F489136

General Info

Members Datasets Scaffolds Average Seq Length
1054 395 1013 193

Family's Representative Sequence

Representative Sequence 3300046674|Ga0495588_0014347|Ga0495588_0014347_142_819
Length 225
Sequence LAEKRSCTLVQRASQAESATRSRFGEPSTKERIMSQETQAASATPRPNDMNLVWLDMEMTGLDPDNDRIIEVAVVVTDAELNILAEGPVFAIHQSDETLDKMDNWNKGTHGKSGLIDRVKASTVNEAQAEEQLIAFLKQWVPANKSPMCGNSICQDRRFMARGMPKLEAFFHYRNLDVSTLKELCRRWKPELASGFKKHQKHTALADIVESIEELRYYREHFIKL

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
3 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
4 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
5 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
6 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
7 2643221556 Massilia sp. Root1485 Isolate Unclassified
8 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
9 2643221638 Duganella sp. Root336D2 Isolate Unclassified
10 2643221645 Massilia sp. Root351 Isolate Unclassified
11 2643221664 Massilia sp. Root418 Isolate Unclassified
12 2643221684 Massilia sp. Root133 Isolate Unclassified
13 2738541280 Massilia sp. GV090 Isolate Unclassified
14 2738541300 Massilia sp. GV016 Isolate Unclassified
15 2738543018 Massilia sp. GV045 Isolate Unclassified
16 2738543030 Massilia sp. GV097 Isolate Unclassified
17 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
18 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
19 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
20 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
21 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
22 2818991436 Collimonas arenae 515 Isolate Unclassified
23 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
24 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
25 2821131069 Duganella sp. 1224 Isolate Unclassified
26 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
27 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
28 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
29 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
30 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
31 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
32 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
33 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
34 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
35 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
36 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
37 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
38 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
39 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
40 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
41 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
42 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
43 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
44 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
45 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
46 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
47 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
48 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
49 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
50 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
51 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
52 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
53 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
54 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
55 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
56 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
57 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
58 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
59 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
60 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
61 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
62 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
63 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
64 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
65 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
66 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
67 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
68 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
69 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
70 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
71 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
72 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
73 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
74 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
75 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
76 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
77 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
78 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
79 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
80 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
81 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
82 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
83 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
84 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
85 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
88 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
89 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
90 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
91 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
94 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
95 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
96 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
97 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
98 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
99 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
100 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
101 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
102 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
103 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
104 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
105 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
107 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
109 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
110 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
111 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
128 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
129 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
132 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
133 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
134 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
135 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
136 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
143 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
144 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
146 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
147 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
150 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
151 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
155 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
160 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
195 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
196 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
197 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
198 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
199 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
200 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
201 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
202 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
203 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
204 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
205 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
211 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
212 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
213 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
214 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
215 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
216 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
217 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
218 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
219 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
220 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
221 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
222 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
223 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
224 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
225 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
226 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
227 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
228 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
229 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
230 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
231 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
232 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
233 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
234 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
235 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
236 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
237 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
238 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
239 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
240 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
241 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
242 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
243 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
244 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
245 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
246 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
247 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
248 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
249 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
250 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
251 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
252 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
253 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
254 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
255 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
256 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
257 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
258 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
259 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
260 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
261 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
262 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
263 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
264 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
265 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
266 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
267 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
268 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
269 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
270 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
271 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
272 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
273 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
274 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
275 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
276 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
277 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
278 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
279 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
280 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
281 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
282 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
283 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
284 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
285 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
286 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
287 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
288 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
289 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
290 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
291 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
292 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
293 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
294 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
295 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
296 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
297 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
298 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
299 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
300 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
301 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
302 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
303 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
304 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
305 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
306 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
307 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
308 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
309 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
310 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
311 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
312 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
313 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
314 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
315 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
316 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
317 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
318 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
319 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
320 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
321 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
322 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
323 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
324 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
325 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
326 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
327 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
328 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
329 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
330 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
331 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
332 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
333 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
334 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
335 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
336 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
337 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
338 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
339 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
340 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
341 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
342 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
343 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
344 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
345 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
346 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
347 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
351 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
352 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
353 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
354 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
355 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
356 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
357 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
358 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
359 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
360 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
361 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
362 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
363 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
364 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
365 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
366 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
367 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
368 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
369 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
370 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
371 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
395 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.69
Metatranscriptomes 3.42
Isolates 3.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.78
Nodule 0.57
Rhizoplane 3.42
Rhizosphere 81.31
Stem 0
Stem Tuber 0
Unclassified 6.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000363 3300002704 Bacteria 13840
2 JGI25155J39150_1000557 3300002704 Bacteria 8407
3 JGI25156J39149_1000170 3300002705 Bacteria 47634
4 JGI25156J39149_1001095 3300002705 Bacteria 12376
5 JGI25162J39368_1000026 3300002737 Bacteria 227710
6 JGI25162J39368_1010038 3300002737 Bacteria 1223
7 JGI25154J39366_1000351 3300002738 Bacteria 26227
8 JGI25154J39366_1000415 3300002738 Bacteria 22969
9 JGI25157J39369_1000170 3300002741 Bacteria 54809
10 JGI25157J39369_1000605 3300002741 Bacteria 20744
11 JGI25159J45721_1004210 3300002987 Bacteria 4850
12 JGI25159J45721_1008279 3300002987 Bacteria 2875
13 JGI25165J46597_1000031 3300003214 Bacteria 296858
14 JGI25161J50226_1001131 3300003374 Bacteria 8930
15 Ga0007417J51691_1071950 3300003544 Bacteria 1190
16 Ga0007416J51690_1059972 3300003577 Bacteria 870
17 Ga0032354_1079230 3300003693 Bacteria 1120
18 Ga0055538_1000018 3300003751 Bacteria 296858
19 Ga0055539_1000023 3300003752 Bacteria 296858
20 Ga0055533_1000031 3300003756 Bacteria 296858
21 Ga0055532_1000017 3300003758 Bacteria 306880
22 Ga0055525_1000029 3300003759 Bacteria 320663
23 Ga0055525_1000039 3300003759 Bacteria 296858
24 Ga0055542_1021560 3300003762 Bacteria 927
25 Ga0055526_1000068 3300003771 Bacteria 98723
26 Ga0055526_1001163 3300003771 Bacteria 19080
27 Ga0055526_1005093 3300003771 Bacteria 7667
28 Ga0055526_1007187 3300003771 Bacteria 5855
29 Ga0055537_1000678 3300003773 Bacteria 17886
30 Ga0055524_1000021 3300003775 Bacteria 227578
31 Ga0055524_1003016 3300003775 Bacteria 8340
32 Ga0055524_1005587 3300003775 Bacteria 5584
33 Ga0055524_1013711 3300003775 Bacteria 3043
34 Ga0055534_1000195 3300003784 Bacteria 44284
35 Ga0055534_1004625 3300003784 Bacteria 3918
36 Ga0055528_1000368 3300003790 Bacteria 36674
37 Ga0055530_10003380 3300003791 Bacteria 9123
38 Ga0055541_1000016 3300003841 Bacteria 296861
39 Ga0055543_1001470 3300004625 Bacteria 9303
40 Ga0065165_1004144 3300005262 Bacteria 9303
41 Ga0065165_1046881 3300005262 Bacteria 1251
42 Ga0070658_10447686 3300005327 Bacteria 1112
43 Ga0070670_100000017 3300005331 Bacteria 224429
44 Ga0070670_100008239 3300005331 Bacteria 8877
45 Ga0070666_10001017 3300005335 Bacteria 17184
46 Ga0070666_10403118 3300005335 Bacteria 983
47 Ga0070682_100516816 3300005337 Bacteria 928
48 Ga0070660_100000420 3300005339 Bacteria 28168
49 Ga0070660_100018151 3300005339 Bacteria 5135
50 Ga0070660_100081746 3300005339 Bacteria 2536
51 Ga0070660_100422141 3300005339 Bacteria 1104
52 Ga0070689_100111630 3300005340 Bacteria 2175
53 Ga0070661_100098624 3300005344 Bacteria 2170
54 Ga0070661_100127414 3300005344 Bacteria 1910
55 Ga0070668_100007166 3300005347 Bacteria 8265
56 Ga0070669_100028281 3300005353 Bacteria 4037
57 Ga0070669_100039493 3300005353 Bacteria 3430
58 Ga0070675_100029487 3300005354 Bacteria 4426
59 Ga0070671_100000173 3300005355 Bacteria 42660
60 Ga0070671_100099885 3300005355 Bacteria 2434
61 Ga0070673_100010734 3300005364 Bacteria 6213
62 Ga0070688_100003318 3300005365 Bacteria 8251
63 Ga0070688_100019613 3300005365 Bacteria 3920
64 Ga0070659_100115125 3300005366 Bacteria 2173
65 Ga0070659_100117647 3300005366 Bacteria 2149
66 Ga0070659_100170659 3300005366 Bacteria 1782
67 Ga0070667_100001097 3300005367 Bacteria 24823
68 Ga0070667_100003801 3300005367 Bacteria 12845
69 Ga0070663_100390729 3300005455 Bacteria 1135
70 Ga0070678_100004615 3300005456 Bacteria 7827
71 Ga0068867_100003865 3300005459 Bacteria 10535
72 Ga0070685_10000026 3300005466 Bacteria 98490
73 Ga0070685_10172828 3300005466 Bacteria 1386
74 Ga0070665_100285816 3300005548 Bacteria 1651
75 Ga0068855_100001073 3300005563 Bacteria 33944
76 Ga0068855_100018683 3300005563 Bacteria 8336
77 Ga0068855_100206715 3300005563 Bacteria 2208
78 Ga0068855_100544190 3300005563 Bacteria 1257
79 Ga0070664_100029568 3300005564 Bacteria 4568
80 Ga0070664_100057458 3300005564 Bacteria 3307
81 Ga0070664_100100244 3300005564 Bacteria 2518
82 Ga0068857_100708483 3300005577 Bacteria 957
83 Ga0068854_100006965 3300005578 Bacteria 7213
84 Ga0068856_100506920 3300005614 Bacteria 1228
85 Ga0068856_100833244 3300005614 Bacteria 942
86 Ga0068852_100220358 3300005616 Bacteria 1804
87 Ga0068852_100574624 3300005616 Bacteria 1129
88 Ga0068859_100317621 3300005617 Bacteria 1651
89 Ga0068864_100000029 3300005618 Bacteria 224429
90 Ga0068861_100127381 3300005719 Bacteria 2062
91 Ga0068851_10336586 3300005834 Bacteria 875
92 Ga0068863_100600276 3300005841 Bacteria 1089
93 Ga0068858_100133592 3300005842 Bacteria 2327
94 Ga0068860_100000228 3300005843 Bacteria 86756
95 Ga0068860_101144895 3300005843 Bacteria 798
96 Ga0068862_100069792 3300005844 Bacteria 3033
97 Ga0068862_100089363 3300005844 Bacteria 2681
98 Ga0075365_10197172 3300006038 Bacteria 1410
99 Ga0075364_10446427 3300006051 Bacteria 883
100 Ga0075367_10558457 3300006178 Bacteria 727
101 Ga0075366_10026204 3300006195 Bacteria 3414
102 Ga0097621_100441709 3300006237 Bacteria 1171
103 Ga0068871_100939794 3300006358 Bacteria 803
104 Ga0097620_100317629 3300006931 Bacteria 1651
105 Ga0079104_1008344 3300006946 Bacteria 3639
106 Ga0099826_10000041 3300006948 Bacteria 96536
107 Ga0105251_10236994 3300009011 Bacteria 822
108 Ga0105240_10009083 3300009093 Bacteria 14111
109 Ga0105240_10011970 3300009093 Bacteria 12023
110 Ga0105240_10020783 3300009093 Bacteria 8745
111 Ga0105241_10016300 3300009174 Bacteria 5446
112 Ga0105248_10006207 3300009177 Bacteria 13098
113 Ga0105237_10135525 3300009545 Bacteria 2457
114 Ga0105237_10259678 3300009545 Bacteria 1740
115 Ga0105238_10000065 3300009551 Bacteria 121196
116 Ga0105238_10150406 3300009551 Bacteria 2303
117 Ga0105238_10233962 3300009551 Bacteria 1814
118 Ga0105238_10262147 3300009551 Bacteria 1708
119 Ga0105249_10901723 3300009553 Bacteria 951
120 Ga0105239_10009136 3300010375 Bacteria 11211
121 Ga0105239_10457761 3300010375 Bacteria 1448
122 Ga0105239_11353967 3300010375 Bacteria 821
123 Ga0157373_10037009 3300013100 Bacteria 3501
124 Ga0157371_10000013 3300013102 Bacteria 352631
125 Ga0157371_10374609 3300013102 Bacteria 1039
126 Ga0157374_10014078 3300013296 Bacteria 6993
127 Ga0157378_10351285 3300013297 Bacteria 1440
128 Ga0157378_10667619 3300013297 Bacteria 1056
129 Ga0163162_10003303 3300013306 Bacteria 15434
130 Ga0163162_10609494 3300013306 Bacteria 1217
131 Ga0163163_10423409 3300014325 Bacteria 1390
132 Ga0157380_10007300 3300014326 Bacteria 7844
133 Ga0182008_10046094 3300014497 Bacteria 2167
134 Ga0182008_10057555 3300014497 Bacteria 1919
135 Ga0157379_10015472 3300014968 Bacteria 6695
136 Ga0157379_10637077 3300014968 Bacteria 997
137 Ga0182006_1016620 3300015261 Bacteria 3136
138 Ga0182006_1029100 3300015261 Bacteria 2241
139 Ga0182006_1050588 3300015261 Bacteria 1601
140 Ga0182006_1174230 3300015261 Bacteria 719
141 Ga0182007_10031167 3300015262 Bacteria 1818
142 Ga0182007_10115956 3300015262 Bacteria 894
143 Ga0182005_1003156 3300015265 Bacteria 5657
144 Ga0163161_10032386 3300017792 Bacteria 3731
145 Ga0213872_10000242 3300021361 Bacteria 48194
146 Ga0213872_10000443 3300021361 Bacteria 33899
147 Ga0213872_10001513 3300021361 Bacteria 14948
148 Ga0213872_10001692 3300021361 Bacteria 13879
149 Ga0213872_10019294 3300021361 Bacteria 3141
150 Ga0213872_10019678 3300021361 Bacteria 3109
151 Ga0213872_10044898 3300021361 Bacteria 2010
152 Ga0213872_10091690 3300021361 Bacteria 1359
153 Ga0213872_10108111 3300021361 Bacteria 1236
154 Ga0213872_10156063 3300021361 Bacteria 995
155 Ga0213876_10076148 3300021384 Bacteria 1772
156 Ga0209435_100015 3300025206 Bacteria 321177
157 Ga0209435_100161 3300025206 Bacteria 21397
158 Ga0209760_100622 3300025207 Bacteria 6046
159 Ga0209436_101543 3300025208 Bacteria 7827
160 Ga0209784_100027 3300025224 Bacteria 363933
161 Ga0209566_100027 3300025225 Bacteria 363933
162 Ga0209674_100044 3300025226 Bacteria 363933
163 Ga0209672_102164 3300025228 Bacteria 5179
164 Ga0209147_100004 3300025229 Bacteria 1371850
165 Ga0209563_100003 3300025230 Bacteria 1932942
166 Ga0209563_100048 3300025230 Bacteria 363933
167 Ga0207427_100643 3300025231 Bacteria 16924
168 Ga0209437_100045 3300025233 Bacteria 429809
169 Ga0209437_100055 3300025233 Bacteria 363933
170 Ga0209437_108693 3300025233 Bacteria 1614
171 Ga0209437_110183 3300025233 Bacteria 1444
172 Ga0209258_100226 3300025242 Bacteria 106588
173 Ga0209646_1000020 3300025246 Bacteria 462204
174 Ga0209646_1000040 3300025246 Bacteria 347867
175 Ga0209646_1000077 3300025246 Bacteria 208262
176 Ga0209026_1000034 3300025250 Bacteria 306953
177 Ga0209026_1009492 3300025250 Bacteria 1907
178 Ga0209026_1016102 3300025250 Bacteria 1215
179 Ga0209677_100028 3300025253 Bacteria 363933
180 Ga0209148_1001819 3300025254 Bacteria 8981
181 Ga0209759_1000049 3300025256 Bacteria 221692
182 Ga0209759_1000357 3300025256 Bacteria 59208
183 Ga0209233_1000070 3300025261 Bacteria 363933
184 Ga0209565_1000015 3300025263 Bacteria 494091
185 Ga0209565_1001939 3300025263 Bacteria 8132
186 Ga0209455_1000169 3300025272 Bacteria 111454
187 Ga0209455_1008089 3300025272 Bacteria 2893
188 Ga0209673_1000394 3300025273 Bacteria 78048
189 Ga0209130_1001054 3300025284 Bacteria 20900
190 Ga0209675_1000012 3300025291 Bacteria 494061
191 Ga0209675_1001711 3300025291 Bacteria 12096
192 Ga0209564_1000016 3300025295 Bacteria 613131
193 Ga0209564_1000071 3300025295 Bacteria 301332
194 Ga0209564_1000072 3300025295 Bacteria 289331
195 Ga0209564_1028688 3300025295 Bacteria 1771
196 Ga0209050_1000240 3300025298 Bacteria 118992
197 Ga0209256_1000044 3300025299 Bacteria 337264
198 Ga0209256_1000076 3300025299 Bacteria 234735
199 Ga0209256_1003100 3300025299 Bacteria 12161
200 Ga0207426_1054078 3300025302 Bacteria 1183
201 Ga0207680_10014776 3300025903 Bacteria 4055
202 Ga0207705_10017557 3300025909 Bacteria 5123
203 Ga0207654_10004697 3300025911 Bacteria 6913
204 Ga0207695_10001341 3300025913 Bacteria 41772
205 Ga0207695_10005745 3300025913 Bacteria 16337
206 Ga0207695_10438637 3300025913 Bacteria 1189
207 Ga0207671_10037277 3300025914 Bacteria 3606
208 Ga0207671_10307253 3300025914 Bacteria 1253
209 Ga0207657_10001145 3300025919 Bacteria 28192
210 Ga0207657_10024222 3300025919 Bacteria 5631
211 Ga0207657_10034425 3300025919 Bacteria 4555
212 Ga0207657_10134734 3300025919 Bacteria 2022
213 Ga0207649_10026917 3300025920 Bacteria 3369
214 Ga0207681_10022277 3300025923 Bacteria 4039
215 Ga0207681_10070592 3300025923 Bacteria 2433
216 Ga0207694_10001114 3300025924 Bacteria 23252
217 Ga0207694_10189850 3300025924 Bacteria 1669
218 Ga0207650_10000003 3300025925 Bacteria 1123235
219 Ga0207650_10004390 3300025925 Bacteria 9637
220 Ga0207644_10004443 3300025931 Bacteria 9107
221 Ga0207690_10084366 3300025932 Bacteria 2226
222 Ga0207690_10191480 3300025932 Bacteria 1547
223 Ga0207690_10819946 3300025932 Bacteria 769
224 Ga0207706_10336169 3300025933 Bacteria 1314
225 Ga0207686_10187296 3300025934 Bacteria 1472
226 Ga0207709_10112420 3300025935 Bacteria 1824
227 Ga0207711_10000472 3300025941 Bacteria 41502
228 Ga0207679_10019205 3300025945 Bacteria 4589
229 Ga0207679_10248449 3300025945 Bacteria 1511
230 Ga0207679_10267272 3300025945 Bacteria 1461
231 Ga0207667_10000078 3300025949 Bacteria 165061
232 Ga0207667_10023739 3300025949 Bacteria 6750
233 Ga0207667_10041450 3300025949 Bacteria 4896
234 Ga0207667_10217165 3300025949 Bacteria 1959
235 Ga0207667_10297414 3300025949 Bacteria 1649
236 Ga0207712_10135816 3300025961 Bacteria 1881
237 Ga0207668_10007151 3300025972 Bacteria 6628
238 Ga0207668_10118956 3300025972 Bacteria 1997
239 Ga0207640_10055935 3300025981 Bacteria 2587
240 Ga0207658_10000012 3300025986 Bacteria 224402
241 Ga0207703_10130918 3300026035 Bacteria 2166
242 Ga0207678_10312327 3300026067 Bacteria 1351
243 Ga0207678_10912544 3300026067 Bacteria 777
244 Ga0207702_10478919 3300026078 Bacteria 1211
245 Ga0207702_10885972 3300026078 Bacteria 884
246 Ga0207702_11225745 3300026078 Bacteria 744
247 Ga0207641_10025128 3300026088 Bacteria 4910
248 Ga0207648_10076849 3300026089 Bacteria 2911
249 Ga0207676_10000003 3300026095 Bacteria 1123235
250 Ga0207674_10349182 3300026116 Bacteria 1430
251 Ga0207674_10350919 3300026116 Bacteria 1426
252 Ga0207698_10158976 3300026142 Bacteria 1973
253 Ga0209282_1000001 3300027666 Bacteria 2450367
254 Ga0268266_10032903 3300028379 Bacteria 4406
255 Ga0268265_10002832 3300028380 Bacteria 12751
256 Ga0268265_10048589 3300028380 Bacteria 3186
257 Ga0268264_10000009 3300028381 Bacteria 724972
258 Ga0268264_10099773 3300028381 Bacteria 2520
259 Ga0307511_10008326 3300030521 Bacteria 10380
260 Ga0316180_1021737 3300030736 Bacteria 2639
261 Ga0316183_1190372 3300030742 Bacteria 979
262 Ga0265331_10064063 3300031250 Bacteria 1731
263 Ga0265327_10090693 3300031251 Bacteria 1491
264 Ga0265327_10165282 3300031251 Bacteria 1020
265 Ga0307509_10270648 3300031507 Bacteria 1467
266 Ga0307408_100000239 3300031548 Bacteria 57570
267 Ga0307408_100224828 3300031548 Bacteria 1533
268 Ga0307416_100005633 3300032002 Bacteria 7726
269 Ga0307414_10788244 3300032004 Bacteria 866
270 Ga0316583_10009603 3300032133 Bacteria 3485
271 Ga0373931_0114275 3300035691 Bacteria 1535
272 Ga0395899_0000128 3300037312 Bacteria 119014
273 Ga0395899_0000753 3300037312 Bacteria 32064
274 Ga0395899_0006694 3300037312 Bacteria 8931
275 Ga0395899_0010304 3300037312 Bacteria 7167
276 Ga0395899_0010704 3300037312 Bacteria 7031
277 Ga0395899_0012339 3300037312 Bacteria 6544
278 Ga0395899_0013728 3300037312 Bacteria 6193
279 Ga0395899_0055314 3300037312 Bacteria 2935
280 Ga0395899_0293240 3300037312 Bacteria 1103
281 Ga0395900_0000123 3300037418 Bacteria 133326
282 Ga0395900_0007904 3300037418 Bacteria 10955
283 Ga0395900_0008621 3300037418 Bacteria 10478
284 Ga0395900_0009260 3300037418 Bacteria 10096
285 Ga0395900_0010088 3300037418 Bacteria 9661
286 Ga0395900_0021826 3300037418 Bacteria 6546
287 Ga0395900_0035310 3300037418 Bacteria 5149
288 Ga0395900_0073035 3300037418 Bacteria 3526
289 Ga0395900_0116934 3300037418 Bacteria 2736
290 Ga0395900_0140769 3300037418 Bacteria 2470
291 Ga0395900_0209971 3300037418 Bacteria 1966
292 Ga0395900_0287131 3300037418 Bacteria 1635
293 Ga0395900_0323735 3300037418 Bacteria 1521
294 Ga0395900_0328620 3300037418 Bacteria 1507
295 Ga0395898_0004536 3300037466 Bacteria 15161
296 Ga0395898_0075038 3300037466 Bacteria 3266
297 Ga0395898_0109879 3300037466 Bacteria 2643
298 Ga0395898_0125841 3300037466 Bacteria 2455
299 Ga0395898_0257386 3300037466 Bacteria 1664
300 Ga0395898_0383923 3300037466 Bacteria 1339
301 Ga0395898_0517499 3300037466 Bacteria 1134
302 Ga0395898_0628288 3300037466 Bacteria 1016
303 Ga0395905_0000905 3300037471 Bacteria 38512
304 Ga0395905_0001709 3300037471 Bacteria 25795
305 Ga0395905_0012941 3300037471 Bacteria 8020
306 Ga0395905_0013998 3300037471 Bacteria 7674
307 Ga0395905_0020397 3300037471 Bacteria 6279
308 Ga0395905_0042482 3300037471 Bacteria 4267
309 Ga0395905_0078281 3300037471 Bacteria 3098
310 Ga0395905_0099213 3300037471 Bacteria 2735
311 Ga0395905_0128099 3300037471 Bacteria 2387
312 Ga0395905_0152274 3300037471 Bacteria 2175
313 Ga0395905_0310643 3300037471 Bacteria 1465
314 Ga0395905_0380827 3300037471 Bacteria 1305
315 Ga0395905_0392670 3300037471 Bacteria 1282
316 Ga0395905_0503627 3300037471 Bacteria 1111
317 Ga0395905_0623628 3300037471 Bacteria 980
318 Ga0395901_0000411 3300038443 Bacteria 50643
319 Ga0395901_0001908 3300038443 Bacteria 21493
320 Ga0395901_0021000 3300038443 Bacteria 6689
321 Ga0395901_0023907 3300038443 Bacteria 6267
322 Ga0395901_0278987 3300038443 Bacteria 1737
323 Ga0395901_0346430 3300038443 Bacteria 1534
324 Ga0395901_0355927 3300038443 Bacteria 1510
325 Ga0395901_0504377 3300038443 Bacteria 1231
326 Ga0395901_0796251 3300038443 Bacteria 934
327 Ga0436365_1765823 3300039437 Bacteria 5366
328 Ga0436361_0014452 3300039447 Bacteria 4411
329 Ga0436361_0032641 3300039447 Bacteria 1118
330 Ga0436361_0149158 3300039447 Bacteria 4068
331 Ga0436361_0161443 3300039447 Bacteria 5435
332 Ga0436361_0275924 3300039447 Bacteria 2979
333 Ga0436361_0458162 3300039447 Bacteria 1237
334 Ga0436361_0568983 3300039447 Bacteria 33450
335 Ga0436361_0632651 3300039447 Bacteria 49929
336 Ga0436361_0746087 3300039447 Bacteria 1617
337 Ga0436361_0830100 3300039447 Bacteria 16365
338 Ga0436361_0938544 3300039447 Bacteria 31788
339 Ga0436361_0973589 3300039447 Bacteria 2003
340 Ga0436361_1043948 3300039447 Bacteria 4310
341 Ga0436362_0115419 3300039453 Bacteria 1304
342 Ga0439448_0010043 3300042005 Bacteria 2797
343 Ga0439448_0123959 3300042005 Bacteria 888
344 Ga0439449_0013722 3300042007 Bacteria 3049
345 Ga0439450_010428 3300042008 Bacteria 1792
346 Ga0439450_018780 3300042008 Bacteria 1456
347 Ga0439455_0106565 3300042012 Bacteria 777
348 Ga0450897_013149 3300042128 Bacteria 823
349 Ga0450904_000276 3300042139 Bacteria 11138
350 Ga0439458_0022881 3300042157 Bacteria 1454
351 Ga0451577_0625920 3300042876 Bacteria 976
352 Ga0466969_0038118 3300044656 Bacteria 2420
353 Ga0466969_0080543 3300044656 Bacteria 1555
354 Ga0466972_0000087 3300044658 Bacteria 84646
355 Ga0466972_0001100 3300044658 Bacteria 12928
356 Ga0466972_0006991 3300044658 Bacteria 5660
357 Ga0466972_0097290 3300044658 Bacteria 1394
358 Ga0466965_0002700 3300044683 Bacteria 7599
359 Ga0466965_0010006 3300044683 Bacteria 4412
360 Ga0466965_0011686 3300044683 Bacteria 4118
361 Ga0466965_0065720 3300044683 Bacteria 1817
362 Ga0466965_0107579 3300044683 Bacteria 1431
363 Ga0466966_0011821 3300044684 Bacteria 5780
364 Ga0466966_0013678 3300044684 Bacteria 5369
365 Ga0466966_0068924 3300044684 Bacteria 2219
366 Ga0466966_0082220 3300044684 Bacteria 2004
367 Ga0466961_0159699 3300044693 Bacteria 1405
368 Ga0466964_0000256 3300044706 Bacteria 15366
369 Ga0466964_0199537 3300044706 Bacteria 960
370 Ga0466964_0206904 3300044706 Bacteria 945
371 Ga0453684_0000102 3300044712 Bacteria 366870
372 Ga0466971_0017407 3300044719 Bacteria 3179
373 Ga0466968_0001835 3300044735 Bacteria 7668
374 Ga0466968_0037123 3300044735 Bacteria 2043
375 Ga0466968_0117279 3300044735 Bacteria 1202
376 Ga0466970_0016339 3300044765 Bacteria 3824
377 Ga0466957_0009721 3300044842 Bacteria 5492
378 Ga0466959_0009557 3300045049 Bacteria 6899
379 Ga0466959_0011644 3300045049 Bacteria 6325
380 Ga0466959_0052704 3300045049 Bacteria 2978
381 Ga0466959_0054139 3300045049 Bacteria 2932
382 Ga0466959_0586236 3300045049 Bacteria 750
383 Ga0451576_0000171 3300045051 Bacteria 162452
384 Ga0451576_0000386 3300045051 Bacteria 102813
385 Ga0451576_0080204 3300045051 Bacteria 3396
386 Ga0451576_0724582 3300045051 Bacteria 1045
387 Ga0466958_0275718 3300045836 Bacteria 1077
388 Ga0466958_0396809 3300045836 Bacteria 890
389 Ga0466967_0005324 3300045976 Bacteria 8891
390 Ga0495617_000034 3300046452 Bacteria 147232
391 Ga0495617_002482 3300046452 Bacteria 7321
392 Ga0495617_002980 3300046452 Bacteria 6473
393 Ga0495617_008361 3300046452 Bacteria 3570
394 Ga0495627_000876 3300046453 Bacteria 21280
395 Ga0495627_024085 3300046453 Bacteria 1987
396 Ga0495592_0003280 3300046454 Bacteria 11595
397 Ga0495592_0405274 3300046454 Bacteria 863
398 Ga0495603_0033409 3300046455 Bacteria 3096
399 Ga0495603_0044124 3300046455 Bacteria 2660
400 Ga0495590_0000027 3300046457 Bacteria 158323
401 Ga0495590_0000257 3300046457 Bacteria 28989
402 Ga0495590_0006267 3300046457 Bacteria 4656
403 Ga0495590_0028084 3300046457 Bacteria 1973
404 Ga0495590_0033182 3300046457 Bacteria 1805
405 Ga0495590_0067583 3300046457 Bacteria 1252
406 Ga0495590_0085440 3300046457 Bacteria 1113
407 Ga0495591_000272 3300046458 Bacteria 48725
408 Ga0495629_0014017 3300046459 Bacteria 5777
409 Ga0495638_0000098 3300046460 Bacteria 140656
410 Ga0495638_0045252 3300046460 Bacteria 2769
411 Ga0495638_0050498 3300046460 Bacteria 2597
412 Ga0495651_0015119 3300046462 Bacteria 5965
413 Ga0495651_0058856 3300046462 Bacteria 2947
414 Ga0495653_0002089 3300046463 Bacteria 15731
415 Ga0495653_0144561 3300046463 Bacteria 1668
416 Ga0495653_0169254 3300046463 Bacteria 1509
417 Ga0495650_0000011 3300046471 Bacteria 615329
418 Ga0495650_0002150 3300046471 Bacteria 16729
419 Ga0495580_0030809 3300046472 Bacteria 3880
420 Ga0495580_0445460 3300046472 Bacteria 869
421 Ga0495582_0004649 3300046473 Bacteria 7718
422 Ga0495582_0017936 3300046473 Bacteria 3869
423 Ga0495582_0114750 3300046473 Bacteria 1514
424 Ga0495605_0000029 3300046474 Bacteria 215329
425 Ga0495605_0000042 3300046474 Bacteria 185225
426 Ga0495605_0000151 3300046474 Bacteria 89442
427 Ga0495605_0006348 3300046474 Bacteria 6815
428 Ga0495605_0007689 3300046474 Bacteria 6109
429 Ga0495605_0010229 3300046474 Bacteria 5252
430 Ga0495605_0024677 3300046474 Bacteria 3142
431 Ga0495605_0035098 3300046474 Bacteria 2536
432 Ga0495605_0044828 3300046474 Bacteria 2183
433 Ga0495605_0132566 3300046474 Bacteria 1123
434 Ga0495639_0309380 3300046475 Bacteria 789
435 Ga0495584_0000007 3300046491 Bacteria 294820
436 Ga0495584_0000122 3300046491 Bacteria 53611
437 Ga0495584_0000506 3300046491 Bacteria 26745
438 Ga0495584_0002007 3300046491 Bacteria 11695
439 Ga0495584_0002049 3300046491 Bacteria 11580
440 Ga0495584_0003276 3300046491 Bacteria 8969
441 Ga0495584_0005376 3300046491 Bacteria 6790
442 Ga0495584_0005715 3300046491 Bacteria 6566
443 Ga0495584_0006099 3300046491 Bacteria 6343
444 Ga0495584_0010896 3300046491 Bacteria 4667
445 Ga0495584_0021540 3300046491 Bacteria 3273
446 Ga0495584_0069350 3300046491 Bacteria 1771
447 Ga0495584_0110508 3300046491 Bacteria 1390
448 Ga0495584_0163756 3300046491 Bacteria 1130
449 Ga0495584_0173545 3300046491 Bacteria 1096
450 Ga0495584_0204880 3300046491 Bacteria 1002
451 Ga0495585_0000115 3300046492 Bacteria 86460
452 Ga0495585_0000421 3300046492 Bacteria 40862
453 Ga0495585_0002934 3300046492 Bacteria 11799
454 Ga0495585_0003505 3300046492 Bacteria 10583
455 Ga0495585_0010560 3300046492 Bacteria 5494
456 Ga0495585_0017306 3300046492 Bacteria 4166
457 Ga0495585_0018451 3300046492 Bacteria 4022
458 Ga0495585_0020952 3300046492 Bacteria 3756
459 Ga0495585_0024454 3300046492 Bacteria 3463
460 Ga0495585_0029130 3300046492 Bacteria 3144
461 Ga0495585_0040655 3300046492 Bacteria 2610
462 Ga0495585_0062272 3300046492 Bacteria 2049
463 Ga0495585_0098278 3300046492 Bacteria 1568
464 Ga0495585_0107344 3300046492 Bacteria 1487
465 Ga0495594_0003496 3300046499 Bacteria 8092
466 Ga0495594_0010511 3300046499 Bacteria 4800
467 Ga0495594_0010807 3300046499 Bacteria 4742
468 Ga0495594_0013150 3300046499 Bacteria 4316
469 Ga0495594_0028672 3300046499 Bacteria 3005
470 Ga0495596_0000474 3300046500 Bacteria 25448
471 Ga0495596_0000530 3300046500 Bacteria 23944
472 Ga0495596_0002008 3300046500 Bacteria 11201
473 Ga0495596_0002300 3300046500 Bacteria 10378
474 Ga0495596_0004690 3300046500 Bacteria 6612
475 Ga0495596_0014436 3300046500 Bacteria 3329
476 Ga0495596_0019973 3300046500 Bacteria 2745
477 Ga0495596_0028741 3300046500 Bacteria 2230
478 Ga0495607_0001671 3300046501 Bacteria 19192
479 Ga0495607_0001966 3300046501 Bacteria 17334
480 Ga0495607_0002476 3300046501 Bacteria 14990
481 Ga0495607_0002735 3300046501 Bacteria 14072
482 Ga0495607_0004292 3300046501 Bacteria 10526
483 Ga0495607_0017561 3300046501 Bacteria 4588
484 Ga0495607_0020165 3300046501 Bacteria 4219
485 Ga0495607_0025435 3300046501 Bacteria 3681
486 Ga0495607_0028377 3300046501 Bacteria 3453
487 Ga0495607_0051721 3300046501 Bacteria 2384
488 Ga0495607_0071761 3300046501 Bacteria 1930
489 Ga0495607_0077910 3300046501 Bacteria 1830
490 Ga0495607_0083439 3300046501 Bacteria 1750
491 Ga0495607_0225317 3300046501 Bacteria 914
492 Ga0495583_0000348 3300046506 Bacteria 73050
493 Ga0495583_0000472 3300046506 Bacteria 58906
494 Ga0495583_0000569 3300046506 Bacteria 50860
495 Ga0495583_0001444 3300046506 Bacteria 24128
496 Ga0495583_0015121 3300046506 Bacteria 4212
497 Ga0495583_0033337 3300046506 Bacteria 2477
498 Ga0495583_0034886 3300046506 Bacteria 2406
499 Ga0495583_0049226 3300046506 Bacteria 1931
500 Ga0495583_0110774 3300046506 Bacteria 1163
501 Ga0495583_0194134 3300046506 Bacteria 827
502 Ga0495606_0000084 3300046507 Bacteria 158428
503 Ga0495606_0000652 3300046507 Bacteria 54651
504 Ga0495606_0000787 3300046507 Bacteria 48504
505 Ga0495606_0001481 3300046507 Bacteria 31269
506 Ga0495606_0012677 3300046507 Bacteria 6729
507 Ga0495606_0021021 3300046507 Bacteria 4791
508 Ga0495606_0029545 3300046507 Bacteria 3845
509 Ga0495606_0031347 3300046507 Bacteria 3698
510 Ga0495606_0034767 3300046507 Bacteria 3455
511 Ga0495606_0039821 3300046507 Bacteria 3161
512 Ga0495606_0047069 3300046507 Bacteria 2846
513 Ga0495606_0106051 3300046507 Bacteria 1702
514 Ga0495606_0349720 3300046507 Bacteria 785
515 Ga0495608_0001512 3300046511 Bacteria 16556
516 Ga0495608_0013677 3300046511 Bacteria 5631
517 Ga0495610_0000473 3300046512 Bacteria 41477
518 Ga0495610_0148582 3300046512 Bacteria 1002
519 Ga0495616_0001479 3300046513 Bacteria 16296
520 Ga0495616_0001547 3300046513 Bacteria 15843
521 Ga0495616_0004099 3300046513 Bacteria 9242
522 Ga0495616_0007026 3300046513 Bacteria 6773
523 Ga0495616_0008239 3300046513 Bacteria 6186
524 Ga0495616_0010806 3300046513 Bacteria 5262
525 Ga0495616_0010992 3300046513 Bacteria 5207
526 Ga0495616_0021408 3300046513 Bacteria 3501
527 Ga0495616_0025599 3300046513 Bacteria 3150
528 Ga0495616_0030670 3300046513 Bacteria 2822
529 Ga0495616_0033463 3300046513 Bacteria 2677
530 Ga0495616_0042972 3300046513 Bacteria 2297
531 Ga0495616_0044363 3300046513 Bacteria 2255
532 Ga0495616_0057484 3300046513 Bacteria 1918
533 Ga0495616_0094410 3300046513 Bacteria 1411
534 Ga0495620_0003439 3300046515 Bacteria 9059
535 Ga0495628_0004339 3300046516 Bacteria 12585
536 Ga0495628_0018273 3300046516 Bacteria 5812
537 Ga0495628_0305552 3300046516 Bacteria 1177
538 Ga0495630_0009137 3300046517 Bacteria 7128
539 Ga0495630_0332897 3300046517 Bacteria 1161
540 Ga0495631_0000550 3300046518 Bacteria 25263
541 Ga0495631_0000810 3300046518 Bacteria 19974
542 Ga0495631_0001888 3300046518 Bacteria 12341
543 Ga0495631_0002771 3300046518 Bacteria 9721
544 Ga0495631_0005099 3300046518 Bacteria 6919
545 Ga0495631_0006258 3300046518 Bacteria 6165
546 Ga0495631_0015840 3300046518 Bacteria 3603
547 Ga0495631_0017560 3300046518 Bacteria 3381
548 Ga0495631_0272480 3300046518 Bacteria 721
549 Ga0495632_0000852 3300046519 Bacteria 26846
550 Ga0495632_0000903 3300046519 Bacteria 26010
551 Ga0495632_0001985 3300046519 Bacteria 16245
552 Ga0495632_0007957 3300046519 Bacteria 6584
553 Ga0495632_0042567 3300046519 Bacteria 2275
554 Ga0495637_0000013 3300046520 Bacteria 244837
555 Ga0495637_0008688 3300046520 Bacteria 4983
556 Ga0495637_0021577 3300046520 Bacteria 2951
557 Ga0495643_0000200 3300046522 Bacteria 93353
558 Ga0495643_0000551 3300046522 Bacteria 46367
559 Ga0495643_0002412 3300046522 Bacteria 14864
560 Ga0495643_0004464 3300046522 Bacteria 9775
561 Ga0495643_0012215 3300046522 Bacteria 5187
562 Ga0495643_0024119 3300046522 Bacteria 3453
563 Ga0495643_0025001 3300046522 Bacteria 3383
564 Ga0495643_0071122 3300046522 Bacteria 1826
565 Ga0495643_0072128 3300046522 Bacteria 1811
566 Ga0495644_0002518 3300046523 Bacteria 7308
567 Ga0495644_0004268 3300046523 Bacteria 5613
568 Ga0495644_0004891 3300046523 Bacteria 5258
569 Ga0495644_0005339 3300046523 Bacteria 5017
570 Ga0495644_0011582 3300046523 Bacteria 3394
571 Ga0495644_0015732 3300046523 Bacteria 2899
572 Ga0495644_0017413 3300046523 Bacteria 2747
573 Ga0495644_0020348 3300046523 Bacteria 2533
574 Ga0495644_0036772 3300046523 Bacteria 1847
575 Ga0495648_0000112 3300046524 Bacteria 99859
576 Ga0495648_0000169 3300046524 Bacteria 75523
577 Ga0495648_0001096 3300046524 Bacteria 27557
578 Ga0495648_0002536 3300046524 Bacteria 16749
579 Ga0495648_0007990 3300046524 Bacteria 8391
580 Ga0495648_0009310 3300046524 Bacteria 7632
581 Ga0495648_0027171 3300046524 Bacteria 3836
582 Ga0495648_0034097 3300046524 Bacteria 3318
583 Ga0495648_0051763 3300046524 Bacteria 2499
584 Ga0495648_0054917 3300046524 Bacteria 2403
585 Ga0495648_0177240 3300046524 Bacteria 1087
586 Ga0495648_0313657 3300046524 Bacteria 730
587 Ga0495663_0004796 3300046525 Bacteria 3781
588 Ga0495663_0032141 3300046525 Bacteria 1562
589 Ga0495666_0015313 3300046526 Bacteria 3818
590 Ga0495666_0049841 3300046526 Bacteria 2014
591 Ga0495642_0000050 3300046528 Bacteria 71246
592 Ga0495642_0001068 3300046528 Bacteria 12668
593 Ga0495642_0001340 3300046528 Bacteria 11027
594 Ga0495642_0001809 3300046528 Bacteria 9172
595 Ga0495642_0003687 3300046528 Bacteria 6013
596 Ga0495642_0004398 3300046528 Bacteria 5471
597 Ga0495642_0008082 3300046528 Bacteria 4025
598 Ga0495642_0021157 3300046528 Bacteria 2557
599 Ga0495642_0029202 3300046528 Bacteria 2200
600 Ga0495642_0056547 3300046528 Bacteria 1620
601 Ga0495642_0134247 3300046528 Bacteria 1066
602 Ga0495642_0186853 3300046528 Bacteria 902
603 Ga0495652_0005056 3300046529 Bacteria 12485
604 Ga0495652_0016097 3300046529 Bacteria 6689
605 Ga0495652_0019388 3300046529 Bacteria 6058
606 Ga0495652_0049462 3300046529 Bacteria 3598
607 Ga0495654_0004305 3300046530 Bacteria 8491
608 Ga0495654_0006380 3300046530 Bacteria 6706
609 Ga0495654_0008593 3300046530 Bacteria 5628
610 Ga0495654_0010005 3300046530 Bacteria 5180
611 Ga0495654_0044679 3300046530 Bacteria 2190
612 Ga0495665_0005554 3300046531 Bacteria 6794
613 Ga0495665_0035779 3300046531 Bacteria 2651
614 Ga0495665_0102901 3300046531 Bacteria 1498
615 Ga0495665_0103170 3300046531 Bacteria 1496
616 Ga0495586_0018982 3300046535 Bacteria 3659
617 Ga0495586_0019447 3300046535 Bacteria 3615
618 Ga0495587_0008756 3300046536 Bacteria 6490
619 Ga0495609_0000022 3300046538 Bacteria 279488
620 Ga0495609_0000163 3300046538 Bacteria 69578
621 Ga0495609_0001355 3300046538 Bacteria 16522
622 Ga0495609_0002267 3300046538 Bacteria 12004
623 Ga0495609_0003271 3300046538 Bacteria 9357
624 Ga0495609_0026941 3300046538 Bacteria 2628
625 Ga0495609_0031532 3300046538 Bacteria 2408
626 Ga0495609_0047144 3300046538 Bacteria 1928
627 Ga0495609_0080225 3300046538 Bacteria 1427
628 Ga0495597_0000064 3300046542 Bacteria 91446
629 Ga0495597_0000266 3300046542 Bacteria 47830
630 Ga0495597_0000566 3300046542 Bacteria 30712
631 Ga0495597_0001407 3300046542 Bacteria 17367
632 Ga0495597_0002770 3300046542 Bacteria 10797
633 Ga0495597_0006826 3300046542 Bacteria 5864
634 Ga0495597_0006959 3300046542 Bacteria 5796
635 Ga0495597_0013020 3300046542 Bacteria 3994
636 Ga0495597_0074237 3300046542 Bacteria 1460
637 Ga0495597_0240246 3300046542 Bacteria 714
638 Ga0495645_0042584 3300046543 Bacteria 3311
639 Ga0495645_0073481 3300046543 Bacteria 2463
640 Ga0495622_0000311 3300046557 Bacteria 36067
641 Ga0495622_0000707 3300046557 Bacteria 18899
642 Ga0495622_0007277 3300046557 Bacteria 5138
643 Ga0495622_0039180 3300046557 Bacteria 2207
644 Ga0495622_0039684 3300046557 Bacteria 2192
645 Ga0495622_0085890 3300046557 Bacteria 1447
646 Ga0495622_0228631 3300046557 Bacteria 822
647 Ga0495633_0001165 3300046558 Bacteria 21122
648 Ga0495633_0001850 3300046558 Bacteria 15548
649 Ga0495633_0010505 3300046558 Bacteria 5046
650 Ga0495633_0016664 3300046558 Bacteria 3781
651 Ga0495633_0018317 3300046558 Bacteria 3558
652 Ga0495633_0020708 3300046558 Bacteria 3302
653 Ga0495633_0024214 3300046558 Bacteria 3001
654 Ga0495633_0047924 3300046558 Bacteria 2018
655 Ga0495633_0086336 3300046558 Bacteria 1459
656 Ga0495633_0123951 3300046558 Bacteria 1196
657 Ga0495633_0230476 3300046558 Bacteria 847
658 Ga0495656_0001658 3300046615 Bacteria 7274
659 Ga0495656_0002958 3300046615 Bacteria 5701
660 Ga0495656_0006533 3300046615 Bacteria 4094
661 Ga0495656_0026222 3300046615 Bacteria 2318
662 Ga0495656_0100038 3300046615 Bacteria 1340
663 Ga0495656_0119591 3300046615 Bacteria 1242
664 Ga0495668_0001322 3300046616 Bacteria 24393
665 Ga0495668_0001809 3300046616 Bacteria 19467
666 Ga0495668_0002020 3300046616 Bacteria 17709
667 Ga0495668_0006891 3300046616 Bacteria 7361
668 Ga0495668_0011176 3300046616 Bacteria 5388
669 Ga0495668_0013456 3300046616 Bacteria 4823
670 Ga0495668_0029492 3300046616 Bacteria 3099
671 Ga0495668_0057478 3300046616 Bacteria 2146
672 Ga0495668_0061174 3300046616 Bacteria 2077
673 Ga0495668_0093914 3300046616 Bacteria 1642
674 Ga0495668_0395699 3300046616 Bacteria 759
675 Ga0495634_0015301 3300046642 Bacteria 5515
676 Ga0495611_0000515 3300046648 Bacteria 22974
677 Ga0495611_0003505 3300046648 Bacteria 6905
678 Ga0495611_0003835 3300046648 Bacteria 6556
679 Ga0495611_0007685 3300046648 Bacteria 4578
680 Ga0495611_0009941 3300046648 Bacteria 4027
681 Ga0495611_0010893 3300046648 Bacteria 3851
682 Ga0495611_0015786 3300046648 Bacteria 3227
683 Ga0495611_0016265 3300046648 Bacteria 3180
684 Ga0495611_0055477 3300046648 Bacteria 1792
685 Ga0495611_0056545 3300046648 Bacteria 1776
686 Ga0495611_0098122 3300046648 Bacteria 1358
687 Ga0495625_0000810 3300046660 Bacteria 43340
688 Ga0495625_0002543 3300046660 Bacteria 19615
689 Ga0495625_0005310 3300046660 Bacteria 11801
690 Ga0495625_0011709 3300046660 Bacteria 7131
691 Ga0495625_0013813 3300046660 Bacteria 6471
692 Ga0495625_0020304 3300046660 Bacteria 5131
693 Ga0495625_0061488 3300046660 Bacteria 2657
694 Ga0495625_0203186 3300046660 Bacteria 1306
695 Ga0495659_0000019 3300046664 Bacteria 74610
696 Ga0495659_0000167 3300046664 Bacteria 29514
697 Ga0495659_0001683 3300046664 Bacteria 7409
698 Ga0495659_0009447 3300046664 Bacteria 3112
699 Ga0495659_0020073 3300046664 Bacteria 2241
700 Ga0495661_0000151 3300046665 Bacteria 81275
701 Ga0495661_0000590 3300046665 Bacteria 37515
702 Ga0495661_0003517 3300046665 Bacteria 11544
703 Ga0495661_0007238 3300046665 Bacteria 7740
704 Ga0495661_0007385 3300046665 Bacteria 7657
705 Ga0495661_0012488 3300046665 Bacteria 5736
706 Ga0495661_0020506 3300046665 Bacteria 4313
707 Ga0495661_0023945 3300046665 Bacteria 3957
708 Ga0495661_0028727 3300046665 Bacteria 3556
709 Ga0495661_0039994 3300046665 Bacteria 2910
710 Ga0495661_0043396 3300046665 Bacteria 2764
711 Ga0495661_0047504 3300046665 Bacteria 2613
712 Ga0495661_0063816 3300046665 Bacteria 2176
713 Ga0495661_0165231 3300046665 Bacteria 1185
714 Ga0495661_0166458 3300046665 Bacteria 1179
715 Ga0495661_0213394 3300046665 Bacteria 1003
716 Ga0495661_0255821 3300046665 Bacteria 892
717 Ga0495588_0000086 3300046674 Bacteria 193241
718 Ga0495588_0011973 3300046674 Bacteria 4085
719 Ga0495588_0014347 3300046674 Bacteria 3791
720 Ga0495588_0017075 3300046674 Bacteria 3518
721 Ga0495588_0032962 3300046674 Bacteria 2613
722 Ga0495588_0034728 3300046674 Bacteria 2552
723 Ga0495588_0058010 3300046674 Bacteria 2001
724 Ga0495588_0116559 3300046674 Bacteria 1407
725 Ga0495657_0058805 3300046675 Bacteria 2551
726 Ga0495599_0003514 3300046678 Bacteria 9176
727 Ga0495623_0008207 3300046679 Bacteria 6793
728 Ga0495623_0011302 3300046679 Bacteria 5776
729 Ga0495623_0035632 3300046679 Bacteria 3189
730 Ga0495623_0041958 3300046679 Bacteria 2916
731 Ga0495623_0048369 3300046679 Bacteria 2697
732 Ga0495646_0001555 3300046680 Bacteria 13656
733 Ga0495669_0000018 3300046684 Bacteria 127866
734 Ga0495669_0026346 3300046684 Bacteria 2540
735 Ga0495669_0093968 3300046684 Bacteria 1387
736 Ga0495613_0089487 3300046689 Bacteria 2230
737 Ga0495624_0033919 3300046690 Bacteria 3305
738 Ga0495624_0036132 3300046690 Bacteria 3187
739 Ga0495624_0292209 3300046690 Bacteria 983
740 Ga0495670_0000143 3300046691 Bacteria 31142
741 Ga0495670_0001120 3300046691 Bacteria 12994
742 Ga0495670_0010421 3300046691 Bacteria 4566
743 Ga0495670_0013539 3300046691 Bacteria 4011
744 Ga0495670_0035185 3300046691 Bacteria 2495
745 Ga0495670_0079714 3300046691 Bacteria 1667
746 Ga0495670_0081229 3300046691 Bacteria 1651
747 Ga0495670_0247697 3300046691 Bacteria 949
748 Ga0495671_0000658 3300046692 Bacteria 25041
749 Ga0495671_0001049 3300046692 Bacteria 19213
750 Ga0495671_0019545 3300046692 Bacteria 3578
751 Ga0495671_0031072 3300046692 Bacteria 2731
752 Ga0495671_0127303 3300046692 Bacteria 1242
753 Ga0495671_0154071 3300046692 Bacteria 1118
754 Ga0495649_0003442 3300046694 Bacteria 10671
755 Ga0495649_0009418 3300046694 Bacteria 5808
756 Ga0495649_0015222 3300046694 Bacteria 4379
757 Ga0495649_0027732 3300046694 Bacteria 3141
758 Ga0495649_0048732 3300046694 Bacteria 2302
759 Ga0495589_0000017 3300046794 Bacteria 206113
760 Ga0495589_0000513 3300046794 Bacteria 27274
761 Ga0495589_0001742 3300046794 Bacteria 12371
762 Ga0495589_0004248 3300046794 Bacteria 7661
763 Ga0495589_0011131 3300046794 Bacteria 4668
764 Ga0495589_0013061 3300046794 Bacteria 4289
765 Ga0495589_0020691 3300046794 Bacteria 3364
766 Ga0495589_0022368 3300046794 Bacteria 3226
767 Ga0495589_0043009 3300046794 Bacteria 2250
768 Ga0495589_0082237 3300046794 Bacteria 1566
769 Ga0495600_0000834 3300046809 Bacteria 16422
770 Ga0495600_0006403 3300046809 Bacteria 7166
771 Ga0495600_0131479 3300046809 Bacteria 1627
772 Ga0495660_0000067 3300046810 Bacteria 119390
773 Ga0495660_0002349 3300046810 Bacteria 12097
774 Ga0495660_0004163 3300046810 Bacteria 8799
775 Ga0495660_0007858 3300046810 Bacteria 6263
776 Ga0495660_0014127 3300046810 Bacteria 4624
777 Ga0495660_0047272 3300046810 Bacteria 2357
778 Ga0495660_0059026 3300046810 Bacteria 2064
779 Ga0495660_0063365 3300046810 Bacteria 1980
780 Ga0495660_0128657 3300046810 Bacteria 1272
781 Ga0495660_0166579 3300046810 Bacteria 1076
782 Ga0495581_0009510 3300047315 Bacteria 5625
783 Ga0495581_0018889 3300047315 Bacteria 4001
784 Ga0495581_0055668 3300047315 Bacteria 2282
785 Ga0495604_0004591 3300047317 Bacteria 10939
786 Ga0495604_0034285 3300047317 Bacteria 4016
787 Ga0495604_0246697 3300047317 Bacteria 1219
788 Ga0495604_0437459 3300047317 Bacteria 856
789 Ga0495636_0000388 3300047318 Bacteria 16592
790 Ga0495636_0003301 3300047318 Bacteria 6250
791 Ga0495636_0004667 3300047318 Bacteria 5374
792 Ga0495636_0009037 3300047318 Bacteria 3918
793 Ga0495636_0023781 3300047318 Bacteria 2482
794 Ga0495636_0061353 3300047318 Bacteria 1590
795 Ga0495636_0135464 3300047318 Bacteria 1097
796 Ga0495674_0221331 3300047319 Bacteria 1564
797 Ga0495672_0000067 3300047320 Bacteria 190335
798 Ga0495672_0000343 3300047320 Bacteria 59629
799 Ga0495672_0000718 3300047320 Bacteria 36426
800 Ga0495672_0001478 3300047320 Bacteria 23059
801 Ga0495672_0003293 3300047320 Bacteria 13969
802 Ga0495672_0004198 3300047320 Bacteria 11934
803 Ga0495672_0034084 3300047320 Bacteria 3149
804 Ga0495672_0052482 3300047320 Bacteria 2394
805 Ga0495672_0128740 3300047320 Bacteria 1334
806 Ga0495676_0000067 3300047321 Bacteria 80084
807 Ga0495676_0028953 3300047321 Bacteria 4722
808 Ga0495676_0461324 3300047321 Bacteria 837
809 Ga0495683_0000083 3300047323 Bacteria 93743
810 Ga0495683_0000348 3300047323 Bacteria 38313
811 Ga0495683_0002803 3300047323 Bacteria 10339
812 Ga0495683_0006314 3300047323 Bacteria 6481
813 Ga0495683_0019894 3300047323 Bacteria 3463
814 Ga0495683_0022607 3300047323 Bacteria 3233
815 Ga0495683_0057907 3300047323 Bacteria 1925
816 Ga0495683_0078187 3300047323 Bacteria 1616
817 Ga0495683_0079896 3300047323 Bacteria 1596
818 Ga0495687_000033 3300047443 Bacteria 263788
819 Ga0495687_000126 3300047443 Bacteria 117879
820 Ga0495687_000252 3300047443 Bacteria 72401
821 Ga0495687_000640 3300047443 Bacteria 40137
822 Ga0495687_008102 3300047443 Bacteria 6070
823 Ga0495687_010751 3300047443 Bacteria 4988
824 Ga0495687_010893 3300047443 Bacteria 4939
825 Ga0495687_022520 3300047443 Bacteria 3022
826 Ga0495675_0003787 3300047444 Bacteria 9148
827 Ga0495675_0030000 3300047444 Bacteria 3470
828 Ga0495675_0088516 3300047444 Bacteria 1944
829 Ga0495677_0000002 3300047445 Bacteria 346767
830 Ga0495677_0005091 3300047445 Bacteria 5003
831 Ga0495677_0008034 3300047445 Bacteria 3920
832 Ga0495677_0008164 3300047445 Bacteria 3888
833 Ga0495677_0014812 3300047445 Bacteria 2836
834 Ga0495677_0021668 3300047445 Bacteria 2329
835 Ga0495677_0032123 3300047445 Bacteria 1911
836 Ga0495677_0044837 3300047445 Bacteria 1621
837 Ga0495677_0051623 3300047445 Bacteria 1514
838 Ga0495677_0098020 3300047445 Bacteria 1108
839 Ga0495677_0128864 3300047445 Bacteria 968
840 Ga0495679_008082 3300047446 Bacteria 4310
841 Ga0495679_008137 3300047446 Bacteria 4292
842 Ga0495679_019799 3300047446 Bacteria 2356
843 Ga0495679_034537 3300047446 Bacteria 1608
844 Ga0495679_074564 3300047446 Bacteria 971
845 Ga0495685_000053 3300047447 Bacteria 45514
846 Ga0495685_000183 3300047447 Bacteria 20748
847 Ga0495685_001317 3300047447 Bacteria 7585
848 Ga0495685_004689 3300047447 Bacteria 4434
849 Ga0495685_016533 3300047447 Bacteria 2521
850 Ga0495673_0000265 3300047469 Bacteria 72840
851 Ga0495681_0000321 3300047470 Bacteria 38154
852 Ga0495681_0007275 3300047470 Bacteria 7112
853 Ga0495681_0016273 3300047470 Bacteria 4176
854 Ga0495681_0030372 3300047470 Bacteria 2752
855 Ga0495681_0032989 3300047470 Bacteria 2599
856 Ga0495681_0046396 3300047470 Bacteria 2072
857 Ga0495686_0000628 3300047472 Bacteria 48588
858 Ga0495686_0033337 3300047472 Bacteria 3326
859 Ga0495686_0040123 3300047472 Bacteria 2987
860 Ga0495686_0091644 3300047472 Bacteria 1844
861 Ga0495686_0129523 3300047472 Bacteria 1497
862 Ga0495686_0181975 3300047472 Bacteria 1217
863 Ga0495593_0054376 3300047673 Bacteria 2110
864 Ga0495602_0024798 3300048088 Bacteria 5814
865 Ga0495602_0104784 3300048088 Bacteria 2313
866 Ga0495602_0159563 3300048088 Bacteria 1762
867 Ga0495614_0001110 3300048089 Bacteria 11534
868 Ga0495614_0018070 3300048089 Bacteria 3056
869 Ga0495615_0001150 3300048090 Bacteria 3817
870 Ga0495615_0029638 3300048090 Bacteria 1300
871 Ga0495626_0000097 3300048091 Bacteria 113925
872 Ga0495626_0000209 3300048091 Bacteria 70145
873 Ga0495626_0000258 3300048091 Bacteria 60668
874 Ga0495626_0003284 3300048091 Bacteria 10440
875 Ga0495626_0007634 3300048091 Bacteria 5998
876 Ga0495626_0011560 3300048091 Bacteria 4666
877 Ga0495626_0016093 3300048091 Bacteria 3809
878 Ga0495626_0018518 3300048091 Bacteria 3495
879 Ga0495626_0021333 3300048091 Bacteria 3214
880 Ga0495626_0026399 3300048091 Bacteria 2831
881 Ga0495626_0044605 3300048091 Bacteria 2073
882 Ga0495626_0049911 3300048091 Bacteria 1935
883 Ga0495626_0059885 3300048091 Bacteria 1736
884 Ga0495626_0145896 3300048091 Bacteria 1000
885 Ga0496100_0052012 3300048903 Bacteria 2661
886 Ga0496100_0159307 3300048903 Bacteria 1617
887 Ga0496101_0044781 3300048904 Bacteria 3167
888 Ga0496101_0092574 3300048904 Bacteria 2251
889 Ga0496102_0000313 3300048905 Bacteria 61085
890 Ga0496102_0000487 3300048905 Bacteria 43875
891 Ga0496102_0055639 3300048905 Bacteria 3607
892 Ga0496102_0420493 3300048905 Bacteria 1255
893 Ga0496103_0091804 3300048906 Bacteria 1916
894 Ga0496103_0231148 3300048906 Bacteria 1189
895 Ga0496103_0422697 3300048906 Bacteria 855
896 Ga0496103_0443694 3300048906 Bacteria 832
897 Ga0496103_0450071 3300048906 Bacteria 826
898 Ga0496104_0848884 3300048907 Bacteria 819
899 Ga0496106_0006127 3300048909 Bacteria 8896
900 Ga0496107_0075821 3300048910 Bacteria 2448
901 Ga0496107_0293454 3300048910 Bacteria 1210
902 Ga0496108_0217414 3300048911 Bacteria 1660
903 Ga0496108_0711016 3300048911 Bacteria 871
904 Ga0496109_0068134 3300048912 Bacteria 3262
905 Ga0496109_0229028 3300048912 Bacteria 1748
906 Ga0496110_0000024 3300048913 Bacteria 74685
907 Ga0496110_0104634 3300048913 Bacteria 2539
908 Ga0496110_0570064 3300048913 Bacteria 1028
909 Ga0496111_0635735 3300048914 Bacteria 779
910 Ga0496112_0367515 3300048915 Bacteria 1380
911 Ga0496112_0755078 3300048915 Bacteria 899
912 Ga0496113_0019700 3300048916 Bacteria 4726
913 Ga0496114_0047812 3300048917 Bacteria 3558
914 Ga0496114_0067969 3300048917 Bacteria 2991
915 Ga0496114_0478533 3300048917 Bacteria 1102
916 Ga0496115_0026659 3300048918 Bacteria 4512
917 Ga0496115_0056234 3300048918 Bacteria 3162
918 Ga0496115_0082225 3300048918 Bacteria 2623
919 Ga0496115_0215720 3300048918 Bacteria 1584
920 Ga0496115_0555710 3300048918 Bacteria 917
921 Ga0496116_0026481 3300048919 Bacteria 4240
922 Ga0496118_0131119 3300048921 Bacteria 1609
923 Ga0496121_0095442 3300048924 Bacteria 2311
924 Ga0496121_0154136 3300048924 Bacteria 1687
925 Ga0496121_0514578 3300048924 Bacteria 757
926 Ga0496122_0000439 3300048925 Bacteria 87380
927 Ga0496122_0002153 3300048925 Bacteria 28900
928 Ga0496122_0004757 3300048925 Bacteria 16624
929 Ga0496122_0011837 3300048925 Bacteria 8770
930 Ga0496123_0000487 3300048926 Bacteria 69019
931 Ga0496123_0003789 3300048926 Bacteria 16558
932 Ga0496123_0022480 3300048926 Bacteria 4858
933 Ga0496124_0016901 3300048927 Bacteria 6913
934 Ga0496124_0021248 3300048927 Bacteria 5984
935 Ga0496124_0023141 3300048927 Bacteria 5680
936 Ga0496124_0045759 3300048927 Bacteria 3751
937 Ga0496124_0076458 3300048927 Bacteria 2763
938 Ga0496124_0303252 3300048927 Bacteria 1152
939 Ga0496125_0001079 3300048928 Bacteria 41999
940 Ga0496125_0003984 3300048928 Bacteria 17378
941 Ga0496125_0099527 3300048928 Bacteria 2147
942 Ga0496125_0182288 3300048928 Bacteria 1397
943 Ga0496125_0246345 3300048928 Bacteria 1131
944 Ga0496126_0060200 3300048929 Bacteria 3416
945 Ga0496126_0224826 3300048929 Bacteria 1575
946 Ga0501308_013232 3300049128 Bacteria 952
947 Ga0501304_003196 3300049160 Bacteria 1188
948 Ga0501305_039264 3300049161 Bacteria 765
949 Ga0495678_000131 3300049459 Bacteria 88620
950 Ga0495678_000355 3300049459 Bacteria 47179
951 Ga0495678_001074 3300049459 Bacteria 23088
952 Ga0495678_003680 3300049459 Bacteria 9283
953 Ga0495678_004358 3300049459 Bacteria 8225
954 Ga0495678_015158 3300049459 Bacteria 3558
955 Ga0495678_033475 3300049459 Bacteria 2120
956 Ga0495678_193161 3300049459 Bacteria 631
957 Ga0495682_0000779 3300049460 Bacteria 20252
958 Ga0495682_0001850 3300049460 Bacteria 10612
959 Ga0495682_0002874 3300049460 Bacteria 7921
960 Ga0495682_0004757 3300049460 Bacteria 5734
961 Ga0501300_033155 3300049523 Bacteria 765
962 Ga0501207_006845 3300049654 Bacteria 1611
963 Ga0501280_000079 3300049776 Bacteria 25935
964 Ga0501282_010548 3300049778 Bacteria 992
965 Ga0501035_0005808 3300049822 Bacteria 11635
966 nmdc:mga00v17_230903_c1 3300050491 Bacteria 1199
967 nmdc:mga0yw44_175167_c1 3300050492 Bacteria 1410
968 Ga0495601_0021365 3300053077 Bacteria 3963
969 Ga0495601_0323983 3300053077 Bacteria 1003
970 Ga0495655_0154964 3300053083 Bacteria 723
971 Ga0500583_0004765 3300053092 Bacteria 4467
972 Ga0500650_0000077 3300053098 Bacteria 28370
973 Ga0500594_0017715 3300053118 Bacteria 1747
974 Ga0500614_159553 3300053123 Bacteria 683
975 Ga0500618_000301 3300053125 Bacteria 37462
976 Ga0500618_000821 3300053125 Bacteria 17044
977 Ga0500564_049825 3300053138 Bacteria 1917
978 Ga0500574_000358 3300053141 Bacteria 5632
979 Ga0500622_0279307 3300053156 Bacteria 720
980 Ga0500634_0016724 3300053161 Bacteria 3917
981 Ga0500661_019973 3300055283 Bacteria 1191
982 Ga0587066_023808 3300059490 Bacteria 1037
983 Ga0587066_089812 3300059490 Bacteria 680
984 Ga0587070_012124 3300059491 Bacteria 1303
985 Ga0587077_006576 3300059493 Bacteria 1653
986 Ga0587077_025555 3300059493 Bacteria 1084
987 Ga0587080_010270 3300059503 Bacteria 1377
988 Ga0587083_0023065 3300059505 Bacteria 1171
989 Ga0587085_003884 3300059506 Bacteria 1662
990 Ga0587086_011885 3300059507 Bacteria 1074
991 Ga0587090_001134 3300059510 Bacteria 2599
992 Ga0587090_013222 3300059510 Bacteria 1190
993 Ga0587091_019150 3300059511 Bacteria 1173
994 Ga0587091_019940 3300059511 Bacteria 1159
995 Ga0587106_021228 3300059605 Bacteria 966
996 Ga0587101_054991 3300059623 Bacteria 696
997 Ga0587109_014206 3300059624 Bacteria 1333
998 Ga0587117_016597 3300059627 Bacteria 982
999 Ga0587062_011715 3300059639 Bacteria 1112
1000 Ga0587067_015649 3300059640 Bacteria 1234
1001 Ga0587067_020457 3300059640 Bacteria 1132
1002 Ga0587068_016177 3300059641 Bacteria 1181
1003 Ga0587069_016163 3300059642 Bacteria 1063
1004 Ga0587069_022812 3300059642 Bacteria 953
1005 Ga0587072_005287 3300059643 Bacteria 1923
1006 Ga0587072_025780 3300059643 Bacteria 1071
1007 Ga0587078_011383 3300059646 Bacteria 1032
1008 Ga0587079_043002 3300059647 Bacteria 920
1009 Ga0587105_003927 3300059651 Bacteria 929
1010 Ga0587071_065599 3300060344 Bacteria 780
1011 Ga0587111_0001153 3300060346 Bacteria 3028
1012 Ga0466962_0032893 3300061719 Bacteria 2481
1013 Ga0466962_0091908 3300061719 Bacteria 1454

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300002987 JGI25159J45721_1004210 JGI25159J45721_10042104 180
2 3300002987 JGI25159J45721_1008279 JGI25159J45721_10082791 180
3 3300003374 JGI25161J50226_1001131 JGI25161J50226_10011316 180
4 3300003771 Ga0055526_1005093 Ga0055526_10050938 180
5 3300004625 Ga0055543_1001470 Ga0055543_10014704 180
6 3300005262 Ga0065165_1004144 Ga0065165_10041444 180
7 3300005331 Ga0070670_100000017 Ga0070670_100000017138 180
8 3300005335 Ga0070666_10403118 Ga0070666_104031182 180
9 3300005353 Ga0070669_100028281 Ga0070669_1000282811 180
10 3300005355 Ga0070671_100000173 Ga0070671_10000017340 180
11 3300005365 Ga0070688_100003318 Ga0070688_1000033182 180
12 3300005367 Ga0070667_100001097 Ga0070667_10000109715 180
13 3300005466 Ga0070685_10000026 Ga0070685_1000002639 180
14 3300005548 Ga0070665_100285816 Ga0070665_1002858162 180
15 3300005617 Ga0068859_100317621 Ga0068859_1003176212 180
16 3300005618 Ga0068864_100000029 Ga0068864_10000002976 180
17 3300005841 Ga0068863_100600276 Ga0068863_1006002762 180
18 3300005842 Ga0068858_100133592 Ga0068858_1001335922 180
19 3300005843 Ga0068860_100000228 Ga0068860_10000022814 180
20 3300005844 Ga0068862_100089363 Ga0068862_1000893633 180
21 3300006051 Ga0075364_10446427 Ga0075364_104464272 180
22 3300006931 Ga0097620_100317629 Ga0097620_1003176292 180
23 3300009553 Ga0105249_10901723 Ga0105249_109017231 180
24 3300013306 Ga0163162_10609494 Ga0163162_106094942 180
25 3300014968 Ga0157379_10637077 Ga0157379_106370771 180
26 3300025208 Ga0209436_101543 Ga0209436_1015433 180
27 3300025284 Ga0209130_1001054 Ga0209130_100105410 180
28 3300025903 Ga0207680_10014776 Ga0207680_100147761 180
29 3300025923 Ga0207681_10022277 Ga0207681_100222772 180
30 3300025925 Ga0207650_10000003 Ga0207650_1000000376 180
31 3300025931 Ga0207644_10004443 Ga0207644_100044439 180
32 3300025941 Ga0207711_10000472 Ga0207711_1000047214 180
33 3300025961 Ga0207712_10135816 Ga0207712_101358162 180
34 3300025986 Ga0207658_10000012 Ga0207658_1000001276 180
35 3300026035 Ga0207703_10130918 Ga0207703_101309182 180
36 3300026088 Ga0207641_10025128 Ga0207641_100251282 180
37 3300026095 Ga0207676_10000003 Ga0207676_100000031019 180
38 3300028379 Ga0268266_10032903 Ga0268266_100329035 180
39 3300028380 Ga0268265_10002832 Ga0268265_100028323 180
40 3300028381 Ga0268264_10000009 Ga0268264_10000009562 180
41 3300047445 Ga0495677_0128864 Ga0495677_0128864_240_785 180
42 3300050491 nmdc:mga00v17_230903_c1 nmdc:mga00v17_230903_c1_46_591 180
43 3300053098 Ga0500650_0000077 Ga0500650_0000077_6900_7445 180
44 3300053138 Ga0500564_049825 Ga0500564_049825_1163_1708 180
45 3300053161 Ga0500634_0016724 Ga0500634_0016724_2935_3480 180
46 3300055283 Ga0500661_019973 Ga0500661_019973_98_643 180
47 3300005331 Ga0070670_100008239 Ga0070670_1000082399 181
48 3300005335 Ga0070666_10001017 Ga0070666_100010175 181
49 3300005340 Ga0070689_100111630 Ga0070689_1001116303 181
50 3300005347 Ga0070668_100007166 Ga0070668_1000071666 181
51 3300005353 Ga0070669_100039493 Ga0070669_1000394934 181
52 3300005354 Ga0070675_100029487 Ga0070675_1000294873 181
53 3300005355 Ga0070671_100099885 Ga0070671_1000998853 181
54 3300005364 Ga0070673_100010734 Ga0070673_1000107342 181
55 3300005365 Ga0070688_100019613 Ga0070688_1000196135 181
56 3300005367 Ga0070667_100003801 Ga0070667_1000038018 181
57 3300005456 Ga0070678_100004615 Ga0070678_1000046156 181
58 3300005459 Ga0068867_100003865 Ga0068867_1000038659 181
59 3300005466 Ga0070685_10172828 Ga0070685_101728282 181
60 3300005719 Ga0068861_100127381 Ga0068861_1001273812 181
61 3300005843 Ga0068860_101144895 Ga0068860_1011448952 181
62 3300005844 Ga0068862_100069792 Ga0068862_1000697925 181
63 3300006038 Ga0075365_10197172 Ga0075365_101971722 181
64 3300006178 Ga0075367_10558457 Ga0075367_105584572 181
65 3300006195 Ga0075366_10026204 Ga0075366_100262045 181
66 3300009177 Ga0105248_10006207 Ga0105248_100062072 181
67 3300009551 Ga0105238_10262147 Ga0105238_102621472 181
68 3300013296 Ga0157374_10014078 Ga0157374_100140787 181
69 3300013297 Ga0157378_10667619 Ga0157378_106676192 181
70 3300013306 Ga0163162_10003303 Ga0163162_100033033 181
71 3300014325 Ga0163163_10423409 Ga0163163_104234092 181
72 3300014326 Ga0157380_10007300 Ga0157380_100073009 181
73 3300014968 Ga0157379_10015472 Ga0157379_100154727 181
74 3300021361 Ga0213872_10001692 Ga0213872_1000169213 181
75 3300021361 Ga0213872_10019678 Ga0213872_100196783 181
76 3300021361 Ga0213872_10091690 Ga0213872_100916902 181
77 3300021384 Ga0213876_10076148 Ga0213876_100761482 181
78 3300025923 Ga0207681_10070592 Ga0207681_100705922 181
79 3300025925 Ga0207650_10004390 Ga0207650_1000439010 181
80 3300025972 Ga0207668_10007151 Ga0207668_100071518 181
81 3300025972 Ga0207668_10118956 Ga0207668_101189562 181
82 3300026089 Ga0207648_10076849 Ga0207648_100768491 181
83 3300028380 Ga0268265_10048589 Ga0268265_100485892 181
84 3300028381 Ga0268264_10099773 Ga0268264_100997732 181
85 3300030521 Ga0307511_10008326 Ga0307511_1000832615 181
86 3300031250 Ga0265331_10064063 Ga0265331_100640632 181
87 3300031251 Ga0265327_10090693 Ga0265327_100906933 181
88 3300031507 Ga0307509_10270648 Ga0307509_102706482 181
89 3300032133 Ga0316583_10009603 Ga0316583_100096034 181
90 3300037418 Ga0395900_0009260 Ga0395900_0009260_1647_2210 181
91 3300039437 Ga0436365_1765823 Ga0436365_1765823_3748_4305 181
92 3300039447 Ga0436361_0275924 Ga0436361_0275924_1963_2508 181
93 3300039447 Ga0436361_0632651 Ga0436361_0632651_3053_3598 181
94 3300039447 Ga0436361_1043948 Ga0436361_1043948_3045_3590 181
95 3300039453 Ga0436362_0115419 Ga0436362_0115419_349_906 181
96 3300042876 Ga0451577_0625920 Ga0451577_0625920_377_922 181
97 3300044712 Ga0453684_0000102 Ga0453684_0000102_43021_43566 181
98 3300045051 Ga0451576_0000171 Ga0451576_0000171_154818_155363 181
99 3300045051 Ga0451576_0000386 Ga0451576_0000386_35310_35855 181
100 3300045051 Ga0451576_0080204 Ga0451576_0080204_405_950 181
101 3300045051 Ga0451576_0724582 Ga0451576_0724582_68_613 181
102 3300046523 Ga0495644_0002518 Ga0495644_0002518_5805_6356 181
103 3300048912 Ga0496109_0229028 Ga0496109_0229028_648_1193 181
104 3300048917 Ga0496114_0478533 Ga0496114_0478533_145_690 181
105 3300049523 Ga0501300_033155 Ga0501300_033155_21_569 181
106 3300049776 Ga0501280_000079 Ga0501280_000079_17100_17648 181
107 3300049778 Ga0501282_010548 Ga0501282_010548_286_834 181
108 3300050492 nmdc:mga0yw44_175167_c1 nmdc:mga0yw44_175167_c1_800_1354 181
109 3300053092 Ga0500583_0004765 Ga0500583_0004765_1300_1845 181
110 3300053123 Ga0500614_159553 Ga0500614_159553_126_671 181
111 3300026078 Ga0207702_11225745 Ga0207702_112257451 182
112 3300037312 Ga0395899_0010704 Ga0395899_0010704_2308_2889 182
113 3300037418 Ga0395900_0010088 Ga0395900_0010088_1414_1995 182
114 3300037466 Ga0395898_0004536 Ga0395898_0004536_2049_2630 182
115 3300037471 Ga0395905_0152274 Ga0395905_0152274_1107_1688 182
116 3300038443 Ga0395901_0023907 Ga0395901_0023907_1529_2110 182
117 3300046520 Ga0495637_0021577 Ga0495637_0021577_1571_2179 182
118 3300049161 Ga0501305_039264 Ga0501305_039264_24_575 182
119 3300049459 Ga0495678_000131 Ga0495678_000131_7626_8234 182
120 3300037471 Ga0395905_0020397 Ga0395905_0020397_4416_4973 183
121 3300037471 Ga0395905_0392670 Ga0395905_0392670_153_710 183
122 3300046457 Ga0495590_0067583 Ga0495590_0067583_118_675 183
123 3300046692 Ga0495671_0019545 Ga0495671_0019545_2239_2847 183
124 iso_pu_bacteria 2521172590 2521557364 183
125 iso_pu_bacteria 2551306416 2553005285 183
126 iso_pu_bacteria 2818991449 2819617647 183
127 iso_pu_bacteria 2904439833 2904439898 183
128 iso_pu_bacteria 2904530477 2904531153 183
129 iso_pu_bacteria 2904584206 2904587200 183
130 iso_pu_bacteria 2904589729 2904592766 183
131 iso_pu_bacteria 2904601388 2904604452 183
132 iso_pu_bacteria 2919046199 2919050215 183
133 iso_pu_bacteria 2919079590 2919082273 183
134 iso_pu_bacteria 2923510766 2923516029 183
135 iso_pu_bacteria 2928130867 2928133217 183
136 3300046530 Ga0495654_0006380 Ga0495654_0006380_2365_2949 184
137 3300046542 Ga0495597_0001407 Ga0495597_0001407_759_1355 184
138 3300046794 Ga0495589_0000513 Ga0495589_0000513_1351_1947 184
139 3300059490 Ga0587066_023808 Ga0587066_023808_219_782 184
140 iso_pu_bacteria 2808606418 2809142462 184
141 3300046810 Ga0495660_0002349 Ga0495660_0002349_969_1535 185
142 3300049459 Ga0495678_033475 Ga0495678_033475_1528_2106 185
143 3300049459 Ga0495678_193161 Ga0495678_193161_15_593 185
144 3300046457 Ga0495590_0028084 Ga0495590_0028084_357_965 186
145 3300046474 Ga0495605_0044828 Ga0495605_0044828_854_1462 186
146 3300046513 Ga0495616_0010992 Ga0495616_0010992_4075_4683 186
147 3300046518 Ga0495631_0000550 Ga0495631_0000550_20763_21371 186
148 3300046524 Ga0495648_0027171 Ga0495648_0027171_1136_1744 186
149 3300046530 Ga0495654_0008593 Ga0495654_0008593_3029_3637 186
150 3300046616 Ga0495668_0006891 Ga0495668_0006891_3893_4501 186
151 3300046810 Ga0495660_0128657 Ga0495660_0128657_406_1014 186
152 3300047446 Ga0495679_019799 Ga0495679_019799_165_773 186
153 3300047447 Ga0495685_001317 Ga0495685_001317_6246_6854 186
154 3300047472 Ga0495686_0129523 Ga0495686_0129523_245_805 186
155 3300047472 Ga0495686_0181975 Ga0495686_0181975_556_1125 186
156 3300048091 Ga0495626_0026399 Ga0495626_0026399_1628_2236 186
157 3300048905 Ga0496102_0000313 Ga0496102_0000313_55490_56074 186
158 3300048927 Ga0496124_0021248 Ga0496124_0021248_2580_3140 186
159 3300048929 Ga0496126_0224826 Ga0496126_0224826_663_1247 186
160 iso_pu_bacteria 2643221638 2644215594 186
161 3300005563 Ga0068855_100001073 Ga0068855_1000010735 187
162 3300005577 Ga0068857_100708483 Ga0068857_1007084831 187
163 3300005578 Ga0068854_100006965 Ga0068854_1000069655 187
164 3300005834 Ga0068851_10336586 Ga0068851_103365862 187
165 3300009093 Ga0105240_10020783 Ga0105240_100207834 187
166 3300009545 Ga0105237_10135525 Ga0105237_101355252 187
167 3300009551 Ga0105238_10000065 Ga0105238_1000006541 187
168 3300010375 Ga0105239_10009136 Ga0105239_100091365 187
169 3300015261 Ga0182006_1029100 Ga0182006_10291002 187
170 3300025228 Ga0209672_102164 Ga0209672_1021643 187
171 3300025913 Ga0207695_10005745 Ga0207695_1000574513 187
172 3300025914 Ga0207671_10037277 Ga0207671_100372775 187
173 3300025924 Ga0207694_10001114 Ga0207694_1000111417 187
174 3300025949 Ga0207667_10000078 Ga0207667_1000007822 187
175 3300025949 Ga0207667_10023739 Ga0207667_100237392 187
176 3300025981 Ga0207640_10055935 Ga0207640_100559352 187
177 3300026116 Ga0207674_10350919 Ga0207674_103509192 187
178 3300039447 Ga0436361_0149158 Ga0436361_0149158_328_897 187
179 3300046529 Ga0495652_0016097 Ga0495652_0016097_4206_4823 187
180 3300046543 Ga0495645_0073481 Ga0495645_0073481_1436_2053 187
181 3300046680 Ga0495646_0001555 Ga0495646_0001555_2749_3366 187
182 3300046690 Ga0495624_0292209 Ga0495624_0292209_155_772 187
183 3300047317 Ga0495604_0437459 Ga0495604_0437459_100_717 187
184 iso_pu_bacteria 2643221554 2643791370 187
185 iso_pu_bacteria 2643221556 2643800212 187
186 iso_pu_bacteria 2643221603 2644027726 187
187 iso_pu_bacteria 2643221645 2644251577 187
188 iso_pu_bacteria 2643221664 2644358246 187
189 iso_pu_bacteria 2643221684 2644472006 187
190 iso_pu_bacteria 2738541280 2738742420 187
191 iso_pu_bacteria 2738541300 2738845373 187
192 iso_pu_bacteria 2738543018 2739276426 187
193 iso_pu_bacteria 2738543030 2739345470 187
194 iso_pu_bacteria 2821131069 2821133472 187
195 iso_pu_bacteria 8047673197 8047674766 187
196 3300037471 Ga0395905_0042482 Ga0395905_0042482_2487_3095 188
197 3300046474 Ga0495605_0006348 Ga0495605_0006348_3904_4479 188
198 3300046474 Ga0495605_0035098 Ga0495605_0035098_973_1548 188
199 3300046491 Ga0495584_0005376 Ga0495584_0005376_1042_1617 188
200 3300046492 Ga0495585_0107344 Ga0495585_0107344_397_972 188
201 3300046500 Ga0495596_0002300 Ga0495596_0002300_2633_3208 188
202 3300046501 Ga0495607_0001671 Ga0495607_0001671_14748_15323 188
203 3300046501 Ga0495607_0028377 Ga0495607_0028377_710_1285 188
204 3300046506 Ga0495583_0001444 Ga0495583_0001444_17735_18310 188
205 3300046507 Ga0495606_0012677 Ga0495606_0012677_1102_1677 188
206 3300046513 Ga0495616_0030670 Ga0495616_0030670_79_654 188
207 3300046513 Ga0495616_0057484 Ga0495616_0057484_71_646 188
208 3300046518 Ga0495631_0006258 Ga0495631_0006258_5441_6016 188
209 3300046519 Ga0495632_0000852 Ga0495632_0000852_3882_4457 188
210 3300046519 Ga0495632_0001985 Ga0495632_0001985_6076_6651 188
211 3300046522 Ga0495643_0002412 Ga0495643_0002412_4065_4640 188
212 3300046522 Ga0495643_0012215 Ga0495643_0012215_3915_4490 188
213 3300046524 Ga0495648_0009310 Ga0495648_0009310_2731_3306 188
214 3300046538 Ga0495609_0002267 Ga0495609_0002267_6908_7483 188
215 3300046616 Ga0495668_0011176 Ga0495668_0011176_2297_2872 188
216 3300046648 Ga0495611_0003505 Ga0495611_0003505_4299_4874 188
217 3300046665 Ga0495661_0003517 Ga0495661_0003517_7379_7954 188
218 3300046665 Ga0495661_0047504 Ga0495661_0047504_1523_2098 188
219 3300046665 Ga0495661_0063816 Ga0495661_0063816_1563_2138 188
220 3300046692 Ga0495671_0127303 Ga0495671_0127303_151_726 188
221 3300046694 Ga0495649_0003442 Ga0495649_0003442_3712_4287 188
222 3300046694 Ga0495649_0048732 Ga0495649_0048732_660_1235 188
223 3300046794 Ga0495589_0004248 Ga0495589_0004248_2244_2819 188
224 3300046810 Ga0495660_0004163 Ga0495660_0004163_5529_6104 188
225 3300047320 Ga0495672_0003293 Ga0495672_0003293_4346_4921 188
226 3300047320 Ga0495672_0034084 Ga0495672_0034084_263_838 188
227 3300047446 Ga0495679_008137 Ga0495679_008137_3202_3777 188
228 3300047470 Ga0495681_0016273 Ga0495681_0016273_1435_2010 188
229 3300048091 Ga0495626_0003284 Ga0495626_0003284_2486_3061 188
230 3300048091 Ga0495626_0018518 Ga0495626_0018518_452_1027 188
231 3300048091 Ga0495626_0021333 Ga0495626_0021333_2063_2638 188
232 3300049459 Ga0495678_003680 Ga0495678_003680_2907_3482 188
233 3300015261 Ga0182006_1016620 Ga0182006_10166202 189
234 3300031251 Ga0265327_10165282 Ga0265327_101652822 189
235 3300032002 Ga0307416_100005633 Ga0307416_1000056335 189
236 3300035691 Ga0373931_0114275 Ga0373931_0114275_148_726 189
237 3300046455 Ga0495603_0044124 Ga0495603_0044124_77_655 189
238 3300046459 Ga0495629_0014017 Ga0495629_0014017_1364_1942 189
239 3300046473 Ga0495582_0004649 Ga0495582_0004649_1142_1720 189
240 3300046474 Ga0495605_0024677 Ga0495605_0024677_1993_2571 189
241 3300046491 Ga0495584_0069350 Ga0495584_0069350_486_1064 189
242 3300046491 Ga0495584_0204880 Ga0495584_0204880_281_859 189
243 3300046492 Ga0495585_0098278 Ga0495585_0098278_77_655 189
244 3300046499 Ga0495594_0010807 Ga0495594_0010807_3682_4260 189
245 3300046499 Ga0495594_0028672 Ga0495594_0028672_789_1367 189
246 3300046500 Ga0495596_0028741 Ga0495596_0028741_1509_2087 189
247 3300046506 Ga0495583_0033337 Ga0495583_0033337_1396_1974 189
248 3300046506 Ga0495583_0034886 Ga0495583_0034886_1717_2295 189
249 3300046513 Ga0495616_0001547 Ga0495616_0001547_8594_9199 189
250 3300046513 Ga0495616_0033463 Ga0495616_0033463_1135_1713 189
251 3300046518 Ga0495631_0017560 Ga0495631_0017560_1669_2247 189
252 3300046523 Ga0495644_0015732 Ga0495644_0015732_77_655 189
253 3300046528 Ga0495642_0004398 Ga0495642_0004398_2429_3007 189
254 3300046528 Ga0495642_0029202 Ga0495642_0029202_695_1300 189
255 3300046530 Ga0495654_0044679 Ga0495654_0044679_511_1089 189
256 3300046558 Ga0495633_0024214 Ga0495633_0024214_1289_1867 189
257 3300046616 Ga0495668_0057478 Ga0495668_0057478_206_784 189
258 3300046648 Ga0495611_0003835 Ga0495611_0003835_704_1282 189
259 3300046674 Ga0495588_0014347 Ga0495588_0014347_142_819 189
260 3300046674 Ga0495588_0017075 Ga0495588_0017075_2020_2598 189
261 3300046674 Ga0495588_0032962 Ga0495588_0032962_1767_2345 189
262 3300046684 Ga0495669_0000018 Ga0495669_0000018_93904_94482 189
263 3300046810 Ga0495660_0014127 Ga0495660_0014127_3948_4526 189
264 3300047315 Ga0495581_0009510 Ga0495581_0009510_4473_5051 189
265 3300047320 Ga0495672_0004198 Ga0495672_0004198_3507_4085 189
266 3300047323 Ga0495683_0079896 Ga0495683_0079896_432_1010 189
267 3300047446 Ga0495679_074564 Ga0495679_074564_209_787 189
268 3300047447 Ga0495685_016533 Ga0495685_016533_1486_2064 189
269 3300047470 Ga0495681_0000321 Ga0495681_0000321_3767_4345 189
270 3300048089 Ga0495614_0001110 Ga0495614_0001110_5795_6373 189
271 3300048091 Ga0495626_0007634 Ga0495626_0007634_312_890 189
272 3300048906 Ga0496103_0443694 Ga0496103_0443694_220_798 189
273 iso_pu_bacteria 2511231026 2511383608 189
274 3300003771 Ga0055526_1007187 Ga0055526_10071872 190
275 3300003775 Ga0055524_1000021 Ga0055524_1000021221 190
276 3300003775 Ga0055524_1003016 Ga0055524_10030165 190
277 3300003775 Ga0055524_1005587 Ga0055524_10055875 190
278 3300003784 Ga0055534_1004625 Ga0055534_10046254 190
279 3300003791 Ga0055530_10003380 Ga0055530_100033804 190
280 3300006948 Ga0099826_10000041 Ga0099826_1000004131 190
281 3300017792 Ga0163161_10032386 Ga0163161_100323865 190
282 3300025263 Ga0209565_1001939 Ga0209565_10019394 190
283 3300025291 Ga0209675_1001711 Ga0209675_10017117 190
284 3300025295 Ga0209564_1000071 Ga0209564_1000071254 190
285 3300025295 Ga0209564_1028688 Ga0209564_10286882 190
286 3300025298 Ga0209050_1000240 Ga0209050_100024038 190
287 3300025299 Ga0209256_1000044 Ga0209256_1000044304 190
288 3300025299 Ga0209256_1003100 Ga0209256_10031005 190
289 3300027666 Ga0209282_1000001 Ga0209282_100000131 190
290 3300031548 Ga0307408_100000239 Ga0307408_10000023911 190
291 3300032004 Ga0307414_10788244 Ga0307414_107882441 190
292 3300046615 Ga0495656_0119591 Ga0495656_0119591_157_738 190
293 3300047469 Ga0495673_0000265 Ga0495673_0000265_26602_27195 190
294 3300048924 Ga0496121_0095442 Ga0496121_0095442_84_698 190
295 3300048929 Ga0496126_0060200 Ga0496126_0060200_2383_2976 190
296 iso_pu_bacteria 2765235838 2765568487 190
297 iso_pu_bacteria 2808606386 2808981228 190
298 iso_pu_bacteria 2808606415 2809131718 190
299 iso_pu_bacteria 2808606419 2809151470 190
300 iso_pu_bacteria 2839094727 2839096648 190
301 iso_pu_bacteria 2852618963 2852620954 190
302 3300003759 Ga0055525_1000029 Ga0055525_100002979 191
303 3300003762 Ga0055542_1021560 Ga0055542_10215601 191
304 3300003771 Ga0055526_1000068 Ga0055526_10000688 191
305 3300005262 Ga0065165_1046881 Ga0065165_10468812 191
306 3300005327 Ga0070658_10447686 Ga0070658_104476862 191
307 3300005339 Ga0070660_100018151 Ga0070660_1000181513 191
308 3300005339 Ga0070660_100081746 Ga0070660_1000817462 191
309 3300005339 Ga0070660_100422141 Ga0070660_1004221411 191
310 3300005344 Ga0070661_100127414 Ga0070661_1001274142 191
311 3300005366 Ga0070659_100117647 Ga0070659_1001176472 191
312 3300005366 Ga0070659_100170659 Ga0070659_1001706592 191
313 3300005563 Ga0068855_100206715 Ga0068855_1002067152 191
314 3300005563 Ga0068855_100544190 Ga0068855_1005441902 191
315 3300005564 Ga0070664_100029568 Ga0070664_1000295682 191
316 3300005564 Ga0070664_100100244 Ga0070664_1001002442 191
317 3300005614 Ga0068856_100833244 Ga0068856_1008332442 191
318 3300005616 Ga0068852_100574624 Ga0068852_1005746242 191
319 3300006237 Ga0097621_100441709 Ga0097621_1004417092 191
320 3300006358 Ga0068871_100939794 Ga0068871_1009397941 191
321 3300006946 Ga0079104_1008344 Ga0079104_10083444 191
322 3300009174 Ga0105241_10016300 Ga0105241_100163004 191
323 3300009551 Ga0105238_10150406 Ga0105238_101504062 191
324 3300010375 Ga0105239_10457761 Ga0105239_104577612 191
325 3300010375 Ga0105239_11353967 Ga0105239_113539672 191
326 3300013102 Ga0157371_10000013 Ga0157371_10000013304 191
327 3300013102 Ga0157371_10374609 Ga0157371_103746092 191
328 3300013297 Ga0157378_10351285 Ga0157378_103512852 191
329 3300014497 Ga0182008_10046094 Ga0182008_100460942 191
330 3300015261 Ga0182006_1050588 Ga0182006_10505882 191
331 3300015261 Ga0182006_1174230 Ga0182006_11742301 191
332 3300021361 Ga0213872_10000242 Ga0213872_1000024218 191
333 3300021361 Ga0213872_10000443 Ga0213872_1000044322 191
334 3300021361 Ga0213872_10019294 Ga0213872_100192942 191
335 3300021361 Ga0213872_10044898 Ga0213872_100448982 191
336 3300021361 Ga0213872_10108111 Ga0213872_101081112 191
337 3300021361 Ga0213872_10156063 Ga0213872_101560632 191
338 3300025230 Ga0209563_100003 Ga0209563_100003243 191
339 3300025233 Ga0209437_110183 Ga0209437_1101832 191
340 3300025246 Ga0209646_1000077 Ga0209646_1000077179 191
341 3300025254 Ga0209148_1001819 Ga0209148_10018199 191
342 3300025295 Ga0209564_1000072 Ga0209564_100007232 191
343 3300025909 Ga0207705_10017557 Ga0207705_100175575 191
344 3300025911 Ga0207654_10004697 Ga0207654_100046977 191
345 3300025919 Ga0207657_10024222 Ga0207657_100242222 191
346 3300025919 Ga0207657_10034425 Ga0207657_100344252 191
347 3300025919 Ga0207657_10134734 Ga0207657_101347342 191
348 3300025932 Ga0207690_10191480 Ga0207690_101914802 191
349 3300025932 Ga0207690_10819946 Ga0207690_108199462 191
350 3300025933 Ga0207706_10336169 Ga0207706_103361692 191
351 3300025934 Ga0207686_10187296 Ga0207686_101872962 191
352 3300025935 Ga0207709_10112420 Ga0207709_101124202 191
353 3300025945 Ga0207679_10248449 Ga0207679_102484491 191
354 3300025945 Ga0207679_10267272 Ga0207679_102672721 191
355 3300025949 Ga0207667_10041450 Ga0207667_100414502 191
356 3300025949 Ga0207667_10297414 Ga0207667_102974142 191
357 3300026067 Ga0207678_10912544 Ga0207678_109125441 191
358 3300026078 Ga0207702_10885972 Ga0207702_108859721 191
359 3300026116 Ga0207674_10349182 Ga0207674_103491822 191
360 3300030736 Ga0316180_1021737 Ga0316180_10217372 191
361 3300030742 Ga0316183_1190372 Ga0316183_11903721 191
362 3300031548 Ga0307408_100224828 Ga0307408_1002248281 191
363 3300037312 Ga0395899_0000128 Ga0395899_0000128_79128_79712 191
364 3300037312 Ga0395899_0006694 Ga0395899_0006694_4679_5257 191
365 3300037312 Ga0395899_0010304 Ga0395899_0010304_3071_3649 191
366 3300037312 Ga0395899_0055314 Ga0395899_0055314_1941_2519 191
367 3300037418 Ga0395900_0000123 Ga0395900_0000123_85773_86351 191
368 3300037418 Ga0395900_0007904 Ga0395900_0007904_7686_8264 191
369 3300037418 Ga0395900_0021826 Ga0395900_0021826_2766_3344 191
370 3300037418 Ga0395900_0035310 Ga0395900_0035310_2308_2886 191
371 3300037418 Ga0395900_0073035 Ga0395900_0073035_2539_3117 191
372 3300037418 Ga0395900_0116934 Ga0395900_0116934_132_716 191
373 3300037418 Ga0395900_0140769 Ga0395900_0140769_1394_1972 191
374 3300037418 Ga0395900_0287131 Ga0395900_0287131_872_1456 191
375 3300037418 Ga0395900_0328620 Ga0395900_0328620_705_1283 191
376 3300037466 Ga0395898_0109879 Ga0395898_0109879_501_1079 191
377 3300037466 Ga0395898_0125841 Ga0395898_0125841_837_1415 191
378 3300037466 Ga0395898_0257386 Ga0395898_0257386_587_1165 191
379 3300037466 Ga0395898_0383923 Ga0395898_0383923_380_958 191
380 3300037466 Ga0395898_0517499 Ga0395898_0517499_215_793 191
381 3300037466 Ga0395898_0628288 Ga0395898_0628288_360_938 191
382 3300037471 Ga0395905_0078281 Ga0395905_0078281_872_1450 191
383 3300037471 Ga0395905_0099213 Ga0395905_0099213_824_1402 191
384 3300037471 Ga0395905_0128099 Ga0395905_0128099_456_1040 191
385 3300037471 Ga0395905_0310643 Ga0395905_0310643_668_1246 191
386 3300037471 Ga0395905_0380827 Ga0395905_0380827_223_807 191
387 3300038443 Ga0395901_0000411 Ga0395901_0000411_24604_25182 191
388 3300038443 Ga0395901_0001908 Ga0395901_0001908_17544_18122 191
389 3300038443 Ga0395901_0278987 Ga0395901_0278987_859_1437 191
390 3300038443 Ga0395901_0355927 Ga0395901_0355927_619_1197 191
391 3300038443 Ga0395901_0504377 Ga0395901_0504377_46_624 191
392 3300038443 Ga0395901_0796251 Ga0395901_0796251_142_720 191
393 3300039447 Ga0436361_0014452 Ga0436361_0014452_770_1363 191
394 3300039447 Ga0436361_0032641 Ga0436361_0032641_443_1030 191
395 3300039447 Ga0436361_0161443 Ga0436361_0161443_740_1333 191
396 3300039447 Ga0436361_0568983 Ga0436361_0568983_23213_23806 191
397 3300039447 Ga0436361_0746087 Ga0436361_0746087_804_1397 191
398 3300039447 Ga0436361_0830100 Ga0436361_0830100_8777_9370 191
399 3300039447 Ga0436361_0973589 Ga0436361_0973589_84_671 191
400 3300042005 Ga0439448_0010043 Ga0439448_0010043_615_1193 191
401 3300042005 Ga0439448_0123959 Ga0439448_0123959_44_622 191
402 3300042007 Ga0439449_0013722 Ga0439449_0013722_147_725 191
403 3300042008 Ga0439450_010428 Ga0439450_010428_765_1343 191
404 3300042008 Ga0439450_018780 Ga0439450_018780_34_612 191
405 3300042012 Ga0439455_0106565 Ga0439455_0106565_189_767 191
406 3300042128 Ga0450897_013149 Ga0450897_013149_206_793 191
407 3300042157 Ga0439458_0022881 Ga0439458_0022881_464_1042 191
408 3300044656 Ga0466969_0038118 Ga0466969_0038118_1426_2004 191
409 3300044656 Ga0466969_0080543 Ga0466969_0080543_768_1346 191
410 3300044658 Ga0466972_0001100 Ga0466972_0001100_2944_3522 191
411 3300044683 Ga0466965_0010006 Ga0466965_0010006_2556_3134 191
412 3300044683 Ga0466965_0011686 Ga0466965_0011686_2564_3148 191
413 3300044683 Ga0466965_0065720 Ga0466965_0065720_1124_1699 191
414 3300044684 Ga0466966_0011821 Ga0466966_0011821_2490_3068 191
415 3300044684 Ga0466966_0068924 Ga0466966_0068924_293_868 191
416 3300044684 Ga0466966_0082220 Ga0466966_0082220_1210_1791 191
417 3300044693 Ga0466961_0159699 Ga0466961_0159699_379_957 191
418 3300044706 Ga0466964_0000256 Ga0466964_0000256_4414_4992 191
419 3300044706 Ga0466964_0199537 Ga0466964_0199537_317_937 191
420 3300044719 Ga0466971_0017407 Ga0466971_0017407_1740_2315 191
421 3300044735 Ga0466968_0001835 Ga0466968_0001835_3535_4113 191
422 3300044735 Ga0466968_0117279 Ga0466968_0117279_159_734 191
423 3300044765 Ga0466970_0016339 Ga0466970_0016339_2729_3316 191
424 3300044842 Ga0466957_0009721 Ga0466957_0009721_1797_2375 191
425 3300045049 Ga0466959_0009557 Ga0466959_0009557_4636_5214 191
426 3300045049 Ga0466959_0011644 Ga0466959_0011644_3065_3640 191
427 3300045049 Ga0466959_0052704 Ga0466959_0052704_487_1074 191
428 3300045049 Ga0466959_0054139 Ga0466959_0054139_1847_2425 191
429 3300045049 Ga0466959_0586236 Ga0466959_0586236_145_723 191
430 3300045836 Ga0466958_0275718 Ga0466958_0275718_45_623 191
431 3300045836 Ga0466958_0396809 Ga0466958_0396809_135_710 191
432 3300045976 Ga0466967_0005324 Ga0466967_0005324_2725_3303 191
433 3300046452 Ga0495617_000034 Ga0495617_000034_67889_68473 191
434 3300046452 Ga0495617_002482 Ga0495617_002482_2446_3030 191
435 3300046452 Ga0495617_002980 Ga0495617_002980_64_648 191
436 3300046452 Ga0495617_008361 Ga0495617_008361_899_1495 191
437 3300046453 Ga0495627_000876 Ga0495627_000876_16235_16819 191
438 3300046453 Ga0495627_024085 Ga0495627_024085_900_1484 191
439 3300046455 Ga0495603_0033409 Ga0495603_0033409_507_1091 191
440 3300046457 Ga0495590_0000027 Ga0495590_0000027_4213_4797 191
441 3300046457 Ga0495590_0000257 Ga0495590_0000257_18884_19480 191
442 3300046457 Ga0495590_0033182 Ga0495590_0033182_1046_1624 191
443 3300046457 Ga0495590_0085440 Ga0495590_0085440_218_802 191
444 3300046458 Ga0495591_000272 Ga0495591_000272_19240_19824 191
445 3300046460 Ga0495638_0000098 Ga0495638_0000098_129222_129818 191
446 3300046471 Ga0495650_0002150 Ga0495650_0002150_9588_10184 191
447 3300046472 Ga0495580_0445460 Ga0495580_0445460_276_857 191
448 3300046473 Ga0495582_0114750 Ga0495582_0114750_441_1028 191
449 3300046474 Ga0495605_0000029 Ga0495605_0000029_69541_70119 191
450 3300046474 Ga0495605_0000042 Ga0495605_0000042_160150_160746 191
451 3300046474 Ga0495605_0000151 Ga0495605_0000151_73901_74485 191
452 3300046474 Ga0495605_0007689 Ga0495605_0007689_1475_2059 191
453 3300046474 Ga0495605_0010229 Ga0495605_0010229_3538_4122 191
454 3300046475 Ga0495639_0309380 Ga0495639_0309380_83_679 191
455 3300046491 Ga0495584_0000007 Ga0495584_0000007_225030_225614 191
456 3300046491 Ga0495584_0000122 Ga0495584_0000122_34079_34663 191
457 3300046491 Ga0495584_0000506 Ga0495584_0000506_14188_14772 191
458 3300046491 Ga0495584_0002007 Ga0495584_0002007_7149_7727 191
459 3300046491 Ga0495584_0002049 Ga0495584_0002049_6643_7227 191
460 3300046491 Ga0495584_0003276 Ga0495584_0003276_2097_2684 191
461 3300046491 Ga0495584_0005715 Ga0495584_0005715_346_924 191
462 3300046491 Ga0495584_0006099 Ga0495584_0006099_565_1149 191
463 3300046491 Ga0495584_0010896 Ga0495584_0010896_2435_3022 191
464 3300046491 Ga0495584_0110508 Ga0495584_0110508_574_1158 191
465 3300046491 Ga0495584_0163756 Ga0495584_0163756_59_643 191
466 3300046491 Ga0495584_0173545 Ga0495584_0173545_482_1066 191
467 3300046492 Ga0495585_0000115 Ga0495585_0000115_827_1411 191
468 3300046492 Ga0495585_0000421 Ga0495585_0000421_31079_31663 191
469 3300046492 Ga0495585_0002934 Ga0495585_0002934_8557_9141 191
470 3300046492 Ga0495585_0003505 Ga0495585_0003505_6068_6652 191
471 3300046492 Ga0495585_0010560 Ga0495585_0010560_822_1406 191
472 3300046492 Ga0495585_0017306 Ga0495585_0017306_2669_3253 191
473 3300046492 Ga0495585_0018451 Ga0495585_0018451_415_999 191
474 3300046492 Ga0495585_0020952 Ga0495585_0020952_3087_3674 191
475 3300046492 Ga0495585_0024454 Ga0495585_0024454_1936_2520 191
476 3300046492 Ga0495585_0029130 Ga0495585_0029130_1391_1975 191
477 3300046492 Ga0495585_0040655 Ga0495585_0040655_1874_2461 191
478 3300046492 Ga0495585_0062272 Ga0495585_0062272_1282_1866 191
479 3300046499 Ga0495594_0003496 Ga0495594_0003496_4121_4708 191
480 3300046499 Ga0495594_0013150 Ga0495594_0013150_2947_3534 191
481 3300046500 Ga0495596_0000474 Ga0495596_0000474_18360_18944 191
482 3300046500 Ga0495596_0000530 Ga0495596_0000530_22448_23032 191
483 3300046500 Ga0495596_0002008 Ga0495596_0002008_1835_2419 191
484 3300046500 Ga0495596_0004690 Ga0495596_0004690_2531_3115 191
485 3300046500 Ga0495596_0014436 Ga0495596_0014436_819_1403 191
486 3300046500 Ga0495596_0019973 Ga0495596_0019973_1940_2524 191
487 3300046501 Ga0495607_0002476 Ga0495607_0002476_12801_13379 191
488 3300046501 Ga0495607_0002735 Ga0495607_0002735_3221_3805 191
489 3300046501 Ga0495607_0004292 Ga0495607_0004292_5616_6200 191
490 3300046501 Ga0495607_0017561 Ga0495607_0017561_2176_2772 191
491 3300046501 Ga0495607_0020165 Ga0495607_0020165_1463_2047 191
492 3300046501 Ga0495607_0025435 Ga0495607_0025435_898_1482 191
493 3300046501 Ga0495607_0051721 Ga0495607_0051721_1233_1811 191
494 3300046501 Ga0495607_0071761 Ga0495607_0071761_70_654 191
495 3300046501 Ga0495607_0077910 Ga0495607_0077910_379_975 191
496 3300046501 Ga0495607_0083439 Ga0495607_0083439_462_1046 191
497 3300046501 Ga0495607_0225317 Ga0495607_0225317_250_834 191
498 3300046506 Ga0495583_0000348 Ga0495583_0000348_27537_28121 191
499 3300046506 Ga0495583_0000472 Ga0495583_0000472_51277_51873 191
500 3300046506 Ga0495583_0000569 Ga0495583_0000569_36174_36758 191
501 3300046506 Ga0495583_0049226 Ga0495583_0049226_1146_1730 191
502 3300046506 Ga0495583_0110774 Ga0495583_0110774_390_974 191
503 3300046506 Ga0495583_0194134 Ga0495583_0194134_168_752 191
504 3300046507 Ga0495606_0000084 Ga0495606_0000084_22034_22618 191
505 3300046507 Ga0495606_0000652 Ga0495606_0000652_25778_26374 191
506 3300046507 Ga0495606_0000787 Ga0495606_0000787_29167_29748 191
507 3300046507 Ga0495606_0001481 Ga0495606_0001481_23523_24119 191
508 3300046507 Ga0495606_0021021 Ga0495606_0021021_1707_2291 191
509 3300046507 Ga0495606_0029545 Ga0495606_0029545_690_1274 191
510 3300046507 Ga0495606_0031347 Ga0495606_0031347_1730_2308 191
511 3300046507 Ga0495606_0034767 Ga0495606_0034767_1423_2007 191
512 3300046507 Ga0495606_0047069 Ga0495606_0047069_1678_2262 191
513 3300046507 Ga0495606_0106051 Ga0495606_0106051_1041_1625 191
514 3300046507 Ga0495606_0349720 Ga0495606_0349720_74_658 191
515 3300046512 Ga0495610_0000473 Ga0495610_0000473_38881_39465 191
516 3300046512 Ga0495610_0148582 Ga0495610_0148582_226_810 191
517 3300046513 Ga0495616_0001479 Ga0495616_0001479_15154_15732 191
518 3300046513 Ga0495616_0004099 Ga0495616_0004099_6196_6780 191
519 3300046513 Ga0495616_0007026 Ga0495616_0007026_3490_4074 191
520 3300046513 Ga0495616_0008239 Ga0495616_0008239_3095_3679 191
521 3300046513 Ga0495616_0010806 Ga0495616_0010806_4041_4625 191
522 3300046513 Ga0495616_0021408 Ga0495616_0021408_194_778 191
523 3300046513 Ga0495616_0025599 Ga0495616_0025599_799_1383 191
524 3300046513 Ga0495616_0042972 Ga0495616_0042972_922_1506 191
525 3300046513 Ga0495616_0094410 Ga0495616_0094410_755_1339 191
526 3300046515 Ga0495620_0003439 Ga0495620_0003439_4426_5010 191
527 3300046516 Ga0495628_0305552 Ga0495628_0305552_523_1104 191
528 3300046517 Ga0495630_0332897 Ga0495630_0332897_272_853 191
529 3300046518 Ga0495631_0000810 Ga0495631_0000810_11739_12323 191
530 3300046518 Ga0495631_0001888 Ga0495631_0001888_3819_4403 191
531 3300046518 Ga0495631_0002771 Ga0495631_0002771_8833_9414 191
532 3300046518 Ga0495631_0005099 Ga0495631_0005099_2910_3494 191
533 3300046518 Ga0495631_0015840 Ga0495631_0015840_1779_2363 191
534 3300046518 Ga0495631_0272480 Ga0495631_0272480_45_629 191
535 3300046519 Ga0495632_0000903 Ga0495632_0000903_2980_3564 191
536 3300046519 Ga0495632_0007957 Ga0495632_0007957_3505_4089 191
537 3300046519 Ga0495632_0042567 Ga0495632_0042567_1507_2091 191
538 3300046520 Ga0495637_0000013 Ga0495637_0000013_214417_215001 191
539 3300046520 Ga0495637_0008688 Ga0495637_0008688_3879_4475 191
540 3300046522 Ga0495643_0000551 Ga0495643_0000551_5998_6594 191
541 3300046522 Ga0495643_0024119 Ga0495643_0024119_2173_2751 191
542 3300046522 Ga0495643_0025001 Ga0495643_0025001_625_1209 191
543 3300046522 Ga0495643_0071122 Ga0495643_0071122_61_645 191
544 3300046522 Ga0495643_0072128 Ga0495643_0072128_192_776 191
545 3300046523 Ga0495644_0004268 Ga0495644_0004268_2134_2718 191
546 3300046523 Ga0495644_0004891 Ga0495644_0004891_2755_3339 191
547 3300046523 Ga0495644_0005339 Ga0495644_0005339_1729_2313 191
548 3300046523 Ga0495644_0011582 Ga0495644_0011582_836_1420 191
549 3300046523 Ga0495644_0017413 Ga0495644_0017413_1017_1601 191
550 3300046523 Ga0495644_0020348 Ga0495644_0020348_1218_1802 191
551 3300046523 Ga0495644_0036772 Ga0495644_0036772_870_1454 191
552 3300046524 Ga0495648_0000112 Ga0495648_0000112_69394_69978 191
553 3300046524 Ga0495648_0000169 Ga0495648_0000169_23255_23851 191
554 3300046524 Ga0495648_0001096 Ga0495648_0001096_23130_23714 191
555 3300046524 Ga0495648_0002536 Ga0495648_0002536_7444_8028 191
556 3300046524 Ga0495648_0007990 Ga0495648_0007990_3638_4216 191
557 3300046524 Ga0495648_0034097 Ga0495648_0034097_750_1346 191
558 3300046524 Ga0495648_0051763 Ga0495648_0051763_59_643 191
559 3300046524 Ga0495648_0054917 Ga0495648_0054917_1509_2093 191
560 3300046524 Ga0495648_0177240 Ga0495648_0177240_66_650 191
561 3300046525 Ga0495663_0004796 Ga0495663_0004796_396_980 191
562 3300046525 Ga0495663_0032141 Ga0495663_0032141_670_1254 191
563 3300046526 Ga0495666_0015313 Ga0495666_0015313_1370_1951 191
564 3300046526 Ga0495666_0049841 Ga0495666_0049841_960_1547 191
565 3300046528 Ga0495642_0000050 Ga0495642_0000050_66595_67179 191
566 3300046528 Ga0495642_0001068 Ga0495642_0001068_4703_5281 191
567 3300046528 Ga0495642_0001340 Ga0495642_0001340_2381_2965 191
568 3300046528 Ga0495642_0001809 Ga0495642_0001809_2399_2995 191
569 3300046528 Ga0495642_0003687 Ga0495642_0003687_2431_3015 191
570 3300046528 Ga0495642_0008082 Ga0495642_0008082_889_1473 191
571 3300046528 Ga0495642_0056547 Ga0495642_0056547_334_915 191
572 3300046528 Ga0495642_0134247 Ga0495642_0134247_79_660 191
573 3300046528 Ga0495642_0186853 Ga0495642_0186853_156_740 191
574 3300046530 Ga0495654_0004305 Ga0495654_0004305_2964_3548 191
575 3300046530 Ga0495654_0010005 Ga0495654_0010005_2818_3402 191
576 3300046531 Ga0495665_0035779 Ga0495665_0035779_935_1519 191
577 3300046531 Ga0495665_0102901 Ga0495665_0102901_270_851 191
578 3300046531 Ga0495665_0103170 Ga0495665_0103170_130_711 191
579 3300046535 Ga0495586_0018982 Ga0495586_0018982_1296_1877 191
580 3300046536 Ga0495587_0008756 Ga0495587_0008756_2733_3314 191
581 3300046538 Ga0495609_0000022 Ga0495609_0000022_157391_157969 191
582 3300046538 Ga0495609_0001355 Ga0495609_0001355_7815_8399 191
583 3300046538 Ga0495609_0003271 Ga0495609_0003271_2870_3454 191
584 3300046538 Ga0495609_0026941 Ga0495609_0026941_1297_1881 191
585 3300046538 Ga0495609_0031532 Ga0495609_0031532_736_1320 191
586 3300046538 Ga0495609_0047144 Ga0495609_0047144_173_757 191
587 3300046538 Ga0495609_0080225 Ga0495609_0080225_688_1272 191
588 3300046542 Ga0495597_0000064 Ga0495597_0000064_85305_85889 191
589 3300046542 Ga0495597_0000266 Ga0495597_0000266_40201_40797 191
590 3300046542 Ga0495597_0000566 Ga0495597_0000566_3947_4531 191
591 3300046542 Ga0495597_0002770 Ga0495597_0002770_6320_6904 191
592 3300046542 Ga0495597_0006959 Ga0495597_0006959_4392_4976 191
593 3300046542 Ga0495597_0013020 Ga0495597_0013020_2115_2699 191
594 3300046542 Ga0495597_0074237 Ga0495597_0074237_57_641 191
595 3300046542 Ga0495597_0240246 Ga0495597_0240246_102_683 191
596 3300046557 Ga0495622_0000311 Ga0495622_0000311_7010_7606 191
597 3300046557 Ga0495622_0000707 Ga0495622_0000707_11322_11918 191
598 3300046557 Ga0495622_0007277 Ga0495622_0007277_2138_2722 191
599 3300046557 Ga0495622_0039684 Ga0495622_0039684_240_824 191
600 3300046557 Ga0495622_0085890 Ga0495622_0085890_157_741 191
601 3300046557 Ga0495622_0228631 Ga0495622_0228631_131_718 191
602 3300046558 Ga0495633_0001165 Ga0495633_0001165_9715_10311 191
603 3300046558 Ga0495633_0001850 Ga0495633_0001850_919_1503 191
604 3300046558 Ga0495633_0010505 Ga0495633_0010505_3791_4375 191
605 3300046558 Ga0495633_0016664 Ga0495633_0016664_3124_3708 191
606 3300046558 Ga0495633_0018317 Ga0495633_0018317_2232_2816 191
607 3300046558 Ga0495633_0020708 Ga0495633_0020708_1602_2186 191
608 3300046558 Ga0495633_0047924 Ga0495633_0047924_418_1002 191
609 3300046558 Ga0495633_0086336 Ga0495633_0086336_675_1259 191
610 3300046558 Ga0495633_0123951 Ga0495633_0123951_505_1089 191
611 3300046615 Ga0495656_0001658 Ga0495656_0001658_4869_5453 191
612 3300046615 Ga0495656_0002958 Ga0495656_0002958_3054_3638 191
613 3300046615 Ga0495656_0006533 Ga0495656_0006533_3095_3679 191
614 3300046615 Ga0495656_0026222 Ga0495656_0026222_964_1548 191
615 3300046615 Ga0495656_0100038 Ga0495656_0100038_568_1146 191
616 3300046616 Ga0495668_0001322 Ga0495668_0001322_19646_20230 191
617 3300046616 Ga0495668_0001809 Ga0495668_0001809_15019_15603 191
618 3300046616 Ga0495668_0002020 Ga0495668_0002020_9304_9900 191
619 3300046616 Ga0495668_0013456 Ga0495668_0013456_420_1007 191
620 3300046616 Ga0495668_0029492 Ga0495668_0029492_420_1004 191
621 3300046616 Ga0495668_0061174 Ga0495668_0061174_857_1441 191
622 3300046616 Ga0495668_0093914 Ga0495668_0093914_69_653 191
623 3300046616 Ga0495668_0395699 Ga0495668_0395699_107_691 191
624 3300046648 Ga0495611_0000515 Ga0495611_0000515_3442_4026 191
625 3300046648 Ga0495611_0007685 Ga0495611_0007685_3271_3855 191
626 3300046648 Ga0495611_0009941 Ga0495611_0009941_2424_3008 191
627 3300046648 Ga0495611_0010893 Ga0495611_0010893_2305_2889 191
628 3300046648 Ga0495611_0015786 Ga0495611_0015786_1920_2504 191
629 3300046648 Ga0495611_0016265 Ga0495611_0016265_2000_2587 191
630 3300046648 Ga0495611_0055477 Ga0495611_0055477_646_1230 191
631 3300046648 Ga0495611_0056545 Ga0495611_0056545_1147_1731 191
632 3300046648 Ga0495611_0098122 Ga0495611_0098122_408_992 191
633 3300046660 Ga0495625_0000810 Ga0495625_0000810_35751_36347 191
634 3300046660 Ga0495625_0011709 Ga0495625_0011709_842_1426 191
635 3300046660 Ga0495625_0013813 Ga0495625_0013813_4183_4767 191
636 3300046660 Ga0495625_0020304 Ga0495625_0020304_747_1328 191
637 3300046660 Ga0495625_0061488 Ga0495625_0061488_285_869 191
638 3300046660 Ga0495625_0203186 Ga0495625_0203186_401_985 191
639 3300046664 Ga0495659_0000019 Ga0495659_0000019_7540_8124 191
640 3300046664 Ga0495659_0001683 Ga0495659_0001683_97_681 191
641 3300046664 Ga0495659_0009447 Ga0495659_0009447_1830_2414 191
642 3300046664 Ga0495659_0020073 Ga0495659_0020073_903_1487 191
643 3300046665 Ga0495661_0000151 Ga0495661_0000151_4307_4885 191
644 3300046665 Ga0495661_0000590 Ga0495661_0000590_3014_3598 191
645 3300046665 Ga0495661_0012488 Ga0495661_0012488_1042_1626 191
646 3300046665 Ga0495661_0020506 Ga0495661_0020506_2075_2659 191
647 3300046665 Ga0495661_0023945 Ga0495661_0023945_160_738 191
648 3300046665 Ga0495661_0028727 Ga0495661_0028727_2083_2667 191
649 3300046665 Ga0495661_0039994 Ga0495661_0039994_406_990 191
650 3300046665 Ga0495661_0043396 Ga0495661_0043396_1714_2295 191
651 3300046665 Ga0495661_0166458 Ga0495661_0166458_152_736 191
652 3300046665 Ga0495661_0213394 Ga0495661_0213394_227_811 191
653 3300046674 Ga0495588_0000086 Ga0495588_0000086_110220_110798 191
654 3300046674 Ga0495588_0011973 Ga0495588_0011973_1166_1750 191
655 3300046674 Ga0495588_0058010 Ga0495588_0058010_681_1265 191
656 3300046674 Ga0495588_0116559 Ga0495588_0116559_51_632 191
657 3300046679 Ga0495623_0048369 Ga0495623_0048369_285_866 191
658 3300046684 Ga0495669_0093968 Ga0495669_0093968_18_602 191
659 3300046689 Ga0495613_0089487 Ga0495613_0089487_678_1259 191
660 3300046690 Ga0495624_0033919 Ga0495624_0033919_1284_1865 191
661 3300046691 Ga0495670_0000143 Ga0495670_0000143_21981_22565 191
662 3300046691 Ga0495670_0001120 Ga0495670_0001120_8528_9112 191
663 3300046691 Ga0495670_0010421 Ga0495670_0010421_2006_2590 191
664 3300046691 Ga0495670_0013539 Ga0495670_0013539_1680_2267 191
665 3300046691 Ga0495670_0035185 Ga0495670_0035185_162_746 191
666 3300046691 Ga0495670_0079714 Ga0495670_0079714_438_1022 191
667 3300046691 Ga0495670_0081229 Ga0495670_0081229_718_1302 191
668 3300046691 Ga0495670_0247697 Ga0495670_0247697_149_745 191
669 3300046692 Ga0495671_0000658 Ga0495671_0000658_6601_7185 191
670 3300046692 Ga0495671_0001049 Ga0495671_0001049_3848_4432 191
671 3300046692 Ga0495671_0031072 Ga0495671_0031072_1180_1761 191
672 3300046692 Ga0495671_0154071 Ga0495671_0154071_308_892 191
673 3300046694 Ga0495649_0015222 Ga0495649_0015222_2323_2919 191
674 3300046694 Ga0495649_0027732 Ga0495649_0027732_1942_2520 191
675 3300046794 Ga0495589_0000017 Ga0495589_0000017_121892_122470 191
676 3300046794 Ga0495589_0001742 Ga0495589_0001742_10875_11453 191
677 3300046794 Ga0495589_0011131 Ga0495589_0011131_2278_2862 191
678 3300046794 Ga0495589_0013061 Ga0495589_0013061_1137_1721 191
679 3300046794 Ga0495589_0020691 Ga0495589_0020691_997_1581 191
680 3300046794 Ga0495589_0022368 Ga0495589_0022368_2358_2945 191
681 3300046794 Ga0495589_0043009 Ga0495589_0043009_1622_2206 191
682 3300046794 Ga0495589_0082237 Ga0495589_0082237_148_732 191
683 3300046809 Ga0495600_0131479 Ga0495600_0131479_890_1474 191
684 3300046810 Ga0495660_0000067 Ga0495660_0000067_61316_61894 191
685 3300046810 Ga0495660_0007858 Ga0495660_0007858_4475_5071 191
686 3300046810 Ga0495660_0047272 Ga0495660_0047272_1231_1815 191
687 3300046810 Ga0495660_0059026 Ga0495660_0059026_1041_1619 191
688 3300046810 Ga0495660_0063365 Ga0495660_0063365_571_1155 191
689 3300046810 Ga0495660_0166579 Ga0495660_0166579_62_646 191
690 3300047315 Ga0495581_0018889 Ga0495581_0018889_749_1333 191
691 3300047315 Ga0495581_0055668 Ga0495581_0055668_748_1329 191
692 3300047317 Ga0495604_0246697 Ga0495604_0246697_73_657 191
693 3300047318 Ga0495636_0003301 Ga0495636_0003301_1354_1938 191
694 3300047318 Ga0495636_0004667 Ga0495636_0004667_1005_1592 191
695 3300047318 Ga0495636_0009037 Ga0495636_0009037_582_1166 191
696 3300047318 Ga0495636_0023781 Ga0495636_0023781_629_1213 191
697 3300047318 Ga0495636_0061353 Ga0495636_0061353_656_1240 191
698 3300047318 Ga0495636_0135464 Ga0495636_0135464_283_867 191
699 3300047319 Ga0495674_0221331 Ga0495674_0221331_819_1403 191
700 3300047320 Ga0495672_0000067 Ga0495672_0000067_171172_171756 191
701 3300047320 Ga0495672_0000343 Ga0495672_0000343_30845_31429 191
702 3300047320 Ga0495672_0000718 Ga0495672_0000718_22744_23328 191
703 3300047320 Ga0495672_0001478 Ga0495672_0001478_18128_18706 191
704 3300047320 Ga0495672_0052482 Ga0495672_0052482_510_1094 191
705 3300047320 Ga0495672_0128740 Ga0495672_0128740_95_679 191
706 3300047321 Ga0495676_0000067 Ga0495676_0000067_78712_79296 191
707 3300047321 Ga0495676_0028953 Ga0495676_0028953_3449_4033 191
708 3300047321 Ga0495676_0461324 Ga0495676_0461324_239_823 191
709 3300047323 Ga0495683_0000083 Ga0495683_0000083_47004_47588 191
710 3300047323 Ga0495683_0000348 Ga0495683_0000348_22704_23288 191
711 3300047323 Ga0495683_0002803 Ga0495683_0002803_8929_9513 191
712 3300047323 Ga0495683_0006314 Ga0495683_0006314_2517_3101 191
713 3300047323 Ga0495683_0019894 Ga0495683_0019894_1964_2548 191
714 3300047323 Ga0495683_0022607 Ga0495683_0022607_2176_2760 191
715 3300047323 Ga0495683_0057907 Ga0495683_0057907_1175_1759 191
716 3300047323 Ga0495683_0078187 Ga0495683_0078187_278_862 191
717 3300047443 Ga0495687_000033 Ga0495687_000033_62581_63159 191
718 3300047443 Ga0495687_000126 Ga0495687_000126_82068_82652 191
719 3300047443 Ga0495687_000640 Ga0495687_000640_8726_9304 191
720 3300047443 Ga0495687_008102 Ga0495687_008102_3053_3637 191
721 3300047443 Ga0495687_010751 Ga0495687_010751_1058_1654 191
722 3300047443 Ga0495687_010893 Ga0495687_010893_2699_3277 191
723 3300047444 Ga0495675_0030000 Ga0495675_0030000_2879_3460 191
724 3300047444 Ga0495675_0088516 Ga0495675_0088516_743_1324 191
725 3300047445 Ga0495677_0000002 Ga0495677_0000002_145986_146564 191
726 3300047445 Ga0495677_0005091 Ga0495677_0005091_1011_1595 191
727 3300047445 Ga0495677_0008164 Ga0495677_0008164_2362_2946 191
728 3300047445 Ga0495677_0014812 Ga0495677_0014812_1816_2400 191
729 3300047445 Ga0495677_0021668 Ga0495677_0021668_724_1308 191
730 3300047445 Ga0495677_0032123 Ga0495677_0032123_621_1205 191
731 3300047445 Ga0495677_0044837 Ga0495677_0044837_664_1242 191
732 3300047445 Ga0495677_0051623 Ga0495677_0051623_262_843 191
733 3300047445 Ga0495677_0098020 Ga0495677_0098020_177_764 191
734 3300047446 Ga0495679_008082 Ga0495679_008082_2311_2895 191
735 3300047447 Ga0495685_000053 Ga0495685_000053_27537_28121 191
736 3300047447 Ga0495685_004689 Ga0495685_004689_489_1073 191
737 3300047470 Ga0495681_0007275 Ga0495681_0007275_4612_5196 191
738 3300047470 Ga0495681_0030372 Ga0495681_0030372_1079_1666 191
739 3300047470 Ga0495681_0046396 Ga0495681_0046396_669_1253 191
740 3300047472 Ga0495686_0000628 Ga0495686_0000628_32553_33137 191
741 3300047472 Ga0495686_0033337 Ga0495686_0033337_2451_3035 191
742 3300047472 Ga0495686_0040123 Ga0495686_0040123_981_1565 191
743 3300047472 Ga0495686_0091644 Ga0495686_0091644_732_1316 191
744 3300047673 Ga0495593_0054376 Ga0495593_0054376_748_1329 191
745 3300048088 Ga0495602_0104784 Ga0495602_0104784_1705_2286 191
746 3300048089 Ga0495614_0018070 Ga0495614_0018070_96_680 191
747 3300048090 Ga0495615_0001150 Ga0495615_0001150_442_1026 191
748 3300048091 Ga0495626_0000097 Ga0495626_0000097_4526_5104 191
749 3300048091 Ga0495626_0000258 Ga0495626_0000258_29645_30223 191
750 3300048091 Ga0495626_0011560 Ga0495626_0011560_1813_2397 191
751 3300048091 Ga0495626_0016093 Ga0495626_0016093_3200_3784 191
752 3300048091 Ga0495626_0044605 Ga0495626_0044605_522_1106 191
753 3300048091 Ga0495626_0049911 Ga0495626_0049911_1026_1613 191
754 3300048091 Ga0495626_0059885 Ga0495626_0059885_820_1404 191
755 3300048091 Ga0495626_0145896 Ga0495626_0145896_139_723 191
756 3300048903 Ga0496100_0052012 Ga0496100_0052012_492_1076 191
757 3300048904 Ga0496101_0044781 Ga0496101_0044781_1454_2038 191
758 3300048905 Ga0496102_0000487 Ga0496102_0000487_6995_7579 191
759 3300048905 Ga0496102_0055639 Ga0496102_0055639_1892_2476 191
760 3300048905 Ga0496102_0420493 Ga0496102_0420493_399_986 191
761 3300048906 Ga0496103_0091804 Ga0496103_0091804_327_911 191
762 3300048906 Ga0496103_0231148 Ga0496103_0231148_314_898 191
763 3300048906 Ga0496103_0422697 Ga0496103_0422697_79_663 191
764 3300048906 Ga0496103_0450071 Ga0496103_0450071_212_790 191
765 3300048907 Ga0496104_0848884 Ga0496104_0848884_156_740 191
766 3300048909 Ga0496106_0006127 Ga0496106_0006127_4223_4801 191
767 3300048910 Ga0496107_0075821 Ga0496107_0075821_1823_2401 191
768 3300048911 Ga0496108_0711016 Ga0496108_0711016_187_771 191
769 3300048913 Ga0496110_0000024 Ga0496110_0000024_60591_61175 191
770 3300048913 Ga0496110_0570064 Ga0496110_0570064_150_734 191
771 3300048915 Ga0496112_0367515 Ga0496112_0367515_536_1114 191
772 3300048915 Ga0496112_0755078 Ga0496112_0755078_73_657 191
773 3300048916 Ga0496113_0019700 Ga0496113_0019700_1998_2576 191
774 3300048917 Ga0496114_0067969 Ga0496114_0067969_833_1411 191
775 3300048918 Ga0496115_0026659 Ga0496115_0026659_439_1020 191
776 3300048918 Ga0496115_0056234 Ga0496115_0056234_1081_1665 191
777 3300048918 Ga0496115_0082225 Ga0496115_0082225_1433_2017 191
778 3300048918 Ga0496115_0215720 Ga0496115_0215720_262_849 191
779 3300048918 Ga0496115_0555710 Ga0496115_0555710_159_740 191
780 3300048924 Ga0496121_0514578 Ga0496121_0514578_139_723 191
781 3300048925 Ga0496122_0000439 Ga0496122_0000439_81671_82255 191
782 3300048925 Ga0496122_0002153 Ga0496122_0002153_5569_6147 191
783 3300048925 Ga0496122_0011837 Ga0496122_0011837_2646_3224 191
784 3300048926 Ga0496123_0000487 Ga0496123_0000487_3953_4537 191
785 3300048926 Ga0496123_0022480 Ga0496123_0022480_2366_2944 191
786 3300048927 Ga0496124_0016901 Ga0496124_0016901_2667_3245 191
787 3300048927 Ga0496124_0023141 Ga0496124_0023141_4941_5525 191
788 3300048927 Ga0496124_0045759 Ga0496124_0045759_142_720 191
789 3300048927 Ga0496124_0076458 Ga0496124_0076458_1666_2250 191
790 3300048927 Ga0496124_0303252 Ga0496124_0303252_84_662 191
791 3300048928 Ga0496125_0182288 Ga0496125_0182288_685_1263 191
792 3300048928 Ga0496125_0246345 Ga0496125_0246345_477_1055 191
793 3300049128 Ga0501308_013232 Ga0501308_013232_265_849 191
794 3300049160 Ga0501304_003196 Ga0501304_003196_533_1111 191
795 3300049459 Ga0495678_000355 Ga0495678_000355_16254_16838 191
796 3300049459 Ga0495678_004358 Ga0495678_004358_2066_2650 191
797 3300049460 Ga0495682_0000779 Ga0495682_0000779_11695_12279 191
798 3300049460 Ga0495682_0001850 Ga0495682_0001850_8094_8678 191
799 3300049460 Ga0495682_0002874 Ga0495682_0002874_7309_7893 191
800 3300049460 Ga0495682_0004757 Ga0495682_0004757_4032_4616 191
801 3300049654 Ga0501207_006845 Ga0501207_006845_1001_1588 191
802 3300049822 Ga0501035_0005808 Ga0501035_0005808_7923_8501 191
803 3300053118 Ga0500594_0017715 Ga0500594_0017715_859_1455 191
804 3300053125 Ga0500618_000301 Ga0500618_000301_18441_19037 191
805 3300053125 Ga0500618_000821 Ga0500618_000821_10962_11555 191
806 3300059490 Ga0587066_089812 Ga0587066_089812_41_619 191
807 3300059503 Ga0587080_010270 Ga0587080_010270_788_1366 191
808 3300059510 Ga0587090_013222 Ga0587090_013222_211_789 191
809 3300059511 Ga0587091_019940 Ga0587091_019940_336_914 191
810 3300059605 Ga0587106_021228 Ga0587106_021228_105_683 191
811 3300059623 Ga0587101_054991 Ga0587101_054991_73_651 191
812 3300059640 Ga0587067_015649 Ga0587067_015649_119_697 191
813 3300059642 Ga0587069_022812 Ga0587069_022812_75_653 191
814 3300059643 Ga0587072_025780 Ga0587072_025780_205_783 191
