bacteria | 2924784321 | 2924786857 | 275 |
| 866 | iso_pu_bacteria | 2937813078 | 2937817104 | 275 |
| 867 | iso_pu_bacteria | 2937822353 | 2937822548 | 275 |
| 868 | iso_pu_bacteria | 2937848649 | 2937852483 | 275 |
| 869 | iso_pu_bacteria | 2937877337 | 2937883621 | 275 |
| 870 | iso_pu_bacteria | 2937891427 | 2937892977 | 275 |
| 871 | iso_pu_bacteria | 2937972304 | 2937977570 | 275 |
| 872 | iso_pu_bacteria | 2937994558 | 2937995194 | 275 |
| 873 | iso_pu_bacteria | 2958034702 | 2958041668 | 275 |
| 874 | iso_pu_bacteria | 2958041894 | 2958047950 | 275 |
| 875 | iso_pu_bacteria | 2958064165 | 2958070661 | 275 |
| 876 | iso_pu_bacteria | 2958084443 | 2958090789 | 275 |
| 877 | iso_pu_bacteria | 2958100919 | 2958102442 | 275 |
| 878 | iso_pu_bacteria | 2958108152 | 2958113401 | 275 |
| 879 | iso_pu_bacteria | 2958115193 | 2958120911 | 275 |
| 880 | iso_pu_bacteria | 2958122699 | 2958128981 | 275 |
| 881 | iso_pu_bacteria | 2958130278 | 2958132133 | 275 |
| 882 | iso_pu_bacteria | 2958137437 | 2958138031 | 275 |
| 883 | iso_pu_bacteria | 2958158011 | 2958164490 | 275 |
| 884 | iso_pu_bacteria | 2958165035 | 2958165541 | 275 |
| 885 | iso_pu_bacteria | 2958172287 | 2958174260 | 275 |
| 886 | iso_pu_bacteria | 2958179912 | 2958181947 | 275 |
| 887 | iso_pu_bacteria | 2961077736 | 2961079791 | 275 |
| 888 | iso_pu_bacteria | 2961127735 | 2961132269 | 275 |
| 889 | iso_pu_bacteria | 2961136820 | 2961139723 | 275 |
| 890 | iso_pu_bacteria | 2961163497 | 2961164000 | 275 |
| 891 | iso_pu_bacteria | 2961170736 | 2961175111 | 275 |
| 892 | iso_pu_bacteria | 2963644680 | 2963646336 | 275 |
| 893 | iso_pu_bacteria | 2965018300 | 2965018934 | 275 |
| 894 | iso_pu_bacteria | 2965025482 | 2965027035 | 275 |
| 895 | iso_pu_bacteria | 2965032056 | 2965040200 | 275 |
| 896 | iso_pu_bacteria | 2965040258 | 2965046269 | 275 |
| 897 | iso_pu_bacteria | 2965062239 | 2965062847 | 275 |
| 898 | iso_pu_bacteria | 2965089291 | 2965090430 | 275 |
| 899 | iso_pu_bacteria | 2965119406 | 2965125245 | 275 |
| 900 | iso_pu_bacteria | 2967996073 | 2967999888 | 275 |
| 901 | iso_pu_bacteria | 2968003550 | 2968008247 | 275 |
| 902 | iso_pu_bacteria | 2968016561 | 2968020461 | 275 |
| 903 | iso_pu_bacteria | 2968091066 | 2968091312 | 275 |
| 904 | iso_pu_bacteria | 2968097103 | 2968103140 | 275 |
| 905 | iso_pu_bacteria | 2968128360 | 2968128930 | 275 |
| 906 | iso_pu_bacteria | 2968138860 | 2968143472 | 275 |
| 907 | iso_pu_bacteria | 2968171901 | 2968172403 | 275 |
| 908 | iso_pu_bacteria | 2970469710 | 2970473758 | 275 |
| 909 | iso_pu_bacteria | 2970489779 | 2970490429 | 275 |
| 910 | iso_pu_bacteria | 2970503327 | 2970507699 | 275 |
| 911 | iso_pu_bacteria | 2970510686 | 2970516849 | 275 |
| 912 | iso_pu_bacteria | 2970532167 | 2970534772 | 275 |
| 913 | iso_pu_bacteria | 2970547951 | 2970548273 | 275 |
| 914 | iso_pu_bacteria | 2970554993 | 2970555625 | 275 |
| 915 | iso_pu_bacteria | 2970593180 | 2970600269 | 275 |
