F489167

General Info

Members Datasets Scaffolds Average Seq Length
1055 662 720 279

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2871435913|2871441915
Length 336
Sequence PRKDILKKFRGMIDKGVPIVGGGAGTGLSAKAEEAGGIDLIIIYNSGRYRMAGRGSAAGLLAYGNANEIVKEMAYEVLPVVRHTPVLAGVNGTDPFVIMPLLLAELKTMGFSGVQNFPTIGLFDGSMRQSFEETGMGFGLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLEVDMIAEAHKLDLLTTPYVFNPDEARAMTKAGADIVVAHMGVTTGGSIGATSAKSLDDCVVEIDAIANAARSVRKDVILLCHGGPISMPDDARYILSHAKGLHGFYGASSMERLPAEAAIARQTADFKSVTLGGQK

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
3 2506520008 Serratia plymuthica AS12 Isolate Unclassified
4 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
5 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
6 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
7 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
8 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
9 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
10 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
11 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
12 2512875024 Mesorhizobium loti R88b Isolate Nodule
13 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
14 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
15 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
16 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
17 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
18 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
19 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
20 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
21 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
22 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
23 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
24 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
25 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
26 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
27 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
28 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
29 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
30 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
31 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
32 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
33 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
34 2643221629 Devosia sp. Root105 Isolate Unclassified
35 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
36 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
37 2643221662 Devosia sp. Root413D1 Isolate Unclassified
38 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
39 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
40 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
41 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
42 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
43 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
44 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
45 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
46 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
47 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
48 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
49 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
50 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
51 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
52 2791355260 Rhizobium sp. L9 Isolate Nodule
53 2791355265 Rhizobium sp. H4 Isolate Nodule
54 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
55 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
56 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
57 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
58 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
59 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
60 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
61 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
62 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
63 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
64 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
65 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
66 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
67 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
68 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
69 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
70 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
71 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
72 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
73 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
74 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
75 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
76 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
77 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
78 2851182111 Bosea sp. Tri-44 Isolate Nodule
79 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
80 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
81 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
82 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
83 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
84 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
85 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
86 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
87 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
88 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
89 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
90 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
91 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
92 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
93 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
94 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
95 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
96 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
97 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
98 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
99 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
100 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
101 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
102 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
103 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
104 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
105 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
106 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
107 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
108 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
109 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
110 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
111 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
112 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
113 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
114 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
115 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
116 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
117 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
118 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
119 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
120 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
121 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
122 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
123 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
124 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
125 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
126 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
127 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
128 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
129 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
130 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
131 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
132 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
133 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
134 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
135 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
136 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
137 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
138 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
139 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
140 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
141 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
142 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
143 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
144 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
145 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
146 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
147 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
148 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
149 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
150 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
151 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
152 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
153 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
154 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
155 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
156 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
157 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
158 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
159 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
160 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
161 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
162 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
163 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
164 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
165 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
166 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
167 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
168 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
169 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
170 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
171 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
172 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
173 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
174 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
175 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
176 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
177 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
178 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
179 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
180 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
181 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
182 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
183 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
184 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
185 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
186 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
187 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
188 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
189 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
190 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
191 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
192 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
193 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
194 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
195 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
196 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
197 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
198 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
199 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
200 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
201 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
202 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
203 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
204 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
205 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
206 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
207 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
208 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
209 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
210 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
211 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
212 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
213 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
214 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
215 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
216 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
217 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
218 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
219 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
220 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
221 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
222 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
223 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
224 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
225 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
226 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
227 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
228 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
229 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
230 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
231 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
232 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
233 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
234 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
235 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
236 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
237 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
238 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
239 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
240 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
241 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
242 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
243 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
244 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
245 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
246 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
247 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
248 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
249 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
250 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
251 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
252 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
253 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
254 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
255 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
256 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
257 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
258 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
259 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
260 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
261 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
262 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
263 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
264 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
265 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
266 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
267 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
268 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
269 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
270 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
271 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
272 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
273 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
274 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
275 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
276 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
277 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
278 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
279 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
280 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
281 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
282 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
283 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
284 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
285 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
286 2996893221 Rhizobium sp. R635 Isolate Nodule
287 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
288 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
289 3004167301 Mesorhizobium loti 582 Isolate Unclassified
290 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
291 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
292 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
293 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
294 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
295 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
296 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
297 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
298 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
299 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
300 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
301 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
302 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
303 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
304 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
305 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
306 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
307 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
308 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
309 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
310 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
311 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
312 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
313 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
314 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
315 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
316 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
317 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
318 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
319 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
320 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
321 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
322 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
323 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
324 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
325 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
326 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
327 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
328 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
329 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
330 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
331 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
332 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
333 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
334 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
335 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
336 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
337 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
338 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
339 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
340 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
341 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
342 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
343 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
344 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
345 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
346 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
347 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
348 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
349 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
350 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
351 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
352 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
353 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
354 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
355 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
356 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
357 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
358 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
359 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
360 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
361 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
362 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
363 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
364 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
365 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
366 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
367 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
368 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
369 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
370 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
371 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
372 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
373 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
374 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
375 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
376 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
377 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
378 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
379 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
380 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
381 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
382 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
383 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
384 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
385 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
386 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
387 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
388 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
389 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
390 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
391 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
392 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
393 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
394 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
395 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
396 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
397 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
398 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
399 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
400 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
401 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
402 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
403 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
404 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
405 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
406 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
407 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
408 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
409 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
410 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
411 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
412 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
413 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
414 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
415 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
416 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
417 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
418 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
419 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
420 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
421 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
422 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
423 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
424 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
425 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
426 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
427 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
428 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
429 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
430 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
431 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
432 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
433 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
434 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
435 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
436 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
437 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
438 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
439 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
440 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
441 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
442 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
443 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
444 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
445 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
446 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
447 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
448 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
449 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
450 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
451 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
452 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
453 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
454 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
455 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
456 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
457 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
458 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
459 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
460 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
461 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
462 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
463 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
464 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
465 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
466 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
467 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
468 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
469 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
470 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
471 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
472 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
473 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
474 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
475 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
476 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
477 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
478 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
479 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
480 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
481 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
482 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
483 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
484 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
485 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
486 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
487 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
488 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
489 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
490 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
491 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
492 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
493 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
494 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
495 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
496 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
497 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
498 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
499 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
500 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
501 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
502 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
503 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
504 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
505 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
506 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
507 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
508 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
509 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
510 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
511 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
512 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
513 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
514 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
515 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
516 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
517 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
518 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
519 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
520 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
521 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
522 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
523 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
524 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
525 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
526 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
527 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
528 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
529 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
530 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
531 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
532 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
533 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
534 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
535 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
536 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
537 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
538 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
539 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
540 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
541 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
542 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
543 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
544 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
545 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
546 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
547 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
548 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
549 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
550 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
551 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
552 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
553 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
554 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
555 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
556 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
557 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
558 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
559 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
560 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
561 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
562 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
563 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
564 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
565 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
566 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
567 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
568 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
569 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
570 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
571 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
572 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
573 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
574 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
575 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
576 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
577 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
578 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
579 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
580 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
581 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
582 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
583 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
584 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
585 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
586 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
587 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
588 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
589 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
590 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
591 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
592 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
593 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
594 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
595 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
596 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
597 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
598 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
599 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
600 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
601 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
602 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
603 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
604 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
605 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
606 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
607 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
608 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
609 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
610 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
611 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
612 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
613 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
614 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
615 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
616 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
617 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
618 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
619 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
620 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
621 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
622 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
623 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
624 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
625 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
626 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
627 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
628 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
629 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
630 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
631 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
632 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
633 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
634 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
635 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
636 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
637 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
638 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
639 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
640 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
641 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
642 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
643 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
644 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
645 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
646 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
647 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
648 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
649 8005382845 Rhizobium sp. R634 Isolate Nodule
650 8005395548 Rhizobium sp. R339 Isolate Nodule
651 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
652 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
653 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
654 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
655 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
656 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
657 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
658 8024501048 Rhizobium sp. H4 Isolate Nodule
659 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
660 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
661 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
662 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 68.25
Metatranscriptomes 0
Isolates 31.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.69
Nodule 26.45
Rhizoplane 1.52
Rhizosphere 59.05
Stem 0
Stem Tuber 0.38
Unclassified 6.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10022936 3300001989 Bacteria 2211
2 JGI25159J45721_1000461 3300002987 Bacteria 18823
3 JGI25165J46597_1000034 3300003214 Bacteria 292458
4 rootH2_10130272 3300003320 Bacteria 1771
5 JGI25160J50197_1000248 3300003354 Bacteria 41777
6 JGI25160J50197_1002309 3300003354 Bacteria 8942
7 JGI25161J50226_1000183 3300003374 Bacteria 41777
8 Ga0055542_1001063 3300003762 Bacteria 16922
9 Ga0055529_1003010 3300003763 Bacteria 2960
10 Ga0055524_1000850 3300003775 Bacteria 20030
11 Ga0055528_1001807 3300003790 Bacteria 12257
12 Ga0055543_1000245 3300004625 Bacteria 41815
13 Ga0065165_1001012 3300005262 Bacteria 34230
14 Ga0070658_10147445 3300005327 Bacteria 1968
15 Ga0070658_10290359 3300005327 Bacteria 1393
16 Ga0070658_10332977 3300005327 Bacteria 1298
17 Ga0070676_10068798 3300005328 Bacteria 2120
18 Ga0070683_100200023 3300005329 Bacteria 1897
19 Ga0070690_100001510 3300005330 Bacteria 12195
20 Ga0070690_100148394 3300005330 Bacteria 1598
21 Ga0068869_100001072 3300005334 Bacteria 15972
22 Ga0068869_100091578 3300005334 Bacteria 2287
23 Ga0068869_100173041 3300005334 Bacteria 1688
24 Ga0068869_100287153 3300005334 Bacteria 1324
25 Ga0070666_10007488 3300005335 Bacteria 6729
26 Ga0068868_100058831 3300005338 Bacteria 3038
27 Ga0068868_100152931 3300005338 Bacteria 1901
28 Ga0068868_100211375 3300005338 Bacteria 1621
29 Ga0068868_100462246 3300005338 Bacteria 1105
30 Ga0068868_100484783 3300005338 Bacteria 1081
31 Ga0070660_100235649 3300005339 Bacteria 1490
32 Ga0070660_100332888 3300005339 Bacteria 1249
33 Ga0070689_100011792 3300005340 Bacteria 6271
34 Ga0070689_100165543 3300005340 Bacteria 1789
35 Ga0070661_100001089 3300005344 Bacteria 19198
36 Ga0070661_100077522 3300005344 Bacteria 2450
37 Ga0070661_100093694 3300005344 Bacteria 2225
38 Ga0070661_100183246 3300005344 Bacteria 1594
39 Ga0070692_10101388 3300005345 Bacteria 1578
40 Ga0070668_100105638 3300005347 Bacteria 2236
41 Ga0070668_100337545 3300005347 Bacteria 1272
42 Ga0070669_100030183 3300005353 Bacteria 3910
43 Ga0070669_100077937 3300005353 Bacteria 2463
44 Ga0070669_100099619 3300005353 Bacteria 2190
45 Ga0070675_100002305 3300005354 Bacteria 14175
46 Ga0070671_100086319 3300005355 Bacteria 2625
47 Ga0070671_100180420 3300005355 Bacteria 1787
48 Ga0070674_100017239 3300005356 Bacteria 4539
49 Ga0070674_100024016 3300005356 Bacteria 3954
50 Ga0070673_100164516 3300005364 Bacteria 1889
51 Ga0070659_100069612 3300005366 Bacteria 2793
52 Ga0070659_100083833 3300005366 Bacteria 2548
53 Ga0070667_100001504 3300005367 Bacteria 20851
54 Ga0070667_100047622 3300005367 Bacteria 3607
55 Ga0070667_100133328 3300005367 Bacteria 2170
56 Ga0070667_100163109 3300005367 Bacteria 1964
57 Ga0070667_100342299 3300005367 Bacteria 1353
58 Ga0070701_10021078 3300005438 Bacteria 3104
59 Ga0070705_100054268 3300005440 Bacteria 2350
60 Ga0070700_100102045 3300005441 Bacteria 1892
61 Ga0070694_100277084 3300005444 Bacteria 1277
62 Ga0070663_100120191 3300005455 Bacteria 1983
63 Ga0070678_100044742 3300005456 Bacteria 3163
64 Ga0070678_100103935 3300005456 Bacteria 2208
65 Ga0070678_100108089 3300005456 Bacteria 2171
66 Ga0070678_100401568 3300005456 Bacteria 1191
67 Ga0070662_100007515 3300005457 Bacteria 7069
68 Ga0070662_100023880 3300005457 Bacteria 4206
69 Ga0070681_10024387 3300005458 Bacteria 6088
70 Ga0068867_100015891 3300005459 Bacteria 5343
71 Ga0068867_100020391 3300005459 Bacteria 4723
72 Ga0068867_100165982 3300005459 Bacteria 1745
73 Ga0070685_10209442 3300005466 Bacteria 1272
74 Ga0070679_100225219 3300005530 Bacteria 1835
75 Ga0070684_100109601 3300005535 Bacteria 2474
76 Ga0068853_100006106 3300005539 Bacteria 9539
77 Ga0068853_100009175 3300005539 Bacteria 7968
78 Ga0068853_100027399 3300005539 Bacteria 4787
79 Ga0068853_100074345 3300005539 Bacteria 2965
80 Ga0070672_100067901 3300005543 Bacteria 2826
81 Ga0070672_100097962 3300005543 Bacteria 2374
82 Ga0070686_100012181 3300005544 Bacteria 4892
83 Ga0070686_100080814 3300005544 Bacteria 2151
84 Ga0070695_100366935 3300005545 Bacteria 1083
85 Ga0070665_100023505 3300005548 Bacteria 6205
86 Ga0070665_100031128 3300005548 Bacteria 5370
87 Ga0070665_100032562 3300005548 Bacteria 5246
88 Ga0070665_100063348 3300005548 Bacteria 3707
89 Ga0070665_100099653 3300005548 Bacteria 2910
90 Ga0070665_100197127 3300005548 Bacteria 2014
91 Ga0070665_100237090 3300005548 Bacteria 1825
92 Ga0070665_100477974 3300005548 Bacteria 1257
93 Ga0070664_100065451 3300005564 Bacteria 3101
94 Ga0070664_100528939 3300005564 Bacteria 1089
95 Ga0068857_100031257 3300005577 Bacteria 4704
96 Ga0068857_100032013 3300005577 Bacteria 4648
97 Ga0068854_100049679 3300005578 Bacteria 2997
98 Ga0068854_100152807 3300005578 Bacteria 1781
99 Ga0068854_100193943 3300005578 Bacteria 1593
100 Ga0068856_100034379 3300005614 Bacteria 4964
101 Ga0068856_100034534 3300005614 Bacteria 4953
102 Ga0068856_100198757 3300005614 Bacteria 2019
103 Ga0068852_100007354 3300005616 Bacteria 8035
104 Ga0068852_100205312 3300005616 Bacteria 1866
105 Ga0068852_100349477 3300005616 Bacteria 1443
106 Ga0068852_100505746 3300005616 Bacteria 1204
107 Ga0068859_100006383 3300005617 Bacteria 11961
108 Ga0068859_100028370 3300005617 Bacteria 5611
109 Ga0068859_100032249 3300005617 Bacteria 5262
110 Ga0068859_100041599 3300005617 Bacteria 4616
111 Ga0068859_100204119 3300005617 Bacteria 2061
112 Ga0068864_100028037 3300005618 Bacteria 4758
113 Ga0068864_100036087 3300005618 Bacteria 4212
114 Ga0068864_100048815 3300005618 Bacteria 3639
115 Ga0068864_100061768 3300005618 Bacteria 3245
116 Ga0068864_100125087 3300005618 Bacteria 2303
117 Ga0068866_10011237 3300005718 Bacteria 3866
118 Ga0068866_10075384 3300005718 Bacteria 1796
119 Ga0068861_100002678 3300005719 Bacteria 11666
120 Ga0068861_100018125 3300005719 Bacteria 5008
121 Ga0068851_10000365 3300005834 Bacteria 20408
122 Ga0068870_10124723 3300005840 Bacteria 1488
123 Ga0068863_100006580 3300005841 Bacteria 11405
124 Ga0068863_100080476 3300005841 Bacteria 3085
125 Ga0068863_100096878 3300005841 Bacteria 2801
126 Ga0068858_100004441 3300005842 Bacteria 13757
127 Ga0068858_100028194 3300005842 Bacteria 5217
128 Ga0068858_100035188 3300005842 Bacteria 4645
129 Ga0068858_100231277 3300005842 Bacteria 1753
130 Ga0068858_100478235 3300005842 Bacteria 1202
131 Ga0068860_100004331 3300005843 Bacteria 14508
132 Ga0068860_100022924 3300005843 Bacteria 6037
133 Ga0068862_100033418 3300005844 Bacteria 4348
134 Ga0068862_100043996 3300005844 Bacteria 3808
135 Ga0068862_100064488 3300005844 Bacteria 3153
136 Ga0068862_100121394 3300005844 Bacteria 2304
137 Ga0068862_100375484 3300005844 Bacteria 1325
138 Ga0081455_10080898 3300005937 Bacteria 2662
139 Ga0081455_10146886 3300005937 Bacteria 1823
140 Ga0081538_10004363 3300005981 Bacteria 13069
141 Ga0081540_1096763 3300005983 Bacteria 1283
142 Ga0081539_10002732 3300005985 Bacteria 23848
143 Ga0081539_10005538 3300005985 Bacteria 12799
144 Ga0081539_10006723 3300005985 Bacteria 10828
145 Ga0075365_10002114 3300006038 Bacteria 9514
146 Ga0075365_10044625 3300006038 Bacteria 2906
147 Ga0075365_10145851 3300006038 Bacteria 1644
148 Ga0075365_10271373 3300006038 Bacteria 1193
149 Ga0075368_10028307 3300006042 Bacteria 2165
150 Ga0075368_10062340 3300006042 Bacteria 1495
151 Ga0075368_10125673 3300006042 Bacteria 1064
152 Ga0075363_100163877 3300006048 Bacteria 1260
153 Ga0075362_10048050 3300006177 Bacteria 1903
154 Ga0075367_10111633 3300006178 Bacteria 1678
155 Ga0075367_10122285 3300006178 Bacteria 1604
156 Ga0075367_10125863 3300006178 Bacteria 1582
157 Ga0075369_10131423 3300006186 Bacteria 1138
158 Ga0097621_100028453 3300006237 Bacteria 4404
159 Ga0097621_100035235 3300006237 Bacteria 3998
160 Ga0097621_100040781 3300006237 Bacteria 3734
161 Ga0097621_100048996 3300006237 Bacteria 3430
162 Ga0075370_10002495 3300006353 Bacteria 8542
163 Ga0075370_10022024 3300006353 Bacteria 3495
164 Ga0075370_10181913 3300006353 Bacteria 1237
165 Ga0068871_100002664 3300006358 Bacteria 12194
166 Ga0068871_100042592 3300006358 Bacteria 3645
167 Ga0068871_100114905 3300006358 Bacteria 2268
168 Ga0068871_100373297 3300006358 Bacteria 1265
169 Ga0068865_100687602 3300006881 Bacteria 873
170 Ga0097620_100006383 3300006931 Bacteria 11961
171 Ga0097620_100028370 3300006931 Bacteria 5611
172 Ga0097620_100032249 3300006931 Bacteria 5262
173 Ga0097620_100041599 3300006931 Bacteria 4616
174 Ga0097620_100204114 3300006931 Bacteria 2061
175 Ga0099794_10058192 3300007265 Bacteria 1873
176 Ga0105251_10023093 3300009011 Bacteria 3217
177 Ga0105244_10000008 3300009036 Bacteria 302297
178 Ga0105244_10044571 3300009036 Bacteria 2285
179 Ga0105240_10033261 3300009093 Bacteria 6665
180 Ga0105240_10066593 3300009093 Bacteria 4467
181 Ga0105240_10356120 3300009093 Bacteria 1659
182 Ga0105240_10398424 3300009093 Bacteria 1551
183 Ga0105240_10679558 3300009093 Bacteria 1126
184 Ga0105245_10036163 3300009098 Bacteria 4386
185 Ga0105245_10138735 3300009098 Bacteria 2288
186 Ga0105245_10225969 3300009098 Bacteria 1808
187 Ga0105245_10319392 3300009098 Bacteria 1529
188 Ga0105245_10458339 3300009098 Bacteria 1285
189 Ga0105247_10008662 3300009101 Bacteria 6199
190 Ga0114129_10414989 3300009147 Bacteria 1772
191 Ga0114129_10454489 3300009147 Bacteria 1679
192 Ga0114129_10773577 3300009147 Bacteria 1227
193 Ga0105243_10091923 3300009148 Bacteria 2500
194 Ga0105243_10361206 3300009148 Bacteria 1337
195 Ga0105241_10036083 3300009174 Bacteria 3720
196 Ga0105241_10157185 3300009174 Bacteria 1865
197 Ga0105242_10208879 3300009176 Bacteria 1738
198 Ga0105248_10041378 3300009177 Bacteria 5166
199 Ga0105248_10061180 3300009177 Bacteria 4227
200 Ga0105248_10088563 3300009177 Bacteria 3484
201 Ga0105248_10364460 3300009177 Bacteria 1627
202 Ga0105248_10447472 3300009177 Bacteria 1455
203 Ga0105248_10689781 3300009177 Bacteria 1152
204 Ga0105237_10000397 3300009545 Bacteria 61927
205 Ga0105237_10009247 3300009545 Bacteria 10567
206 Ga0105237_10019781 3300009545 Bacteria 6951
207 Ga0105237_10054607 3300009545 Bacteria 4003
208 Ga0105238_10001007 3300009551 Bacteria 28742
209 Ga0105238_10038235 3300009551 Bacteria 4874
210 Ga0105238_10105265 3300009551 Bacteria 2803
211 Ga0105238_10158573 3300009551 Bacteria 2238
212 Ga0105238_10314728 3300009551 Bacteria 1551
213 Ga0105238_10405995 3300009551 Bacteria 1356
214 Ga0105249_10028900 3300009553 Bacteria 5004
215 Ga0105249_10161350 3300009553 Bacteria 2167
216 Ga0105249_10388482 3300009553 Bacteria 1423
217 Ga0123341_1000002 3300009765 Bacteria 191257
218 Ga0123342_1030249 3300009766 Bacteria 2736
219 Ga0105239_10014766 3300010375 Bacteria 8662
220 Ga0105239_10050615 3300010375 Bacteria 4556
221 Ga0105239_10161991 3300010375 Bacteria 2500
222 Ga0105239_10572027 3300010375 Bacteria 1288
223 Ga0157373_10107585 3300013100 Bacteria 1960
224 Ga0157370_10009932 3300013104 Bacteria 10080
225 Ga0157370_10075580 3300013104 Bacteria 3175
226 Ga0157369_10082358 3300013105 Bacteria 3443
227 Ga0157369_10188646 3300013105 Bacteria 2167
228 Ga0157374_10025942 3300013296 Bacteria 5268
229 Ga0157374_10033943 3300013296 Bacteria 4658
230 Ga0157374_10167215 3300013296 Bacteria 2144
231 Ga0157378_10045061 3300013297 Bacteria 3918
232 Ga0157378_10136529 3300013297 Bacteria 2274
233 Ga0163162_10024703 3300013306 Bacteria 5935
234 Ga0163162_10045548 3300013306 Bacteria 4395
235 Ga0163162_10057983 3300013306 Bacteria 3900
236 Ga0163162_10423131 3300013306 Bacteria 1464
237 Ga0163162_10739421 3300013306 Bacteria 1103
238 Ga0157372_10011373 3300013307 Bacteria 9468
239 Ga0157372_10708737 3300013307 Bacteria 1171
240 Ga0157375_10008005 3300013308 Bacteria 9255
241 Ga0157375_10023236 3300013308 Bacteria 5717
242 Ga0157375_10356582 3300013308 Bacteria 1628
243 Ga0163163_10261173 3300014325 Bacteria 1783
244 Ga0157380_10014846 3300014326 Bacteria 5706
245 Ga0157380_10069262 3300014326 Bacteria 2846
246 Ga0157380_10240615 3300014326 Bacteria 1631
247 Ga0157380_10359558 3300014326 Bacteria 1365
248 Ga0182008_10036580 3300014497 Bacteria 2456
249 Ga0157377_10040065 3300014745 Bacteria 2593
250 Ga0157379_10032980 3300014968 Bacteria 4618
251 Ga0157379_10048368 3300014968 Bacteria 3796
252 Ga0157379_10079481 3300014968 Bacteria 2936
253 Ga0157379_10110685 3300014968 Bacteria 2466
254 Ga0157379_10146008 3300014968 Bacteria 2133
255 Ga0157379_10172661 3300014968 Bacteria 1951
256 Ga0157379_10188227 3300014968 Bacteria 1865
257 Ga0157376_10017989 3300014969 Bacteria 5407
258 Ga0157376_10300346 3300014969 Bacteria 1520
259 Ga0157376_10415360 3300014969 Bacteria 1304
260 Ga0163161_10000375 3300017792 Bacteria 37352
261 Ga0163161_10015393 3300017792 Bacteria 5332
262 Ga0163161_10046661 3300017792 Bacteria 3126
263 Ga0163161_10473372 3300017792 Bacteria 1016
264 Ga0214544_1000010 3300021320 Bacteria 270164
265 Ga0214542_1000023 3300021321 Bacteria 191557
266 Ga0214543_1000019 3300021327 Bacteria 267908
267 Ga0214543_1000132 3300021327 Bacteria 102506
268 Ga0213872_10025047 3300021361 Bacteria 2744
269 Ga0213872_10065659 3300021361 Bacteria 1638
270 Ga0213876_10007178 3300021384 Bacteria 6072
271 Ga0209026_1000100 3300025250 Bacteria 156131
272 Ga0209148_1000069 3300025254 Bacteria 334444
273 Ga0209148_1003960 3300025254 Bacteria 3806
274 Ga0209759_1000549 3300025256 Bacteria 38630
275 Ga0209233_1000028 3300025261 Bacteria 642062
276 Ga0209455_1000135 3300025272 Bacteria 148007
277 Ga0209130_1000098 3300025284 Bacteria 142506
278 Ga0207426_1000069 3300025302 Bacteria 334513
279 Ga0207656_10033061 3300025321 Bacteria 2152
280 Ga0207656_10093293 3300025321 Bacteria 1369
281 Ga0207655_1000083 3300025728 Bacteria 213295
282 Ga0207642_10003301 3300025899 Bacteria 5072
283 Ga0207642_10017892 3300025899 Bacteria 2707
284 Ga0207642_10079957 3300025899 Bacteria 1584
285 Ga0207642_10306952 3300025899 Bacteria 922
286 Ga0207710_10020079 3300025900 Bacteria 2854
287 Ga0207688_10048621 3300025901 Bacteria 2370
288 Ga0207680_10008233 3300025903 Bacteria 5111
289 Ga0207680_10037305 3300025903 Bacteria 2805
290 Ga0207645_10014615 3300025907 Bacteria 5247
291 Ga0207645_10063671 3300025907 Bacteria 2356
292 Ga0207645_10080212 3300025907 Bacteria 2092
293 Ga0207645_10111210 3300025907 Bacteria 1773
294 Ga0207645_10150484 3300025907 Bacteria 1519
295 Ga0207643_10037483 3300025908 Bacteria 2721
296 Ga0207705_10193299 3300025909 Bacteria 1540
297 Ga0207707_10013657 3300025912 Bacteria 7081
298 Ga0207695_10038212 3300025913 Bacteria 5171
299 Ga0207695_10076226 3300025913 Bacteria 3410
300 Ga0207695_10096031 3300025913 Bacteria 2966
301 Ga0207695_10253863 3300025913 Bacteria 1657
302 Ga0207671_10001048 3300025914 Bacteria 33586
303 Ga0207671_10011147 3300025914 Bacteria 7344
304 Ga0207671_10048066 3300025914 Bacteria 3158
305 Ga0207671_10107859 3300025914 Bacteria 2116
306 Ga0207671_10206365 3300025914 Bacteria 1536
307 Ga0207660_10152323 3300025917 Bacteria 1777
308 Ga0207662_10091224 3300025918 Bacteria 1874
309 Ga0207657_10126788 3300025919 Bacteria 2096
310 Ga0207649_10016189 3300025920 Bacteria 4200
311 Ga0207649_10046174 3300025920 Bacteria 2674
312 Ga0207649_10092468 3300025920 Bacteria 1983
313 Ga0207652_10209720 3300025921 Bacteria 1754
314 Ga0207681_10002332 3300025923 Bacteria 12077
315 Ga0207681_10153866 3300025923 Bacteria 1726
316 Ga0207694_10000939 3300025924 Bacteria 25682
317 Ga0207694_10024125 3300025924 Bacteria 4618
318 Ga0207694_10041236 3300025924 Bacteria 3556
319 Ga0207650_10003921 3300025925 Bacteria 10179
320 Ga0207650_10329831 3300025925 Bacteria 1251
321 Ga0207659_10002102 3300025926 Bacteria 11796
322 Ga0207659_10004947 3300025926 Bacteria 8080
323 Ga0207659_10112987 3300025926 Bacteria 2068
324 Ga0207644_10000391 3300025931 Bacteria 28488
325 Ga0207644_10148455 3300025931 Bacteria 1812
326 Ga0207706_10012440 3300025933 Bacteria 7753
327 Ga0207706_10117616 3300025933 Bacteria 2338
328 Ga0207686_10061306 3300025934 Bacteria 2384
329 Ga0207686_10129417 3300025934 Bacteria 1729
330 Ga0207709_10040090 3300025935 Bacteria 2802
331 Ga0207709_10331959 3300025935 Bacteria 1142
332 Ga0207670_10363940 3300025936 Bacteria 1148
333 Ga0207669_10230800 3300025937 Bacteria 1365
334 Ga0207704_10002411 3300025938 Bacteria 8409
335 Ga0207704_10003969 3300025938 Bacteria 6732
336 Ga0207704_10156931 3300025938 Bacteria 1614
337 Ga0207704_10253923 3300025938 Bacteria 1322
338 Ga0207691_10106812 3300025940 Bacteria 2493
339 Ga0207691_10416751 3300025940 Bacteria 1145
340 Ga0207711_10075706 3300025941 Bacteria 2930
341 Ga0207711_10135078 3300025941 Bacteria 2215
342 Ga0207711_10259726 3300025941 Bacteria 1596
343 Ga0207711_10293817 3300025941 Bacteria 1498
344 Ga0207689_10001138 3300025942 Bacteria 25663
345 Ga0207689_10001210 3300025942 Bacteria 24834
346 Ga0207689_10025123 3300025942 Bacteria 4993
347 Ga0207689_10046936 3300025942 Bacteria 3568
348 Ga0207689_10068759 3300025942 Bacteria 2910
349 Ga0207679_10115679 3300025945 Bacteria 2125
350 Ga0207679_10406468 3300025945 Bacteria 1199
351 Ga0207667_10070326 3300025949 Bacteria 3642
352 Ga0207667_10168889 3300025949 Bacteria 2248
353 Ga0207667_10703046 3300025949 Bacteria 1013
354 Ga0207712_10014157 3300025961 Bacteria 5121
355 Ga0207712_10149895 3300025961 Bacteria 1800
356 Ga0207668_10081767 3300025972 Bacteria 2344
357 Ga0207658_10014043 3300025986 Bacteria 5481
358 Ga0207658_10041836 3300025986 Bacteria 3320
359 Ga0207658_10060711 3300025986 Bacteria 2822
360 Ga0207677_10002667 3300026023 Bacteria 9401
361 Ga0207677_10050917 3300026023 Bacteria 2804
362 Ga0207677_10057425 3300026023 Bacteria 2672
363 Ga0207703_10009260 3300026035 Bacteria 7744
364 Ga0207703_10021839 3300026035 Bacteria 5011
365 Ga0207703_10184954 3300026035 Bacteria 1841
366 Ga0207703_10186380 3300026035 Bacteria 1835
367 Ga0207703_10415708 3300026035 Bacteria 1250
368 Ga0207639_10007355 3300026041 Bacteria 7504
369 Ga0207639_10024149 3300026041 Bacteria 4395
370 Ga0207639_10043661 3300026041 Bacteria 3367
371 Ga0207639_10083123 3300026041 Bacteria 2541
372 Ga0207639_10188821 3300026041 Bacteria 1758
373 Ga0207639_10694793 3300026041 Bacteria 943
374 Ga0207678_10028557 3300026067 Bacteria 4869
375 Ga0207678_10043551 3300026067 Bacteria 3884
376 Ga0207678_10322066 3300026067 Bacteria 1330
377 Ga0207708_10007488 3300026075 Bacteria 8069
378 Ga0207708_10077668 3300026075 Bacteria 2548
379 Ga0207708_10101084 3300026075 Bacteria 2232
380 Ga0207708_10551199 3300026075 Bacteria 972
381 Ga0207641_10003042 3300026088 Bacteria 15111
382 Ga0207641_10064788 3300026088 Bacteria 3124
383 Ga0207641_10106666 3300026088 Bacteria 2477
384 Ga0207641_10171221 3300026088 Bacteria 1982
385 Ga0207648_10002672 3300026089 Bacteria 18989
386 Ga0207648_10020858 3300026089 Bacteria 5900
387 Ga0207648_10023482 3300026089 Bacteria 5523
388 Ga0207648_10082941 3300026089 Bacteria 2796
389 Ga0207648_10115887 3300026089 Bacteria 2355
390 Ga0207648_10651299 3300026089 Bacteria 974
391 Ga0207676_10020763 3300026095 Bacteria 4809
392 Ga0207676_10103059 3300026095 Bacteria 2370
393 Ga0207676_10214101 3300026095 Bacteria 1711
394 Ga0207674_10021614 3300026116 Bacteria 6927
395 Ga0207674_10028028 3300026116 Bacteria 5951
396 Ga0207674_10041929 3300026116 Bacteria 4730
397 Ga0207674_10042765 3300026116 Bacteria 4676
398 Ga0207674_10043491 3300026116 Bacteria 4631
399 Ga0207675_100006819 3300026118 Bacteria 10814
400 Ga0207675_100013077 3300026118 Bacteria 7747
401 Ga0207675_100013316 3300026118 Bacteria 7676
402 Ga0207675_100027523 3300026118 Bacteria 5295
403 Ga0207683_10066240 3300026121 Bacteria 3185
404 Ga0207683_10087595 3300026121 Bacteria 2769
405 Ga0207698_10012540 3300026142 Bacteria 5553
406 Ga0207698_10110387 3300026142 Bacteria 2304
407 Ga0207428_10088859 3300027907 Bacteria 2402
408 Ga0268266_10000257 3300028379 Bacteria 89384
409 Ga0268266_10033856 3300028379 Bacteria 4342
410 Ga0268266_10067552 3300028379 Bacteria 3094
411 Ga0268266_10099515 3300028379 Bacteria 2560
412 Ga0268266_10123949 3300028379 Bacteria 2303
413 Ga0268266_10181019 3300028379 Bacteria 1919
414 Ga0268265_10101967 3300028380 Bacteria 2320
415 Ga0268265_10119785 3300028380 Bacteria 2166
416 Ga0268265_10136798 3300028380 Bacteria 2045
417 Ga0268265_10165509 3300028380 Bacteria 1884
418 Ga0268265_10241758 3300028380 Bacteria 1593
419 Ga0268264_10001001 3300028381 Bacteria 28672
420 Ga0268264_10003066 3300028381 Bacteria 14474
421 Ga0268264_10023023 3300028381 Bacteria 5083
422 Ga0268264_10081093 3300028381 Bacteria 2772
423 Ga0268264_10198848 3300028381 Bacteria 1832
424 Ga0307515_10001956 3300028794 Bacteria 45627
425 Ga0265332_10070180 3300031238 Bacteria 1493
426 Ga0265325_10012043 3300031241 Bacteria 4955
427 Ga0265340_10103457 3300031247 Bacteria 1322
428 Ga0265339_10215540 3300031249 Bacteria 941
429 Ga0265331_10021115 3300031250 Bacteria 3336
430 Ga0265331_10092429 3300031250 Bacteria 1397
431 Ga0265316_10448039 3300031344 Bacteria 926
432 Ga0307513_10154305 3300031456 Bacteria 2199
433 Ga0307408_100184963 3300031548 Bacteria 1674
434 Ga0265313_10066804 3300031595 Bacteria 1665
435 Ga0265314_10036505 3300031711 Bacteria 3571
436 Ga0265314_10207403 3300031711 Bacteria 1153
437 Ga0307405_10055754 3300031731 Bacteria 2475
438 Ga0307413_10154821 3300031824 Bacteria 1602
439 Ga0307413_10391905 3300031824 Bacteria 1085
440 Ga0307406_10165481 3300031901 Bacteria 1595
441 Ga0307406_10182726 3300031901 Bacteria 1528
442 Ga0307406_10212650 3300031901 Bacteria 1432
443 Ga0307407_10135268 3300031903 Bacteria 1583
444 Ga0307412_10364108 3300031911 Bacteria 1165
445 Ga0307409_100071106 3300031995 Bacteria 2765
446 Ga0307409_100435895 3300031995 Bacteria 1261
447 Ga0307416_100011529 3300032002 Bacteria 5903
448 Ga0307416_100025422 3300032002 Bacteria 4340
449 Ga0307411_10175938 3300032005 Bacteria 1619
450 Ga0307415_100112335 3300032126 Bacteria 2024
451 Ga0307415_100271516 3300032126 Bacteria 1389
452 Ga0373962_0019366 3300035242 Bacteria 1780
453 Ga0373931_0030437 3300035691 Bacteria 2778
454 Ga0395899_0084472 3300037312 Bacteria 2308
455 Ga0395900_0014410 3300037418 Bacteria 8069
456 Ga0395900_0117317 3300037418 Bacteria 2731
457 Ga0395898_0250599 3300037466 Bacteria 1689
458 Ga0395905_0015692 3300037471 Bacteria 7196
459 Ga0395905_0133797 3300037471 Bacteria 2332
460 Ga0395905_0252820 3300037471 Bacteria 1646
461 Ga0395905_0344751 3300037471 Bacteria 1381
462 Ga0395901_0047074 3300038443 Bacteria 4479
463 Ga0395901_0076932 3300038443 Bacteria 3482
464 Ga0395901_0151688 3300038443 Bacteria 2435
465 Ga0436365_0551841 3300039437 Bacteria 1251
466 Ga0436365_1295259 3300039437 Bacteria 8569
467 Ga0436361_0060394 3300039447 Bacteria 4673
468 Ga0436361_0845671 3300039447 Bacteria 3085
469 Ga0439438_000021 3300041405 Bacteria 109330
470 Ga0439447_002674 3300041407 Bacteria 6453
471 Ga0439465_0035766 3300041413 Bacteria 1593
472 Ga0451841_0277328 3300041498 Bacteria 1627
473 Ga0451843_1665491 3300041509 Bacteria 1372
474 Ga0451855_1135979 3300041511 Bacteria 1792
475 Ga0451853_1535672 3300041512 Bacteria 1966
476 Ga0451853_3126826 3300041512 Bacteria 2691
477 Ga0439445_0079000 3300042004 Bacteria 918
478 Ga0439432_020645 3300042006 Bacteria 2187
479 Ga0439450_033059 3300042008 Bacteria 1171
480 Ga0450908_012082 3300042184 Bacteria 1571
481 Ga0439435_0050826 3300042436 Bacteria 1186
482 Ga0439464_0006733 3300042439 Bacteria 2996
483 Ga0466972_0029385 3300044658 Bacteria 2706
484 Ga0451576_0064685 3300045051 Bacteria 3809
485 Ga0466958_0157855 3300045836 Bacteria 1432
486 Ga0466967_0306169 3300045976 Bacteria 1530
487 Ga0495627_001317 3300046453 Bacteria 15130
488 Ga0495591_002496 3300046458 Bacteria 10186
489 Ga0495629_0199720 3300046459 Bacteria 1383
490 Ga0495638_0042235 3300046460 Bacteria 2881
491 Ga0495638_0215387 3300046460 Bacteria 1076
492 Ga0495650_0000008 3300046471 Bacteria 688246
493 Ga0495650_0013567 3300046471 Bacteria 4299
494 Ga0495650_0062159 3300046471 Bacteria 1493
495 Ga0495580_0016298 3300046472 Bacteria 5580
496 Ga0495605_0019290 3300046474 Bacteria 3647
497 Ga0495605_0031401 3300046474 Bacteria 2713
498 Ga0495584_0022473 3300046491 Bacteria 3200
499 Ga0495596_0112964 3300046500 Bacteria 1055
500 Ga0495607_0009540 3300046501 Bacteria 6560
501 Ga0495607_0148138 3300046501 Bacteria 1204
502 Ga0495606_0001619 3300046507 Bacteria 29382
503 Ga0495610_0018917 3300046512 Bacteria 3872
504 Ga0495616_0013102 3300046513 Bacteria 4688
505 Ga0495620_0016163 3300046515 Bacteria 3754
506 Ga0495628_0532409 3300046516 Bacteria 845
507 Ga0495631_0056290 3300046518 Bacteria 1712
508 Ga0495631_0078236 3300046518 Bacteria 1428
509 Ga0495632_0024918 3300046519 Bacteria 3171
510 Ga0495637_0078976 3300046520 Bacteria 1315
511 Ga0495643_0128851 3300046522 Bacteria 1272
512 Ga0495644_0025575 3300046523 Bacteria 2240
513 Ga0495648_0007216 3300046524 Bacteria 8929
514 Ga0495648_0014184 3300046524 Bacteria 5846
515 Ga0495648_0031408 3300046524 Bacteria 3497
516 Ga0495654_0076200 3300046530 Bacteria 1581
517 Ga0495621_0047296 3300046539 Bacteria 1529
518 Ga0495597_0013170 3300046542 Bacteria 3969
519 Ga0495597_0091737 3300046542 Bacteria 1289
520 Ga0495656_0000137 3300046615 Bacteria 27177
521 Ga0495656_0012841 3300046615 Bacteria 3102
522 Ga0495668_0036681 3300046616 Bacteria 2746
523 Ga0495668_0044095 3300046616 Bacteria 2479
524 Ga0495625_0005544 3300046660 Bacteria 11461
525 Ga0495625_0021804 3300046660 Bacteria 4921
526 Ga0495625_0145329 3300046660 Bacteria 1597
527 Ga0495625_0247566 3300046660 Bacteria 1158
528 Ga0495624_0097942 3300046690 Bacteria 1807
529 Ga0495671_0009568 3300046692 Bacteria 5409
530 Ga0495649_0003827 3300046694 Bacteria 9962
531 Ga0495649_0051331 3300046694 Bacteria 2237
532 Ga0495589_0016275 3300046794 Bacteria 3823
533 Ga0495660_0000019 3300046810 Bacteria 311047
534 Ga0495660_0053584 3300046810 Bacteria 2189
535 Ga0495672_0000003 3300047320 Bacteria 728845
536 Ga0495676_0041260 3300047321 Bacteria 3800
537 Ga0495680_0199987 3300047322 Bacteria 1434
538 Ga0495683_0060105 3300047323 Bacteria 1884
539 Ga0495687_000315 3300047443 Bacteria 62841
540 Ga0495687_004781 3300047443 Bacteria 8944
541 Ga0495673_0000011 3300047469 Bacteria 674140
542 Ga0495681_0046366 3300047470 Bacteria 2073
543 Ga0495686_0024783 3300047472 Bacteria 3937
544 Ga0495686_0025877 3300047472 Bacteria 3843
545 Ga0495686_0052543 3300047472 Bacteria 2555
546 Ga0495686_0058797 3300047472 Bacteria 2395
547 Ga0495593_0034342 3300047673 Bacteria 2759
548 Ga0495602_0349358 3300048088 Bacteria 1068
549 Ga0495615_0019143 3300048090 Bacteria 1517
550 Ga0495615_0031301 3300048090 Bacteria 1275
551 Ga0496102_0031944 3300048905 Bacteria 4727
552 Ga0496105_0431673 3300048908 Bacteria 1042
553 Ga0496106_0015363 3300048909 Bacteria 5666
554 Ga0496107_0057456 3300048910 Bacteria 2812
555 Ga0496108_0083530 3300048911 Bacteria 2709
556 Ga0496108_0137129 3300048911 Bacteria 2106
557 Ga0496108_0559098 3300048911 Bacteria 998
558 Ga0496109_0275367 3300048912 Bacteria 1586
559 Ga0496110_0008710 3300048913 Bacteria 8172
560 Ga0496111_0082657 3300048914 Bacteria 2346
561 Ga0496112_0001731 3300048915 Bacteria 17084
562 Ga0496112_0690544 3300048915 Bacteria 949
563 Ga0496113_0165586 3300048916 Bacteria 1749
564 Ga0496114_0280180 3300048917 Bacteria 1470
565 Ga0496116_0000076 3300048919 Bacteria 229670
566 Ga0496119_0000044 3300048922 Bacteria 191820
567 Ga0496119_0001021 3300048922 Bacteria 35860
568 Ga0496119_0010974 3300048922 Bacteria 7562
569 Ga0496120_0000044 3300048923 Bacteria 192292
570 Ga0496120_0000073 3300048923 Bacteria 164280
571 Ga0496120_0002155 3300048923 Bacteria 20986
572 Ga0496120_0020849 3300048923 Bacteria 4153
573 Ga0496121_0154062 3300048924 Bacteria 1688
574 Ga0496121_0167571 3300048924 Bacteria 1599
575 Ga0496124_0392689 3300048927 Bacteria 966
576 Ga0496125_0066554 3300048928 Bacteria 2846
577 Ga0496126_0046351 3300048929 Bacteria 3988
578 Ga0496126_0152871 3300048929 Bacteria 1977
579 Ga0495678_000479 3300049459 Bacteria 39762
580 Ga0495682_0000006 3300049460 Bacteria 316373
581 Ga0501031_0026318 3300049568 Bacteria 3793
582 Ga0501031_0058101 3300049568 Bacteria 2520
583 Ga0501032_0000018 3300049569 Bacteria 156275
584 Ga0501032_0012010 3300049569 Bacteria 6200
585 Ga0501032_0016409 3300049569 Bacteria 5209
586 Ga0501032_0145442 3300049569 Bacteria 1560
587 Ga0501033_0000032 3300049570 Bacteria 156304
588 Ga0501033_0010055 3300049570 Bacteria 7263
589 Ga0501033_0022431 3300049570 Bacteria 4762
590 Ga0501033_0048959 3300049570 Bacteria 3138
591 Ga0501034_0000103 3300049571 Bacteria 156304
592 Ga0501034_0000444 3300049571 Bacteria 68426
593 Ga0501034_0013483 3300049571 Bacteria 8413
594 Ga0501034_0026618 3300049571 Bacteria 5888
595 Ga0501034_0043168 3300049571 Bacteria 4564
596 Ga0501034_0050527 3300049571 Bacteria 4193
597 Ga0501034_0051840 3300049571 Bacteria 4136
598 Ga0501034_0053228 3300049571 Bacteria 4077
599 Ga0501034_0085368 3300049571 Bacteria 3158
600 Ga0501034_0176639 3300049571 Bacteria 2101
601 Ga0501034_0177927 3300049571 Bacteria 2093
602 Ga0501034_0201026 3300049571 Bacteria 1951
603 Ga0501034_0371386 3300049571 Bacteria 1356
604 Ga0501034_0584761 3300049571 Bacteria 1023
605 Ga0501036_0000012 3300049572 Bacteria 156304
606 Ga0501036_0021735 3300049572 Bacteria 5393
607 Ga0501036_0357484 3300049572 Bacteria 1219
608 Ga0501037_0000018 3300049573 Bacteria 156304
609 Ga0501037_0070785 3300049573 Bacteria 2537
610 Ga0501037_0361101 3300049573 Bacteria 1001
611 Ga0501038_0000017 3300049574 Bacteria 156304
612 Ga0501038_0035575 3300049574 Bacteria 4371
613 Ga0501039_0000024 3300049575 Bacteria 156304
614 Ga0501039_0085075 3300049575 Bacteria 2463
615 Ga0501039_0095117 3300049575 Bacteria 2322
616 Ga0501040_0040528 3300049576 Bacteria 3169
617 Ga0501043_0004332 3300049579 Bacteria 11551
618 Ga0501043_0035219 3300049579 Bacteria 3938
619 Ga0501043_0040158 3300049579 Bacteria 3678
620 Ga0501043_0047170 3300049579 Bacteria 3387
621 Ga0501043_0126877 3300049579 Bacteria 2001
622 Ga0501043_0210059 3300049579 Bacteria 1509
623 Ga0501046_0020293 3300049580 Bacteria 5498
624 Ga0501047_0004558 3300049581 Bacteria 13028
625 Ga0501047_0008752 3300049581 Bacteria 9553
626 Ga0501047_0075346 3300049581 Bacteria 3247
627 Ga0501047_0084654 3300049581 Bacteria 3047
628 Ga0501047_0086899 3300049581 Bacteria 3004
629 Ga0501047_0134003 3300049581 Bacteria 2357
630 Ga0501047_0242319 3300049581 Bacteria 1653
631 Ga0501047_0289007 3300049581 Bacteria 1483
632 Ga0501067_0017674 3300049583 Bacteria 3948
633 Ga0501068_0000614 3300049584 Bacteria 18139
634 Ga0501068_0026011 3300049584 Bacteria 3445
635 Ga0501069_0010352 3300049585 Bacteria 4935
636 Ga0501069_0013466 3300049585 Bacteria 4361
637 Ga0501069_0043505 3300049585 Bacteria 2486
638 Ga0501070_0007753 3300049586 Bacteria 9100
639 Ga0501070_0026001 3300049586 Bacteria 4911
640 Ga0501070_0093477 3300049586 Bacteria 2488
641 Ga0501070_0145407 3300049586 Bacteria 1957
642 Ga0501070_0364503 3300049586 Bacteria 1172
643 Ga0501071_0014047 3300049587 Bacteria 5472
644 Ga0501072_0274843 3300049588 Bacteria 1340
645 Ga0501073_0000143 3300049589 Bacteria 47217
646 Ga0501073_0016948 3300049589 Bacteria 5276
647 Ga0501073_0025527 3300049589 Bacteria 4236
648 Ga0501073_0031477 3300049589 Bacteria 3785
649 Ga0501073_0087298 3300049589 Bacteria 2169
650 Ga0501073_0090803 3300049589 Bacteria 2123
651 Ga0501073_0099760 3300049589 Bacteria 2016
652 Ga0501073_0144825 3300049589 Bacteria 1646
653 Ga0501073_0248679 3300049589 Bacteria 1227
654 Ga0501074_0031683 3300049590 Bacteria 3830
655 Ga0501074_0043632 3300049590 Bacteria 3246
656 Ga0501074_0185745 3300049590 Bacteria 1482
657 Ga0501076_0069235 3300049592 Bacteria 2820
658 Ga0501077_0004814 3300049593 Bacteria 8204
659 Ga0501079_0172456 3300049741 Bacteria 1687
660 Ga0501080_0000955 3300049742 Bacteria 23659
661 Ga0501080_0016628 3300049742 Bacteria 6796
662 Ga0501080_0035296 3300049742 Bacteria 4667
663 Ga0501080_0290864 3300049742 Bacteria 1483
664 Ga0501080_0311304 3300049742 Bacteria 1427
665 Ga0501080_0408157 3300049742 Bacteria 1221
666 Ga0501080_0691419 3300049742 Bacteria 900
667 Ga0501083_0008455 3300049744 Bacteria 7274
668 Ga0501083_0044759 3300049744 Bacteria 2996
669 Ga0501083_0064134 3300049744 Bacteria 2448
670 Ga0501083_0080260 3300049744 Bacteria 2163
671 Ga0501035_0000040 3300049822 Bacteria 156262
672 Ga0501035_0005942 3300049822 Bacteria 11492
673 Ga0501035_0010917 3300049822 Bacteria 8410
674 Ga0501035_0013756 3300049822 Bacteria 7469
675 Ga0501035_0031169 3300049822 Bacteria 4856
676 Ga0501035_0047332 3300049822 Bacteria 3861
677 Ga0501035_0108123 3300049822 Bacteria 2438
678 Ga0501035_0155127 3300049822 Bacteria 1985
679 Ga0501044_0000040 3300049823 Bacteria 156304
680 Ga0501044_0007916 3300049823 Bacteria 11685
681 Ga0501044_0013108 3300049823 Bacteria 8975
682 Ga0501044_0059837 3300049823 Bacteria 3902
683 Ga0501044_0061348 3300049823 Bacteria 3846
684 Ga0501044_0064588 3300049823 Bacteria 3736
685 Ga0501044_0395455 3300049823 Bacteria 1295
686 nmdc:mga03683_114917_c1 3300050489 Bacteria 1193
687 nmdc:mga03683_57021_c1 3300050489 Bacteria 1643
688 nmdc:mga0yw44_177287_c1 3300050492 Bacteria 1401
689 nmdc:mga0yw44_315155_c1 3300050492 Bacteria 1050
690 nmdc:mga0yw44_82007_c1 3300050492 Bacteria 2023
691 nmdc:mga0k408_45484_c1 3300050493 Bacteria 2533
692 nmdc:mga0k408_68018_c1 3300050493 Bacteria 2077
693 nmdc:mga06z11_257117_c1 3300050494 Bacteria 1030
694 nmdc:mga06z11_308338_c1 3300050494 Bacteria 942
695 nmdc:mga04h51_79090_c1 3300050495 Bacteria 1163
696 nmdc:mga07m45_17151_c1 3300050496 Bacteria 3884
697 nmdc:mga07m45_378_c1 3300050496 Bacteria 18230
698 nmdc:mga05p37_346908_c1 3300050507 Bacteria 1749
699 nmdc:mga06r32_15012_c1 3300050510 Bacteria 7030
700 nmdc:mga06r32_212448_c1 3300050510 Bacteria 1922
701 nmdc:mga08y16_430057_c1 3300050511 Bacteria 1348
702 nmdc:mga0sz30_116209_c1 3300050516 Bacteria 1174
703 nmdc:mga0sz30_41876_c1 3300050516 Bacteria 1926
704 Ga0495619_0314681 3300053085 Bacteria 1084
705 Ga0500643_022254 3300053087 Bacteria 2043
706 Ga0500555_021183 3300053103 Bacteria 1871
707 Ga0500562_055410 3300053108 Bacteria 1063
708 Ga0500621_000004 3300053126 Bacteria 485792
709 Ga0500568_0000010 3300053139 Bacteria 249043
710 Ga0500568_0017450 3300053139 Bacteria 3169
711 Ga0500616_0055079 3300053153 Bacteria 2081
712 Ga0500616_0145217 3300053153 Bacteria 1104
713 Ga0500620_000598 3300053155 Bacteria 6198
714 Ga0500622_0000734 3300053156 Bacteria 28647
715 Ga0500622_0045878 3300053156 Bacteria 2261
716 Ga0500627_0161288 3300053158 Bacteria 1011
717 Ga0500645_002075 3300053730 Bacteria 9285
718 Ga0501084_0086241 3300054114 Bacteria 2636
719 Ga0501082_0017173 3300060353 Bacteria 6234
720 Ga0501082_0442417 3300060353 Bacteria 1135

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045836 Ga0466958_0157855 Ga0466958_0157855_243_1007 219
2 3300026041 Ga0207639_10694793 Ga0207639_106947931 230
3 iso_pu_bacteria 3003930520 3003931263 242
4 3300053085 Ga0495619_0314681 Ga0495619_0314681_202_939 243
5 iso_pu_bacteria 2938014810 2938016112 243
6 3300005344 Ga0070661_100001089 Ga0070661_1000010896 251
7 3300005539 Ga0068853_100006106 Ga0068853_1000061068 251
8 3300005614 Ga0068856_100034379 Ga0068856_1000343793 251
9 3300005616 Ga0068852_100007354 Ga0068852_1000073546 251
10 3300005834 Ga0068851_10000365 Ga0068851_100003658 251
11 3300009093 Ga0105240_10066593 Ga0105240_100665934 251
12 3300009174 Ga0105241_10036083 Ga0105241_100360834 251
13 3300009545 Ga0105237_10019781 Ga0105237_100197818 251
14 3300009551 Ga0105238_10038235 Ga0105238_100382354 251
15 3300025913 Ga0207695_10096031 Ga0207695_100960314 251
16 3300025914 Ga0207671_10011147 Ga0207671_100111478 251
17 3300025920 Ga0207649_10016189 Ga0207649_100161895 251
18 3300025949 Ga0207667_10168889 Ga0207667_101688892 251
19 3300026041 Ga0207639_10024149 Ga0207639_100241492 251
20 3300026116 Ga0207674_10043491 Ga0207674_100434916 251
21 3300049579 Ga0501043_0047170 Ga0501043_0047170_2246_3076 256
22 3300049581 Ga0501047_0075346 Ga0501047_0075346_2111_2941 256
23 3300049575 Ga0501039_0095117 Ga0501039_0095117_852_1637 258
24 iso_pu_bacteria 2513237351 2514585981 258
25 3300005364 Ga0070673_100164516 Ga0070673_1001645162 259
26 3300006042 Ga0075368_10062340 Ga0075368_100623402 259
27 3300006881 Ga0068865_100687602 Ga0068865_1006876021 259
28 3300013296 Ga0157374_10033943 Ga0157374_100339433 259
29 3300013297 Ga0157378_10045061 Ga0157378_100450612 259
30 3300013306 Ga0163162_10423131 Ga0163162_104231311 259
31 3300014969 Ga0157376_10017989 Ga0157376_100179895 259
32 3300021384 Ga0213876_10007178 Ga0213876_100071782 259
33 3300049569 Ga0501032_0145442 Ga0501032_0145442_735_1526 259
34 3300049579 Ga0501043_0126877 Ga0501043_0126877_12_797 259
35 3300050495 nmdc:mga04h51_79090_c1 nmdc:mga04h51_79090_c1_276_1061 259
36 3300005578 Ga0068854_100193943 Ga0068854_1001939432 260
37 3300009098 Ga0105245_10319392 Ga0105245_103193921 260
38 3300041511 Ga0451855_1135979 Ga0451855_1135979_19_816 260
39 3300046516 Ga0495628_0532409 Ga0495628_0532409_18_821 260
40 3300047321 Ga0495676_0041260 Ga0495676_0041260_2985_3788 260
41 3300050510 nmdc:mga06r32_15012_c1 nmdc:mga06r32_15012_c1_3034_3831 260
42 iso_pu_bacteria 2871466892 2871473272 260
43 iso_pu_bacteria 2906378014 2906384876 260
44 3300025909 Ga0207705_10193299 Ga0207705_101932992 262
45 3300049573 Ga0501037_0361101 Ga0501037_0361101_172_966 262
46 3300049586 Ga0501070_0364503 Ga0501070_0364503_36_824 262
47 3300005985 Ga0081539_10002732 Ga0081539_1000273219 263
48 3300044658 Ga0466972_0029385 Ga0466972_0029385_11_814 263
49 3300013104 Ga0157370_10075580 Ga0157370_100755802 264
50 3300048927 Ga0496124_0392689 Ga0496124_0392689_128_937 264
51 3300013306 Ga0163162_10045548 Ga0163162_100455482 265
52 3300048912 Ga0496109_0275367 Ga0496109_0275367_704_1507 265
53 iso_pu_bacteria 2977957713 2977964757 265
54 3300047472 Ga0495686_0024783 Ga0495686_0024783_845_1654 266
55 iso_pu_bacteria 8054563764 8054568395 267
56 3300025933 Ga0207706_10117616 Ga0207706_101176162 268
57 3300048088 Ga0495602_0349358 Ga0495602_0349358_99_932 268
58 3300048929 Ga0496126_0046351 Ga0496126_0046351_2862_3695 268
59 3300049583 Ga0501067_0017674 Ga0501067_0017674_1230_2054 269
60 3300049593 Ga0501077_0004814 Ga0501077_0004814_3613_4437 269
61 3300060353 Ga0501082_0017173 Ga0501082_0017173_4852_5676 269
62 iso_pu_bacteria 2513237084 2513571888 269
63 iso_pu_bacteria 2791355260 2793322548 269
64 iso_pu_bacteria 2791355265 2793356265 269
65 iso_pu_bacteria 2838022645 2838024757 269
66 iso_pu_bacteria 2838042994 2838046870 269
67 iso_pu_bacteria 2838668709 2838668896 269
68 iso_pu_bacteria 2838701080 2838701444 269
69 iso_pu_bacteria 2842146304 2842146491 269
70 iso_pu_bacteria 2842192696 2842194118 269
71 iso_pu_bacteria 2842198810 2842200138 269
72 iso_pu_bacteria 2842250916 2842251279 269
73 iso_pu_bacteria 2842285085 2842288119 269
74 iso_pu_bacteria 2842402390 2842405385 269
75 iso_pu_bacteria 2842409023 2842411858 269
76 iso_pu_bacteria 2842415677 2842418615 269
77 iso_pu_bacteria 2851182111 2851186195 269
78 iso_pu_bacteria 2894023352 2894026861 269
79 iso_pu_bacteria 2904541872 2904542417 269
80 iso_pu_bacteria 2919171160 2919173906 269
81 iso_pu_bacteria 2929160207 2929167669 269
82 iso_pu_bacteria 2936367885 2936373589 269
83 iso_pu_bacteria 2958092219 2958093536 269
84 iso_pu_bacteria 2996893221 2996895732 269
85 iso_pu_bacteria 8005382845 8005384501 269
86 iso_pu_bacteria 8005395548 8005397813 269
87 iso_pu_bacteria 8024501048 8024501837 269
88 3300032126 Ga0307415_100112335 Ga0307415_1001123353 270
89 3300037466 Ga0395898_0250599 Ga0395898_0250599_25_852 270
90 iso_pu_bacteria 2506520007 2506580941 270
91 iso_pu_bacteria 2506520008 2506586080 270
92 iso_pu_bacteria 2515154155 2515853372 270
93 iso_pu_bacteria 2643221629 2644169376 270
94 iso_pu_bacteria 2643221662 2644350773 270
95 iso_pu_bacteria 2654587920 2656276776 270
96 iso_pu_bacteria 2687453601 2689447492 270
97 iso_pu_bacteria 2739367655 2739612373 270
98 iso_pu_bacteria 2854916844 2854917309 270
99 iso_pu_bacteria 2871282230 2871284461 270
100 iso_pu_bacteria 2900051742 2900053985 270
101 iso_pu_bacteria 2900051742 2900054458 270
102 iso_pu_bacteria 2937843397 2937847024 270
103 iso_pu_bacteria 2996310559 2996316552 270
104 iso_pu_bacteria 2996336353 2996341633 270
105 3300005548 Ga0070665_100197127 Ga0070665_1001971272 271
106 3300028379 Ga0268266_10181019 Ga0268266_101810193 271
107 3300041512 Ga0451853_1535672 Ga0451853_1535672_272_1102 271
108 3300042184 Ga0450908_012082 Ga0450908_012082_194_1069 271
109 3300046459 Ga0495629_0199720 Ga0495629_0199720_124_954 271
110 3300048908 Ga0496105_0431673 Ga0496105_0431673_171_1001 271
111 iso_pu_bacteria 2510065019 2510136115 271
112 iso_pu_bacteria 2510461076 2510892882 271
113 iso_pu_bacteria 2513237084 2513568416 271
114 iso_pu_bacteria 2513237093 2513630727 271
115 iso_pu_bacteria 2513237103 2513711921 271
116 iso_pu_bacteria 2513237162 2514018250 271
117 iso_pu_bacteria 2515075009 2515108958 271
118 iso_pu_bacteria 2515154113 2515633037 271
119 iso_pu_bacteria 2515154114 2515640242 271
120 iso_pu_bacteria 2515154116 2515656323 271
121 iso_pu_bacteria 2516653077 2517040899 271
122 iso_pu_bacteria 2517093000 2517098499 271
123 iso_pu_bacteria 2615840624 2616297886 271
124 iso_pu_bacteria 2643221629 2644169825 271
125 iso_pu_bacteria 2643221634 2644195208 271
126 iso_pu_bacteria 2643221643 2644241132 271
127 iso_pu_bacteria 2643221662 2644350461 271
128 iso_pu_bacteria 2724679232 2725949384 271
129 iso_pu_bacteria 2765235802 2765464463 271
130 iso_pu_bacteria 2765235942 2766064607 271
131 iso_pu_bacteria 2775506902 2776267091 271
132 iso_pu_bacteria 2775506904 2776283434 271
133 iso_pu_bacteria 2791355259 2793315014 271
134 iso_pu_bacteria 2839993093 2839997337 271
135 iso_pu_bacteria 2840764183 2840765801 271
136 iso_pu_bacteria 2842110456 2842113798 271
137 iso_pu_bacteria 2842205361 2842209930 271
138 iso_pu_bacteria 2842217011 2842219644 271
139 iso_pu_bacteria 2842278818 2842283384 271
140 iso_pu_bacteria 2842489311 2842494805 271
141 iso_pu_bacteria 2842495871 2842500841 271
142 iso_pu_bacteria 2855195626 2855196576 271
143 iso_pu_bacteria 2857516855 2857523132 271
144 iso_pu_bacteria 2885305155 2885307950 271
145 iso_pu_bacteria 2885326080 2885326734 271
146 iso_pu_bacteria 2885334103 2885340995 271
147 iso_pu_bacteria 2913295892 2913301660 271
148 iso_pu_bacteria 2933586486 2933589566 271
149 iso_pu_bacteria 2936367885 2936374699 271
150 iso_pu_bacteria 2936375103 2936375866 271
151 iso_pu_bacteria 639633055 639645356 271
152 iso_pu_bacteria 8005289223 8005290826 271
153 iso_pu_bacteria 8005301065 8005301296 271
154 iso_pu_bacteria 8005376324 8005380540 271
155 iso_pu_bacteria 8005460587 8005467551 271
156 iso_pu_bacteria 8005556819 8005559466 271
157 iso_pu_bacteria 8005563573 8005566487 271
158 iso_pu_bacteria 8005688590 8005688889 271
159 iso_pu_bacteria 8018127388 8018132315 271
160 iso_pu_bacteria 8018163183 8018163761 271
161 iso_pu_bacteria 8024479707 8024481423 271
162 iso_pu_bacteria 8054558443 8054560632 271
163 iso_pu_bacteria 8057874678 8057881284 271
164 3300009176 Ga0105242_10208879 Ga0105242_102088792 272
165 3300009551 Ga0105238_10001007 Ga0105238_1000100721 272
166 3300025924 Ga0207694_10000939 Ga0207694_1000093923 272
167 3300049571 Ga0501034_0053228 Ga0501034_0053228_2970_3794 272
168 3300049581 Ga0501047_0084654 Ga0501047_0084654_788_1612 272
169 3300049585 Ga0501069_0010352 Ga0501069_0010352_3864_4688 272
170 3300049589 Ga0501073_0016948 Ga0501073_0016948_3677_4501 272
171 3300049592 Ga0501076_0069235 Ga0501076_0069235_745_1569 272
172 3300049742 Ga0501080_0290864 Ga0501080_0290864_38_862 272
173 3300049742 Ga0501080_0408157 Ga0501080_0408157_258_1082 272
174 3300049744 Ga0501083_0064134 Ga0501083_0064134_1572_2396 272
175 3300049822 Ga0501035_0155127 Ga0501035_0155127_985_1809 272
176 3300049823 Ga0501044_0059837 Ga0501044_0059837_613_1437 272
177 3300060353 Ga0501082_0442417 Ga0501082_0442417_234_1058 272
178 iso_pu_bacteria 2876392853 2876397708 272
179 iso_pu_bacteria 2904659560 2904664359 272
180 iso_pu_bacteria 2961114664 2961119358 272
181 iso_pu_bacteria 2968110612 2968115613 272
182 3300003320 rootH2_10130272 rootH2_101302722 273
183 3300003354 JGI25160J50197_1002309 JGI25160J50197_10023097 273
184 3300003775 Ga0055524_1000850 Ga0055524_100085011 273
185 3300003790 Ga0055528_1001807 Ga0055528_10018072 273
186 3300005456 Ga0070678_100108089 Ga0070678_1001080892 273
187 3300005548 Ga0070665_100063348 Ga0070665_1000633482 273
188 3300005577 Ga0068857_100032013 Ga0068857_1000320132 273
189 3300005616 Ga0068852_100505746 Ga0068852_1005057462 273
190 3300005617 Ga0068859_100204119 Ga0068859_1002041192 273
191 3300005618 Ga0068864_100036087 Ga0068864_1000360872 273
192 3300005844 Ga0068862_100043996 Ga0068862_1000439962 273
193 3300005937 Ga0081455_10080898 Ga0081455_100808982 273
194 3300005985 Ga0081539_10005538 Ga0081539_1000553811 273
195 3300006178 Ga0075367_10111633 Ga0075367_101116332 273
196 3300006178 Ga0075367_10125863 Ga0075367_101258632 273
197 3300006353 Ga0075370_10002495 Ga0075370_100024956 273
198 3300006353 Ga0075370_10181913 Ga0075370_101819132 273
199 3300006931 Ga0097620_100204114 Ga0097620_1002041142 273
200 3300009093 Ga0105240_10033261 Ga0105240_100332614 273
201 3300009093 Ga0105240_10679558 Ga0105240_106795581 273
202 3300009148 Ga0105243_10361206 Ga0105243_103612062 273
203 3300009174 Ga0105241_10157185 Ga0105241_101571852 273
204 3300009545 Ga0105237_10009247 Ga0105237_100092475 273
205 3300009553 Ga0105249_10161350 Ga0105249_101613502 273
206 3300014326 Ga0157380_10240615 Ga0157380_102406152 273
207 3300014968 Ga0157379_10188227 Ga0157379_101882272 273
208 3300017792 Ga0163161_10473372 Ga0163161_104733721 273
209 3300021327 Ga0214543_1000132 Ga0214543_100013284 273
210 3300025907 Ga0207645_10080212 Ga0207645_100802122 273
211 3300025913 Ga0207695_10038212 Ga0207695_100382123 273
212 3300025914 Ga0207671_10107859 Ga0207671_101078591 273
213 3300025961 Ga0207712_10149895 Ga0207712_101498952 273
214 3300026023 Ga0207677_10050917 Ga0207677_100509172 273
215 3300026067 Ga0207678_10043551 Ga0207678_100435513 273
216 3300026089 Ga0207648_10115887 Ga0207648_101158872 273
217 3300026116 Ga0207674_10028028 Ga0207674_100280282 273
218 3300027907 Ga0207428_10088859 Ga0207428_100888592 273
219 3300028380 Ga0268265_10241758 Ga0268265_102417582 273
220 3300031903 Ga0307407_10135268 Ga0307407_101352682 273
221 3300031995 Ga0307409_100435895 Ga0307409_1004358952 273
222 3300046458 Ga0495591_002496 Ga0495591_002496_3023_3850 273
223 3300046471 Ga0495650_0000008 Ga0495650_0000008_436873_437700 273
224 3300046471 Ga0495650_0062159 Ga0495650_0062159_249_1079 273
225 3300046474 Ga0495605_0031401 Ga0495605_0031401_556_1383 273
226 3300046491 Ga0495584_0022473 Ga0495584_0022473_470_1297 273
227 3300046501 Ga0495607_0009540 Ga0495607_0009540_5207_6034 273
228 3300046507 Ga0495606_0001619 Ga0495606_0001619_15276_16103 273
229 3300046513 Ga0495616_0013102 Ga0495616_0013102_461_1288 273
230 3300046520 Ga0495637_0078976 Ga0495637_0078976_468_1295 273
231 3300046523 Ga0495644_0025575 Ga0495644_0025575_1333_2160 273
232 3300046524 Ga0495648_0014184 Ga0495648_0014184_2394_3221 273
233 3300046524 Ga0495648_0031408 Ga0495648_0031408_1779_2612 273
234 3300046539 Ga0495621_0047296 Ga0495621_0047296_601_1431 273
235 3300046542 Ga0495597_0013170 Ga0495597_0013170_1696_2526 273
236 3300046615 Ga0495656_0000137 Ga0495656_0000137_21478_22308 273
237 3300046692 Ga0495671_0009568 Ga0495671_0009568_4053_4880 273
238 3300046694 Ga0495649_0003827 Ga0495649_0003827_5990_6820 273
239 3300046694 Ga0495649_0051331 Ga0495649_0051331_175_1002 273
240 3300046794 Ga0495589_0016275 Ga0495589_0016275_2729_3556 273
241 3300046810 Ga0495660_0000019 Ga0495660_0000019_60549_61376 273
242 3300047320 Ga0495672_0000003 Ga0495672_0000003_282480_283307 273
243 3300047323 Ga0495683_0060105 Ga0495683_0060105_104_931 273
244 3300047443 Ga0495687_000315 Ga0495687_000315_35876_36706 273
245 3300047443 Ga0495687_004781 Ga0495687_004781_3438_4268 273
246 3300047469 Ga0495673_0000011 Ga0495673_0000011_422910_423737 273
247 3300048090 Ga0495615_0031301 Ga0495615_0031301_434_1264 273
248 3300048917 Ga0496114_0280180 Ga0496114_0280180_507_1337 273
249 3300049459 Ga0495678_000479 Ga0495678_000479_23448_24275 273
250 3300049460 Ga0495682_0000006 Ga0495682_0000006_17252_18079 273
251 3300050489 nmdc:mga03683_57021_c1 nmdc:mga03683_57021_c1_578_1408 273
252 3300050492 nmdc:mga0yw44_82007_c1 nmdc:mga0yw44_82007_c1_751_1581 273
253 3300050493 nmdc:mga0k408_45484_c1 nmdc:mga0k408_45484_c1_1648_2478 273
254 3300050493 nmdc:mga0k408_68018_c1 nmdc:mga0k408_68018_c1_960_1790 273
255 3300050494 nmdc:mga06z11_308338_c1 nmdc:mga06z11_308338_c1_33_875 273
256 3300050496 nmdc:mga07m45_17151_c1 nmdc:mga07m45_17151_c1_2452_3282 273
257 3300050496 nmdc:mga07m45_378_c1 nmdc:mga07m45_378_c1_1417_2247 273
258 3300053126 Ga0500621_000004 Ga0500621_000004_237606_238433 273
259 3300053139 Ga0500568_0017450 Ga0500568_0017450_1017_1847 273
260 3300053156 Ga0500622_0045878 Ga0500622_0045878_179_1009 273
261 3300053730 Ga0500645_002075 Ga0500645_002075_8317_9165 273
262 iso_pu_bacteria 2508501127 2509142467 273
263 iso_pu_bacteria 2509276022 2509394643 273
264 iso_pu_bacteria 2597489875 2597811080 273
265 iso_pu_bacteria 2841734538 2841737462 273
266 iso_pu_bacteria 2847670302 2847674706 273
267 iso_pu_bacteria 2856314179 2856317408 273
268 iso_pu_bacteria 2856342000 2856349200 273
269 iso_pu_bacteria 2869162929 2869168561 273
270 iso_pu_bacteria 2871435913 2871441915 273
271 iso_pu_bacteria 2871474448 2871480887 273
272 iso_pu_bacteria 2878035449 2878038446 273
273 iso_pu_bacteria 2878788777 2878794336 273
274 iso_pu_bacteria 2885312484 2885313128 273
275 iso_pu_bacteria 2889790730 2889794442 273
276 iso_pu_bacteria 2889914905 2889914953 273
277 iso_pu_bacteria 2906414383 2906417473 273
278 iso_pu_bacteria 2937836603 2937840302 273
279 iso_pu_bacteria 2958071322 2958071511 273
280 iso_pu_bacteria 2970524798 2970527094 273
281 iso_pu_bacteria 2970540015 2970544535 273
282 iso_pu_bacteria 2977864932 2977871925 273
283 iso_pu_bacteria 8004395343 8004402195 273
284 iso_pu_bacteria 8004633249 8004637406 273
285 iso_pu_bacteria 8055617313 8055619183 273
286 3300005327 Ga0070658_10147445 Ga0070658_101474452 274
287 3300005328 Ga0070676_10068798 Ga0070676_100687982 274
288 3300005329 Ga0070683_100200023 Ga0070683_1002000232 274
289 3300005330 Ga0070690_100001510 Ga0070690_1000015108 274
290 3300005330 Ga0070690_100148394 Ga0070690_1001483942 274
291 3300005334 Ga0068869_100001072 Ga0068869_1000010727 274
292 3300005334 Ga0068869_100091578 Ga0068869_1000915782 274
293 3300005334 Ga0068869_100173041 Ga0068869_1001730412 274
294 3300005334 Ga0068869_100287153 Ga0068869_1002871531 274
295 3300005335 Ga0070666_10007488 Ga0070666_100074882 274
296 3300005338 Ga0068868_100058831 Ga0068868_1000588314 274
297 3300005338 Ga0068868_100152931 Ga0068868_1001529312 274
298 3300005338 Ga0068868_100211375 Ga0068868_1002113752 274
299 3300005338 Ga0068868_100462246 Ga0068868_1004622461 274
300 3300005339 Ga0070660_100235649 Ga0070660_1002356491 274
301 3300005340 Ga0070689_100011792 Ga0070689_1000117922 274
302 3300005340 Ga0070689_100165543 Ga0070689_1001655432 274
303 3300005344 Ga0070661_100077522 Ga0070661_1000775222 274
304 3300005344 Ga0070661_100093694 Ga0070661_1000936942 274
305 3300005345 Ga0070692_10101388 Ga0070692_101013882 274
306 3300005347 Ga0070668_100105638 Ga0070668_1001056382 274
307 3300005347 Ga0070668_100337545 Ga0070668_1003375451 274
308 3300005353 Ga0070669_100030183 Ga0070669_1000301832 274
309 3300005353 Ga0070669_100077937 Ga0070669_1000779372 274
310 3300005353 Ga0070669_100099619 Ga0070669_1000996192 274
311 3300005354 Ga0070675_100002305 Ga0070675_1000023056 274
312 3300005355 Ga0070671_100086319 Ga0070671_1000863192 274
313 3300005355 Ga0070671_100180420 Ga0070671_1001804202 274
314 3300005356 Ga0070674_100017239 Ga0070674_1000172395 274
315 3300005366 Ga0070659_100069612 Ga0070659_1000696122 274
316 3300005366 Ga0070659_100083833 Ga0070659_1000838332 274
317 3300005367 Ga0070667_100001504 Ga0070667_1000015047 274
318 3300005367 Ga0070667_100047622 Ga0070667_1000476223 274
319 3300005367 Ga0070667_100133328 Ga0070667_1001333282 274
320 3300005367 Ga0070667_100163109 Ga0070667_1001631092 274
321 3300005367 Ga0070667_100342299 Ga0070667_1003422992 274
322 3300005438 Ga0070701_10021078 Ga0070701_100210782 274
323 3300005440 Ga0070705_100054268 Ga0070705_1000542682 274
324 3300005441 Ga0070700_100102045 Ga0070700_1001020452 274
325 3300005444 Ga0070694_100277084 Ga0070694_1002770841 274
326 3300005455 Ga0070663_100120191 Ga0070663_1001201912 274
327 3300005456 Ga0070678_100044742 Ga0070678_1000447422 274
328 3300005456 Ga0070678_100103935 Ga0070678_1001039353 274
329 3300005457 Ga0070662_100007515 Ga0070662_1000075154 274
330 3300005457 Ga0070662_100023880 Ga0070662_1000238803 274
331 3300005458 Ga0070681_10024387 Ga0070681_100243872 274
332 3300005459 Ga0068867_100015891 Ga0068867_1000158914 274
333 3300005459 Ga0068867_100020391 Ga0068867_1000203912 274
334 3300005459 Ga0068867_100165982 Ga0068867_1001659822 274
335 3300005466 Ga0070685_10209442 Ga0070685_102094422 274
336 3300005530 Ga0070679_100225219 Ga0070679_1002252192 274
337 3300005535 Ga0070684_100109601 Ga0070684_1001096012 274
338 3300005539 Ga0068853_100027399 Ga0068853_1000273994 274
339 3300005539 Ga0068853_100074345 Ga0068853_1000743452 274
340 3300005543 Ga0070672_100067901 Ga0070672_1000679012 274
341 3300005543 Ga0070672_100097962 Ga0070672_1000979622 274
342 3300005544 Ga0070686_100012181 Ga0070686_1000121814 274
343 3300005544 Ga0070686_100080814 Ga0070686_1000808142 274
344 3300005545 Ga0070695_100366935 Ga0070695_1003669352 274
345 3300005548 Ga0070665_100031128 Ga0070665_1000311284 274
346 3300005548 Ga0070665_100032562 Ga0070665_1000325622 274
347 3300005548 Ga0070665_100099653 Ga0070665_1000996532 274
348 3300005564 Ga0070664_100065451 Ga0070664_1000654512 274
349 3300005577 Ga0068857_100031257 Ga0068857_1000312573 274
350 3300005578 Ga0068854_100049679 Ga0068854_1000496792 274
351 3300005578 Ga0068854_100152807 Ga0068854_1001528072 274
352 3300005614 Ga0068856_100034534 Ga0068856_1000345342 274
353 3300005614 Ga0068856_100198757 Ga0068856_1001987572 274
354 3300005616 Ga0068852_100205312 Ga0068852_1002053122 274
355 3300005616 Ga0068852_100349477 Ga0068852_1003494772 274
356 3300005617 Ga0068859_100006383 Ga0068859_1000063838 274
357 3300005617 Ga0068859_100028370 Ga0068859_1000283702 274
358 3300005617 Ga0068859_100032249 Ga0068859_1000322492 274
359 3300005617 Ga0068859_100041599 Ga0068859_1000415994 274
360 3300005618 Ga0068864_100028037 Ga0068864_1000280372 274
361 3300005618 Ga0068864_100048815 Ga0068864_1000488152 274
362 3300005618 Ga0068864_100061768 Ga0068864_1000617682 274
363 3300005618 Ga0068864_100125087 Ga0068864_1001250872 274
364 3300005718 Ga0068866_10011237 Ga0068866_100112372 274
365 3300005718 Ga0068866_10075384 Ga0068866_100753843 274
366 3300005719 Ga0068861_100002678 Ga0068861_10000267810 274
367 3300005719 Ga0068861_100018125 Ga0068861_1000181252 274
368 3300005840 Ga0068870_10124723 Ga0068870_101247232 274
369 3300005841 Ga0068863_100006580 Ga0068863_1000065809 274
370 3300005841 Ga0068863_100080476 Ga0068863_1000804762 274
371 3300005841 Ga0068863_100096878 Ga0068863_1000968783 274
372 3300005842 Ga0068858_100004441 Ga0068858_10000444112 274
373 3300005842 Ga0068858_100028194 Ga0068858_1000281945 274
374 3300005842 Ga0068858_100035188 Ga0068858_1000351884 274
375 3300005842 Ga0068858_100231277 Ga0068858_1002312772 274
376 3300005843 Ga0068860_100004331 Ga0068860_1000043319 274
377 3300005843 Ga0068860_100022924 Ga0068860_1000229245 274
378 3300005844 Ga0068862_100033418 Ga0068862_1000334182 274
379 3300005844 Ga0068862_100064488 Ga0068862_1000644882 274
380 3300005844 Ga0068862_100121394 Ga0068862_1001213942 274
381 3300005844 Ga0068862_100375484 Ga0068862_1003754842 274
382 3300005981 Ga0081538_10004363 Ga0081538_100043634 274
383 3300005985 Ga0081539_10006723 Ga0081539_100067232 274
384 3300006038 Ga0075365_10145851 Ga0075365_101458512 274
385 3300006042 Ga0075368_10125673 Ga0075368_101256732 274
386 3300006048 Ga0075363_100163877 Ga0075363_1001638771 274
387 3300006177 Ga0075362_10048050 Ga0075362_100480502 274
388 3300006237 Ga0097621_100028453 Ga0097621_1000284533 274
389 3300006237 Ga0097621_100035235 Ga0097621_1000352352 274
390 3300006237 Ga0097621_100040781 Ga0097621_1000407812 274
391 3300006237 Ga0097621_100048996 Ga0097621_1000489962 274
392 3300006358 Ga0068871_100002664 Ga0068871_1000026647 274
393 3300006358 Ga0068871_100042592 Ga0068871_1000425924 274
394 3300006358 Ga0068871_100114905 Ga0068871_1001149052 274
395 3300006358 Ga0068871_100373297 Ga0068871_1003732972 274
396 3300006931 Ga0097620_100006383 Ga0097620_1000063838 274
397 3300006931 Ga0097620_100028370 Ga0097620_1000283702 274
398 3300006931 Ga0097620_100032249 Ga0097620_1000322494 274
399 3300006931 Ga0097620_100041599 Ga0097620_1000415992 274
400 3300007265 Ga0099794_10058192 Ga0099794_100581921 274
401 3300009011 Ga0105251_10023093 Ga0105251_100230933 274
402 3300009036 Ga0105244_10000008 Ga0105244_10000008158 274
403 3300009036 Ga0105244_10044571 Ga0105244_100445713 274
404 3300009093 Ga0105240_10356120 Ga0105240_103561202 274
405 3300009098 Ga0105245_10036163 Ga0105245_100361633 274
406 3300009098 Ga0105245_10138735 Ga0105245_101387354 274
407 3300009098 Ga0105245_10225969 Ga0105245_102259692 274
408 3300009101 Ga0105247_10008662 Ga0105247_100086623 274
409 3300009147 Ga0114129_10414989 Ga0114129_104149892 274
410 3300009147 Ga0114129_10454489 Ga0114129_104544892 274
411 3300009148 Ga0105243_10091923 Ga0105243_100919232 274
412 3300009177 Ga0105248_10041378 Ga0105248_100413784 274
413 3300009177 Ga0105248_10061180 Ga0105248_100611803 274
414 3300009177 Ga0105248_10088563 Ga0105248_100885632 274
415 3300009177 Ga0105248_10364460 Ga0105248_103644602 274
416 3300009177 Ga0105248_10447472 Ga0105248_104474722 274
417 3300009177 Ga0105248_10689781 Ga0105248_106897812 274
418 3300009551 Ga0105238_10105265 Ga0105238_101052652 274
419 3300009551 Ga0105238_10158573 Ga0105238_101585733 274
420 3300009551 Ga0105238_10405995 Ga0105238_104059952 274
421 3300009553 Ga0105249_10028900 Ga0105249_100289002 274
422 3300009553 Ga0105249_10388482 Ga0105249_103884822 274
423 3300010375 Ga0105239_10161991 Ga0105239_101619912 274
424 3300013100 Ga0157373_10107585 Ga0157373_101075852 274
425 3300013104 Ga0157370_10009932 Ga0157370_100099324 274
426 3300013105 Ga0157369_10082358 Ga0157369_100823582 274
427 3300013296 Ga0157374_10025942 Ga0157374_100259424 274
428 3300013296 Ga0157374_10167215 Ga0157374_101672152 274
429 3300013297 Ga0157378_10136529 Ga0157378_101365292 274
430 3300013306 Ga0163162_10024703 Ga0163162_100247032 274
431 3300013306 Ga0163162_10057983 Ga0163162_100579832 274
432 3300013307 Ga0157372_10011373 Ga0157372_100113732 274
433 3300013308 Ga0157375_10008005 Ga0157375_100080058 274
434 3300013308 Ga0157375_10023236 Ga0157375_100232364 274
435 3300013308 Ga0157375_10356582 Ga0157375_103565822 274
436 3300014325 Ga0163163_10261173 Ga0163163_102611732 274
437 3300014326 Ga0157380_10014846 Ga0157380_100148465 274
438 3300014326 Ga0157380_10069262 Ga0157380_100692622 274
439 3300014326 Ga0157380_10359558 Ga0157380_103595582 274
440 3300014745 Ga0157377_10040065 Ga0157377_100400652 274
441 3300014968 Ga0157379_10032980 Ga0157379_100329802 274
442 3300014968 Ga0157379_10048368 Ga0157379_100483682 274
443 3300014968 Ga0157379_10079481 Ga0157379_100794812 274
444 3300014968 Ga0157379_10110685 Ga0157379_101106851 274
445 3300014968 Ga0157379_10146008 Ga0157379_101460081 274
446 3300014968 Ga0157379_10172661 Ga0157379_101726612 274
447 3300014969 Ga0157376_10300346 Ga0157376_103003462 274
448 3300014969 Ga0157376_10415360 Ga0157376_104153602 274
449 3300017792 Ga0163161_10000375 Ga0163161_100003754 274
450 3300017792 Ga0163161_10015393 Ga0163161_100153934 274
451 3300017792 Ga0163161_10046661 Ga0163161_100466612 274
452 3300021361 Ga0213872_10065659 Ga0213872_100656592 274
453 3300025321 Ga0207656_10033061 Ga0207656_100330612 274
454 3300025321 Ga0207656_10093293 Ga0207656_100932932 274
455 3300025728 Ga0207655_1000083 Ga0207655_1000083130 274
456 3300025899 Ga0207642_10003301 Ga0207642_100033014 274
457 3300025899 Ga0207642_10079957 Ga0207642_100799572 274
458 3300025899 Ga0207642_10306952 Ga0207642_103069521 274
459 3300025900 Ga0207710_10020079 Ga0207710_100200792 274
460 3300025901 Ga0207688_10048621 Ga0207688_100486212 274
461 3300025903 Ga0207680_10008233 Ga0207680_100082334 274
462 3300025903 Ga0207680_10037305 Ga0207680_100373052 274
463 3300025907 Ga0207645_10014615 Ga0207645_100146152 274
464 3300025907 Ga0207645_10063671 Ga0207645_100636712 274
465 3300025908 Ga0207643_10037483 Ga0207643_100374833 274
466 3300025912 Ga0207707_10013657 Ga0207707_100136574 274
467 3300025913 Ga0207695_10076226 Ga0207695_100762262 274
468 3300025913 Ga0207695_10253863 Ga0207695_102538632 274
469 3300025914 Ga0207671_10206365 Ga0207671_102063652 274
470 3300025917 Ga0207660_10152323 Ga0207660_101523231 274
471 3300025918 Ga0207662_10091224 Ga0207662_100912241 274
472 3300025919 Ga0207657_10126788 Ga0207657_101267882 274
473 3300025920 Ga0207649_10046174 Ga0207649_100461742 274
474 3300025921 Ga0207652_10209720 Ga0207652_102097202 274
475 3300025923 Ga0207681_10002332 Ga0207681_100023322 274
476 3300025923 Ga0207681_10153866 Ga0207681_101538662 274
477 3300025924 Ga0207694_10024125 Ga0207694_100241254 274
478 3300025925 Ga0207650_10003921 Ga0207650_100039217 274
479 3300025925 Ga0207650_10329831 Ga0207650_103298312 274
480 3300025926 Ga0207659_10002102 Ga0207659_100021022 274
481 3300025926 Ga0207659_10004947 Ga0207659_100049475 274
482 3300025926 Ga0207659_10112987 Ga0207659_101129872 274
483 3300025931 Ga0207644_10000391 Ga0207644_1000039122 274
484 3300025933 Ga0207706_10012440 Ga0207706_100124407 274
485 3300025934 Ga0207686_10061306 Ga0207686_100613062 274
486 3300025934 Ga0207686_10129417 Ga0207686_101294172 274
487 3300025935 Ga0207709_10040090 Ga0207709_100400902 274
488 3300025935 Ga0207709_10331959 Ga0207709_103319592 274
489 3300025936 Ga0207670_10363940 Ga0207670_103639401 274
490 3300025938 Ga0207704_10002411 Ga0207704_100024119 274
491 3300025938 Ga0207704_10003969 Ga0207704_100039696 274
492 3300025938 Ga0207704_10156931 Ga0207704_101569312 274
493 3300025938 Ga0207704_10253923 Ga0207704_102539234 274
494 3300025940 Ga0207691_10106812 Ga0207691_101068122 274
495 3300025940 Ga0207691_10416751 Ga0207691_104167512 274
496 3300025941 Ga0207711_10075706 Ga0207711_100757062 274
497 3300025941 Ga0207711_10135078 Ga0207711_101350782 274
498 3300025941 Ga0207711_10259726 Ga0207711_102597262 274
499 3300025941 Ga0207711_10293817 Ga0207711_102938172 274
500 3300025942 Ga0207689_10001138 Ga0207689_100011387 274
501 3300025942 Ga0207689_10001210 Ga0207689_1000121023 274
502 3300025942 Ga0207689_10025123 Ga0207689_100251234 274
503 3300025942 Ga0207689_10046936 Ga0207689_100469362 274
504 3300025942 Ga0207689_10068759 Ga0207689_100687592 274
505 3300025945 Ga0207679_10115679 Ga0207679_101156792 274
506 3300025949 Ga0207667_10070326 Ga0207667_100703264 274
507 3300025961 Ga0207712_10014157 Ga0207712_100141572 274
508 3300025972 Ga0207668_10081767 Ga0207668_100817672 274
509 3300025986 Ga0207658_10014043 Ga0207658_100140435 274
510 3300025986 Ga0207658_10041836 Ga0207658_100418361 274
511 3300025986 Ga0207658_10060711 Ga0207658_100607113 274
512 3300026023 Ga0207677_10002667 Ga0207677_100026678 274
513 3300026023 Ga0207677_10057425 Ga0207677_100574252 274
514 3300026035 Ga0207703_10009260 Ga0207703_100092603 274
515 3300026035 Ga0207703_10021839 Ga0207703_100218395 274
516 3300026035 Ga0207703_10184954 Ga0207703_101849542 274
517 3300026035 Ga0207703_10186380 Ga0207703_101863802 274
518 3300026041 Ga0207639_10007355 Ga0207639_100073558 274
519 3300026041 Ga0207639_10043661 Ga0207639_100436614 274
520 3300026041 Ga0207639_10083123 Ga0207639_100831233 274
521 3300026041 Ga0207639_10188821 Ga0207639_101888212 274
522 3300026067 Ga0207678_10028557 Ga0207678_100285572 274
523 3300026075 Ga0207708_10007488 Ga0207708_100074882 274
524 3300026075 Ga0207708_10077668 Ga0207708_100776683 274
525 3300026075 Ga0207708_10101084 Ga0207708_101010842 274
526 3300026075 Ga0207708_10551199 Ga0207708_105511991 274
527 3300026088 Ga0207641_10003042 Ga0207641_100030425 274
528 3300026088 Ga0207641_10064788 Ga0207641_100647882 274
529 3300026088 Ga0207641_10106666 Ga0207641_101066662 274
530 3300026088 Ga0207641_10171221 Ga0207641_101712213 274
531 3300026089 Ga0207648_10002672 Ga0207648_100026727 274
532 3300026089 Ga0207648_10020858 Ga0207648_100208584 274
533 3300026089 Ga0207648_10023482 Ga0207648_100234822 274
534 3300026089 Ga0207648_10082941 Ga0207648_100829412 274
535 3300026095 Ga0207676_10020763 Ga0207676_100207632 274
536 3300026095 Ga0207676_10103059 Ga0207676_101030592 274
537 3300026095 Ga0207676_10214101 Ga0207676_102141012 274
538 3300026116 Ga0207674_10021614 Ga0207674_100216145 274
539 3300026116 Ga0207674_10041929 Ga0207674_100419292 274
540 3300026118 Ga0207675_100006819 Ga0207675_1000068199 274
541 3300026118 Ga0207675_100013077 Ga0207675_1000130777 274
542 3300026118 Ga0207675_100013316 Ga0207675_1000133166 274
543 3300026118 Ga0207675_100027523 Ga0207675_1000275232 274
544 3300026121 Ga0207683_10066240 Ga0207683_100662404 274
545 3300026121 Ga0207683_10087595 Ga0207683_100875952 274
546 3300026142 Ga0207698_10012540 Ga0207698_100125404 274
547 3300026142 Ga0207698_10110387 Ga0207698_101103872 274
548 3300028379 Ga0268266_10033856 Ga0268266_100338565 274
549 3300028379 Ga0268266_10067552 Ga0268266_100675524 274
550 3300028379 Ga0268266_10099515 Ga0268266_100995152 274
551 3300028380 Ga0268265_10101967 Ga0268265_101019672 274
552 3300028380 Ga0268265_10119785 Ga0268265_101197852 274
553 3300028380 Ga0268265_10136798 Ga0268265_101367981 274
554 3300028380 Ga0268265_10165509 Ga0268265_101655092 274
555 3300028381 Ga0268264_10001001 Ga0268264_100010014 274
556 3300028381 Ga0268264_10003066 Ga0268264_100030669 274
557 3300028381 Ga0268264_10023023 Ga0268264_100230235 274
558 3300028381 Ga0268264_10081093 Ga0268264_100810932 274
559 3300028381 Ga0268264_10198848 Ga0268264_101988482 274
560 3300031241 Ga0265325_10012043 Ga0265325_100120436 274
561 3300031249 Ga0265339_10215540 Ga0265339_102155401 274
562 3300031250 Ga0265331_10021115 Ga0265331_100211152 274
563 3300031344 Ga0265316_10448039 Ga0265316_104480391 274
564 3300031548 Ga0307408_100184963 Ga0307408_1001849632 274
565 3300031595 Ga0265313_10066804 Ga0265313_100668043 274
566 3300031711 Ga0265314_10036505 Ga0265314_100365052 274
567 3300031731 Ga0307405_10055754 Ga0307405_100557542 274
568 3300031824 Ga0307413_10154821 Ga0307413_101548212 274
569 3300031824 Ga0307413_10391905 Ga0307413_103919052 274
570 3300031901 Ga0307406_10165481 Ga0307406_101654812 274
571 3300031901 Ga0307406_10182726 Ga0307406_101827262 274
572 3300031911 Ga0307412_10364108 Ga0307412_103641082 274
573 3300031995 Ga0307409_100071106 Ga0307409_1000711063 274
574 3300032002 Ga0307416_100011529 Ga0307416_1000115292 274
575 3300032002 Ga0307416_100025422 Ga0307416_1000254222 274
576 3300032005 Ga0307411_10175938 Ga0307411_101759381 274
577 3300032126 Ga0307415_100271516 Ga0307415_1002715162 274
578 3300035242 Ga0373962_0019366 Ga0373962_0019366_386_1225 274
579 3300035691 Ga0373931_0030437 Ga0373931_0030437_542_1381 274
580 3300037471 Ga0395905_0015692 Ga0395905_0015692_1028_1867 274
581 3300039437 Ga0436365_0551841 Ga0436365_0551841_230_1078 274
582 3300039437 Ga0436365_1295259 Ga0436365_1295259_65_937 274
583 3300039447 Ga0436361_0060394 Ga0436361_0060394_2471_3313 274
584 3300041405 Ga0439438_000021 Ga0439438_000021_41080_41910 274
585 3300041407 Ga0439447_002674 Ga0439447_002674_430_1260 274
586 3300041413 Ga0439465_0035766 Ga0439465_0035766_419_1267 274
587 3300042006 Ga0439432_020645 Ga0439432_020645_1263_2093 274
588 3300042008 Ga0439450_033059 Ga0439450_033059_98_937 274
589 3300042439 Ga0439464_0006733 Ga0439464_0006733_1294_2133 274
590 3300045051 Ga0451576_0064685 Ga0451576_0064685_1301_2140 274
591 3300046453 Ga0495627_001317 Ga0495627_001317_818_1651 274
592 3300046471 Ga0495650_0013567 Ga0495650_0013567_87_965 274
593 3300046472 Ga0495580_0016298 Ga0495580_0016298_2502_3332 274
594 3300046500 Ga0495596_0112964 Ga0495596_0112964_104_952 274
595 3300047322 Ga0495680_0199987 Ga0495680_0199987_424_1254 274
596 3300047472 Ga0495686_0025877 Ga0495686_0025877_2027_2857 274
597 3300047472 Ga0495686_0058797 Ga0495686_0058797_1217_2083 274
598 3300048905 Ga0496102_0031944 Ga0496102_0031944_2214_3053 274
599 3300048909 Ga0496106_0015363 Ga0496106_0015363_1378_2217 274
600 3300048910 Ga0496107_0057456 Ga0496107_0057456_447_1286 274
601 3300048911 Ga0496108_0083530 Ga0496108_0083530_1483_2322 274
602 3300048911 Ga0496108_0137129 Ga0496108_0137129_440_1279 274
603 3300048911 Ga0496108_0559098 Ga0496108_0559098_92_922 274
604 3300048913 Ga0496110_0008710 Ga0496110_0008710_4072_4911 274
605 3300048914 Ga0496111_0082657 Ga0496111_0082657_1376_2215 274
606 3300048915 Ga0496112_0690544 Ga0496112_0690544_74_913 274
607 3300048916 Ga0496113_0165586 Ga0496113_0165586_687_1526 274
608 3300048919 Ga0496116_0000076 Ga0496116_0000076_127854_128684 274
609 3300048922 Ga0496119_0000044 Ga0496119_0000044_173888_174718 274
610 3300048922 Ga0496119_0001021 Ga0496119_0001021_21287_22117 274
611 3300048923 Ga0496120_0000044 Ga0496120_0000044_17103_17933 274
612 3300048923 Ga0496120_0000073 Ga0496120_0000073_15665_16495 274
613 3300049568 Ga0501031_0026318 Ga0501031_0026318_2710_3546 274
614 3300049571 Ga0501034_0000444 Ga0501034_0000444_9490_10320 274
615 3300049571 Ga0501034_0026618 Ga0501034_0026618_2999_3829 274
616 3300049571 Ga0501034_0043168 Ga0501034_0043168_1903_2814 274
617 3300049571 Ga0501034_0176639 Ga0501034_0176639_1131_1967 274
618 3300049571 Ga0501034_0177927 Ga0501034_0177927_984_1823 274
619 3300049571 Ga0501034_0201026 Ga0501034_0201026_1081_1926 274
620 3300049572 Ga0501036_0357484 Ga0501036_0357484_252_1163 274
621 3300049579 Ga0501043_0040158 Ga0501043_0040158_1263_2099 274
622 3300049581 Ga0501047_0008752 Ga0501047_0008752_723_1559 274
623 3300049584 Ga0501068_0000614 Ga0501068_0000614_7240_8070 274
624 3300049585 Ga0501069_0043505 Ga0501069_0043505_1472_2383 274
625 3300049586 Ga0501070_0007753 Ga0501070_0007753_7238_8149 274
626 3300049586 Ga0501070_0145407 Ga0501070_0145407_898_1728 274
627 3300049588 Ga0501072_0274843 Ga0501072_0274843_124_1035 274
628 3300049589 Ga0501073_0000143 Ga0501073_0000143_4260_5090 274
629 3300049589 Ga0501073_0087298 Ga0501073_0087298_407_1318 274
630 3300049589 Ga0501073_0099760 Ga0501073_0099760_817_1647 274
631 3300049590 Ga0501074_0043632 Ga0501074_0043632_191_1021 274
632 3300049742 Ga0501080_0000955 Ga0501080_0000955_8452_9282 274
633 3300049742 Ga0501080_0016628 Ga0501080_0016628_1015_1926 274
634 3300049742 Ga0501080_0311304 Ga0501080_0311304_243_1079 274
635 3300049744 Ga0501083_0008455 Ga0501083_0008455_3677_4507 274
636 3300049744 Ga0501083_0044759 Ga0501083_0044759_1819_2649 274
637 3300049744 Ga0501083_0080260 Ga0501083_0080260_17_847 274
638 3300049822 Ga0501035_0047332 Ga0501035_0047332_116_946 274
639 3300049822 Ga0501035_0108123 Ga0501035_0108123_1344_2180 274
640 3300050489 nmdc:mga03683_114917_c1 nmdc:mga03683_114917_c1_47_877 274
641 3300050507 nmdc:mga05p37_346908_c1 nmdc:mga05p37_346908_c1_136_966 274
642 3300050510 nmdc:mga06r32_212448_c1 nmdc:mga06r32_212448_c1_224_1054 274
643 3300053087 Ga0500643_022254 Ga0500643_022254_219_1055 274
644 3300053103 Ga0500555_021183 Ga0500555_021183_236_1066 274
645 3300054114 Ga0501084_0086241 Ga0501084_0086241_81_911 274
646 iso_pu_bacteria 2512875024 2512960891 274
647 iso_pu_bacteria 2857349434 2857352255 274
648 iso_pu_bacteria 2924726620 2924730220 274
649 iso_pu_bacteria 2968083720 2968087138 274
650 iso_pu_bacteria 2968117919 2968118986 274
651 iso_pu_bacteria 2977942078 2977945674 274
652 iso_pu_bacteria 2987636660 2987639439 274
653 iso_pu_bacteria 3004203850 3004204317 274
654 3300002987 JGI25159J45721_1000461 JGI25159J45721_100046119 275
655 3300003354 JGI25160J50197_1000248 JGI25160J50197_100024819 275
656 3300003374 JGI25161J50226_1000183 JGI25161J50226_100018325 275
657 3300004625 Ga0055543_1000245 Ga0055543_100024525 275
658 3300005262 Ga0065165_1001012 Ga0065165_100101219 275
659 3300005327 Ga0070658_10290359 Ga0070658_102903592 275
660 3300005338 Ga0068868_100484783 Ga0068868_1004847832 275
661 3300005339 Ga0070660_100332888 Ga0070660_1003328882 275
662 3300005344 Ga0070661_100183246 Ga0070661_1001832462 275
663 3300005356 Ga0070674_100024016 Ga0070674_1000240162 275
664 3300005456 Ga0070678_100401568 Ga0070678_1004015681 275
665 3300005548 Ga0070665_100023505 Ga0070665_1000235054 275
666 3300005548 Ga0070665_100237090 Ga0070665_1002370903 275
667 3300005564 Ga0070664_100528939 Ga0070664_1005289392 275
668 3300006038 Ga0075365_10271373 Ga0075365_102713732 275
669 3300006178 Ga0075367_10122285 Ga0075367_101222853 275
670 3300006353 Ga0075370_10022024 Ga0075370_100220243 275
671 3300009147 Ga0114129_10773577 Ga0114129_107735772 275
672 3300009545 Ga0105237_10000397 Ga0105237_1000039727 275
673 3300009765 Ga0123341_1000002 Ga0123341_100000233 275
674 3300009766 Ga0123342_1030249 Ga0123342_10302492 275
675 3300010375 Ga0105239_10014766 Ga0105239_100147668 275
676 3300010375 Ga0105239_10572027 Ga0105239_105720272 275
677 3300021320 Ga0214544_1000010 Ga0214544_1000010232 275
678 3300021321 Ga0214542_1000023 Ga0214542_100002319 275
679 3300021327 Ga0214543_1000019 Ga0214543_100001994 275
680 3300025284 Ga0209130_1000098 Ga0209130_1000098122 275
681 3300025302 Ga0207426_1000069 Ga0207426_1000069138 275
682 3300025899 Ga0207642_10017892 Ga0207642_100178923 275
683 3300025907 Ga0207645_10111210 Ga0207645_101112102 275
684 3300025914 Ga0207671_10001048 Ga0207671_1000104828 275
685 3300025920 Ga0207649_10092468 Ga0207649_100924683 275
686 3300025931 Ga0207644_10148455 Ga0207644_101484552 275
687 3300025945 Ga0207679_10406468 Ga0207679_104064682 275
688 3300025949 Ga0207667_10703046 Ga0207667_107030462 275
689 3300026089 Ga0207648_10651299 Ga0207648_106512992 275
690 3300026116 Ga0207674_10042765 Ga0207674_100427653 275
691 3300028379 Ga0268266_10000257 Ga0268266_1000025766 275
692 3300028794 Ga0307515_10001956 Ga0307515_1000195640 275
693 3300031238 Ga0265332_10070180 Ga0265332_100701802 275
694 3300031247 Ga0265340_10103457 Ga0265340_101034572 275
695 3300031250 Ga0265331_10092429 Ga0265331_100924292 275
696 3300031456 Ga0307513_10154305 Ga0307513_101543052 275
697 3300031711 Ga0265314_10207403 Ga0265314_102074032 275
698 3300031901 Ga0307406_10212650 Ga0307406_102126502 275
699 3300037312 Ga0395899_0084472 Ga0395899_0084472_975_1808 275
700 3300037418 Ga0395900_0014410 Ga0395900_0014410_6339_7172 275
701 3300037471 Ga0395905_0133797 Ga0395905_0133797_691_1533 275
702 3300037471 Ga0395905_0344751 Ga0395905_0344751_334_1173 275
703 3300038443 Ga0395901_0076932 Ga0395901_0076932_424_1257 275
704 3300041498 Ga0451841_0277328 Ga0451841_0277328_128_970 275
705 3300041509 Ga0451843_1665491 Ga0451843_1665491_128_970 275
706 3300041512 Ga0451853_3126826 Ga0451853_3126826_1235_2077 275
707 3300042004 Ga0439445_0079000 Ga0439445_0079000_10_852 275
708 3300045976 Ga0466967_0306169 Ga0466967_0306169_305_1141 275
709 3300046460 Ga0495638_0042235 Ga0495638_0042235_408_1250 275
710 3300046460 Ga0495638_0215387 Ga0495638_0215387_112_951 275
711 3300046474 Ga0495605_0019290 Ga0495605_0019290_769_1611 275
712 3300046501 Ga0495607_0148138 Ga0495607_0148138_227_1069 275
713 3300046512 Ga0495610_0018917 Ga0495610_0018917_823_1665 275
714 3300046515 Ga0495620_0016163 Ga0495620_0016163_1015_1857 275
715 3300046518 Ga0495631_0056290 Ga0495631_0056290_703_1545 275
716 3300046518 Ga0495631_0078236 Ga0495631_0078236_479_1321 275
717 3300046519 Ga0495632_0024918 Ga0495632_0024918_170_1012 275
718 3300046522 Ga0495643_0128851 Ga0495643_0128851_249_1091 275
719 3300046524 Ga0495648_0007216 Ga0495648_0007216_2389_3231 275
720 3300046530 Ga0495654_0076200 Ga0495654_0076200_375_1217 275
721 3300046615 Ga0495656_0012841 Ga0495656_0012841_1593_2435 275
722 3300046616 Ga0495668_0044095 Ga0495668_0044095_595_1437 275
723 3300046660 Ga0495625_0005544 Ga0495625_0005544_7856_8698 275
724 3300046660 Ga0495625_0247566 Ga0495625_0247566_221_1060 275
725 3300046690 Ga0495624_0097942 Ga0495624_0097942_929_1777 275
726 3300046810 Ga0495660_0053584 Ga0495660_0053584_715_1557 275
727 3300047470 Ga0495681_0046366 Ga0495681_0046366_724_1566 275
728 3300047472 Ga0495686_0052543 Ga0495686_0052543_138_980 275
729 3300047673 Ga0495593_0034342 Ga0495593_0034342_1635_2483 275
730 3300048090 Ga0495615_0019143 Ga0495615_0019143_22_864 275
731 3300048922 Ga0496119_0010974 Ga0496119_0010974_1900_2742 275
732 3300048924 Ga0496121_0167571 Ga0496121_0167571_90_932 275
733 3300048928 Ga0496125_0066554 Ga0496125_0066554_83_925 275
734 3300049569 Ga0501032_0000018 Ga0501032_0000018_150318_151157 275
735 3300049570 Ga0501033_0000032 Ga0501033_0000032_150329_151168 275
736 3300049570 Ga0501033_0048959 Ga0501033_0048959_125_964 275
737 3300049571 Ga0501034_0000103 Ga0501034_0000103_5137_5976 275
738 3300049571 Ga0501034_0051840 Ga0501034_0051840_560_1396 275
739 3300049571 Ga0501034_0371386 Ga0501034_0371386_50_889 275
740 3300049571 Ga0501034_0584761 Ga0501034_0584761_127_966 275
741 3300049572 Ga0501036_0000012 Ga0501036_0000012_150329_151168 275
742 3300049573 Ga0501037_0000018 Ga0501037_0000018_5137_5976 275
743 3300049574 Ga0501038_0000017 Ga0501038_0000017_5137_5976 275
744 3300049575 Ga0501039_0000024 Ga0501039_0000024_5137_5976 275
745 3300049576 Ga0501040_0040528 Ga0501040_0040528_478_1317 275
746 3300049579 Ga0501043_0004332 Ga0501043_0004332_5288_6127 275
747 3300049579 Ga0501043_0035219 Ga0501043_0035219_928_1773 275
748 3300049579 Ga0501043_0210059 Ga0501043_0210059_171_1016 275
749 3300049581 Ga0501047_0004558 Ga0501047_0004558_5072_5911 275
750 3300049581 Ga0501047_0289007 Ga0501047_0289007_416_1261 275
751 3300049586 Ga0501070_0026001 Ga0501070_0026001_3741_4580 275
752 3300049589 Ga0501073_0090803 Ga0501073_0090803_1139_1984 275
753 3300049742 Ga0501080_0035296 Ga0501080_0035296_3042_3887 275
754 3300049822 Ga0501035_0000040 Ga0501035_0000040_5095_5934 275
755 3300049822 Ga0501035_0005942 Ga0501035_0005942_424_1269 275
756 3300049822 Ga0501035_0031169 Ga0501035_0031169_653_1492 275
757 3300049823 Ga0501044_0000040 Ga0501044_0000040_5137_5976 275
758 3300049823 Ga0501044_0013108 Ga0501044_0013108_824_1663 275
759 3300049823 Ga0501044_0064588 Ga0501044_0064588_766_1611 275
760 3300050492 nmdc:mga0yw44_177287_c1 nmdc:mga0yw44_177287_c1_467_1306 275
761 3300050511 nmdc:mga08y16_430057_c1 nmdc:mga08y16_430057_c1_374_1216 275
762 3300053108 Ga0500562_055410 Ga0500562_055410_182_1018 275
763 3300053153 Ga0500616_0055079 Ga0500616_0055079_799_1656 275
764 3300053153 Ga0500616_0145217 Ga0500616_0145217_89_925 275
765 3300053156 Ga0500622_0000734 Ga0500622_0000734_22278_23117 275
766 iso_pu_bacteria 2503198000 2503199714 275
767 iso_pu_bacteria 2508501123 2509116655 275
768 iso_pu_bacteria 2509276018 2509372055 275
769 iso_pu_bacteria 2510065059 2510318778 275
770 iso_pu_bacteria 2512875016 2512932870 275
771 iso_pu_bacteria 2513237090 2513608981 275
772 iso_pu_bacteria 2513237164 2514036663 275
773 iso_pu_bacteria 2513237305 2514417286 275
774 iso_pu_bacteria 2588253730 2588518926 275
775 iso_pu_bacteria 2599185301 2599939860 275
776 iso_pu_bacteria 2643221595 2643987609 275
777 iso_pu_bacteria 2643221627 2644157870 275
778 iso_pu_bacteria 2687453392 2688596966 275
779 iso_pu_bacteria 2693429783 2694630225 275
780 iso_pu_bacteria 2693429784 2694634305 275
781 iso_pu_bacteria 2721755686 2723574116 275
782 iso_pu_bacteria 2791355123 2792748281 275
783 iso_pu_bacteria 2844009547 2844012307 275
784 iso_pu_bacteria 2847686936 2847690815 275
785 iso_pu_bacteria 2856328259 2856328731 275
786 iso_pu_bacteria 2856334872 2856338338 275
787 iso_pu_bacteria 2856349417 2856355334 275
788 iso_pu_bacteria 2856364286 2856366857 275
789 iso_pu_bacteria 2857367948 2857370918 275
790 iso_pu_bacteria 2869169390 2869175169 275
791 iso_pu_bacteria 2869234852 2869241877 275
792 iso_pu_bacteria 2869242130 2869249189 275
793 iso_pu_bacteria 2869249662 2869249922 275
794 iso_pu_bacteria 2869256925 2869262911 275
795 iso_pu_bacteria 2869271264 2869276239 275
796 iso_pu_bacteria 2869278585 2869285653 275
797 iso_pu_bacteria 2869285874 2869287731 275
798 iso_pu_bacteria 2871429161 2871435679 275
799 iso_pu_bacteria 2871444079 2871445479 275
800 iso_pu_bacteria 2871451962 2871452877 275
801 iso_pu_bacteria 2871459585 2871460251 275
802 iso_pu_bacteria 2871495908 2871496544 275
803 iso_pu_bacteria 2874102143 2874105293 275
804 iso_pu_bacteria 2874109183 2874115110 275
805 iso_pu_bacteria 2874116593 2874119248 275
806 iso_pu_bacteria 2874131515 2874132901 275
807 iso_pu_bacteria 2874139085 2874142009 275
808 iso_pu_bacteria 2874146452 2874151362 275
809 iso_pu_bacteria 2874155637 2874158996 275
810 iso_pu_bacteria 2874162495 2874163034 275
811 iso_pu_bacteria 2874168670 2874175073 275
812 iso_pu_bacteria 2876363079 2876364880 275
813 iso_pu_bacteria 2876369609 2876377286 275
814 iso_pu_bacteria 2876386047 2876387077 275
815 iso_pu_bacteria 2876399893 2876405592 275
816 iso_pu_bacteria 2876406927 2876413852 275
817 iso_pu_bacteria 2876413966 2876417415 275
818 iso_pu_bacteria 2878730984 2878733083 275
819 iso_pu_bacteria 2878738818 2878744807 275
820 iso_pu_bacteria 2878745973 2878749242 275
821 iso_pu_bacteria 2878753008 2878757562 275
822 iso_pu_bacteria 2878760144 2878760772 275
823 iso_pu_bacteria 2878767105 2878767603 275
824 iso_pu_bacteria 2878781027 2878784098 275
825 iso_pu_bacteria 2881147464 2881149590 275
826 iso_pu_bacteria 2881155292 2881160771 275
827 iso_pu_bacteria 2881161766 2881166469 275
828 iso_pu_bacteria 2881845957 2881849486 275
829 iso_pu_bacteria 2881853255 2881860505 275
830 iso_pu_bacteria 2881861095 2881863131 275
831 iso_pu_bacteria 2882632389 2882639383 275
832 iso_pu_bacteria 2882912400 2882918380 275
833 iso_pu_bacteria 2885318864 2885319415 275
834 iso_pu_bacteria 2885350715 2885356108 275
835 iso_pu_bacteria 2888350351 2888354698 275
836 iso_pu_bacteria 2889010040 2889016313 275
837 iso_pu_bacteria 2889016732 2889018664 275
838 iso_pu_bacteria 2903492973 2903498706 275
839 iso_pu_bacteria 2903492973 2903501292 275
840 iso_pu_bacteria 2903521522 2903522384 275
841 iso_pu_bacteria 2903528002 2903528763 275
842 iso_pu_bacteria 2903540706 2903541338 275
843 iso_pu_bacteria 2906308376 2906310280 275
844 iso_pu_bacteria 2906321335 2906324345 275
845 iso_pu_bacteria 2906328253 2906333159 275
846 iso_pu_bacteria 2906354277 2906355226 275
847 iso_pu_bacteria 2906363423 2906365978 275
848 iso_pu_bacteria 2906370794 2906375160 275
849 iso_pu_bacteria 2906386501 2906387086 275
850 iso_pu_bacteria 2906393657 2906394381 275
851 iso_pu_bacteria 2906401398 2906407986 275
852 iso_pu_bacteria 2906408224 2906414051 275
853 iso_pu_bacteria 2922130491 2922138325 275
854 iso_pu_bacteria 2922151315 2922153686 275
855 iso_pu_bacteria 2922158528 2922159040 275
856 iso_pu_bacteria 2922172374 2922172652 275
857 iso_pu_bacteria 2922178524 2922179550 275
858 iso_pu_bacteria 2922185730 2922188375 275
859 iso_pu_bacteria 2924710171 2924712192 275
860 iso_pu_bacteria 2924733363 2924733918 275
861 iso_pu_bacteria 2924741084 2924743665 275
862 iso_pu_bacteria 2924748358 2924749216 275
863 iso_pu_bacteria 2924762789 2924767248 275
864 iso_pu_bacteria 2924776078 2924782838 275
865 iso_pu_bacteria 2924784321 2924786857 275
866 iso_pu_bacteria 2937813078 2937817104 275
867 iso_pu_bacteria 2937822353 2937822548 275
868 iso_pu_bacteria 2937848649 2937852483 275
869 iso_pu_bacteria 2937877337 2937883621 275
870 iso_pu_bacteria 2937891427 2937892977 275
871 iso_pu_bacteria 2937972304 2937977570 275
872 iso_pu_bacteria 2937994558 2937995194 275
873 iso_pu_bacteria 2958034702 2958041668 275
874 iso_pu_bacteria 2958041894 2958047950 275
875 iso_pu_bacteria 2958064165 2958070661 275
876 iso_pu_bacteria 2958084443 2958090789 275
877 iso_pu_bacteria 2958100919 2958102442 275
878 iso_pu_bacteria 2958108152 2958113401 275
879 iso_pu_bacteria 2958115193 2958120911 275
880 iso_pu_bacteria 2958122699 2958128981 275
881 iso_pu_bacteria 2958130278 2958132133 275
882 iso_pu_bacteria 2958137437 2958138031 275
883 iso_pu_bacteria 2958158011 2958164490 275
884 iso_pu_bacteria 2958165035 2958165541 275
885 iso_pu_bacteria 2958172287 2958174260 275
886 iso_pu_bacteria 2958179912 2958181947 275
887 iso_pu_bacteria 2961077736 2961079791 275
888 iso_pu_bacteria 2961127735 2961132269 275
889 iso_pu_bacteria 2961136820 2961139723 275
890 iso_pu_bacteria 2961163497 2961164000 275
891 iso_pu_bacteria 2961170736 2961175111 275
892 iso_pu_bacteria 2963644680 2963646336 275
893 iso_pu_bacteria 2965018300 2965018934 275
894 iso_pu_bacteria 2965025482 2965027035 275
895 iso_pu_bacteria 2965032056 2965040200 275
896 iso_pu_bacteria 2965040258 2965046269 275
897 iso_pu_bacteria 2965062239 2965062847 275
898 iso_pu_bacteria 2965089291 2965090430 275
899 iso_pu_bacteria 2965119406 2965125245 275
900 iso_pu_bacteria 2967996073 2967999888 275
901 iso_pu_bacteria 2968003550 2968008247 275
902 iso_pu_bacteria 2968016561 2968020461 275
903 iso_pu_bacteria 2968091066 2968091312 275
904 iso_pu_bacteria 2968097103 2968103140 275
905 iso_pu_bacteria 2968128360 2968128930 275
906 iso_pu_bacteria 2968138860 2968143472 275
907 iso_pu_bacteria 2968171901 2968172403 275
908 iso_pu_bacteria 2970469710 2970473758 275
909 iso_pu_bacteria 2970489779 2970490429 275
910 iso_pu_bacteria 2970503327 2970507699 275
911 iso_pu_bacteria 2970510686 2970516849 275
912 iso_pu_bacteria 2970532167 2970534772 275
913 iso_pu_bacteria 2970547951 2970548273 275
914 iso_pu_bacteria 2970554993 2970555625 275
915 iso_pu_bacteria 2970593180 2970600269 275
916 iso_pu_bacteria 2970619444 2970620167 275
917 iso_pu_bacteria 2977821940 2977826719 275
918 iso_pu_bacteria 2977828996 2977832939 275
919 iso_pu_bacteria 2977843712 2977847395 275
920 iso_pu_bacteria 2977851361 2977854159 275
921 iso_pu_bacteria 2977858184 2977861730 275
922 iso_pu_bacteria 2977872689 2977873983 275
923 iso_pu_bacteria 2977915119 2977921921 275
924 iso_pu_bacteria 2977922695 2977925277 275
925 iso_pu_bacteria 2977935797 2977940645 275
926 iso_pu_bacteria 2977971508 2977973944 275
927 iso_pu_bacteria 2977986579 2977991287 275
928 iso_pu_bacteria 2979710463 2979715663 275
929 iso_pu_bacteria 2979742915 2979745632 275
930 iso_pu_bacteria 2979764755 2979771260 275
931 iso_pu_bacteria 2979779861 2979782194 275
932 iso_pu_bacteria 2979793036 2979793979 275
933 iso_pu_bacteria 2979808191 2979812883 275
934 iso_pu_bacteria 2987645492 2987648062 275
935 iso_pu_bacteria 2987652177 2987653914 275
936 iso_pu_bacteria 2987659509 2987660008 275
937 iso_pu_bacteria 2987666974 2987673446 275
938 iso_pu_bacteria 2996341866 2996342788 275
939 iso_pu_bacteria 2996348954 2996352919 275
940 iso_pu_bacteria 2996386984 2996393295 275
941 iso_pu_bacteria 3000135777 3000139312 275
942 iso_pu_bacteria 3004167301 3004167353 275
943 iso_pu_bacteria 3004188549 3004189056 275
944 iso_pu_bacteria 3004211236 3004217771 275
945 iso_pu_bacteria 3004218560 3004221181 275
946 iso_pu_bacteria 3004232784 3004232810 275
947 iso_pu_bacteria 3004239961 3004243378 275
948 iso_pu_bacteria 3004268573 3004269930 275
949 iso_pu_bacteria 3004275668 3004279601 275
950 iso_pu_bacteria 3004289098 3004290610 275
951 iso_pu_bacteria 3004334049 3004336058 275
952 iso_pu_bacteria 649633066 649871524 275
953 iso_pu_bacteria 8004300914 8004301844 275
954 iso_pu_bacteria 8004312739 8004314683 275
955 iso_pu_bacteria 8004374579 8004379135 275
956 iso_pu_bacteria 8004387939 8004389516 275
957 iso_pu_bacteria 8004445564 8004451787 275
958 iso_pu_bacteria 8004640170 8004644028 275
959 iso_pu_bacteria 8004703790 8004712337 275
960 iso_pu_bacteria 8004714634 8004717914 275
961 iso_pu_bacteria 8004727605 8004734035 275
962 3300006038 Ga0075365_10044625 Ga0075365_100446256 276
963 3300021361 Ga0213872_10025047 Ga0213872_100250472 276
964 3300039447 Ga0436361_0845671 Ga0436361_0845671_305_1210 276
965 3300049742 Ga0501080_0691419 Ga0501080_0691419_25_885 276
966 3300053158 Ga0500627_0161288 Ga0500627_0161288_132_995 276
967 3300005842 Ga0068858_100478235 Ga0068858_1004782351 277
968 3300005983 Ga0081540_1096763 Ga0081540_10967632 277
969 3300026035 Ga0207703_10415708 Ga0207703_104157082 277
970 3300042436 Ga0439435_0050826 Ga0439435_0050826_235_1074 277
971 3300049568 Ga0501031_0058101 Ga0501031_0058101_686_1534 277
972 3300049569 Ga0501032_0012010 Ga0501032_0012010_705_1553 277
973 3300049569 Ga0501032_0016409 Ga0501032_0016409_526_1374 277
974 3300049570 Ga0501033_0010055 Ga0501033_0010055_3006_3854 277
975 3300049570 Ga0501033_0022431 Ga0501033_0022431_686_1534 277
976 3300049571 Ga0501034_0013483 Ga0501034_0013483_4516_5364 277
977 3300049571 Ga0501034_0050527 Ga0501034_0050527_2903_3742 277
978 3300049571 Ga0501034_0085368 Ga0501034_0085368_635_1486 277
979 3300049572 Ga0501036_0021735 Ga0501036_0021735_3841_4689 277
980 3300049573 Ga0501037_0070785 Ga0501037_0070785_703_1551 277
981 3300049574 Ga0501038_0035575 Ga0501038_0035575_1421_2269 277
982 3300049575 Ga0501039_0085075 Ga0501039_0085075_705_1553 277
983 3300049580 Ga0501046_0020293 Ga0501046_0020293_3947_4795 277
984 3300049581 Ga0501047_0086899 Ga0501047_0086899_987_1835 277
985 3300049581 Ga0501047_0134003 Ga0501047_0134003_987_1835 277
986 3300049581 Ga0501047_0242319 Ga0501047_0242319_121_960 277
987 3300049584 Ga0501068_0026011 Ga0501068_0026011_900_1739 277
988 3300049585 Ga0501069_0013466 Ga0501069_0013466_2529_3368 277
989 3300049586 Ga0501070_0093477 Ga0501070_0093477_1592_2431 277
990 3300049587 Ga0501071_0014047 Ga0501071_0014047_4559_5407 277
991 3300049589 Ga0501073_0031477 Ga0501073_0031477_18_857 277
992 3300049589 Ga0501073_0144825 Ga0501073_0144825_587_1435 277
993 3300049589 Ga0501073_0248679 Ga0501073_0248679_116_985 277
994 3300049590 Ga0501074_0031683 Ga0501074_0031683_2581_3420 277
995 3300049590 Ga0501074_0185745 Ga0501074_0185745_140_988 277
996 3300049741 Ga0501079_0172456 Ga0501079_0172456_372_1211 277
997 3300049822 Ga0501035_0010917 Ga0501035_0010917_6877_7725 277
998 3300049822 Ga0501035_0013756 Ga0501035_0013756_3377_4225 277
999 3300049823 Ga0501044_0007916 Ga0501044_0007916_10133_10981 277
1000 3300049823 Ga0501044_0061348 Ga0501044_0061348_2313_3161 277
1001 3300049823 Ga0501044_0395455 Ga0501044_0395455_46_885 277
1002 3300053139 Ga0500568_0000010 Ga0500568_0000010_37895_38761 277
1003 3300048924 Ga0496121_0154062 Ga0496121_0154062_660_1511 278
1004 3300049589 Ga0501073_0025527 Ga0501073_0025527_289_1164 278
1005 iso_pu_bacteria 2961183825 2961188401 278
1006 3300001989 JGI24739J22299_10022936 JGI24739J22299_100229362 279
1007 3300003214 JGI25165J46597_1000034 JGI25165J46597_100003480 279
1008 3300003762 Ga0055542_1001063 Ga0055542_100106317 279
1009 3300003763 Ga0055529_1003010 Ga0055529_10030102 279
1010 3300005327 Ga0070658_10332977 Ga0070658_103329772 279
1011 3300005539 Ga0068853_100009175 Ga0068853_1000091755 279
1012 3300005548 Ga0070665_100477974 Ga0070665_1004779742 279
1013 3300005937 Ga0081455_10146886 Ga0081455_101468862 279
1014 3300006038 Ga0075365_10002114 Ga0075365_100021145 279
1015 3300006042 Ga0075368_10028307 Ga0075368_100283072 279
1016 3300006186 Ga0075369_10131423 Ga0075369_101314232 279
1017 3300009093 Ga0105240_10398424 Ga0105240_103984242 279
1018 3300009098 Ga0105245_10458339 Ga0105245_104583392 279
1019 3300009545 Ga0105237_10054607 Ga0105237_100546074 279
1020 3300009551 Ga0105238_10314728 Ga0105238_103147282 279
1021 3300010375 Ga0105239_10050615 Ga0105239_100506154 279
1022 3300013105 Ga0157369_10188646 Ga0157369_101886463 279
1023 3300013306 Ga0163162_10739421 Ga0163162_107394212 279
1024 3300013307 Ga0157372_10708737 Ga0157372_107087372 279
1025 3300014497 Ga0182008_10036580 Ga0182008_100365803 279
1026 3300025250 Ga0209026_1000100 Ga0209026_100010019 279
1027 3300025254 Ga0209148_1000069 Ga0209148_1000069167 279
1028 3300025254 Ga0209148_1003960 Ga0209148_10039604 279
1029 3300025256 Ga0209759_1000549 Ga0209759_100054921 279
1030 3300025261 Ga0209233_1000028 Ga0209233_100002884 279
1031 3300025272 Ga0209455_1000135 Ga0209455_100013520 279
1032 3300025907 Ga0207645_10150484 Ga0207645_101504842 279
1033 3300025914 Ga0207671_10048066 Ga0207671_100480663 279
1034 3300025924 Ga0207694_10041236 Ga0207694_100412364 279
1035 3300025937 Ga0207669_10230800 Ga0207669_102308002 279
1036 3300026067 Ga0207678_10322066 Ga0207678_103220662 279
1037 3300028379 Ga0268266_10123949 Ga0268266_101239492 279
1038 3300037418 Ga0395900_0117317 Ga0395900_0117317_1700_2545 279
1039 3300037471 Ga0395905_0252820 Ga0395905_0252820_506_1351 279
1040 3300038443 Ga0395901_0047074 Ga0395901_0047074_3345_4190 279
1041 3300038443 Ga0395901_0151688 Ga0395901_0151688_1307_2152 279
1042 3300046542 Ga0495597_0091737 Ga0495597_0091737_360_1214 279
1043 3300046616 Ga0495668_0036681 Ga0495668_0036681_986_1849 279
1044 3300046660 Ga0495625_0021804 Ga0495625_0021804_3910_4776 279
1045 3300046660 Ga0495625_0145329 Ga0495625_0145329_73_939 279
1046 3300048915 Ga0496112_0001731 Ga0496112_0001731_14244_15110 279
1047 3300048923 Ga0496120_0002155 Ga0496120_0002155_3777_4616 279
1048 3300048923 Ga0496120_0020849 Ga0496120_0020849_1868_2722 279
1049 3300048929 Ga0496126_0152871 Ga0496126_0152871_1118_1963 279
1050 3300050492 nmdc:mga0yw44_315155_c1 nmdc:mga0yw44_315155_c1_160_1026 279
1051 3300050494 nmdc:mga06z11_257117_c1 nmdc:mga06z11_257117_c1_23_880 279
1052 3300050516 nmdc:mga0sz30_116209_c1 nmdc:mga0sz30_116209_c1_71_937 279
1053 3300050516 nmdc:mga0sz30_41876_c1 nmdc:mga0sz30_41876_c1_853_1719 279
1054 3300053155 Ga0500620_000598 Ga0500620_000598_2954_3811 279
1055 iso_pu_bacteria 2965110997 2965117065 279

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09370

PEP_hydrolase

Phosphoenolpyruvate hydrolase-like

194

330

0.98

PF09370

PEP_hydrolase

Phosphoenolpyruvate hydrolase-like

4

147

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p10-assembly1.cif.gz_E crystal structure of a putative phosphonopyruvate hydrolase (mll9387) from mesorhizobium loti maff303099 at 2.15 a resolution 0.9357 4 277
2p10-assembly1.cif.gz_D crystal structure of a putative phosphonopyruvate hydrolase (mll9387) from mesorhizobium loti maff303099 at 2.15 a resolution 0.9346 4 277
2p10-assembly1.cif.gz_E crystal structure of a putative phosphonopyruvate hydrolase (mll9387) from mesorhizobium loti maff303099 at 2.15 a resolution 0.9295 4 277
2p10-assembly1.cif.gz_F crystal structure of a putative phosphonopyruvate hydrolase (mll9387) from mesorhizobium loti maff303099 at 2.15 a resolution 0.9292 4 277
2p10-assembly1.cif.gz_D crystal structure of a putative phosphonopyruvate hydrolase (mll9387) from mesorhizobium loti maff303099 at 2.15 a resolution 0.9244 4 277
ID Description Score Start End Superfamily
af_A0A1D6FD56_1_198_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9354 55 252 3.20.20.70
2p10E01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9341 4 252 3.20.20.70
af_A0A1D6FD56_1_198_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9308 55 252 3.20.20.70
af_A0A1D6MLW1_1_166_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9293 57 218 3.20.20.70
2p10E01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9263 4 252 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A527VN36-F1-model_v4 Phosphoenolpyruvate hydrolase family protein 0.9969 156 240 GO:0016787
AF-A0A5K0XTA2-F1-model_v4 TIM-barrel domain-containing protein 0.9899 145 227 GO:0003824
AF-A0A530ATE5-F1-model_v4 deleted 0.9859 75 279
AF-A0A528AZZ8-F1-model_v4 Phosphoenolpyruvate hydrolase family protein 0.9844 110 245 GO:0016787
AF-L8GJP6-F1-model_v4 Transcriptional regulator, putative 0.9836 130 276 GO:0003824

Feature Viewer

pLDDT pTM Quality
89.8 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map