815 3300059647 Ga0587079_043002 Ga0587079_043002_58_636 191
816 3300059651 Ga0587105_003927 Ga0587105_003927_103_681 191
817 3300060344 Ga0587071_065599 Ga0587071_065599_82_660 191
818 3300061719 Ga0466962_0032893 Ga0466962_0032893_1510_2085 191
819 3300061719 Ga0466962_0091908 Ga0466962_0091908_171_749 191
820 iso_pu_bacteria 2818991436 2819543187 191
821 3300003771 Ga0055526_1001163 Ga0055526_10011638 192
822 3300003773 Ga0055537_1000678 Ga0055537_100067811 192
823 3300003775 Ga0055524_1013711 Ga0055524_10137113 192
824 3300003784 Ga0055534_1000195 Ga0055534_100019521 192
825 3300003790 Ga0055528_1000368 Ga0055528_100036810 192
826 3300005339 Ga0070660_100000420 Ga0070660_1000004208 192
827 3300005344 Ga0070661_100098624 Ga0070661_1000986241 192
828 3300005366 Ga0070659_100115125 Ga0070659_1001151252 192
829 3300005455 Ga0070663_100390729 Ga0070663_1003907292 192
830 3300005564 Ga0070664_100057458 Ga0070664_1000574582 192
831 3300005614 Ga0068856_100506920 Ga0068856_1005069201 192
832 3300015262 Ga0182007_10115956 Ga0182007_101159561 192
833 3300021361 Ga0213872_10001513 Ga0213872_100015134 192
834 3300025233 Ga0209437_108693 Ga0209437_1086932 192
835 3300025250 Ga0209026_1009492 Ga0209026_10094922 192
836 3300025263 Ga0209565_1000015 Ga0209565_100001543 192
837 3300025272 Ga0209455_1000169 Ga0209455_10001698 192
838 3300025273 Ga0209673_1000394 Ga0209673_100039443 192
839 3300025291 Ga0209675_1000012 Ga0209675_1000012439 192
840 3300025295 Ga0209564_1000016 Ga0209564_1000016552 192
841 3300025299 Ga0209256_1000076 Ga0209256_10000764 192
842 3300025302 Ga0207426_1054078 Ga0207426_10540781 192
843 3300025913 Ga0207695_10438637 Ga0207695_104386372 192
844 3300025919 Ga0207657_10001145 Ga0207657_1000114521 192
845 3300025920 Ga0207649_10026917 Ga0207649_100269172 192
846 3300025932 Ga0207690_10084366 Ga0207690_100843662 192
847 3300025945 Ga0207679_10019205 Ga0207679_100192056 192
848 3300026067 Ga0207678_10312327 Ga0207678_103123272 192
849 3300026078 Ga0207702_10478919 Ga0207702_104789192 192
850 3300037312 Ga0395899_0000753 Ga0395899_0000753_21566_22153 192
851 3300037312 Ga0395899_0012339 Ga0395899_0012339_807_1394 192
852 3300037312 Ga0395899_0013728 Ga0395899_0013728_4889_5476 192
853 3300037312 Ga0395899_0293240 Ga0395899_0293240_178_804 192
854 3300037418 Ga0395900_0008621 Ga0395900_0008621_9716_10303 192
855 3300037418 Ga0395900_0209971 Ga0395900_0209971_1122_1709 192
856 3300037418 Ga0395900_0323735 Ga0395900_0323735_447_1034 192
857 3300037466 Ga0395898_0075038 Ga0395898_0075038_2641_3228 192
858 3300037471 Ga0395905_0000905 Ga0395905_0000905_16860_17447 192
859 3300037471 Ga0395905_0001709 Ga0395905_0001709_14735_15322 192
860 3300037471 Ga0395905_0012941 Ga0395905_0012941_6199_6834 192
861 3300037471 Ga0395905_0013998 Ga0395905_0013998_5767_6354 192
862 3300037471 Ga0395905_0503627 Ga0395905_0503627_131_712 192
863 3300037471 Ga0395905_0623628 Ga0395905_0623628_250_840 192
864 3300038443 Ga0395901_0021000 Ga0395901_0021000_4818_5405 192
865 3300038443 Ga0395901_0346430 Ga0395901_0346430_807_1394 192
866 3300039447 Ga0436361_0458162 Ga0436361_0458162_543_1139 192
867 3300039447 Ga0436361_0938544 Ga0436361_0938544_25039_25635 192
868 3300042139 Ga0450904_000276 Ga0450904_000276_412_1008 192
869 3300044658 Ga0466972_0000087 Ga0466972_0000087_76324_76911 192
870 3300044658 Ga0466972_0006991 Ga0466972_0006991_1059_1646 192
871 3300044658 Ga0466972_0097290 Ga0466972_0097290_510_1097 192
872 3300044683 Ga0466965_0002700 Ga0466965_0002700_876_1463 192
873 3300044683 Ga0466965_0107579 Ga0466965_0107579_650_1237 192
874 3300044684 Ga0466966_0013678 Ga0466966_0013678_4257_4844 192
875 3300044706 Ga0466964_0206904 Ga0466964_0206904_186_773 192
876 3300044735 Ga0466968_0037123 Ga0466968_0037123_674_1261 192
877 3300046457 Ga0495590_0006267 Ga0495590_0006267_2416_2997 192
878 3300046460 Ga0495638_0050498 Ga0495638_0050498_999_1604 192
879 3300046463 Ga0495653_0144561 Ga0495653_0144561_430_1011 192
880 3300046463 Ga0495653_0169254 Ga0495653_0169254_720_1301 192
881 3300046471 Ga0495650_0000011 Ga0495650_0000011_418418_419002 192
882 3300046472 Ga0495580_0030809 Ga0495580_0030809_1518_2111 192
883 3300046473 Ga0495582_0017936 Ga0495582_0017936_2556_3149 192
884 3300046474 Ga0495605_0132566 Ga0495605_0132566_63_668 192
885 3300046491 Ga0495584_0021540 Ga0495584_0021540_2170_2775 192
886 3300046499 Ga0495594_0010511 Ga0495594_0010511_521_1114 192
887 3300046501 Ga0495607_0001966 Ga0495607_0001966_6976_7581 192
888 3300046506 Ga0495583_0015121 Ga0495583_0015121_2895_3500 192
889 3300046507 Ga0495606_0039821 Ga0495606_0039821_2544_3137 192
890 3300046513 Ga0495616_0044363 Ga0495616_0044363_743_1348 192
891 3300046517 Ga0495630_0009137 Ga0495630_0009137_2346_2939 192
892 3300046522 Ga0495643_0004464 Ga0495643_0004464_1160_1747 192
893 3300046524 Ga0495648_0313657 Ga0495648_0313657_68_673 192
894 3300046528 Ga0495642_0021157 Ga0495642_0021157_1281_1886 192
895 3300046529 Ga0495652_0005056 Ga0495652_0005056_7640_8233 192
896 3300046531 Ga0495665_0005554 Ga0495665_0005554_3879_4472 192
897 3300046535 Ga0495586_0019447 Ga0495586_0019447_1920_2513 192
898 3300046538 Ga0495609_0000163 Ga0495609_0000163_42386_42991 192
899 3300046542 Ga0495597_0006826 Ga0495597_0006826_3990_4577 192
900 3300046558 Ga0495633_0230476 Ga0495633_0230476_195_782 192
901 3300046642 Ga0495634_0015301 Ga0495634_0015301_1103_1696 192
902 3300046660 Ga0495625_0002543 Ga0495625_0002543_4884_5489 192
903 3300046664 Ga0495659_0000167 Ga0495659_0000167_5928_6533 192
904 3300046665 Ga0495661_0007238 Ga0495661_0007238_680_1285 192
905 3300046665 Ga0495661_0007385 Ga0495661_0007385_1912_2499 192
906 3300046665 Ga0495661_0165231 Ga0495661_0165231_111_707 192
907 3300046665 Ga0495661_0255821 Ga0495661_0255821_71_658 192
908 3300046674 Ga0495588_0034728 Ga0495588_0034728_1362_1955 192
909 3300046679 Ga0495623_0008207 Ga0495623_0008207_113_706 192
910 3300046679 Ga0495623_0041958 Ga0495623_0041958_1223_1804 192
911 3300046684 Ga0495669_0026346 Ga0495669_0026346_1548_2153 192
912 3300046694 Ga0495649_0009418 Ga0495649_0009418_1438_2043 192
913 3300046809 Ga0495600_0006403 Ga0495600_0006403_1101_1694 192
914 3300047317 Ga0495604_0034285 Ga0495604_0034285_1110_1703 192
915 3300047318 Ga0495636_0000388 Ga0495636_0000388_5760_6365 192
916 3300047443 Ga0495687_000252 Ga0495687_000252_57622_58218 192
917 3300047443 Ga0495687_022520 Ga0495687_022520_893_1480 192
918 3300047444 Ga0495675_0003787 Ga0495675_0003787_4080_4673 192
919 3300047445 Ga0495677_0008034 Ga0495677_0008034_388_993 192
920 3300047446 Ga0495679_034537 Ga0495679_034537_105_710 192
921 3300047447 Ga0495685_000183 Ga0495685_000183_3972_4577 192
922 3300047470 Ga0495681_0032989 Ga0495681_0032989_806_1411 192
923 3300048088 Ga0495602_0159563 Ga0495602_0159563_464_1045 192
924 3300048090 Ga0495615_0029638 Ga0495615_0029638_439_1041 192
925 3300048903 Ga0496100_0159307 Ga0496100_0159307_372_971 192
926 3300048904 Ga0496101_0092574 Ga0496101_0092574_136_723 192
927 3300048910 Ga0496107_0293454 Ga0496107_0293454_399_986 192
928 3300048911 Ga0496108_0217414 Ga0496108_0217414_315_902 192
929 3300048912 Ga0496109_0068134 Ga0496109_0068134_700_1287 192
930 3300048913 Ga0496110_0104634 Ga0496110_0104634_309_896 192
931 3300048914 Ga0496111_0635735 Ga0496111_0635735_65_652 192
932 3300049459 Ga0495678_001074 Ga0495678_001074_19526_20110 192
933 3300049459 Ga0495678_015158 Ga0495678_015158_942_1526 192
934 3300053083 Ga0495655_0154964 Ga0495655_0154964_92_679 192
935 3300053156 Ga0500622_0279307 Ga0500622_0279307_62_649 192
936 3300059491 Ga0587070_012124 Ga0587070_012124_459_1046 192
937 3300059493 Ga0587077_006576 Ga0587077_006576_203_790 192
938 3300059493 Ga0587077_025555 Ga0587077_025555_262_849 192
939 3300059505 Ga0587083_0023065 Ga0587083_0023065_437_1024 192
940 3300059506 Ga0587085_003884 Ga0587085_003884_134_721 192
941 3300059507 Ga0587086_011885 Ga0587086_011885_435_1022 192
942 3300059510 Ga0587090_001134 Ga0587090_001134_1299_1886 192
943 3300059511 Ga0587091_019150 Ga0587091_019150_217_804 192
944 3300059624 Ga0587109_014206 Ga0587109_014206_499_1086 192
945 3300059627 Ga0587117_016597 Ga0587117_016597_261_848 192
946 3300059639 Ga0587062_011715 Ga0587062_011715_426_1013 192
947 3300059640 Ga0587067_020457 Ga0587067_020457_416_1003 192
948 3300059641 Ga0587068_016177 Ga0587068_016177_467_1054 192
949 3300059642 Ga0587069_016163 Ga0587069_016163_269_856 192
950 3300059643 Ga0587072_005287 Ga0587072_005287_379_966 192
951 3300059646 Ga0587078_011383 Ga0587078_011383_343_981 192
952 3300060346 Ga0587111_0001153 Ga0587111_0001153_647_1234 192
953 iso_pu_bacteria 2511231003 2511250064 192
954 iso_pu_bacteria 2818991445 2819592044 192
955 iso_pu_bacteria 2884811622 2884813179 192
956 iso_pu_bacteria 2884836552 2884840539 192
957 iso_pu_bacteria 2884852848 2884855796 192
958 iso_pu_bacteria 2896154374 2896157279 192
959 3300005337 Ga0070682_100516816 Ga0070682_1005168161 193
960 3300046460 Ga0495638_0045252 Ga0495638_0045252_1930_2526 193
961 3300048091 Ga0495626_0000209 Ga0495626_0000209_4301_4894 193
962 3300046522 Ga0495643_0000200 Ga0495643_0000200_27607_28212 194
963 3300002737 JGI25162J39368_1000026 JGI25162J39368_1000026186 195
964 3300003214 JGI25165J46597_1000031 JGI25165J46597_100003160 195
965 3300003544 Ga0007417J51691_1071950 Ga0007417J51691_10719502 195
966 3300003577 Ga0007416J51690_1059972 Ga0007416J51690_10599721 195
967 3300003693 Ga0032354_1079230 Ga0032354_10792301 195
968 3300003751 Ga0055538_1000018 Ga0055538_100001860 195
969 3300003752 Ga0055539_1000023 Ga0055539_100002360 195
970 3300003756 Ga0055533_1000031 Ga0055533_1000031234 195
971 3300003759 Ga0055525_1000039 Ga0055525_100003960 195
972 3300003841 Ga0055541_1000016 Ga0055541_100001660 195
973 3300015262 Ga0182007_10031167 Ga0182007_100311672 195
974 3300015265 Ga0182005_1003156 Ga0182005_10031563 195
975 3300025207 Ga0209760_100622 Ga0209760_1006221 195
976 3300025224 Ga0209784_100027 Ga0209784_10002761 195
977 3300025225 Ga0209566_100027 Ga0209566_10002761 195
978 3300025226 Ga0209674_100044 Ga0209674_10004461 195
979 3300025230 Ga0209563_100048 Ga0209563_10004861 195
980 3300025231 Ga0207427_100643 Ga0207427_1006432 195
981 3300025233 Ga0209437_100055 Ga0209437_10005561 195
982 3300025253 Ga0209677_100028 Ga0209677_10002861 195
983 3300025261 Ga0209233_1000070 Ga0209233_100007061 195
984 3300046454 Ga0495592_0003280 Ga0495592_0003280_3049_3657 195
985 3300046454 Ga0495592_0405274 Ga0495592_0405274_151_756 195
986 3300046462 Ga0495651_0015119 Ga0495651_0015119_4441_5046 195
987 3300046462 Ga0495651_0058856 Ga0495651_0058856_439_1047 195
988 3300046463 Ga0495653_0002089 Ga0495653_0002089_10123_10731 195
989 3300046511 Ga0495608_0001512 Ga0495608_0001512_2923_3531 195
990 3300046511 Ga0495608_0013677 Ga0495608_0013677_3878_4483 195
991 3300046516 Ga0495628_0004339 Ga0495628_0004339_2726_3334 195
992 3300046516 Ga0495628_0018273 Ga0495628_0018273_2944_3549 195
993 3300046529 Ga0495652_0019388 Ga0495652_0019388_1810_2418 195
994 3300046529 Ga0495652_0049462 Ga0495652_0049462_2185_2790 195
995 3300046543 Ga0495645_0042584 Ga0495645_0042584_664_1272 195
996 3300046557 Ga0495622_0039180 Ga0495622_0039180_1127_1735 195
997 3300046675 Ga0495657_0058805 Ga0495657_0058805_434_1042 195
998 3300046678 Ga0495599_0003514 Ga0495599_0003514_2781_3389 195
999 3300046679 Ga0495623_0011302 Ga0495623_0011302_130_735 195
1000 3300046679 Ga0495623_0035632 Ga0495623_0035632_1772_2380 195
1001 3300046690 Ga0495624_0036132 Ga0495624_0036132_1801_2409 195
1002 3300046809 Ga0495600_0000834 Ga0495600_0000834_13914_14522 195
1003 3300047317 Ga0495604_0004591 Ga0495604_0004591_974_1582 195
1004 3300048088 Ga0495602_0024798 Ga0495602_0024798_3805_4413 195
1005 3300048917 Ga0496114_0047812 Ga0496114_0047812_1496_2092 195
1006 3300048928 Ga0496125_0001079 Ga0496125_0001079_11635_12231 195
1007 3300053077 Ga0495601_0021365 Ga0495601_0021365_2722_3330 195
1008 3300053077 Ga0495601_0323983 Ga0495601_0323983_374_979 195
1009 3300053141 Ga0500574_000358 Ga0500574_000358_2801_3409 195
1010 3300002704 JGI25155J39150_1000363 JGI25155J39150_10003634 196
1011 3300002704 JGI25155J39150_1000557 JGI25155J39150_10005576 196
1012 3300002705 JGI25156J39149_1000170 JGI25156J39149_100017031 196
1013 3300002705 JGI25156J39149_1001095 JGI25156J39149_10010954 196
1014 3300002737 JGI25162J39368_1010038 JGI25162J39368_10100382 196
1015 3300002738 JGI25154J39366_1000351 JGI25154J39366_100035114 196
1016 3300002738 JGI25154J39366_1000415 JGI25154J39366_100041511 196
1017 3300002741 JGI25157J39369_1000170 JGI25157J39369_100017040 196
1018 3300002741 JGI25157J39369_1000605 JGI25157J39369_100060511 196
1019 3300003758 Ga0055532_1000017 Ga0055532_1000017142 196
1020 3300005563 Ga0068855_100018683 Ga0068855_1000186836 196
1021 3300005616 Ga0068852_100220358 Ga0068852_1002203582 196
1022 3300009011 Ga0105251_10236994 Ga0105251_102369941 196
1023 3300009093 Ga0105240_10009083 Ga0105240_1000908311 196
1024 3300009093 Ga0105240_10011970 Ga0105240_100119707 196
1025 3300009545 Ga0105237_10259678 Ga0105237_102596782 196
1026 3300009551 Ga0105238_10233962 Ga0105238_102339622 196
1027 3300013100 Ga0157373_10037009 Ga0157373_100370094 196
1028 3300014497 Ga0182008_10057555 Ga0182008_100575552 196
1029 3300025206 Ga0209435_100015 Ga0209435_100015157 196
1030 3300025206 Ga0209435_100161 Ga0209435_10016111 196
1031 3300025229 Ga0209147_100004 Ga0209147_1000041069 196
1032 3300025233 Ga0209437_100045 Ga0209437_100045378 196
1033 3300025242 Ga0209258_100226 Ga0209258_10022658 196
1034 3300025246 Ga0209646_1000020 Ga0209646_1000020141 196
1035 3300025246 Ga0209646_1000040 Ga0209646_1000040187 196
1036 3300025250 Ga0209026_1000034 Ga0209026_1000034132 196
1037 3300025250 Ga0209026_1016102 Ga0209026_10161022 196
1038 3300025256 Ga0209759_1000049 Ga0209759_100004971 196
1039 3300025256 Ga0209759_1000357 Ga0209759_100035744 196
1040 3300025272 Ga0209455_1008089 Ga0209455_10080894 196
1041 3300025913 Ga0207695_10001341 Ga0207695_1000134115 196
1042 3300025914 Ga0207671_10307253 Ga0207671_103072532 196
1043 3300025924 Ga0207694_10189850 Ga0207694_101898502 196
1044 3300025949 Ga0207667_10217165 Ga0207667_102171652 196
1045 3300026142 Ga0207698_10158976 Ga0207698_101589762 196
1046 3300046660 Ga0495625_0005310 Ga0495625_0005310_11095_11685 196
1047 3300048919 Ga0496116_0026481 Ga0496116_0026481_3630_4220 196
1048 3300048921 Ga0496118_0131119 Ga0496118_0131119_603_1193 196
1049 3300048924 Ga0496121_0154136 Ga0496121_0154136_180_770 196
1050 3300048925 Ga0496122_0004757 Ga0496122_0004757_11319_11909 196
1051 3300048926 Ga0496123_0003789 Ga0496123_0003789_11293_11883 196
1052 3300048928 Ga0496125_0003984 Ga0496125_0003984_9879_10469 196
1053 3300048928 Ga0496125_0099527 Ga0496125_0099527_1405_1995 196
1054 iso_pu_bacteria 2548876994 2550693247 196

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00929

RNase_T

Exonuclease

53

215

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cy4-assembly1.cif.gz_B crystal structure of an oligoribonuclease from acinetobacter baumannii 0.9744 20 193
3tr8-assembly1.cif.gz_B structure of an oligoribonuclease (orn) from coxiella burnetii 0.9732 18 196
5cy4-assembly2.cif.gz_C crystal structure of an oligoribonuclease from acinetobacter baumannii 0.973 20 193
6n6h-assembly1.cif.gz_A vibrio cholerae oligoribonuclease bound to pcpu 0.9726 18 196
5cy4-assembly3.cif.gz_E crystal structure of an oligoribonuclease from acinetobacter baumannii 0.9713 20 193
ID Description Score Start End Superfamily
af_P9WIU1_1_181_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9546 19 192 3.30.420.10
af_Q556Y2_11_190_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9441 21 195 3.30.420.10
af_Q17819_4_192_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9431 21 196 3.30.420.10
af_Q6K4V8_62_244_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9364 20 196 3.30.420.10
1ytaA00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9199 18 196 3.30.420.10
ID Description Score Start End GO Terms
AF-X1BLJ9-F1-model_v4 Exonuclease domain-containing protein 0.995 20 112 GO:0000175
GO:0003676
AF-A0A353PFZ1-F1-model_v4 Oligoribonuclease 0.9949 18 115 GO:0003676
GO:0004527
GO:0006259
AF-A0A3D2DDW7-F1-model_v4 deleted 0.9944 18 113
AF-U6CZQ9-F1-model_v4 Oligoribonuclease, mitochondrial 0.9895 21 113 GO:0000175
GO:0003676
GO:0005739
AF-A0A227J347-F1-model_v4 Oligoribonuclease 0.9894 19 99 GO:0000175
GO:0003676
GO:0006259

Feature Viewer

pLDDT pTM Quality
90.45 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map