| 916 | iso_pu_bacteria | 2970619444 | 2970620167 | 275 |
| 917 | iso_pu_bacteria | 2977821940 | 2977826719 | 275 |
| 918 | iso_pu_bacteria | 2977828996 | 2977832939 | 275 |
| 919 | iso_pu_bacteria | 2977843712 | 2977847395 | 275 |
| 920 | iso_pu_bacteria | 2977851361 | 2977854159 | 275 |
| 921 | iso_pu_bacteria | 2977858184 | 2977861730 | 275 |
| 922 | iso_pu_bacteria | 2977872689 | 2977873983 | 275 |
| 923 | iso_pu_bacteria | 2977915119 | 2977921921 | 275 |
| 924 | iso_pu_bacteria | 2977922695 | 2977925277 | 275 |
| 925 | iso_pu_bacteria | 2977935797 | 2977940645 | 275 |
| 926 | iso_pu_bacteria | 2977971508 | 2977973944 | 275 |
| 927 | iso_pu_bacteria | 2977986579 | 2977991287 | 275 |
| 928 | iso_pu_bacteria | 2979710463 | 2979715663 | 275 |
| 929 | iso_pu_bacteria | 2979742915 | 2979745632 | 275 |
| 930 | iso_pu_bacteria | 2979764755 | 2979771260 | 275 |
| 931 | iso_pu_bacteria | 2979779861 | 2979782194 | 275 |
| 932 | iso_pu_bacteria | 2979793036 | 2979793979 | 275 |
| 933 | iso_pu_bacteria | 2979808191 | 2979812883 | 275 |
| 934 | iso_pu_bacteria | 2987645492 | 2987648062 | 275 |
| 935 | iso_pu_bacteria | 2987652177 | 2987653914 | 275 |
| 936 | iso_pu_bacteria | 2987659509 | 2987660008 | 275 |
| 937 | iso_pu_bacteria | 2987666974 | 2987673446 | 275 |
| 938 | iso_pu_bacteria | 2996341866 | 2996342788 | 275 |
| 939 | iso_pu_bacteria | 2996348954 | 2996352919 | 275 |
| 940 | iso_pu_bacteria | 2996386984 | 2996393295 | 275 |
| 941 | iso_pu_bacteria | 3000135777 | 3000139312 | 275 |
| 942 | iso_pu_bacteria | 3004167301 | 3004167353 | 275 |
| 943 | iso_pu_bacteria | 3004188549 | 3004189056 | 275 |
| 944 | iso_pu_bacteria | 3004211236 | 3004217771 | 275 |
| 945 | iso_pu_bacteria | 3004218560 | 3004221181 | 275 |
| 946 | iso_pu_bacteria | 3004232784 | 3004232810 | 275 |
| 947 | iso_pu_bacteria | 3004239961 | 3004243378 | 275 |
| 948 | iso_pu_bacteria | 3004268573 | 3004269930 | 275 |
| 949 | iso_pu_bacteria | 3004275668 | 3004279601 | 275 |
| 950 | iso_pu_bacteria | 3004289098 | 3004290610 | 275 |
| 951 | iso_pu_bacteria | 3004334049 | 3004336058 | 275 |
| 952 | iso_pu_bacteria | 649633066 | 649871524 | 275 |
| 953 | iso_pu_bacteria | 8004300914 | 8004301844 | 275 |
| 954 | iso_pu_bacteria | 8004312739 | 8004314683 | 275 |
| 955 | iso_pu_bacteria | 8004374579 | 8004379135 | 275 |
| 956 | iso_pu_bacteria | 8004387939 | 8004389516 | 275 |
| 957 | iso_pu_bacteria | 8004445564 | 8004451787 | 275 |
| 958 | iso_pu_bacteria | 8004640170 | 8004644028 | 275 |
| 959 | iso_pu_bacteria | 8004703790 | 8004712337 | 275 |
| 960 | iso_pu_bacteria | 8004714634 | 8004717914 | 275 |
| 961 | iso_pu_bacteria | 8004727605 | 8004734035 | 275 |
| 962 | 3300006038 | Ga0075365_10044625 | Ga0075365_100446256 | 276 |
| 963 | 3300021361 | Ga0213872_10025047 | Ga0213872_100250472 | 276 |
| 964 | 3300039447 | Ga0436361_0845671 | Ga0436361_0845671_305_1210 | 276 |
| 965 | 3300049742 | Ga0501080_0691419 | Ga0501080_0691419_25_885 | 276 |
| 966 | 3300053158 | Ga0500627_0161288 | Ga0500627_0161288_132_995 | 276 |
| 967 | 3300005842 | Ga0068858_100478235 | Ga0068858_1004782351 | 277 |
| 968 | 3300005983 | Ga0081540_1096763 | Ga0081540_10967632 | 277 |
| 969 | 3300026035 | Ga0207703_10415708 | Ga0207703_104157082 | 277 |
| 970 | 3300042436 | Ga0439435_0050826 | Ga0439435_0050826_235_1074 | 277 |
| 971 | 3300049568 | Ga0501031_0058101 | Ga0501031_0058101_686_1534 | 277 |
| 972 | 3300049569 | Ga0501032_0012010 | Ga0501032_0012010_705_1553 | 277 |
| 973 | 3300049569 | Ga0501032_0016409 | Ga0501032_0016409_526_1374 | 277 |
| 974 | 3300049570 | Ga0501033_0010055 | Ga0501033_0010055_3006_3854 | 277 |
| 975 | 3300049570 | Ga0501033_0022431 | Ga0501033_0022431_686_1534 | 277 |
| 976 | 3300049571 | Ga0501034_0013483 | Ga0501034_0013483_4516_5364 | 277 |
| 977 | 3300049571 | Ga0501034_0050527 | Ga0501034_0050527_2903_3742 | 277 |
| 978 | 3300049571 | Ga0501034_0085368 | Ga0501034_0085368_635_1486 | 277 |
| 979 | 3300049572 | Ga0501036_0021735 | Ga0501036_0021735_3841_4689 | 277 |
| 980 | 3300049573 | Ga0501037_0070785 | Ga0501037_0070785_703_1551 | 277 |
| 981 | 3300049574 | Ga0501038_0035575 | Ga0501038_0035575_1421_2269 | 277 |
| 982 | 3300049575 | Ga0501039_0085075 | Ga0501039_0085075_705_1553 | 277 |
| 983 | 3300049580 | Ga0501046_0020293 | Ga0501046_0020293_3947_4795 | 277 |
| 984 | 3300049581 | Ga0501047_0086899 | Ga0501047_0086899_987_1835 | 277 |
| 985 | 3300049581 | Ga0501047_0134003 | Ga0501047_0134003_987_1835 | 277 |
| 986 | 3300049581 | Ga0501047_0242319 | Ga0501047_0242319_121_960 | 277 |
| 987 | 3300049584 | Ga0501068_0026011 | Ga0501068_0026011_900_1739 | 277 |
| 988 | 3300049585 | Ga0501069_0013466 | Ga0501069_0013466_2529_3368 | 277 |
| 989 | 3300049586 | Ga0501070_0093477 | Ga0501070_0093477_1592_2431 | 277 |
| 990 | 3300049587 | Ga0501071_0014047 | Ga0501071_0014047_4559_5407 | 277 |
| 991 | 3300049589 | Ga0501073_0031477 | Ga0501073_0031477_18_857 | 277 |
| 992 | 3300049589 | Ga0501073_0144825 | Ga0501073_0144825_587_1435 | 277 |
| 993 | 3300049589 | Ga0501073_0248679 | Ga0501073_0248679_116_985 | 277 |
| 994 | 3300049590 | Ga0501074_0031683 | Ga0501074_0031683_2581_3420 | 277 |
| 995 | 3300049590 | Ga0501074_0185745 | Ga0501074_0185745_140_988 | 277 |
| 996 | 3300049741 | Ga0501079_0172456 | Ga0501079_0172456_372_1211 | 277 |
| 997 | 3300049822 | Ga0501035_0010917 | Ga0501035_0010917_6877_7725 | 277 |
| 998 | 3300049822 | Ga0501035_0013756 | Ga0501035_0013756_3377_4225 | 277 |
| 999 | 3300049823 | Ga0501044_0007916 | Ga0501044_0007916_10133_10981 | 277 |
| 1000 | 3300049823 | Ga0501044_0061348 | Ga0501044_0061348_2313_3161 | 277 |
| 1001 | 3300049823 | Ga0501044_0395455 | Ga0501044_0395455_46_885 | 277 |
| 1002 | 3300053139 | Ga0500568_0000010 | Ga0500568_0000010_37895_38761 | 277 |
| 1003 | 3300048924 | Ga0496121_0154062 | Ga0496121_0154062_660_1511 | 278 |
| 1004 | 3300049589 | Ga0501073_0025527 | Ga0501073_0025527_289_1164 | 278 |
| 1005 | iso_pu_bacteria | 2961183825 | 2961188401 | 278 |
| 1006 | 3300001989 | JGI24739J22299_10022936 | JGI24739J22299_100229362 | 279 |
| 1007 | 3300003214 | JGI25165J46597_1000034 | JGI25165J46597_100003480 | 279 |
| 1008 | 3300003762 | Ga0055542_1001063 | Ga0055542_100106317 | 279 |
| 1009 | 3300003763 | Ga0055529_1003010 | Ga0055529_10030102 | 279 |
| 1010 | 3300005327 | Ga0070658_10332977 | Ga0070658_103329772 | 279 |
| 1011 | 3300005539 | Ga0068853_100009175 | Ga0068853_1000091755 | 279 |
| 1012 | 3300005548 | Ga0070665_100477974 | Ga0070665_1004779742 | 279 |
| 1013 | 3300005937 | Ga0081455_10146886 | Ga0081455_101468862 | 279 |
| 1014 | 3300006038 | Ga0075365_10002114 | Ga0075365_100021145 | 279 |
| 1015 | 3300006042 | Ga0075368_10028307 | Ga0075368_100283072 | 279 |
| 1016 | 3300006186 | Ga0075369_10131423 | Ga0075369_101314232 | 279 |
| 1017 | 3300009093 | Ga0105240_10398424 | Ga0105240_103984242 | 279 |
| 1018 | 3300009098 | Ga0105245_10458339 | Ga0105245_104583392 | 279 |
| 1019 | 3300009545 | Ga0105237_10054607 | Ga0105237_100546074 | 279 |
| 1020 | 3300009551 | Ga0105238_10314728 | Ga0105238_103147282 | 279 |
| 1021 | 3300010375 | Ga0105239_10050615 | Ga0105239_100506154 | 279 |
| 1022 | 3300013105 | Ga0157369_10188646 | Ga0157369_101886463 | 279 |
| 1023 | 3300013306 | Ga0163162_10739421 | Ga0163162_107394212 | 279 |
| 1024 | 3300013307 | Ga0157372_10708737 | Ga0157372_107087372 | 279 |
| 1025 | 3300014497 | Ga0182008_10036580 | Ga0182008_100365803 | 279 |
| 1026 | 3300025250 | Ga0209026_1000100 | Ga0209026_100010019 | 279 |
| 1027 | 3300025254 | Ga0209148_1000069 | Ga0209148_1000069167 | 279 |
| 1028 | 3300025254 | Ga0209148_1003960 | Ga0209148_10039604 | 279 |
| 1029 | 3300025256 | Ga0209759_1000549 | Ga0209759_100054921 | 279 |
| 1030 | 3300025261 | Ga0209233_1000028 | Ga0209233_100002884 | 279 |
| 1031 | 3300025272 | Ga0209455_1000135 | Ga0209455_100013520 | 279 |
| 1032 | 3300025907 | Ga0207645_10150484 | Ga0207645_101504842 | 279 |
| 1033 | 3300025914 | Ga0207671_10048066 | Ga0207671_100480663 | 279 |
| 1034 | 3300025924 | Ga0207694_10041236 | Ga0207694_100412364 | 279 |
| 1035 | 3300025937 | Ga0207669_10230800 | Ga0207669_102308002 | 279 |
| 1036 | 3300026067 | Ga0207678_10322066 | Ga0207678_103220662 | 279 |
| 1037 | 3300028379 | Ga0268266_10123949 | Ga0268266_101239492 | 279 |
| 1038 | 3300037418 | Ga0395900_0117317 | Ga0395900_0117317_1700_2545 | 279 |
| 1039 | 3300037471 | Ga0395905_0252820 | Ga0395905_0252820_506_1351 | 279 |
| 1040 | 3300038443 | Ga0395901_0047074 | Ga0395901_0047074_3345_4190 | 279 |
| 1041 | 3300038443 | Ga0395901_0151688 | Ga0395901_0151688_1307_2152 | 279 |
| 1042 | 3300046542 | Ga0495597_0091737 | Ga0495597_0091737_360_1214 | 279 |
| 1043 | 3300046616 | Ga0495668_0036681 | Ga0495668_0036681_986_1849 | 279 |
| 1044 | 3300046660 | Ga0495625_0021804 | Ga0495625_0021804_3910_4776 | 279 |
| 1045 | 3300046660 | Ga0495625_0145329 | Ga0495625_0145329_73_939 | 279 |
| 1046 | 3300048915 | Ga0496112_0001731 | Ga0496112_0001731_14244_15110 | 279 |
| 1047 | 3300048923 | Ga0496120_0002155 | Ga0496120_0002155_3777_4616 | 279 |
| 1048 | 3300048923 | Ga0496120_0020849 | Ga0496120_0020849_1868_2722 | 279 |
| 1049 | 3300048929 | Ga0496126_0152871 | Ga0496126_0152871_1118_1963 | 279 |
| 1050 | 3300050492 | nmdc:mga0yw44_315155_c1 | nmdc:mga0yw44_315155_c1_160_1026 | 279 |
| 1051 | 3300050494 | nmdc:mga06z11_257117_c1 | nmdc:mga06z11_257117_c1_23_880 | 279 |
| 1052 | 3300050516 | nmdc:mga0sz30_116209_c1 | nmdc:mga0sz30_116209_c1_71_937 | 279 |
| 1053 | 3300050516 | nmdc:mga0sz30_41876_c1 | nmdc:mga0sz30_41876_c1_853_1719 | 279 |
| 1054 | 3300053155 | Ga0500620_000598 | Ga0500620_000598_2954_3811 | 279 |
| 1055 | iso_pu_bacteria | 2965110997 | 2965117065 | 279 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2p10-assembly1.cif.gz_E | crystal structure of a putative phosphonopyruvate hydrolase (mll9387) from mesorhizobium loti maff303099 at 2.15 a resolution | 0.9357 | 4 | 277 |
| 2p10-assembly1.cif.gz_D | crystal structure of a putative phosphonopyruvate hydrolase (mll9387) from mesorhizobium loti maff303099 at 2.15 a resolution | 0.9346 | 4 | 277 |
| 2p10-assembly1.cif.gz_E | crystal structure of a putative phosphonopyruvate hydrolase (mll9387) from mesorhizobium loti maff303099 at 2.15 a resolution | 0.9295 | 4 | 277 |
| 2p10-assembly1.cif.gz_F | crystal structure of a putative phosphonopyruvate hydrolase (mll9387) from mesorhizobium loti maff303099 at 2.15 a resolution | 0.9292 | 4 | 277 |
| 2p10-assembly1.cif.gz_D | crystal structure of a putative phosphonopyruvate hydrolase (mll9387) from mesorhizobium loti maff303099 at 2.15 a resolution | 0.9244 | 4 | 277 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6FD56_1_198_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9354 | 55 | 252 | 3.20.20.70 |
| 2p10E01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9341 | 4 | 252 | 3.20.20.70 |
| af_A0A1D6FD56_1_198_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9308 | 55 | 252 | 3.20.20.70 |
| af_A0A1D6MLW1_1_166_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9293 | 57 | 218 | 3.20.20.70 |
| 2p10E01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9263 | 4 | 252 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A527VN36-F1-model_v4 | Phosphoenolpyruvate hydrolase family protein | 0.9969 | 156 | 240 |
GO:0016787
|
| AF-A0A5K0XTA2-F1-model_v4 | TIM-barrel domain-containing protein | 0.9899 | 145 | 227 |
GO:0003824
|
| AF-A0A530ATE5-F1-model_v4 | deleted | 0.9859 | 75 | 279 |
|
| AF-A0A528AZZ8-F1-model_v4 | Phosphoenolpyruvate hydrolase family protein | 0.9844 | 110 | 245 |
GO:0016787
|
| AF-L8GJP6-F1-model_v4 | Transcriptional regulator, putative | 0.9836 | 130 | 276 |
GO:0003824
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar