F489136
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1054 | 395 | 1013 | 193 |
Family's Representative Sequence
| Representative Sequence | 3300046674|Ga0495588_0014347|Ga0495588_0014347_142_819 |
| Length | 225 |
| Sequence | LAEKRSCTLVQRASQAESATRSRFGEPSTKERIMSQETQAASATPRPNDMNLVWLDMEMTGLDPDNDRIIEVAVVVTDAELNILAEGPVFAIHQSDETLDKMDNWNKGTHGKSGLIDRVKASTVNEAQAEEQLIAFLKQWVPANKSPMCGNSICQDRRFMARGMPKLEAFFHYRNLDVSTLKELCRRWKPELASGFKKHQKHTALADIVESIEELRYYREHFIKL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 2 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 3 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 4 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 5 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 6 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 7 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 8 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 9 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 10 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 11 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 12 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 13 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 14 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 15 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 16 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 17 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 18 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 19 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 20 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 21 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 22 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 23 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 24 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 25 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 26 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 27 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 28 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 29 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 30 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 31 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 32 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 33 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 34 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 35 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 36 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 37 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 38 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 39 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 40 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 41 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 42 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 43 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 44 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 45 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 46 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 47 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 48 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 49 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 50 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 51 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 52 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 53 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 54 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 55 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 56 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 57 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 58 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 59 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 60 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 61 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 62 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 63 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 64 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 65 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 66 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 67 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 73 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 80 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 85 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 88 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 90 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 91 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 92 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 93 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 94 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 95 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 96 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 97 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 98 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 99 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 100 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 101 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 102 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 103 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 104 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 105 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 107 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 109 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 110 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 128 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 130 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 132 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 133 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 134 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 146 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 147 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 150 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 191 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 195 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 196 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 197 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 198 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 199 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 200 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 201 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 202 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 203 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 204 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 206 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 207 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 208 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 209 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 210 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 211 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 212 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 213 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 214 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 215 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 216 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 217 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 218 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 219 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 220 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 221 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 222 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 223 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 224 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 225 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 226 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 227 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 228 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 229 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 230 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 231 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 232 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 233 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 234 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 235 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 236 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 327 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 328 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 329 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 330 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 331 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 334 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 335 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 336 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 337 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 338 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 339 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 340 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 341 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 342 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 343 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 344 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 345 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 346 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 347 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 353 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 354 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 355 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 356 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 358 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 359 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 362 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 363 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 364 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 365 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 366 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 367 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 368 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 369 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 370 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 371 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 395 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.69 |
| Metatranscriptomes | 3.42 |
| Isolates | 3.89 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.78 |
| Nodule | 0.57 |
| Rhizoplane | 3.42 |
| Rhizosphere | 81.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000363 | 3300002704 | Bacteria | 13840 |
| 2 | JGI25155J39150_1000557 | 3300002704 | Bacteria | 8407 |
| 3 | JGI25156J39149_1000170 | 3300002705 | Bacteria | 47634 |
| 4 | JGI25156J39149_1001095 | 3300002705 | Bacteria | 12376 |
| 5 | JGI25162J39368_1000026 | 3300002737 | Bacteria | 227710 |
| 6 | JGI25162J39368_1010038 | 3300002737 | Bacteria | 1223 |
| 7 | JGI25154J39366_1000351 | 3300002738 | Bacteria | 26227 |
| 8 | JGI25154J39366_1000415 | 3300002738 | Bacteria | 22969 |
| 9 | JGI25157J39369_1000170 | 3300002741 | Bacteria | 54809 |
| 10 | JGI25157J39369_1000605 | 3300002741 | Bacteria | 20744 |
| 11 | JGI25159J45721_1004210 | 3300002987 | Bacteria | 4850 |
| 12 | JGI25159J45721_1008279 | 3300002987 | Bacteria | 2875 |
| 13 | JGI25165J46597_1000031 | 3300003214 | Bacteria | 296858 |
| 14 | JGI25161J50226_1001131 | 3300003374 | Bacteria | 8930 |
| 15 | Ga0007417J51691_1071950 | 3300003544 | Bacteria | 1190 |
| 16 | Ga0007416J51690_1059972 | 3300003577 | Bacteria | 870 |
| 17 | Ga0032354_1079230 | 3300003693 | Bacteria | 1120 |
| 18 | Ga0055538_1000018 | 3300003751 | Bacteria | 296858 |
| 19 | Ga0055539_1000023 | 3300003752 | Bacteria | 296858 |
| 20 | Ga0055533_1000031 | 3300003756 | Bacteria | 296858 |
| 21 | Ga0055532_1000017 | 3300003758 | Bacteria | 306880 |
| 22 | Ga0055525_1000029 | 3300003759 | Bacteria | 320663 |
| 23 | Ga0055525_1000039 | 3300003759 | Bacteria | 296858 |
| 24 | Ga0055542_1021560 | 3300003762 | Bacteria | 927 |
| 25 | Ga0055526_1000068 | 3300003771 | Bacteria | 98723 |
| 26 | Ga0055526_1001163 | 3300003771 | Bacteria | 19080 |
| 27 | Ga0055526_1005093 | 3300003771 | Bacteria | 7667 |
| 28 | Ga0055526_1007187 | 3300003771 | Bacteria | 5855 |
| 29 | Ga0055537_1000678 | 3300003773 | Bacteria | 17886 |
| 30 | Ga0055524_1000021 | 3300003775 | Bacteria | 227578 |
| 31 | Ga0055524_1003016 | 3300003775 | Bacteria | 8340 |
| 32 | Ga0055524_1005587 | 3300003775 | Bacteria | 5584 |
| 33 | Ga0055524_1013711 | 3300003775 | Bacteria | 3043 |
| 34 | Ga0055534_1000195 | 3300003784 | Bacteria | 44284 |
| 35 | Ga0055534_1004625 | 3300003784 | Bacteria | 3918 |
| 36 | Ga0055528_1000368 | 3300003790 | Bacteria | 36674 |
| 37 | Ga0055530_10003380 | 3300003791 | Bacteria | 9123 |
| 38 | Ga0055541_1000016 | 3300003841 | Bacteria | 296861 |
| 39 | Ga0055543_1001470 | 3300004625 | Bacteria | 9303 |
| 40 | Ga0065165_1004144 | 3300005262 | Bacteria | 9303 |
| 41 | Ga0065165_1046881 | 3300005262 | Bacteria | 1251 |
| 42 | Ga0070658_10447686 | 3300005327 | Bacteria | 1112 |
| 43 | Ga0070670_100000017 | 3300005331 | Bacteria | 224429 |
| 44 | Ga0070670_100008239 | 3300005331 | Bacteria | 8877 |
| 45 | Ga0070666_10001017 | 3300005335 | Bacteria | 17184 |
| 46 | Ga0070666_10403118 | 3300005335 | Bacteria | 983 |
| 47 | Ga0070682_100516816 | 3300005337 | Bacteria | 928 |
| 48 | Ga0070660_100000420 | 3300005339 | Bacteria | 28168 |
| 49 | Ga0070660_100018151 | 3300005339 | Bacteria | 5135 |
| 50 | Ga0070660_100081746 | 3300005339 | Bacteria | 2536 |
| 51 | Ga0070660_100422141 | 3300005339 | Bacteria | 1104 |
| 52 | Ga0070689_100111630 | 3300005340 | Bacteria | 2175 |
| 53 | Ga0070661_100098624 | 3300005344 | Bacteria | 2170 |
| 54 | Ga0070661_100127414 | 3300005344 | Bacteria | 1910 |
| 55 | Ga0070668_100007166 | 3300005347 | Bacteria | 8265 |
| 56 | Ga0070669_100028281 | 3300005353 | Bacteria | 4037 |
| 57 | Ga0070669_100039493 | 3300005353 | Bacteria | 3430 |
| 58 | Ga0070675_100029487 | 3300005354 | Bacteria | 4426 |
| 59 | Ga0070671_100000173 | 3300005355 | Bacteria | 42660 |
| 60 | Ga0070671_100099885 | 3300005355 | Bacteria | 2434 |
| 61 | Ga0070673_100010734 | 3300005364 | Bacteria | 6213 |
| 62 | Ga0070688_100003318 | 3300005365 | Bacteria | 8251 |
| 63 | Ga0070688_100019613 | 3300005365 | Bacteria | 3920 |
| 64 | Ga0070659_100115125 | 3300005366 | Bacteria | 2173 |
| 65 | Ga0070659_100117647 | 3300005366 | Bacteria | 2149 |
| 66 | Ga0070659_100170659 | 3300005366 | Bacteria | 1782 |
| 67 | Ga0070667_100001097 | 3300005367 | Bacteria | 24823 |
| 68 | Ga0070667_100003801 | 3300005367 | Bacteria | 12845 |
| 69 | Ga0070663_100390729 | 3300005455 | Bacteria | 1135 |
| 70 | Ga0070678_100004615 | 3300005456 | Bacteria | 7827 |
| 71 | Ga0068867_100003865 | 3300005459 | Bacteria | 10535 |
| 72 | Ga0070685_10000026 | 3300005466 | Bacteria | 98490 |
| 73 | Ga0070685_10172828 | 3300005466 | Bacteria | 1386 |
| 74 | Ga0070665_100285816 | 3300005548 | Bacteria | 1651 |
| 75 | Ga0068855_100001073 | 3300005563 | Bacteria | 33944 |
| 76 | Ga0068855_100018683 | 3300005563 | Bacteria | 8336 |
| 77 | Ga0068855_100206715 | 3300005563 | Bacteria | 2208 |
| 78 | Ga0068855_100544190 | 3300005563 | Bacteria | 1257 |
| 79 | Ga0070664_100029568 | 3300005564 | Bacteria | 4568 |
| 80 | Ga0070664_100057458 | 3300005564 | Bacteria | 3307 |
| 81 | Ga0070664_100100244 | 3300005564 | Bacteria | 2518 |
| 82 | Ga0068857_100708483 | 3300005577 | Bacteria | 957 |
| 83 | Ga0068854_100006965 | 3300005578 | Bacteria | 7213 |
| 84 | Ga0068856_100506920 | 3300005614 | Bacteria | 1228 |
| 85 | Ga0068856_100833244 | 3300005614 | Bacteria | 942 |
| 86 | Ga0068852_100220358 | 3300005616 | Bacteria | 1804 |
| 87 | Ga0068852_100574624 | 3300005616 | Bacteria | 1129 |
| 88 | Ga0068859_100317621 | 3300005617 | Bacteria | 1651 |
| 89 | Ga0068864_100000029 | 3300005618 | Bacteria | 224429 |
| 90 | Ga0068861_100127381 | 3300005719 | Bacteria | 2062 |
| 91 | Ga0068851_10336586 | 3300005834 | Bacteria | 875 |
| 92 | Ga0068863_100600276 | 3300005841 | Bacteria | 1089 |
| 93 | Ga0068858_100133592 | 3300005842 | Bacteria | 2327 |
| 94 | Ga0068860_100000228 | 3300005843 | Bacteria | 86756 |
| 95 | Ga0068860_101144895 | 3300005843 | Bacteria | 798 |
| 96 | Ga0068862_100069792 | 3300005844 | Bacteria | 3033 |
| 97 | Ga0068862_100089363 | 3300005844 | Bacteria | 2681 |
| 98 | Ga0075365_10197172 | 3300006038 | Bacteria | 1410 |
| 99 | Ga0075364_10446427 | 3300006051 | Bacteria | 883 |
| 100 | Ga0075367_10558457 | 3300006178 | Bacteria | 727 |
| 101 | Ga0075366_10026204 | 3300006195 | Bacteria | 3414 |
| 102 | Ga0097621_100441709 | 3300006237 | Bacteria | 1171 |
| 103 | Ga0068871_100939794 | 3300006358 | Bacteria | 803 |
| 104 | Ga0097620_100317629 | 3300006931 | Bacteria | 1651 |
| 105 | Ga0079104_1008344 | 3300006946 | Bacteria | 3639 |
| 106 | Ga0099826_10000041 | 3300006948 | Bacteria | 96536 |
| 107 | Ga0105251_10236994 | 3300009011 | Bacteria | 822 |
| 108 | Ga0105240_10009083 | 3300009093 | Bacteria | 14111 |
| 109 | Ga0105240_10011970 | 3300009093 | Bacteria | 12023 |
| 110 | Ga0105240_10020783 | 3300009093 | Bacteria | 8745 |
| 111 | Ga0105241_10016300 | 3300009174 | Bacteria | 5446 |
| 112 | Ga0105248_10006207 | 3300009177 | Bacteria | 13098 |
| 113 | Ga0105237_10135525 | 3300009545 | Bacteria | 2457 |
| 114 | Ga0105237_10259678 | 3300009545 | Bacteria | 1740 |
| 115 | Ga0105238_10000065 | 3300009551 | Bacteria | 121196 |
| 116 | Ga0105238_10150406 | 3300009551 | Bacteria | 2303 |
| 117 | Ga0105238_10233962 | 3300009551 | Bacteria | 1814 |
| 118 | Ga0105238_10262147 | 3300009551 | Bacteria | 1708 |
| 119 | Ga0105249_10901723 | 3300009553 | Bacteria | 951 |
| 120 | Ga0105239_10009136 | 3300010375 | Bacteria | 11211 |
| 121 | Ga0105239_10457761 | 3300010375 | Bacteria | 1448 |
| 122 | Ga0105239_11353967 | 3300010375 | Bacteria | 821 |
| 123 | Ga0157373_10037009 | 3300013100 | Bacteria | 3501 |
| 124 | Ga0157371_10000013 | 3300013102 | Bacteria | 352631 |
| 125 | Ga0157371_10374609 | 3300013102 | Bacteria | 1039 |
| 126 | Ga0157374_10014078 | 3300013296 | Bacteria | 6993 |
| 127 | Ga0157378_10351285 | 3300013297 | Bacteria | 1440 |
| 128 | Ga0157378_10667619 | 3300013297 | Bacteria | 1056 |
| 129 | Ga0163162_10003303 | 3300013306 | Bacteria | 15434 |
| 130 | Ga0163162_10609494 | 3300013306 | Bacteria | 1217 |
| 131 | Ga0163163_10423409 | 3300014325 | Bacteria | 1390 |
| 132 | Ga0157380_10007300 | 3300014326 | Bacteria | 7844 |
| 133 | Ga0182008_10046094 | 3300014497 | Bacteria | 2167 |
| 134 | Ga0182008_10057555 | 3300014497 | Bacteria | 1919 |
| 135 | Ga0157379_10015472 | 3300014968 | Bacteria | 6695 |
| 136 | Ga0157379_10637077 | 3300014968 | Bacteria | 997 |
| 137 | Ga0182006_1016620 | 3300015261 | Bacteria | 3136 |
| 138 | Ga0182006_1029100 | 3300015261 | Bacteria | 2241 |
| 139 | Ga0182006_1050588 | 3300015261 | Bacteria | 1601 |
| 140 | Ga0182006_1174230 | 3300015261 | Bacteria | 719 |
| 141 | Ga0182007_10031167 | 3300015262 | Bacteria | 1818 |
| 142 | Ga0182007_10115956 | 3300015262 | Bacteria | 894 |
| 143 | Ga0182005_1003156 | 3300015265 | Bacteria | 5657 |
| 144 | Ga0163161_10032386 | 3300017792 | Bacteria | 3731 |
| 145 | Ga0213872_10000242 | 3300021361 | Bacteria | 48194 |
| 146 | Ga0213872_10000443 | 3300021361 | Bacteria | 33899 |
| 147 | Ga0213872_10001513 | 3300021361 | Bacteria | 14948 |
| 148 | Ga0213872_10001692 | 3300021361 | Bacteria | 13879 |
| 149 | Ga0213872_10019294 | 3300021361 | Bacteria | 3141 |
| 150 | Ga0213872_10019678 | 3300021361 | Bacteria | 3109 |
| 151 | Ga0213872_10044898 | 3300021361 | Bacteria | 2010 |
| 152 | Ga0213872_10091690 | 3300021361 | Bacteria | 1359 |
| 153 | Ga0213872_10108111 | 3300021361 | Bacteria | 1236 |
| 154 | Ga0213872_10156063 | 3300021361 | Bacteria | 995 |
| 155 | Ga0213876_10076148 | 3300021384 | Bacteria | 1772 |
| 156 | Ga0209435_100015 | 3300025206 | Bacteria | 321177 |
| 157 | Ga0209435_100161 | 3300025206 | Bacteria | 21397 |
| 158 | Ga0209760_100622 | 3300025207 | Bacteria | 6046 |
| 159 | Ga0209436_101543 | 3300025208 | Bacteria | 7827 |
| 160 | Ga0209784_100027 | 3300025224 | Bacteria | 363933 |
| 161 | Ga0209566_100027 | 3300025225 | Bacteria | 363933 |
| 162 | Ga0209674_100044 | 3300025226 | Bacteria | 363933 |
| 163 | Ga0209672_102164 | 3300025228 | Bacteria | 5179 |
| 164 | Ga0209147_100004 | 3300025229 | Bacteria | 1371850 |
| 165 | Ga0209563_100003 | 3300025230 | Bacteria | 1932942 |
| 166 | Ga0209563_100048 | 3300025230 | Bacteria | 363933 |
| 167 | Ga0207427_100643 | 3300025231 | Bacteria | 16924 |
| 168 | Ga0209437_100045 | 3300025233 | Bacteria | 429809 |
| 169 | Ga0209437_100055 | 3300025233 | Bacteria | 363933 |
| 170 | Ga0209437_108693 | 3300025233 | Bacteria | 1614 |
| 171 | Ga0209437_110183 | 3300025233 | Bacteria | 1444 |
| 172 | Ga0209258_100226 | 3300025242 | Bacteria | 106588 |
| 173 | Ga0209646_1000020 | 3300025246 | Bacteria | 462204 |
| 174 | Ga0209646_1000040 | 3300025246 | Bacteria | 347867 |
| 175 | Ga0209646_1000077 | 3300025246 | Bacteria | 208262 |
| 176 | Ga0209026_1000034 | 3300025250 | Bacteria | 306953 |
| 177 | Ga0209026_1009492 | 3300025250 | Bacteria | 1907 |
| 178 | Ga0209026_1016102 | 3300025250 | Bacteria | 1215 |
| 179 | Ga0209677_100028 | 3300025253 | Bacteria | 363933 |
| 180 | Ga0209148_1001819 | 3300025254 | Bacteria | 8981 |
| 181 | Ga0209759_1000049 | 3300025256 | Bacteria | 221692 |
| 182 | Ga0209759_1000357 | 3300025256 | Bacteria | 59208 |
| 183 | Ga0209233_1000070 | 3300025261 | Bacteria | 363933 |
| 184 | Ga0209565_1000015 | 3300025263 | Bacteria | 494091 |
| 185 | Ga0209565_1001939 | 3300025263 | Bacteria | 8132 |
| 186 | Ga0209455_1000169 | 3300025272 | Bacteria | 111454 |
| 187 | Ga0209455_1008089 | 3300025272 | Bacteria | 2893 |
| 188 | Ga0209673_1000394 | 3300025273 | Bacteria | 78048 |
| 189 | Ga0209130_1001054 | 3300025284 | Bacteria | 20900 |
| 190 | Ga0209675_1000012 | 3300025291 | Bacteria | 494061 |
| 191 | Ga0209675_1001711 | 3300025291 | Bacteria | 12096 |
| 192 | Ga0209564_1000016 | 3300025295 | Bacteria | 613131 |
| 193 | Ga0209564_1000071 | 3300025295 | Bacteria | 301332 |
| 194 | Ga0209564_1000072 | 3300025295 | Bacteria | 289331 |
| 195 | Ga0209564_1028688 | 3300025295 | Bacteria | 1771 |
| 196 | Ga0209050_1000240 | 3300025298 | Bacteria | 118992 |
| 197 | Ga0209256_1000044 | 3300025299 | Bacteria | 337264 |
| 198 | Ga0209256_1000076 | 3300025299 | Bacteria | 234735 |
| 199 | Ga0209256_1003100 | 3300025299 | Bacteria | 12161 |
| 200 | Ga0207426_1054078 | 3300025302 | Bacteria | 1183 |
| 201 | Ga0207680_10014776 | 3300025903 | Bacteria | 4055 |
| 202 | Ga0207705_10017557 | 3300025909 | Bacteria | 5123 |
| 203 | Ga0207654_10004697 | 3300025911 | Bacteria | 6913 |
| 204 | Ga0207695_10001341 | 3300025913 | Bacteria | 41772 |
| 205 | Ga0207695_10005745 | 3300025913 | Bacteria | 16337 |
| 206 | Ga0207695_10438637 | 3300025913 | Bacteria | 1189 |
| 207 | Ga0207671_10037277 | 3300025914 | Bacteria | 3606 |
| 208 | Ga0207671_10307253 | 3300025914 | Bacteria | 1253 |
| 209 | Ga0207657_10001145 | 3300025919 | Bacteria | 28192 |
| 210 | Ga0207657_10024222 | 3300025919 | Bacteria | 5631 |
| 211 | Ga0207657_10034425 | 3300025919 | Bacteria | 4555 |
| 212 | Ga0207657_10134734 | 3300025919 | Bacteria | 2022 |
| 213 | Ga0207649_10026917 | 3300025920 | Bacteria | 3369 |
| 214 | Ga0207681_10022277 | 3300025923 | Bacteria | 4039 |
| 215 | Ga0207681_10070592 | 3300025923 | Bacteria | 2433 |
| 216 | Ga0207694_10001114 | 3300025924 | Bacteria | 23252 |
| 217 | Ga0207694_10189850 | 3300025924 | Bacteria | 1669 |
| 218 | Ga0207650_10000003 | 3300025925 | Bacteria | 1123235 |
| 219 | Ga0207650_10004390 | 3300025925 | Bacteria | 9637 |
| 220 | Ga0207644_10004443 | 3300025931 | Bacteria | 9107 |
| 221 | Ga0207690_10084366 | 3300025932 | Bacteria | 2226 |
| 222 | Ga0207690_10191480 | 3300025932 | Bacteria | 1547 |
| 223 | Ga0207690_10819946 | 3300025932 | Bacteria | 769 |
| 224 | Ga0207706_10336169 | 3300025933 | Bacteria | 1314 |
| 225 | Ga0207686_10187296 | 3300025934 | Bacteria | 1472 |
| 226 | Ga0207709_10112420 | 3300025935 | Bacteria | 1824 |
| 227 | Ga0207711_10000472 | 3300025941 | Bacteria | 41502 |
| 228 | Ga0207679_10019205 | 3300025945 | Bacteria | 4589 |
| 229 | Ga0207679_10248449 | 3300025945 | Bacteria | 1511 |
| 230 | Ga0207679_10267272 | 3300025945 | Bacteria | 1461 |
| 231 | Ga0207667_10000078 | 3300025949 | Bacteria | 165061 |
| 232 | Ga0207667_10023739 | 3300025949 | Bacteria | 6750 |
| 233 | Ga0207667_10041450 | 3300025949 | Bacteria | 4896 |
| 234 | Ga0207667_10217165 | 3300025949 | Bacteria | 1959 |
| 235 | Ga0207667_10297414 | 3300025949 | Bacteria | 1649 |
| 236 | Ga0207712_10135816 | 3300025961 | Bacteria | 1881 |
| 237 | Ga0207668_10007151 | 3300025972 | Bacteria | 6628 |
| 238 | Ga0207668_10118956 | 3300025972 | Bacteria | 1997 |
| 239 | Ga0207640_10055935 | 3300025981 | Bacteria | 2587 |
| 240 | Ga0207658_10000012 | 3300025986 | Bacteria | 224402 |
| 241 | Ga0207703_10130918 | 3300026035 | Bacteria | 2166 |
| 242 | Ga0207678_10312327 | 3300026067 | Bacteria | 1351 |
| 243 | Ga0207678_10912544 | 3300026067 | Bacteria | 777 |
| 244 | Ga0207702_10478919 | 3300026078 | Bacteria | 1211 |
| 245 | Ga0207702_10885972 | 3300026078 | Bacteria | 884 |
| 246 | Ga0207702_11225745 | 3300026078 | Bacteria | 744 |
| 247 | Ga0207641_10025128 | 3300026088 | Bacteria | 4910 |
| 248 | Ga0207648_10076849 | 3300026089 | Bacteria | 2911 |
| 249 | Ga0207676_10000003 | 3300026095 | Bacteria | 1123235 |
| 250 | Ga0207674_10349182 | 3300026116 | Bacteria | 1430 |
| 251 | Ga0207674_10350919 | 3300026116 | Bacteria | 1426 |
| 252 | Ga0207698_10158976 | 3300026142 | Bacteria | 1973 |
| 253 | Ga0209282_1000001 | 3300027666 | Bacteria | 2450367 |
| 254 | Ga0268266_10032903 | 3300028379 | Bacteria | 4406 |
| 255 | Ga0268265_10002832 | 3300028380 | Bacteria | 12751 |
| 256 | Ga0268265_10048589 | 3300028380 | Bacteria | 3186 |
| 257 | Ga0268264_10000009 | 3300028381 | Bacteria | 724972 |
| 258 | Ga0268264_10099773 | 3300028381 | Bacteria | 2520 |
| 259 | Ga0307511_10008326 | 3300030521 | Bacteria | 10380 |
| 260 | Ga0316180_1021737 | 3300030736 | Bacteria | 2639 |
| 261 | Ga0316183_1190372 | 3300030742 | Bacteria | 979 |
| 262 | Ga0265331_10064063 | 3300031250 | Bacteria | 1731 |
| 263 | Ga0265327_10090693 | 3300031251 | Bacteria | 1491 |
| 264 | Ga0265327_10165282 | 3300031251 | Bacteria | 1020 |
| 265 | Ga0307509_10270648 | 3300031507 | Bacteria | 1467 |
| 266 | Ga0307408_100000239 | 3300031548 | Bacteria | 57570 |
| 267 | Ga0307408_100224828 | 3300031548 | Bacteria | 1533 |
| 268 | Ga0307416_100005633 | 3300032002 | Bacteria | 7726 |
| 269 | Ga0307414_10788244 | 3300032004 | Bacteria | 866 |
| 270 | Ga0316583_10009603 | 3300032133 | Bacteria | 3485 |
| 271 | Ga0373931_0114275 | 3300035691 | Bacteria | 1535 |
| 272 | Ga0395899_0000128 | 3300037312 | Bacteria | 119014 |
| 273 | Ga0395899_0000753 | 3300037312 | Bacteria | 32064 |
| 274 | Ga0395899_0006694 | 3300037312 | Bacteria | 8931 |
| 275 | Ga0395899_0010304 | 3300037312 | Bacteria | 7167 |
| 276 | Ga0395899_0010704 | 3300037312 | Bacteria | 7031 |
| 277 | Ga0395899_0012339 | 3300037312 | Bacteria | 6544 |
| 278 | Ga0395899_0013728 | 3300037312 | Bacteria | 6193 |
| 279 | Ga0395899_0055314 | 3300037312 | Bacteria | 2935 |
| 280 | Ga0395899_0293240 | 3300037312 | Bacteria | 1103 |
| 281 | Ga0395900_0000123 | 3300037418 | Bacteria | 133326 |
| 282 | Ga0395900_0007904 | 3300037418 | Bacteria | 10955 |
| 283 | Ga0395900_0008621 | 3300037418 | Bacteria | 10478 |
| 284 | Ga0395900_0009260 | 3300037418 | Bacteria | 10096 |
| 285 | Ga0395900_0010088 | 3300037418 | Bacteria | 9661 |
| 286 | Ga0395900_0021826 | 3300037418 | Bacteria | 6546 |
| 287 | Ga0395900_0035310 | 3300037418 | Bacteria | 5149 |
| 288 | Ga0395900_0073035 | 3300037418 | Bacteria | 3526 |
| 289 | Ga0395900_0116934 | 3300037418 | Bacteria | 2736 |
| 290 | Ga0395900_0140769 | 3300037418 | Bacteria | 2470 |
| 291 | Ga0395900_0209971 | 3300037418 | Bacteria | 1966 |
| 292 | Ga0395900_0287131 | 3300037418 | Bacteria | 1635 |
| 293 | Ga0395900_0323735 | 3300037418 | Bacteria | 1521 |
| 294 | Ga0395900_0328620 | 3300037418 | Bacteria | 1507 |
| 295 | Ga0395898_0004536 | 3300037466 | Bacteria | 15161 |
| 296 | Ga0395898_0075038 | 3300037466 | Bacteria | 3266 |
| 297 | Ga0395898_0109879 | 3300037466 | Bacteria | 2643 |
| 298 | Ga0395898_0125841 | 3300037466 | Bacteria | 2455 |
| 299 | Ga0395898_0257386 | 3300037466 | Bacteria | 1664 |
| 300 | Ga0395898_0383923 | 3300037466 | Bacteria | 1339 |
| 301 | Ga0395898_0517499 | 3300037466 | Bacteria | 1134 |
| 302 | Ga0395898_0628288 | 3300037466 | Bacteria | 1016 |
| 303 | Ga0395905_0000905 | 3300037471 | Bacteria | 38512 |
| 304 | Ga0395905_0001709 | 3300037471 | Bacteria | 25795 |
| 305 | Ga0395905_0012941 | 3300037471 | Bacteria | 8020 |
| 306 | Ga0395905_0013998 | 3300037471 | Bacteria | 7674 |
| 307 | Ga0395905_0020397 | 3300037471 | Bacteria | 6279 |
| 308 | Ga0395905_0042482 | 3300037471 | Bacteria | 4267 |
| 309 | Ga0395905_0078281 | 3300037471 | Bacteria | 3098 |
| 310 | Ga0395905_0099213 | 3300037471 | Bacteria | 2735 |
| 311 | Ga0395905_0128099 | 3300037471 | Bacteria | 2387 |
| 312 | Ga0395905_0152274 | 3300037471 | Bacteria | 2175 |
| 313 | Ga0395905_0310643 | 3300037471 | Bacteria | 1465 |
| 314 | Ga0395905_0380827 | 3300037471 | Bacteria | 1305 |
| 315 | Ga0395905_0392670 | 3300037471 | Bacteria | 1282 |
| 316 | Ga0395905_0503627 | 3300037471 | Bacteria | 1111 |
| 317 | Ga0395905_0623628 | 3300037471 | Bacteria | 980 |
| 318 | Ga0395901_0000411 | 3300038443 | Bacteria | 50643 |
| 319 | Ga0395901_0001908 | 3300038443 | Bacteria | 21493 |
| 320 | Ga0395901_0021000 | 3300038443 | Bacteria | 6689 |
| 321 | Ga0395901_0023907 | 3300038443 | Bacteria | 6267 |
| 322 | Ga0395901_0278987 | 3300038443 | Bacteria | 1737 |
| 323 | Ga0395901_0346430 | 3300038443 | Bacteria | 1534 |
| 324 | Ga0395901_0355927 | 3300038443 | Bacteria | 1510 |
| 325 | Ga0395901_0504377 | 3300038443 | Bacteria | 1231 |
| 326 | Ga0395901_0796251 | 3300038443 | Bacteria | 934 |
| 327 | Ga0436365_1765823 | 3300039437 | Bacteria | 5366 |
| 328 | Ga0436361_0014452 | 3300039447 | Bacteria | 4411 |
| 329 | Ga0436361_0032641 | 3300039447 | Bacteria | 1118 |
| 330 | Ga0436361_0149158 | 3300039447 | Bacteria | 4068 |
| 331 | Ga0436361_0161443 | 3300039447 | Bacteria | 5435 |
| 332 | Ga0436361_0275924 | 3300039447 | Bacteria | 2979 |
| 333 | Ga0436361_0458162 | 3300039447 | Bacteria | 1237 |
| 334 | Ga0436361_0568983 | 3300039447 | Bacteria | 33450 |
| 335 | Ga0436361_0632651 | 3300039447 | Bacteria | 49929 |
| 336 | Ga0436361_0746087 | 3300039447 | Bacteria | 1617 |
| 337 | Ga0436361_0830100 | 3300039447 | Bacteria | 16365 |
| 338 | Ga0436361_0938544 | 3300039447 | Bacteria | 31788 |
| 339 | Ga0436361_0973589 | 3300039447 | Bacteria | 2003 |
| 340 | Ga0436361_1043948 | 3300039447 | Bacteria | 4310 |
| 341 | Ga0436362_0115419 | 3300039453 | Bacteria | 1304 |
| 342 | Ga0439448_0010043 | 3300042005 | Bacteria | 2797 |
| 343 | Ga0439448_0123959 | 3300042005 | Bacteria | 888 |
| 344 | Ga0439449_0013722 | 3300042007 | Bacteria | 3049 |
| 345 | Ga0439450_010428 | 3300042008 | Bacteria | 1792 |
| 346 | Ga0439450_018780 | 3300042008 | Bacteria | 1456 |
| 347 | Ga0439455_0106565 | 3300042012 | Bacteria | 777 |
| 348 | Ga0450897_013149 | 3300042128 | Bacteria | 823 |
| 349 | Ga0450904_000276 | 3300042139 | Bacteria | 11138 |
| 350 | Ga0439458_0022881 | 3300042157 | Bacteria | 1454 |
| 351 | Ga0451577_0625920 | 3300042876 | Bacteria | 976 |
| 352 | Ga0466969_0038118 | 3300044656 | Bacteria | 2420 |
| 353 | Ga0466969_0080543 | 3300044656 | Bacteria | 1555 |
| 354 | Ga0466972_0000087 | 3300044658 | Bacteria | 84646 |
| 355 | Ga0466972_0001100 | 3300044658 | Bacteria | 12928 |
| 356 | Ga0466972_0006991 | 3300044658 | Bacteria | 5660 |
| 357 | Ga0466972_0097290 | 3300044658 | Bacteria | 1394 |
| 358 | Ga0466965_0002700 | 3300044683 | Bacteria | 7599 |
| 359 | Ga0466965_0010006 | 3300044683 | Bacteria | 4412 |
| 360 | Ga0466965_0011686 | 3300044683 | Bacteria | 4118 |
| 361 | Ga0466965_0065720 | 3300044683 | Bacteria | 1817 |
| 362 | Ga0466965_0107579 | 3300044683 | Bacteria | 1431 |
| 363 | Ga0466966_0011821 | 3300044684 | Bacteria | 5780 |
| 364 | Ga0466966_0013678 | 3300044684 | Bacteria | 5369 |
| 365 | Ga0466966_0068924 | 3300044684 | Bacteria | 2219 |
| 366 | Ga0466966_0082220 | 3300044684 | Bacteria | 2004 |
| 367 | Ga0466961_0159699 | 3300044693 | Bacteria | 1405 |
| 368 | Ga0466964_0000256 | 3300044706 | Bacteria | 15366 |
| 369 | Ga0466964_0199537 | 3300044706 | Bacteria | 960 |
| 370 | Ga0466964_0206904 | 3300044706 | Bacteria | 945 |
| 371 | Ga0453684_0000102 | 3300044712 | Bacteria | 366870 |
| 372 | Ga0466971_0017407 | 3300044719 | Bacteria | 3179 |
| 373 | Ga0466968_0001835 | 3300044735 | Bacteria | 7668 |
| 374 | Ga0466968_0037123 | 3300044735 | Bacteria | 2043 |
| 375 | Ga0466968_0117279 | 3300044735 | Bacteria | 1202 |
| 376 | Ga0466970_0016339 | 3300044765 | Bacteria | 3824 |
| 377 | Ga0466957_0009721 | 3300044842 | Bacteria | 5492 |
| 378 | Ga0466959_0009557 | 3300045049 | Bacteria | 6899 |
| 379 | Ga0466959_0011644 | 3300045049 | Bacteria | 6325 |
| 380 | Ga0466959_0052704 | 3300045049 | Bacteria | 2978 |
| 381 | Ga0466959_0054139 | 3300045049 | Bacteria | 2932 |
| 382 | Ga0466959_0586236 | 3300045049 | Bacteria | 750 |
| 383 | Ga0451576_0000171 | 3300045051 | Bacteria | 162452 |
| 384 | Ga0451576_0000386 | 3300045051 | Bacteria | 102813 |
| 385 | Ga0451576_0080204 | 3300045051 | Bacteria | 3396 |
| 386 | Ga0451576_0724582 | 3300045051 | Bacteria | 1045 |
| 387 | Ga0466958_0275718 | 3300045836 | Bacteria | 1077 |
| 388 | Ga0466958_0396809 | 3300045836 | Bacteria | 890 |
| 389 | Ga0466967_0005324 | 3300045976 | Bacteria | 8891 |
| 390 | Ga0495617_000034 | 3300046452 | Bacteria | 147232 |
| 391 | Ga0495617_002482 | 3300046452 | Bacteria | 7321 |
| 392 | Ga0495617_002980 | 3300046452 | Bacteria | 6473 |
| 393 | Ga0495617_008361 | 3300046452 | Bacteria | 3570 |
| 394 | Ga0495627_000876 | 3300046453 | Bacteria | 21280 |
| 395 | Ga0495627_024085 | 3300046453 | Bacteria | 1987 |
| 396 | Ga0495592_0003280 | 3300046454 | Bacteria | 11595 |
| 397 | Ga0495592_0405274 | 3300046454 | Bacteria | 863 |
| 398 | Ga0495603_0033409 | 3300046455 | Bacteria | 3096 |
| 399 | Ga0495603_0044124 | 3300046455 | Bacteria | 2660 |
| 400 | Ga0495590_0000027 | 3300046457 | Bacteria | 158323 |
| 401 | Ga0495590_0000257 | 3300046457 | Bacteria | 28989 |
| 402 | Ga0495590_0006267 | 3300046457 | Bacteria | 4656 |
| 403 | Ga0495590_0028084 | 3300046457 | Bacteria | 1973 |
| 404 | Ga0495590_0033182 | 3300046457 | Bacteria | 1805 |
| 405 | Ga0495590_0067583 | 3300046457 | Bacteria | 1252 |
| 406 | Ga0495590_0085440 | 3300046457 | Bacteria | 1113 |
| 407 | Ga0495591_000272 | 3300046458 | Bacteria | 48725 |
| 408 | Ga0495629_0014017 | 3300046459 | Bacteria | 5777 |
| 409 | Ga0495638_0000098 | 3300046460 | Bacteria | 140656 |
| 410 | Ga0495638_0045252 | 3300046460 | Bacteria | 2769 |
| 411 | Ga0495638_0050498 | 3300046460 | Bacteria | 2597 |
| 412 | Ga0495651_0015119 | 3300046462 | Bacteria | 5965 |
| 413 | Ga0495651_0058856 | 3300046462 | Bacteria | 2947 |
| 414 | Ga0495653_0002089 | 3300046463 | Bacteria | 15731 |
| 415 | Ga0495653_0144561 | 3300046463 | Bacteria | 1668 |
| 416 | Ga0495653_0169254 | 3300046463 | Bacteria | 1509 |
| 417 | Ga0495650_0000011 | 3300046471 | Bacteria | 615329 |
| 418 | Ga0495650_0002150 | 3300046471 | Bacteria | 16729 |
| 419 | Ga0495580_0030809 | 3300046472 | Bacteria | 3880 |
| 420 | Ga0495580_0445460 | 3300046472 | Bacteria | 869 |
| 421 | Ga0495582_0004649 | 3300046473 | Bacteria | 7718 |
| 422 | Ga0495582_0017936 | 3300046473 | Bacteria | 3869 |
| 423 | Ga0495582_0114750 | 3300046473 | Bacteria | 1514 |
| 424 | Ga0495605_0000029 | 3300046474 | Bacteria | 215329 |
| 425 | Ga0495605_0000042 | 3300046474 | Bacteria | 185225 |
| 426 | Ga0495605_0000151 | 3300046474 | Bacteria | 89442 |
| 427 | Ga0495605_0006348 | 3300046474 | Bacteria | 6815 |
| 428 | Ga0495605_0007689 | 3300046474 | Bacteria | 6109 |
| 429 | Ga0495605_0010229 | 3300046474 | Bacteria | 5252 |
| 430 | Ga0495605_0024677 | 3300046474 | Bacteria | 3142 |
| 431 | Ga0495605_0035098 | 3300046474 | Bacteria | 2536 |
| 432 | Ga0495605_0044828 | 3300046474 | Bacteria | 2183 |
| 433 | Ga0495605_0132566 | 3300046474 | Bacteria | 1123 |
| 434 | Ga0495639_0309380 | 3300046475 | Bacteria | 789 |
| 435 | Ga0495584_0000007 | 3300046491 | Bacteria | 294820 |
| 436 | Ga0495584_0000122 | 3300046491 | Bacteria | 53611 |
| 437 | Ga0495584_0000506 | 3300046491 | Bacteria | 26745 |
| 438 | Ga0495584_0002007 | 3300046491 | Bacteria | 11695 |
| 439 | Ga0495584_0002049 | 3300046491 | Bacteria | 11580 |
| 440 | Ga0495584_0003276 | 3300046491 | Bacteria | 8969 |
| 441 | Ga0495584_0005376 | 3300046491 | Bacteria | 6790 |
| 442 | Ga0495584_0005715 | 3300046491 | Bacteria | 6566 |
| 443 | Ga0495584_0006099 | 3300046491 | Bacteria | 6343 |
| 444 | Ga0495584_0010896 | 3300046491 | Bacteria | 4667 |
| 445 | Ga0495584_0021540 | 3300046491 | Bacteria | 3273 |
| 446 | Ga0495584_0069350 | 3300046491 | Bacteria | 1771 |
| 447 | Ga0495584_0110508 | 3300046491 | Bacteria | 1390 |
| 448 | Ga0495584_0163756 | 3300046491 | Bacteria | 1130 |
| 449 | Ga0495584_0173545 | 3300046491 | Bacteria | 1096 |
| 450 | Ga0495584_0204880 | 3300046491 | Bacteria | 1002 |
| 451 | Ga0495585_0000115 | 3300046492 | Bacteria | 86460 |
| 452 | Ga0495585_0000421 | 3300046492 | Bacteria | 40862 |
| 453 | Ga0495585_0002934 | 3300046492 | Bacteria | 11799 |
| 454 | Ga0495585_0003505 | 3300046492 | Bacteria | 10583 |
| 455 | Ga0495585_0010560 | 3300046492 | Bacteria | 5494 |
| 456 | Ga0495585_0017306 | 3300046492 | Bacteria | 4166 |
| 457 | Ga0495585_0018451 | 3300046492 | Bacteria | 4022 |
| 458 | Ga0495585_0020952 | 3300046492 | Bacteria | 3756 |
| 459 | Ga0495585_0024454 | 3300046492 | Bacteria | 3463 |
| 460 | Ga0495585_0029130 | 3300046492 | Bacteria | 3144 |
| 461 | Ga0495585_0040655 | 3300046492 | Bacteria | 2610 |
| 462 | Ga0495585_0062272 | 3300046492 | Bacteria | 2049 |
| 463 | Ga0495585_0098278 | 3300046492 | Bacteria | 1568 |
| 464 | Ga0495585_0107344 | 3300046492 | Bacteria | 1487 |
| 465 | Ga0495594_0003496 | 3300046499 | Bacteria | 8092 |
| 466 | Ga0495594_0010511 | 3300046499 | Bacteria | 4800 |
| 467 | Ga0495594_0010807 | 3300046499 | Bacteria | 4742 |
| 468 | Ga0495594_0013150 | 3300046499 | Bacteria | 4316 |
| 469 | Ga0495594_0028672 | 3300046499 | Bacteria | 3005 |
| 470 | Ga0495596_0000474 | 3300046500 | Bacteria | 25448 |
| 471 | Ga0495596_0000530 | 3300046500 | Bacteria | 23944 |
| 472 | Ga0495596_0002008 | 3300046500 | Bacteria | 11201 |
| 473 | Ga0495596_0002300 | 3300046500 | Bacteria | 10378 |
| 474 | Ga0495596_0004690 | 3300046500 | Bacteria | 6612 |
| 475 | Ga0495596_0014436 | 3300046500 | Bacteria | 3329 |
| 476 | Ga0495596_0019973 | 3300046500 | Bacteria | 2745 |
| 477 | Ga0495596_0028741 | 3300046500 | Bacteria | 2230 |
| 478 | Ga0495607_0001671 | 3300046501 | Bacteria | 19192 |
| 479 | Ga0495607_0001966 | 3300046501 | Bacteria | 17334 |
| 480 | Ga0495607_0002476 | 3300046501 | Bacteria | 14990 |
| 481 | Ga0495607_0002735 | 3300046501 | Bacteria | 14072 |
| 482 | Ga0495607_0004292 | 3300046501 | Bacteria | 10526 |
| 483 | Ga0495607_0017561 | 3300046501 | Bacteria | 4588 |
| 484 | Ga0495607_0020165 | 3300046501 | Bacteria | 4219 |
| 485 | Ga0495607_0025435 | 3300046501 | Bacteria | 3681 |
| 486 | Ga0495607_0028377 | 3300046501 | Bacteria | 3453 |
| 487 | Ga0495607_0051721 | 3300046501 | Bacteria | 2384 |
| 488 | Ga0495607_0071761 | 3300046501 | Bacteria | 1930 |
| 489 | Ga0495607_0077910 | 3300046501 | Bacteria | 1830 |
| 490 | Ga0495607_0083439 | 3300046501 | Bacteria | 1750 |
| 491 | Ga0495607_0225317 | 3300046501 | Bacteria | 914 |
| 492 | Ga0495583_0000348 | 3300046506 | Bacteria | 73050 |
| 493 | Ga0495583_0000472 | 3300046506 | Bacteria | 58906 |
| 494 | Ga0495583_0000569 | 3300046506 | Bacteria | 50860 |
| 495 | Ga0495583_0001444 | 3300046506 | Bacteria | 24128 |
| 496 | Ga0495583_0015121 | 3300046506 | Bacteria | 4212 |
| 497 | Ga0495583_0033337 | 3300046506 | Bacteria | 2477 |
| 498 | Ga0495583_0034886 | 3300046506 | Bacteria | 2406 |
| 499 | Ga0495583_0049226 | 3300046506 | Bacteria | 1931 |
| 500 | Ga0495583_0110774 | 3300046506 | Bacteria | 1163 |
| 501 | Ga0495583_0194134 | 3300046506 | Bacteria | 827 |
| 502 | Ga0495606_0000084 | 3300046507 | Bacteria | 158428 |
| 503 | Ga0495606_0000652 | 3300046507 | Bacteria | 54651 |
| 504 | Ga0495606_0000787 | 3300046507 | Bacteria | 48504 |
| 505 | Ga0495606_0001481 | 3300046507 | Bacteria | 31269 |
| 506 | Ga0495606_0012677 | 3300046507 | Bacteria | 6729 |
| 507 | Ga0495606_0021021 | 3300046507 | Bacteria | 4791 |
| 508 | Ga0495606_0029545 | 3300046507 | Bacteria | 3845 |
| 509 | Ga0495606_0031347 | 3300046507 | Bacteria | 3698 |
| 510 | Ga0495606_0034767 | 3300046507 | Bacteria | 3455 |
| 511 | Ga0495606_0039821 | 3300046507 | Bacteria | 3161 |
| 512 | Ga0495606_0047069 | 3300046507 | Bacteria | 2846 |
| 513 | Ga0495606_0106051 | 3300046507 | Bacteria | 1702 |
| 514 | Ga0495606_0349720 | 3300046507 | Bacteria | 785 |
| 515 | Ga0495608_0001512 | 3300046511 | Bacteria | 16556 |
| 516 | Ga0495608_0013677 | 3300046511 | Bacteria | 5631 |
| 517 | Ga0495610_0000473 | 3300046512 | Bacteria | 41477 |
| 518 | Ga0495610_0148582 | 3300046512 | Bacteria | 1002 |
| 519 | Ga0495616_0001479 | 3300046513 | Bacteria | 16296 |
| 520 | Ga0495616_0001547 | 3300046513 | Bacteria | 15843 |
| 521 | Ga0495616_0004099 | 3300046513 | Bacteria | 9242 |
| 522 | Ga0495616_0007026 | 3300046513 | Bacteria | 6773 |
| 523 | Ga0495616_0008239 | 3300046513 | Bacteria | 6186 |
| 524 | Ga0495616_0010806 | 3300046513 | Bacteria | 5262 |
| 525 | Ga0495616_0010992 | 3300046513 | Bacteria | 5207 |
| 526 | Ga0495616_0021408 | 3300046513 | Bacteria | 3501 |
| 527 | Ga0495616_0025599 | 3300046513 | Bacteria | 3150 |
| 528 | Ga0495616_0030670 | 3300046513 | Bacteria | 2822 |
| 529 | Ga0495616_0033463 | 3300046513 | Bacteria | 2677 |
| 530 | Ga0495616_0042972 | 3300046513 | Bacteria | 2297 |
| 531 | Ga0495616_0044363 | 3300046513 | Bacteria | 2255 |
| 532 | Ga0495616_0057484 | 3300046513 | Bacteria | 1918 |
| 533 | Ga0495616_0094410 | 3300046513 | Bacteria | 1411 |
| 534 | Ga0495620_0003439 | 3300046515 | Bacteria | 9059 |
| 535 | Ga0495628_0004339 | 3300046516 | Bacteria | 12585 |
| 536 | Ga0495628_0018273 | 3300046516 | Bacteria | 5812 |
| 537 | Ga0495628_0305552 | 3300046516 | Bacteria | 1177 |
| 538 | Ga0495630_0009137 | 3300046517 | Bacteria | 7128 |
| 539 | Ga0495630_0332897 | 3300046517 | Bacteria | 1161 |
| 540 | Ga0495631_0000550 | 3300046518 | Bacteria | 25263 |
| 541 | Ga0495631_0000810 | 3300046518 | Bacteria | 19974 |
| 542 | Ga0495631_0001888 | 3300046518 | Bacteria | 12341 |
| 543 | Ga0495631_0002771 | 3300046518 | Bacteria | 9721 |
| 544 | Ga0495631_0005099 | 3300046518 | Bacteria | 6919 |
| 545 | Ga0495631_0006258 | 3300046518 | Bacteria | 6165 |
| 546 | Ga0495631_0015840 | 3300046518 | Bacteria | 3603 |
| 547 | Ga0495631_0017560 | 3300046518 | Bacteria | 3381 |
| 548 | Ga0495631_0272480 | 3300046518 | Bacteria | 721 |
| 549 | Ga0495632_0000852 | 3300046519 | Bacteria | 26846 |
| 550 | Ga0495632_0000903 | 3300046519 | Bacteria | 26010 |
| 551 | Ga0495632_0001985 | 3300046519 | Bacteria | 16245 |
| 552 | Ga0495632_0007957 | 3300046519 | Bacteria | 6584 |
| 553 | Ga0495632_0042567 | 3300046519 | Bacteria | 2275 |
| 554 | Ga0495637_0000013 | 3300046520 | Bacteria | 244837 |
| 555 | Ga0495637_0008688 | 3300046520 | Bacteria | 4983 |
| 556 | Ga0495637_0021577 | 3300046520 | Bacteria | 2951 |
| 557 | Ga0495643_0000200 | 3300046522 | Bacteria | 93353 |
| 558 | Ga0495643_0000551 | 3300046522 | Bacteria | 46367 |
| 559 | Ga0495643_0002412 | 3300046522 | Bacteria | 14864 |
| 560 | Ga0495643_0004464 | 3300046522 | Bacteria | 9775 |
| 561 | Ga0495643_0012215 | 3300046522 | Bacteria | 5187 |
| 562 | Ga0495643_0024119 | 3300046522 | Bacteria | 3453 |
| 563 | Ga0495643_0025001 | 3300046522 | Bacteria | 3383 |
| 564 | Ga0495643_0071122 | 3300046522 | Bacteria | 1826 |
| 565 | Ga0495643_0072128 | 3300046522 | Bacteria | 1811 |
| 566 | Ga0495644_0002518 | 3300046523 | Bacteria | 7308 |
| 567 | Ga0495644_0004268 | 3300046523 | Bacteria | 5613 |
| 568 | Ga0495644_0004891 | 3300046523 | Bacteria | 5258 |
| 569 | Ga0495644_0005339 | 3300046523 | Bacteria | 5017 |
| 570 | Ga0495644_0011582 | 3300046523 | Bacteria | 3394 |
| 571 | Ga0495644_0015732 | 3300046523 | Bacteria | 2899 |
| 572 | Ga0495644_0017413 | 3300046523 | Bacteria | 2747 |
| 573 | Ga0495644_0020348 | 3300046523 | Bacteria | 2533 |
| 574 | Ga0495644_0036772 | 3300046523 | Bacteria | 1847 |
| 575 | Ga0495648_0000112 | 3300046524 | Bacteria | 99859 |
| 576 | Ga0495648_0000169 | 3300046524 | Bacteria | 75523 |
| 577 | Ga0495648_0001096 | 3300046524 | Bacteria | 27557 |
| 578 | Ga0495648_0002536 | 3300046524 | Bacteria | 16749 |
| 579 | Ga0495648_0007990 | 3300046524 | Bacteria | 8391 |
| 580 | Ga0495648_0009310 | 3300046524 | Bacteria | 7632 |
| 581 | Ga0495648_0027171 | 3300046524 | Bacteria | 3836 |
| 582 | Ga0495648_0034097 | 3300046524 | Bacteria | 3318 |
| 583 | Ga0495648_0051763 | 3300046524 | Bacteria | 2499 |
| 584 | Ga0495648_0054917 | 3300046524 | Bacteria | 2403 |
| 585 | Ga0495648_0177240 | 3300046524 | Bacteria | 1087 |
| 586 | Ga0495648_0313657 | 3300046524 | Bacteria | 730 |
| 587 | Ga0495663_0004796 | 3300046525 | Bacteria | 3781 |
| 588 | Ga0495663_0032141 | 3300046525 | Bacteria | 1562 |
| 589 | Ga0495666_0015313 | 3300046526 | Bacteria | 3818 |
| 590 | Ga0495666_0049841 | 3300046526 | Bacteria | 2014 |
| 591 | Ga0495642_0000050 | 3300046528 | Bacteria | 71246 |
| 592 | Ga0495642_0001068 | 3300046528 | Bacteria | 12668 |
| 593 | Ga0495642_0001340 | 3300046528 | Bacteria | 11027 |
| 594 | Ga0495642_0001809 | 3300046528 | Bacteria | 9172 |
| 595 | Ga0495642_0003687 | 3300046528 | Bacteria | 6013 |
| 596 | Ga0495642_0004398 | 3300046528 | Bacteria | 5471 |
| 597 | Ga0495642_0008082 | 3300046528 | Bacteria | 4025 |
| 598 | Ga0495642_0021157 | 3300046528 | Bacteria | 2557 |
| 599 | Ga0495642_0029202 | 3300046528 | Bacteria | 2200 |
| 600 | Ga0495642_0056547 | 3300046528 | Bacteria | 1620 |
| 601 | Ga0495642_0134247 | 3300046528 | Bacteria | 1066 |
| 602 | Ga0495642_0186853 | 3300046528 | Bacteria | 902 |
| 603 | Ga0495652_0005056 | 3300046529 | Bacteria | 12485 |
| 604 | Ga0495652_0016097 | 3300046529 | Bacteria | 6689 |
| 605 | Ga0495652_0019388 | 3300046529 | Bacteria | 6058 |
| 606 | Ga0495652_0049462 | 3300046529 | Bacteria | 3598 |
| 607 | Ga0495654_0004305 | 3300046530 | Bacteria | 8491 |
| 608 | Ga0495654_0006380 | 3300046530 | Bacteria | 6706 |
| 609 | Ga0495654_0008593 | 3300046530 | Bacteria | 5628 |
| 610 | Ga0495654_0010005 | 3300046530 | Bacteria | 5180 |
| 611 | Ga0495654_0044679 | 3300046530 | Bacteria | 2190 |
| 612 | Ga0495665_0005554 | 3300046531 | Bacteria | 6794 |
| 613 | Ga0495665_0035779 | 3300046531 | Bacteria | 2651 |
| 614 | Ga0495665_0102901 | 3300046531 | Bacteria | 1498 |
| 615 | Ga0495665_0103170 | 3300046531 | Bacteria | 1496 |
| 616 | Ga0495586_0018982 | 3300046535 | Bacteria | 3659 |
| 617 | Ga0495586_0019447 | 3300046535 | Bacteria | 3615 |
| 618 | Ga0495587_0008756 | 3300046536 | Bacteria | 6490 |
| 619 | Ga0495609_0000022 | 3300046538 | Bacteria | 279488 |
| 620 | Ga0495609_0000163 | 3300046538 | Bacteria | 69578 |
| 621 | Ga0495609_0001355 | 3300046538 | Bacteria | 16522 |
| 622 | Ga0495609_0002267 | 3300046538 | Bacteria | 12004 |
| 623 | Ga0495609_0003271 | 3300046538 | Bacteria | 9357 |
| 624 | Ga0495609_0026941 | 3300046538 | Bacteria | 2628 |
| 625 | Ga0495609_0031532 | 3300046538 | Bacteria | 2408 |
| 626 | Ga0495609_0047144 | 3300046538 | Bacteria | 1928 |
| 627 | Ga0495609_0080225 | 3300046538 | Bacteria | 1427 |
| 628 | Ga0495597_0000064 | 3300046542 | Bacteria | 91446 |
| 629 | Ga0495597_0000266 | 3300046542 | Bacteria | 47830 |
| 630 | Ga0495597_0000566 | 3300046542 | Bacteria | 30712 |
| 631 | Ga0495597_0001407 | 3300046542 | Bacteria | 17367 |
| 632 | Ga0495597_0002770 | 3300046542 | Bacteria | 10797 |
| 633 | Ga0495597_0006826 | 3300046542 | Bacteria | 5864 |
| 634 | Ga0495597_0006959 | 3300046542 | Bacteria | 5796 |
| 635 | Ga0495597_0013020 | 3300046542 | Bacteria | 3994 |
| 636 | Ga0495597_0074237 | 3300046542 | Bacteria | 1460 |
| 637 | Ga0495597_0240246 | 3300046542 | Bacteria | 714 |
| 638 | Ga0495645_0042584 | 3300046543 | Bacteria | 3311 |
| 639 | Ga0495645_0073481 | 3300046543 | Bacteria | 2463 |
| 640 | Ga0495622_0000311 | 3300046557 | Bacteria | 36067 |
| 641 | Ga0495622_0000707 | 3300046557 | Bacteria | 18899 |
| 642 | Ga0495622_0007277 | 3300046557 | Bacteria | 5138 |
| 643 | Ga0495622_0039180 | 3300046557 | Bacteria | 2207 |
| 644 | Ga0495622_0039684 | 3300046557 | Bacteria | 2192 |
| 645 | Ga0495622_0085890 | 3300046557 | Bacteria | 1447 |
| 646 | Ga0495622_0228631 | 3300046557 | Bacteria | 822 |
| 647 | Ga0495633_0001165 | 3300046558 | Bacteria | 21122 |
| 648 | Ga0495633_0001850 | 3300046558 | Bacteria | 15548 |
| 649 | Ga0495633_0010505 | 3300046558 | Bacteria | 5046 |
| 650 | Ga0495633_0016664 | 3300046558 | Bacteria | 3781 |
| 651 | Ga0495633_0018317 | 3300046558 | Bacteria | 3558 |
| 652 | Ga0495633_0020708 | 3300046558 | Bacteria | 3302 |
| 653 | Ga0495633_0024214 | 3300046558 | Bacteria | 3001 |
| 654 | Ga0495633_0047924 | 3300046558 | Bacteria | 2018 |
| 655 | Ga0495633_0086336 | 3300046558 | Bacteria | 1459 |
| 656 | Ga0495633_0123951 | 3300046558 | Bacteria | 1196 |
| 657 | Ga0495633_0230476 | 3300046558 | Bacteria | 847 |
| 658 | Ga0495656_0001658 | 3300046615 | Bacteria | 7274 |
| 659 | Ga0495656_0002958 | 3300046615 | Bacteria | 5701 |
| 660 | Ga0495656_0006533 | 3300046615 | Bacteria | 4094 |
| 661 | Ga0495656_0026222 | 3300046615 | Bacteria | 2318 |
| 662 | Ga0495656_0100038 | 3300046615 | Bacteria | 1340 |
| 663 | Ga0495656_0119591 | 3300046615 | Bacteria | 1242 |
| 664 | Ga0495668_0001322 | 3300046616 | Bacteria | 24393 |
| 665 | Ga0495668_0001809 | 3300046616 | Bacteria | 19467 |
| 666 | Ga0495668_0002020 | 3300046616 | Bacteria | 17709 |
| 667 | Ga0495668_0006891 | 3300046616 | Bacteria | 7361 |
| 668 | Ga0495668_0011176 | 3300046616 | Bacteria | 5388 |
| 669 | Ga0495668_0013456 | 3300046616 | Bacteria | 4823 |
| 670 | Ga0495668_0029492 | 3300046616 | Bacteria | 3099 |
| 671 | Ga0495668_0057478 | 3300046616 | Bacteria | 2146 |
| 672 | Ga0495668_0061174 | 3300046616 | Bacteria | 2077 |
| 673 | Ga0495668_0093914 | 3300046616 | Bacteria | 1642 |
| 674 | Ga0495668_0395699 | 3300046616 | Bacteria | 759 |
| 675 | Ga0495634_0015301 | 3300046642 | Bacteria | 5515 |
| 676 | Ga0495611_0000515 | 3300046648 | Bacteria | 22974 |
| 677 | Ga0495611_0003505 | 3300046648 | Bacteria | 6905 |
| 678 | Ga0495611_0003835 | 3300046648 | Bacteria | 6556 |
| 679 | Ga0495611_0007685 | 3300046648 | Bacteria | 4578 |
| 680 | Ga0495611_0009941 | 3300046648 | Bacteria | 4027 |
| 681 | Ga0495611_0010893 | 3300046648 | Bacteria | 3851 |
| 682 | Ga0495611_0015786 | 3300046648 | Bacteria | 3227 |
| 683 | Ga0495611_0016265 | 3300046648 | Bacteria | 3180 |
| 684 | Ga0495611_0055477 | 3300046648 | Bacteria | 1792 |
| 685 | Ga0495611_0056545 | 3300046648 | Bacteria | 1776 |
| 686 | Ga0495611_0098122 | 3300046648 | Bacteria | 1358 |
| 687 | Ga0495625_0000810 | 3300046660 | Bacteria | 43340 |
| 688 | Ga0495625_0002543 | 3300046660 | Bacteria | 19615 |
| 689 | Ga0495625_0005310 | 3300046660 | Bacteria | 11801 |
| 690 | Ga0495625_0011709 | 3300046660 | Bacteria | 7131 |
| 691 | Ga0495625_0013813 | 3300046660 | Bacteria | 6471 |
| 692 | Ga0495625_0020304 | 3300046660 | Bacteria | 5131 |
| 693 | Ga0495625_0061488 | 3300046660 | Bacteria | 2657 |
| 694 | Ga0495625_0203186 | 3300046660 | Bacteria | 1306 |
| 695 | Ga0495659_0000019 | 3300046664 | Bacteria | 74610 |
| 696 | Ga0495659_0000167 | 3300046664 | Bacteria | 29514 |
| 697 | Ga0495659_0001683 | 3300046664 | Bacteria | 7409 |
| 698 | Ga0495659_0009447 | 3300046664 | Bacteria | 3112 |
| 699 | Ga0495659_0020073 | 3300046664 | Bacteria | 2241 |
| 700 | Ga0495661_0000151 | 3300046665 | Bacteria | 81275 |
| 701 | Ga0495661_0000590 | 3300046665 | Bacteria | 37515 |
| 702 | Ga0495661_0003517 | 3300046665 | Bacteria | 11544 |
| 703 | Ga0495661_0007238 | 3300046665 | Bacteria | 7740 |
| 704 | Ga0495661_0007385 | 3300046665 | Bacteria | 7657 |
| 705 | Ga0495661_0012488 | 3300046665 | Bacteria | 5736 |
| 706 | Ga0495661_0020506 | 3300046665 | Bacteria | 4313 |
| 707 | Ga0495661_0023945 | 3300046665 | Bacteria | 3957 |
| 708 | Ga0495661_0028727 | 3300046665 | Bacteria | 3556 |
| 709 | Ga0495661_0039994 | 3300046665 | Bacteria | 2910 |
| 710 | Ga0495661_0043396 | 3300046665 | Bacteria | 2764 |
| 711 | Ga0495661_0047504 | 3300046665 | Bacteria | 2613 |
| 712 | Ga0495661_0063816 | 3300046665 | Bacteria | 2176 |
| 713 | Ga0495661_0165231 | 3300046665 | Bacteria | 1185 |
| 714 | Ga0495661_0166458 | 3300046665 | Bacteria | 1179 |
| 715 | Ga0495661_0213394 | 3300046665 | Bacteria | 1003 |
| 716 | Ga0495661_0255821 | 3300046665 | Bacteria | 892 |
| 717 | Ga0495588_0000086 | 3300046674 | Bacteria | 193241 |
| 718 | Ga0495588_0011973 | 3300046674 | Bacteria | 4085 |
| 719 | Ga0495588_0014347 | 3300046674 | Bacteria | 3791 |
| 720 | Ga0495588_0017075 | 3300046674 | Bacteria | 3518 |
| 721 | Ga0495588_0032962 | 3300046674 | Bacteria | 2613 |
| 722 | Ga0495588_0034728 | 3300046674 | Bacteria | 2552 |
| 723 | Ga0495588_0058010 | 3300046674 | Bacteria | 2001 |
| 724 | Ga0495588_0116559 | 3300046674 | Bacteria | 1407 |
| 725 | Ga0495657_0058805 | 3300046675 | Bacteria | 2551 |
| 726 | Ga0495599_0003514 | 3300046678 | Bacteria | 9176 |
| 727 | Ga0495623_0008207 | 3300046679 | Bacteria | 6793 |
| 728 | Ga0495623_0011302 | 3300046679 | Bacteria | 5776 |
| 729 | Ga0495623_0035632 | 3300046679 | Bacteria | 3189 |
| 730 | Ga0495623_0041958 | 3300046679 | Bacteria | 2916 |
| 731 | Ga0495623_0048369 | 3300046679 | Bacteria | 2697 |
| 732 | Ga0495646_0001555 | 3300046680 | Bacteria | 13656 |
| 733 | Ga0495669_0000018 | 3300046684 | Bacteria | 127866 |
| 734 | Ga0495669_0026346 | 3300046684 | Bacteria | 2540 |
| 735 | Ga0495669_0093968 | 3300046684 | Bacteria | 1387 |
| 736 | Ga0495613_0089487 | 3300046689 | Bacteria | 2230 |
| 737 | Ga0495624_0033919 | 3300046690 | Bacteria | 3305 |
| 738 | Ga0495624_0036132 | 3300046690 | Bacteria | 3187 |
| 739 | Ga0495624_0292209 | 3300046690 | Bacteria | 983 |
| 740 | Ga0495670_0000143 | 3300046691 | Bacteria | 31142 |
| 741 | Ga0495670_0001120 | 3300046691 | Bacteria | 12994 |
| 742 | Ga0495670_0010421 | 3300046691 | Bacteria | 4566 |
| 743 | Ga0495670_0013539 | 3300046691 | Bacteria | 4011 |
| 744 | Ga0495670_0035185 | 3300046691 | Bacteria | 2495 |
| 745 | Ga0495670_0079714 | 3300046691 | Bacteria | 1667 |
| 746 | Ga0495670_0081229 | 3300046691 | Bacteria | 1651 |
| 747 | Ga0495670_0247697 | 3300046691 | Bacteria | 949 |
| 748 | Ga0495671_0000658 | 3300046692 | Bacteria | 25041 |
| 749 | Ga0495671_0001049 | 3300046692 | Bacteria | 19213 |
| 750 | Ga0495671_0019545 | 3300046692 | Bacteria | 3578 |
| 751 | Ga0495671_0031072 | 3300046692 | Bacteria | 2731 |
| 752 | Ga0495671_0127303 | 3300046692 | Bacteria | 1242 |
| 753 | Ga0495671_0154071 | 3300046692 | Bacteria | 1118 |
| 754 | Ga0495649_0003442 | 3300046694 | Bacteria | 10671 |
| 755 | Ga0495649_0009418 | 3300046694 | Bacteria | 5808 |
| 756 | Ga0495649_0015222 | 3300046694 | Bacteria | 4379 |
| 757 | Ga0495649_0027732 | 3300046694 | Bacteria | 3141 |
| 758 | Ga0495649_0048732 | 3300046694 | Bacteria | 2302 |
| 759 | Ga0495589_0000017 | 3300046794 | Bacteria | 206113 |
| 760 | Ga0495589_0000513 | 3300046794 | Bacteria | 27274 |
| 761 | Ga0495589_0001742 | 3300046794 | Bacteria | 12371 |
| 762 | Ga0495589_0004248 | 3300046794 | Bacteria | 7661 |
| 763 | Ga0495589_0011131 | 3300046794 | Bacteria | 4668 |
| 764 | Ga0495589_0013061 | 3300046794 | Bacteria | 4289 |
| 765 | Ga0495589_0020691 | 3300046794 | Bacteria | 3364 |
| 766 | Ga0495589_0022368 | 3300046794 | Bacteria | 3226 |
| 767 | Ga0495589_0043009 | 3300046794 | Bacteria | 2250 |
| 768 | Ga0495589_0082237 | 3300046794 | Bacteria | 1566 |
| 769 | Ga0495600_0000834 | 3300046809 | Bacteria | 16422 |
| 770 | Ga0495600_0006403 | 3300046809 | Bacteria | 7166 |
| 771 | Ga0495600_0131479 | 3300046809 | Bacteria | 1627 |
| 772 | Ga0495660_0000067 | 3300046810 | Bacteria | 119390 |
| 773 | Ga0495660_0002349 | 3300046810 | Bacteria | 12097 |
| 774 | Ga0495660_0004163 | 3300046810 | Bacteria | 8799 |
| 775 | Ga0495660_0007858 | 3300046810 | Bacteria | 6263 |
| 776 | Ga0495660_0014127 | 3300046810 | Bacteria | 4624 |
| 777 | Ga0495660_0047272 | 3300046810 | Bacteria | 2357 |
| 778 | Ga0495660_0059026 | 3300046810 | Bacteria | 2064 |
| 779 | Ga0495660_0063365 | 3300046810 | Bacteria | 1980 |
| 780 | Ga0495660_0128657 | 3300046810 | Bacteria | 1272 |
| 781 | Ga0495660_0166579 | 3300046810 | Bacteria | 1076 |
| 782 | Ga0495581_0009510 | 3300047315 | Bacteria | 5625 |
| 783 | Ga0495581_0018889 | 3300047315 | Bacteria | 4001 |
| 784 | Ga0495581_0055668 | 3300047315 | Bacteria | 2282 |
| 785 | Ga0495604_0004591 | 3300047317 | Bacteria | 10939 |
| 786 | Ga0495604_0034285 | 3300047317 | Bacteria | 4016 |
| 787 | Ga0495604_0246697 | 3300047317 | Bacteria | 1219 |
| 788 | Ga0495604_0437459 | 3300047317 | Bacteria | 856 |
| 789 | Ga0495636_0000388 | 3300047318 | Bacteria | 16592 |
| 790 | Ga0495636_0003301 | 3300047318 | Bacteria | 6250 |
| 791 | Ga0495636_0004667 | 3300047318 | Bacteria | 5374 |
| 792 | Ga0495636_0009037 | 3300047318 | Bacteria | 3918 |
| 793 | Ga0495636_0023781 | 3300047318 | Bacteria | 2482 |
| 794 | Ga0495636_0061353 | 3300047318 | Bacteria | 1590 |
| 795 | Ga0495636_0135464 | 3300047318 | Bacteria | 1097 |
| 796 | Ga0495674_0221331 | 3300047319 | Bacteria | 1564 |
| 797 | Ga0495672_0000067 | 3300047320 | Bacteria | 190335 |
| 798 | Ga0495672_0000343 | 3300047320 | Bacteria | 59629 |
| 799 | Ga0495672_0000718 | 3300047320 | Bacteria | 36426 |
| 800 | Ga0495672_0001478 | 3300047320 | Bacteria | 23059 |
| 801 | Ga0495672_0003293 | 3300047320 | Bacteria | 13969 |
| 802 | Ga0495672_0004198 | 3300047320 | Bacteria | 11934 |
| 803 | Ga0495672_0034084 | 3300047320 | Bacteria | 3149 |
| 804 | Ga0495672_0052482 | 3300047320 | Bacteria | 2394 |
| 805 | Ga0495672_0128740 | 3300047320 | Bacteria | 1334 |
| 806 | Ga0495676_0000067 | 3300047321 | Bacteria | 80084 |
| 807 | Ga0495676_0028953 | 3300047321 | Bacteria | 4722 |
| 808 | Ga0495676_0461324 | 3300047321 | Bacteria | 837 |
| 809 | Ga0495683_0000083 | 3300047323 | Bacteria | 93743 |
| 810 | Ga0495683_0000348 | 3300047323 | Bacteria | 38313 |
| 811 | Ga0495683_0002803 | 3300047323 | Bacteria | 10339 |
| 812 | Ga0495683_0006314 | 3300047323 | Bacteria | 6481 |
| 813 | Ga0495683_0019894 | 3300047323 | Bacteria | 3463 |
| 814 | Ga0495683_0022607 | 3300047323 | Bacteria | 3233 |
| 815 | Ga0495683_0057907 | 3300047323 | Bacteria | 1925 |
| 816 | Ga0495683_0078187 | 3300047323 | Bacteria | 1616 |
| 817 | Ga0495683_0079896 | 3300047323 | Bacteria | 1596 |
| 818 | Ga0495687_000033 | 3300047443 | Bacteria | 263788 |
| 819 | Ga0495687_000126 | 3300047443 | Bacteria | 117879 |
| 820 | Ga0495687_000252 | 3300047443 | Bacteria | 72401 |
| 821 | Ga0495687_000640 | 3300047443 | Bacteria | 40137 |
| 822 | Ga0495687_008102 | 3300047443 | Bacteria | 6070 |
| 823 | Ga0495687_010751 | 3300047443 | Bacteria | 4988 |
| 824 | Ga0495687_010893 | 3300047443 | Bacteria | 4939 |
| 825 | Ga0495687_022520 | 3300047443 | Bacteria | 3022 |
| 826 | Ga0495675_0003787 | 3300047444 | Bacteria | 9148 |
| 827 | Ga0495675_0030000 | 3300047444 | Bacteria | 3470 |
| 828 | Ga0495675_0088516 | 3300047444 | Bacteria | 1944 |
| 829 | Ga0495677_0000002 | 3300047445 | Bacteria | 346767 |
| 830 | Ga0495677_0005091 | 3300047445 | Bacteria | 5003 |
| 831 | Ga0495677_0008034 | 3300047445 | Bacteria | 3920 |
| 832 | Ga0495677_0008164 | 3300047445 | Bacteria | 3888 |
| 833 | Ga0495677_0014812 | 3300047445 | Bacteria | 2836 |
| 834 | Ga0495677_0021668 | 3300047445 | Bacteria | 2329 |
| 835 | Ga0495677_0032123 | 3300047445 | Bacteria | 1911 |
| 836 | Ga0495677_0044837 | 3300047445 | Bacteria | 1621 |
| 837 | Ga0495677_0051623 | 3300047445 | Bacteria | 1514 |
| 838 | Ga0495677_0098020 | 3300047445 | Bacteria | 1108 |
| 839 | Ga0495677_0128864 | 3300047445 | Bacteria | 968 |
| 840 | Ga0495679_008082 | 3300047446 | Bacteria | 4310 |
| 841 | Ga0495679_008137 | 3300047446 | Bacteria | 4292 |
| 842 | Ga0495679_019799 | 3300047446 | Bacteria | 2356 |
| 843 | Ga0495679_034537 | 3300047446 | Bacteria | 1608 |
| 844 | Ga0495679_074564 | 3300047446 | Bacteria | 971 |
| 845 | Ga0495685_000053 | 3300047447 | Bacteria | 45514 |
| 846 | Ga0495685_000183 | 3300047447 | Bacteria | 20748 |
| 847 | Ga0495685_001317 | 3300047447 | Bacteria | 7585 |
| 848 | Ga0495685_004689 | 3300047447 | Bacteria | 4434 |
| 849 | Ga0495685_016533 | 3300047447 | Bacteria | 2521 |
| 850 | Ga0495673_0000265 | 3300047469 | Bacteria | 72840 |
| 851 | Ga0495681_0000321 | 3300047470 | Bacteria | 38154 |
| 852 | Ga0495681_0007275 | 3300047470 | Bacteria | 7112 |
| 853 | Ga0495681_0016273 | 3300047470 | Bacteria | 4176 |
| 854 | Ga0495681_0030372 | 3300047470 | Bacteria | 2752 |
| 855 | Ga0495681_0032989 | 3300047470 | Bacteria | 2599 |
| 856 | Ga0495681_0046396 | 3300047470 | Bacteria | 2072 |
| 857 | Ga0495686_0000628 | 3300047472 | Bacteria | 48588 |
| 858 | Ga0495686_0033337 | 3300047472 | Bacteria | 3326 |
| 859 | Ga0495686_0040123 | 3300047472 | Bacteria | 2987 |
| 860 | Ga0495686_0091644 | 3300047472 | Bacteria | 1844 |
| 861 | Ga0495686_0129523 | 3300047472 | Bacteria | 1497 |
| 862 | Ga0495686_0181975 | 3300047472 | Bacteria | 1217 |
| 863 | Ga0495593_0054376 | 3300047673 | Bacteria | 2110 |
| 864 | Ga0495602_0024798 | 3300048088 | Bacteria | 5814 |
| 865 | Ga0495602_0104784 | 3300048088 | Bacteria | 2313 |
| 866 | Ga0495602_0159563 | 3300048088 | Bacteria | 1762 |
| 867 | Ga0495614_0001110 | 3300048089 | Bacteria | 11534 |
| 868 | Ga0495614_0018070 | 3300048089 | Bacteria | 3056 |
| 869 | Ga0495615_0001150 | 3300048090 | Bacteria | 3817 |
| 870 | Ga0495615_0029638 | 3300048090 | Bacteria | 1300 |
| 871 | Ga0495626_0000097 | 3300048091 | Bacteria | 113925 |
| 872 | Ga0495626_0000209 | 3300048091 | Bacteria | 70145 |
| 873 | Ga0495626_0000258 | 3300048091 | Bacteria | 60668 |
| 874 | Ga0495626_0003284 | 3300048091 | Bacteria | 10440 |
| 875 | Ga0495626_0007634 | 3300048091 | Bacteria | 5998 |
| 876 | Ga0495626_0011560 | 3300048091 | Bacteria | 4666 |
| 877 | Ga0495626_0016093 | 3300048091 | Bacteria | 3809 |
| 878 | Ga0495626_0018518 | 3300048091 | Bacteria | 3495 |
| 879 | Ga0495626_0021333 | 3300048091 | Bacteria | 3214 |
| 880 | Ga0495626_0026399 | 3300048091 | Bacteria | 2831 |
| 881 | Ga0495626_0044605 | 3300048091 | Bacteria | 2073 |
| 882 | Ga0495626_0049911 | 3300048091 | Bacteria | 1935 |
| 883 | Ga0495626_0059885 | 3300048091 | Bacteria | 1736 |
| 884 | Ga0495626_0145896 | 3300048091 | Bacteria | 1000 |
| 885 | Ga0496100_0052012 | 3300048903 | Bacteria | 2661 |
| 886 | Ga0496100_0159307 | 3300048903 | Bacteria | 1617 |
| 887 | Ga0496101_0044781 | 3300048904 | Bacteria | 3167 |
| 888 | Ga0496101_0092574 | 3300048904 | Bacteria | 2251 |
| 889 | Ga0496102_0000313 | 3300048905 | Bacteria | 61085 |
| 890 | Ga0496102_0000487 | 3300048905 | Bacteria | 43875 |
| 891 | Ga0496102_0055639 | 3300048905 | Bacteria | 3607 |
| 892 | Ga0496102_0420493 | 3300048905 | Bacteria | 1255 |
| 893 | Ga0496103_0091804 | 3300048906 | Bacteria | 1916 |
| 894 | Ga0496103_0231148 | 3300048906 | Bacteria | 1189 |
| 895 | Ga0496103_0422697 | 3300048906 | Bacteria | 855 |
| 896 | Ga0496103_0443694 | 3300048906 | Bacteria | 832 |
| 897 | Ga0496103_0450071 | 3300048906 | Bacteria | 826 |
| 898 | Ga0496104_0848884 | 3300048907 | Bacteria | 819 |
| 899 | Ga0496106_0006127 | 3300048909 | Bacteria | 8896 |
| 900 | Ga0496107_0075821 | 3300048910 | Bacteria | 2448 |
| 901 | Ga0496107_0293454 | 3300048910 | Bacteria | 1210 |
| 902 | Ga0496108_0217414 | 3300048911 | Bacteria | 1660 |
| 903 | Ga0496108_0711016 | 3300048911 | Bacteria | 871 |
| 904 | Ga0496109_0068134 | 3300048912 | Bacteria | 3262 |
| 905 | Ga0496109_0229028 | 3300048912 | Bacteria | 1748 |
| 906 | Ga0496110_0000024 | 3300048913 | Bacteria | 74685 |
| 907 | Ga0496110_0104634 | 3300048913 | Bacteria | 2539 |
| 908 | Ga0496110_0570064 | 3300048913 | Bacteria | 1028 |
| 909 | Ga0496111_0635735 | 3300048914 | Bacteria | 779 |
| 910 | Ga0496112_0367515 | 3300048915 | Bacteria | 1380 |
| 911 | Ga0496112_0755078 | 3300048915 | Bacteria | 899 |
| 912 | Ga0496113_0019700 | 3300048916 | Bacteria | 4726 |
| 913 | Ga0496114_0047812 | 3300048917 | Bacteria | 3558 |
| 914 | Ga0496114_0067969 | 3300048917 | Bacteria | 2991 |
| 915 | Ga0496114_0478533 | 3300048917 | Bacteria | 1102 |
| 916 | Ga0496115_0026659 | 3300048918 | Bacteria | 4512 |
| 917 | Ga0496115_0056234 | 3300048918 | Bacteria | 3162 |
| 918 | Ga0496115_0082225 | 3300048918 | Bacteria | 2623 |
| 919 | Ga0496115_0215720 | 3300048918 | Bacteria | 1584 |
| 920 | Ga0496115_0555710 | 3300048918 | Bacteria | 917 |
| 921 | Ga0496116_0026481 | 3300048919 | Bacteria | 4240 |
| 922 | Ga0496118_0131119 | 3300048921 | Bacteria | 1609 |
| 923 | Ga0496121_0095442 | 3300048924 | Bacteria | 2311 |
| 924 | Ga0496121_0154136 | 3300048924 | Bacteria | 1687 |
| 925 | Ga0496121_0514578 | 3300048924 | Bacteria | 757 |
| 926 | Ga0496122_0000439 | 3300048925 | Bacteria | 87380 |
| 927 | Ga0496122_0002153 | 3300048925 | Bacteria | 28900 |
| 928 | Ga0496122_0004757 | 3300048925 | Bacteria | 16624 |
| 929 | Ga0496122_0011837 | 3300048925 | Bacteria | 8770 |
| 930 | Ga0496123_0000487 | 3300048926 | Bacteria | 69019 |
| 931 | Ga0496123_0003789 | 3300048926 | Bacteria | 16558 |
| 932 | Ga0496123_0022480 | 3300048926 | Bacteria | 4858 |
| 933 | Ga0496124_0016901 | 3300048927 | Bacteria | 6913 |
| 934 | Ga0496124_0021248 | 3300048927 | Bacteria | 5984 |
| 935 | Ga0496124_0023141 | 3300048927 | Bacteria | 5680 |
| 936 | Ga0496124_0045759 | 3300048927 | Bacteria | 3751 |
| 937 | Ga0496124_0076458 | 3300048927 | Bacteria | 2763 |
| 938 | Ga0496124_0303252 | 3300048927 | Bacteria | 1152 |
| 939 | Ga0496125_0001079 | 3300048928 | Bacteria | 41999 |
| 940 | Ga0496125_0003984 | 3300048928 | Bacteria | 17378 |
| 941 | Ga0496125_0099527 | 3300048928 | Bacteria | 2147 |
| 942 | Ga0496125_0182288 | 3300048928 | Bacteria | 1397 |
| 943 | Ga0496125_0246345 | 3300048928 | Bacteria | 1131 |
| 944 | Ga0496126_0060200 | 3300048929 | Bacteria | 3416 |
| 945 | Ga0496126_0224826 | 3300048929 | Bacteria | 1575 |
| 946 | Ga0501308_013232 | 3300049128 | Bacteria | 952 |
| 947 | Ga0501304_003196 | 3300049160 | Bacteria | 1188 |
| 948 | Ga0501305_039264 | 3300049161 | Bacteria | 765 |
| 949 | Ga0495678_000131 | 3300049459 | Bacteria | 88620 |
| 950 | Ga0495678_000355 | 3300049459 | Bacteria | 47179 |
| 951 | Ga0495678_001074 | 3300049459 | Bacteria | 23088 |
| 952 | Ga0495678_003680 | 3300049459 | Bacteria | 9283 |
| 953 | Ga0495678_004358 | 3300049459 | Bacteria | 8225 |
| 954 | Ga0495678_015158 | 3300049459 | Bacteria | 3558 |
| 955 | Ga0495678_033475 | 3300049459 | Bacteria | 2120 |
| 956 | Ga0495678_193161 | 3300049459 | Bacteria | 631 |
| 957 | Ga0495682_0000779 | 3300049460 | Bacteria | 20252 |
| 958 | Ga0495682_0001850 | 3300049460 | Bacteria | 10612 |
| 959 | Ga0495682_0002874 | 3300049460 | Bacteria | 7921 |
| 960 | Ga0495682_0004757 | 3300049460 | Bacteria | 5734 |
| 961 | Ga0501300_033155 | 3300049523 | Bacteria | 765 |
| 962 | Ga0501207_006845 | 3300049654 | Bacteria | 1611 |
| 963 | Ga0501280_000079 | 3300049776 | Bacteria | 25935 |
| 964 | Ga0501282_010548 | 3300049778 | Bacteria | 992 |
| 965 | Ga0501035_0005808 | 3300049822 | Bacteria | 11635 |
| 966 | nmdc:mga00v17_230903_c1 | 3300050491 | Bacteria | 1199 |
| 967 | nmdc:mga0yw44_175167_c1 | 3300050492 | Bacteria | 1410 |
| 968 | Ga0495601_0021365 | 3300053077 | Bacteria | 3963 |
| 969 | Ga0495601_0323983 | 3300053077 | Bacteria | 1003 |
| 970 | Ga0495655_0154964 | 3300053083 | Bacteria | 723 |
| 971 | Ga0500583_0004765 | 3300053092 | Bacteria | 4467 |
| 972 | Ga0500650_0000077 | 3300053098 | Bacteria | 28370 |
| 973 | Ga0500594_0017715 | 3300053118 | Bacteria | 1747 |
| 974 | Ga0500614_159553 | 3300053123 | Bacteria | 683 |
| 975 | Ga0500618_000301 | 3300053125 | Bacteria | 37462 |
| 976 | Ga0500618_000821 | 3300053125 | Bacteria | 17044 |
| 977 | Ga0500564_049825 | 3300053138 | Bacteria | 1917 |
| 978 | Ga0500574_000358 | 3300053141 | Bacteria | 5632 |
| 979 | Ga0500622_0279307 | 3300053156 | Bacteria | 720 |
| 980 | Ga0500634_0016724 | 3300053161 | Bacteria | 3917 |
| 981 | Ga0500661_019973 | 3300055283 | Bacteria | 1191 |
| 982 | Ga0587066_023808 | 3300059490 | Bacteria | 1037 |
| 983 | Ga0587066_089812 | 3300059490 | Bacteria | 680 |
| 984 | Ga0587070_012124 | 3300059491 | Bacteria | 1303 |
| 985 | Ga0587077_006576 | 3300059493 | Bacteria | 1653 |
| 986 | Ga0587077_025555 | 3300059493 | Bacteria | 1084 |
| 987 | Ga0587080_010270 | 3300059503 | Bacteria | 1377 |
| 988 | Ga0587083_0023065 | 3300059505 | Bacteria | 1171 |
| 989 | Ga0587085_003884 | 3300059506 | Bacteria | 1662 |
| 990 | Ga0587086_011885 | 3300059507 | Bacteria | 1074 |
| 991 | Ga0587090_001134 | 3300059510 | Bacteria | 2599 |
| 992 | Ga0587090_013222 | 3300059510 | Bacteria | 1190 |
| 993 | Ga0587091_019150 | 3300059511 | Bacteria | 1173 |
| 994 | Ga0587091_019940 | 3300059511 | Bacteria | 1159 |
| 995 | Ga0587106_021228 | 3300059605 | Bacteria | 966 |
| 996 | Ga0587101_054991 | 3300059623 | Bacteria | 696 |
| 997 | Ga0587109_014206 | 3300059624 | Bacteria | 1333 |
| 998 | Ga0587117_016597 | 3300059627 | Bacteria | 982 |
| 999 | Ga0587062_011715 | 3300059639 | Bacteria | 1112 |
| 1000 | Ga0587067_015649 | 3300059640 | Bacteria | 1234 |
| 1001 | Ga0587067_020457 | 3300059640 | Bacteria | 1132 |
| 1002 | Ga0587068_016177 | 3300059641 | Bacteria | 1181 |
| 1003 | Ga0587069_016163 | 3300059642 | Bacteria | 1063 |
| 1004 | Ga0587069_022812 | 3300059642 | Bacteria | 953 |
| 1005 | Ga0587072_005287 | 3300059643 | Bacteria | 1923 |
| 1006 | Ga0587072_025780 | 3300059643 | Bacteria | 1071 |
| 1007 | Ga0587078_011383 | 3300059646 | Bacteria | 1032 |
| 1008 | Ga0587079_043002 | 3300059647 | Bacteria | 920 |
| 1009 | Ga0587105_003927 | 3300059651 | Bacteria | 929 |
| 1010 | Ga0587071_065599 | 3300060344 | Bacteria | 780 |
| 1011 | Ga0587111_0001153 | 3300060346 | Bacteria | 3028 |
| 1012 | Ga0466962_0032893 | 3300061719 | Bacteria | 2481 |
| 1013 | Ga0466962_0091908 | 3300061719 | Bacteria | 1454 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300002987 | JGI25159J45721_1004210 | JGI25159J45721_10042104 | 180 |
| 2 | 3300002987 | JGI25159J45721_1008279 | JGI25159J45721_10082791 | 180 |
| 3 | 3300003374 | JGI25161J50226_1001131 | JGI25161J50226_10011316 | 180 |
| 4 | 3300003771 | Ga0055526_1005093 | Ga0055526_10050938 | 180 |
| 5 | 3300004625 | Ga0055543_1001470 | Ga0055543_10014704 | 180 |
| 6 | 3300005262 | Ga0065165_1004144 | Ga0065165_10041444 | 180 |
| 7 | 3300005331 | Ga0070670_100000017 | Ga0070670_100000017138 | 180 |
| 8 | 3300005335 | Ga0070666_10403118 | Ga0070666_104031182 | 180 |
| 9 | 3300005353 | Ga0070669_100028281 | Ga0070669_1000282811 | 180 |
| 10 | 3300005355 | Ga0070671_100000173 | Ga0070671_10000017340 | 180 |
| 11 | 3300005365 | Ga0070688_100003318 | Ga0070688_1000033182 | 180 |
| 12 | 3300005367 | Ga0070667_100001097 | Ga0070667_10000109715 | 180 |
| 13 | 3300005466 | Ga0070685_10000026 | Ga0070685_1000002639 | 180 |
| 14 | 3300005548 | Ga0070665_100285816 | Ga0070665_1002858162 | 180 |
| 15 | 3300005617 | Ga0068859_100317621 | Ga0068859_1003176212 | 180 |
| 16 | 3300005618 | Ga0068864_100000029 | Ga0068864_10000002976 | 180 |
| 17 | 3300005841 | Ga0068863_100600276 | Ga0068863_1006002762 | 180 |
| 18 | 3300005842 | Ga0068858_100133592 | Ga0068858_1001335922 | 180 |
| 19 | 3300005843 | Ga0068860_100000228 | Ga0068860_10000022814 | 180 |
| 20 | 3300005844 | Ga0068862_100089363 | Ga0068862_1000893633 | 180 |
| 21 | 3300006051 | Ga0075364_10446427 | Ga0075364_104464272 | 180 |
| 22 | 3300006931 | Ga0097620_100317629 | Ga0097620_1003176292 | 180 |
| 23 | 3300009553 | Ga0105249_10901723 | Ga0105249_109017231 | 180 |
| 24 | 3300013306 | Ga0163162_10609494 | Ga0163162_106094942 | 180 |
| 25 | 3300014968 | Ga0157379_10637077 | Ga0157379_106370771 | 180 |
| 26 | 3300025208 | Ga0209436_101543 | Ga0209436_1015433 | 180 |
| 27 | 3300025284 | Ga0209130_1001054 | Ga0209130_100105410 | 180 |
| 28 | 3300025903 | Ga0207680_10014776 | Ga0207680_100147761 | 180 |
| 29 | 3300025923 | Ga0207681_10022277 | Ga0207681_100222772 | 180 |
| 30 | 3300025925 | Ga0207650_10000003 | Ga0207650_1000000376 | 180 |
| 31 | 3300025931 | Ga0207644_10004443 | Ga0207644_100044439 | 180 |
| 32 | 3300025941 | Ga0207711_10000472 | Ga0207711_1000047214 | 180 |
| 33 | 3300025961 | Ga0207712_10135816 | Ga0207712_101358162 | 180 |
| 34 | 3300025986 | Ga0207658_10000012 | Ga0207658_1000001276 | 180 |
| 35 | 3300026035 | Ga0207703_10130918 | Ga0207703_101309182 | 180 |
| 36 | 3300026088 | Ga0207641_10025128 | Ga0207641_100251282 | 180 |
| 37 | 3300026095 | Ga0207676_10000003 | Ga0207676_100000031019 | 180 |
| 38 | 3300028379 | Ga0268266_10032903 | Ga0268266_100329035 | 180 |
| 39 | 3300028380 | Ga0268265_10002832 | Ga0268265_100028323 | 180 |
| 40 | 3300028381 | Ga0268264_10000009 | Ga0268264_10000009562 | 180 |
| 41 | 3300047445 | Ga0495677_0128864 | Ga0495677_0128864_240_785 | 180 |
| 42 | 3300050491 | nmdc:mga00v17_230903_c1 | nmdc:mga00v17_230903_c1_46_591 | 180 |
| 43 | 3300053098 | Ga0500650_0000077 | Ga0500650_0000077_6900_7445 | 180 |
| 44 | 3300053138 | Ga0500564_049825 | Ga0500564_049825_1163_1708 | 180 |
| 45 | 3300053161 | Ga0500634_0016724 | Ga0500634_0016724_2935_3480 | 180 |
| 46 | 3300055283 | Ga0500661_019973 | Ga0500661_019973_98_643 | 180 |
| 47 | 3300005331 | Ga0070670_100008239 | Ga0070670_1000082399 | 181 |
| 48 | 3300005335 | Ga0070666_10001017 | Ga0070666_100010175 | 181 |
| 49 | 3300005340 | Ga0070689_100111630 | Ga0070689_1001116303 | 181 |
| 50 | 3300005347 | Ga0070668_100007166 | Ga0070668_1000071666 | 181 |
| 51 | 3300005353 | Ga0070669_100039493 | Ga0070669_1000394934 | 181 |
| 52 | 3300005354 | Ga0070675_100029487 | Ga0070675_1000294873 | 181 |
| 53 | 3300005355 | Ga0070671_100099885 | Ga0070671_1000998853 | 181 |
| 54 | 3300005364 | Ga0070673_100010734 | Ga0070673_1000107342 | 181 |
| 55 | 3300005365 | Ga0070688_100019613 | Ga0070688_1000196135 | 181 |
| 56 | 3300005367 | Ga0070667_100003801 | Ga0070667_1000038018 | 181 |
| 57 | 3300005456 | Ga0070678_100004615 | Ga0070678_1000046156 | 181 |
| 58 | 3300005459 | Ga0068867_100003865 | Ga0068867_1000038659 | 181 |
| 59 | 3300005466 | Ga0070685_10172828 | Ga0070685_101728282 | 181 |
| 60 | 3300005719 | Ga0068861_100127381 | Ga0068861_1001273812 | 181 |
| 61 | 3300005843 | Ga0068860_101144895 | Ga0068860_1011448952 | 181 |
| 62 | 3300005844 | Ga0068862_100069792 | Ga0068862_1000697925 | 181 |
| 63 | 3300006038 | Ga0075365_10197172 | Ga0075365_101971722 | 181 |
| 64 | 3300006178 | Ga0075367_10558457 | Ga0075367_105584572 | 181 |
| 65 | 3300006195 | Ga0075366_10026204 | Ga0075366_100262045 | 181 |
| 66 | 3300009177 | Ga0105248_10006207 | Ga0105248_100062072 | 181 |
| 67 | 3300009551 | Ga0105238_10262147 | Ga0105238_102621472 | 181 |
| 68 | 3300013296 | Ga0157374_10014078 | Ga0157374_100140787 | 181 |
| 69 | 3300013297 | Ga0157378_10667619 | Ga0157378_106676192 | 181 |
| 70 | 3300013306 | Ga0163162_10003303 | Ga0163162_100033033 | 181 |
| 71 | 3300014325 | Ga0163163_10423409 | Ga0163163_104234092 | 181 |
| 72 | 3300014326 | Ga0157380_10007300 | Ga0157380_100073009 | 181 |
| 73 | 3300014968 | Ga0157379_10015472 | Ga0157379_100154727 | 181 |
| 74 | 3300021361 | Ga0213872_10001692 | Ga0213872_1000169213 | 181 |
| 75 | 3300021361 | Ga0213872_10019678 | Ga0213872_100196783 | 181 |
| 76 | 3300021361 | Ga0213872_10091690 | Ga0213872_100916902 | 181 |
| 77 | 3300021384 | Ga0213876_10076148 | Ga0213876_100761482 | 181 |
| 78 | 3300025923 | Ga0207681_10070592 | Ga0207681_100705922 | 181 |
| 79 | 3300025925 | Ga0207650_10004390 | Ga0207650_1000439010 | 181 |
| 80 | 3300025972 | Ga0207668_10007151 | Ga0207668_100071518 | 181 |
| 81 | 3300025972 | Ga0207668_10118956 | Ga0207668_101189562 | 181 |
| 82 | 3300026089 | Ga0207648_10076849 | Ga0207648_100768491 | 181 |
| 83 | 3300028380 | Ga0268265_10048589 | Ga0268265_100485892 | 181 |
| 84 | 3300028381 | Ga0268264_10099773 | Ga0268264_100997732 | 181 |
| 85 | 3300030521 | Ga0307511_10008326 | Ga0307511_1000832615 | 181 |
| 86 | 3300031250 | Ga0265331_10064063 | Ga0265331_100640632 | 181 |
| 87 | 3300031251 | Ga0265327_10090693 | Ga0265327_100906933 | 181 |
| 88 | 3300031507 | Ga0307509_10270648 | Ga0307509_102706482 | 181 |
| 89 | 3300032133 | Ga0316583_10009603 | Ga0316583_100096034 | 181 |
| 90 | 3300037418 | Ga0395900_0009260 | Ga0395900_0009260_1647_2210 | 181 |
| 91 | 3300039437 | Ga0436365_1765823 | Ga0436365_1765823_3748_4305 | 181 |
| 92 | 3300039447 | Ga0436361_0275924 | Ga0436361_0275924_1963_2508 | 181 |
| 93 | 3300039447 | Ga0436361_0632651 | Ga0436361_0632651_3053_3598 | 181 |
| 94 | 3300039447 | Ga0436361_1043948 | Ga0436361_1043948_3045_3590 | 181 |
| 95 | 3300039453 | Ga0436362_0115419 | Ga0436362_0115419_349_906 | 181 |
| 96 | 3300042876 | Ga0451577_0625920 | Ga0451577_0625920_377_922 | 181 |
| 97 | 3300044712 | Ga0453684_0000102 | Ga0453684_0000102_43021_43566 | 181 |
| 98 | 3300045051 | Ga0451576_0000171 | Ga0451576_0000171_154818_155363 | 181 |
| 99 | 3300045051 | Ga0451576_0000386 | Ga0451576_0000386_35310_35855 | 181 |
| 100 | 3300045051 | Ga0451576_0080204 | Ga0451576_0080204_405_950 | 181 |
| 101 | 3300045051 | Ga0451576_0724582 | Ga0451576_0724582_68_613 | 181 |
| 102 | 3300046523 | Ga0495644_0002518 | Ga0495644_0002518_5805_6356 | 181 |
| 103 | 3300048912 | Ga0496109_0229028 | Ga0496109_0229028_648_1193 | 181 |
| 104 | 3300048917 | Ga0496114_0478533 | Ga0496114_0478533_145_690 | 181 |
| 105 | 3300049523 | Ga0501300_033155 | Ga0501300_033155_21_569 | 181 |
| 106 | 3300049776 | Ga0501280_000079 | Ga0501280_000079_17100_17648 | 181 |
| 107 | 3300049778 | Ga0501282_010548 | Ga0501282_010548_286_834 | 181 |
| 108 | 3300050492 | nmdc:mga0yw44_175167_c1 | nmdc:mga0yw44_175167_c1_800_1354 | 181 |
| 109 | 3300053092 | Ga0500583_0004765 | Ga0500583_0004765_1300_1845 | 181 |
| 110 | 3300053123 | Ga0500614_159553 | Ga0500614_159553_126_671 | 181 |
| 111 | 3300026078 | Ga0207702_11225745 | Ga0207702_112257451 | 182 |
| 112 | 3300037312 | Ga0395899_0010704 | Ga0395899_0010704_2308_2889 | 182 |
| 113 | 3300037418 | Ga0395900_0010088 | Ga0395900_0010088_1414_1995 | 182 |
| 114 | 3300037466 | Ga0395898_0004536 | Ga0395898_0004536_2049_2630 | 182 |
| 115 | 3300037471 | Ga0395905_0152274 | Ga0395905_0152274_1107_1688 | 182 |
| 116 | 3300038443 | Ga0395901_0023907 | Ga0395901_0023907_1529_2110 | 182 |
| 117 | 3300046520 | Ga0495637_0021577 | Ga0495637_0021577_1571_2179 | 182 |
| 118 | 3300049161 | Ga0501305_039264 | Ga0501305_039264_24_575 | 182 |
| 119 | 3300049459 | Ga0495678_000131 | Ga0495678_000131_7626_8234 | 182 |
| 120 | 3300037471 | Ga0395905_0020397 | Ga0395905_0020397_4416_4973 | 183 |
| 121 | 3300037471 | Ga0395905_0392670 | Ga0395905_0392670_153_710 | 183 |
| 122 | 3300046457 | Ga0495590_0067583 | Ga0495590_0067583_118_675 | 183 |
| 123 | 3300046692 | Ga0495671_0019545 | Ga0495671_0019545_2239_2847 | 183 |
| 124 | iso_pu_bacteria | 2521172590 | 2521557364 | 183 |
| 125 | iso_pu_bacteria | 2551306416 | 2553005285 | 183 |
| 126 | iso_pu_bacteria | 2818991449 | 2819617647 | 183 |
| 127 | iso_pu_bacteria | 2904439833 | 2904439898 | 183 |
| 128 | iso_pu_bacteria | 2904530477 | 2904531153 | 183 |
| 129 | iso_pu_bacteria | 2904584206 | 2904587200 | 183 |
| 130 | iso_pu_bacteria | 2904589729 | 2904592766 | 183 |
| 131 | iso_pu_bacteria | 2904601388 | 2904604452 | 183 |
| 132 | iso_pu_bacteria | 2919046199 | 2919050215 | 183 |
| 133 | iso_pu_bacteria | 2919079590 | 2919082273 | 183 |
| 134 | iso_pu_bacteria | 2923510766 | 2923516029 | 183 |
| 135 | iso_pu_bacteria | 2928130867 | 2928133217 | 183 |
| 136 | 3300046530 | Ga0495654_0006380 | Ga0495654_0006380_2365_2949 | 184 |
| 137 | 3300046542 | Ga0495597_0001407 | Ga0495597_0001407_759_1355 | 184 |
| 138 | 3300046794 | Ga0495589_0000513 | Ga0495589_0000513_1351_1947 | 184 |
| 139 | 3300059490 | Ga0587066_023808 | Ga0587066_023808_219_782 | 184 |
| 140 | iso_pu_bacteria | 2808606418 | 2809142462 | 184 |
| 141 | 3300046810 | Ga0495660_0002349 | Ga0495660_0002349_969_1535 | 185 |
| 142 | 3300049459 | Ga0495678_033475 | Ga0495678_033475_1528_2106 | 185 |
| 143 | 3300049459 | Ga0495678_193161 | Ga0495678_193161_15_593 | 185 |
| 144 | 3300046457 | Ga0495590_0028084 | Ga0495590_0028084_357_965 | 186 |
| 145 | 3300046474 | Ga0495605_0044828 | Ga0495605_0044828_854_1462 | 186 |
| 146 | 3300046513 | Ga0495616_0010992 | Ga0495616_0010992_4075_4683 | 186 |
| 147 | 3300046518 | Ga0495631_0000550 | Ga0495631_0000550_20763_21371 | 186 |
| 148 | 3300046524 | Ga0495648_0027171 | Ga0495648_0027171_1136_1744 | 186 |
| 149 | 3300046530 | Ga0495654_0008593 | Ga0495654_0008593_3029_3637 | 186 |
| 150 | 3300046616 | Ga0495668_0006891 | Ga0495668_0006891_3893_4501 | 186 |
| 151 | 3300046810 | Ga0495660_0128657 | Ga0495660_0128657_406_1014 | 186 |
| 152 | 3300047446 | Ga0495679_019799 | Ga0495679_019799_165_773 | 186 |
| 153 | 3300047447 | Ga0495685_001317 | Ga0495685_001317_6246_6854 | 186 |
| 154 | 3300047472 | Ga0495686_0129523 | Ga0495686_0129523_245_805 | 186 |
| 155 | 3300047472 | Ga0495686_0181975 | Ga0495686_0181975_556_1125 | 186 |
| 156 | 3300048091 | Ga0495626_0026399 | Ga0495626_0026399_1628_2236 | 186 |
| 157 | 3300048905 | Ga0496102_0000313 | Ga0496102_0000313_55490_56074 | 186 |
| 158 | 3300048927 | Ga0496124_0021248 | Ga0496124_0021248_2580_3140 | 186 |
| 159 | 3300048929 | Ga0496126_0224826 | Ga0496126_0224826_663_1247 | 186 |
| 160 | iso_pu_bacteria | 2643221638 | 2644215594 | 186 |
| 161 | 3300005563 | Ga0068855_100001073 | Ga0068855_1000010735 | 187 |
| 162 | 3300005577 | Ga0068857_100708483 | Ga0068857_1007084831 | 187 |
| 163 | 3300005578 | Ga0068854_100006965 | Ga0068854_1000069655 | 187 |
| 164 | 3300005834 | Ga0068851_10336586 | Ga0068851_103365862 | 187 |
| 165 | 3300009093 | Ga0105240_10020783 | Ga0105240_100207834 | 187 |
| 166 | 3300009545 | Ga0105237_10135525 | Ga0105237_101355252 | 187 |
| 167 | 3300009551 | Ga0105238_10000065 | Ga0105238_1000006541 | 187 |
| 168 | 3300010375 | Ga0105239_10009136 | Ga0105239_100091365 | 187 |
| 169 | 3300015261 | Ga0182006_1029100 | Ga0182006_10291002 | 187 |
| 170 | 3300025228 | Ga0209672_102164 | Ga0209672_1021643 | 187 |
| 171 | 3300025913 | Ga0207695_10005745 | Ga0207695_1000574513 | 187 |
| 172 | 3300025914 | Ga0207671_10037277 | Ga0207671_100372775 | 187 |
| 173 | 3300025924 | Ga0207694_10001114 | Ga0207694_1000111417 | 187 |
| 174 | 3300025949 | Ga0207667_10000078 | Ga0207667_1000007822 | 187 |
| 175 | 3300025949 | Ga0207667_10023739 | Ga0207667_100237392 | 187 |
| 176 | 3300025981 | Ga0207640_10055935 | Ga0207640_100559352 | 187 |
| 177 | 3300026116 | Ga0207674_10350919 | Ga0207674_103509192 | 187 |
| 178 | 3300039447 | Ga0436361_0149158 | Ga0436361_0149158_328_897 | 187 |
| 179 | 3300046529 | Ga0495652_0016097 | Ga0495652_0016097_4206_4823 | 187 |
| 180 | 3300046543 | Ga0495645_0073481 | Ga0495645_0073481_1436_2053 | 187 |
| 181 | 3300046680 | Ga0495646_0001555 | Ga0495646_0001555_2749_3366 | 187 |
| 182 | 3300046690 | Ga0495624_0292209 | Ga0495624_0292209_155_772 | 187 |
| 183 | 3300047317 | Ga0495604_0437459 | Ga0495604_0437459_100_717 | 187 |
| 184 | iso_pu_bacteria | 2643221554 | 2643791370 | 187 |
| 185 | iso_pu_bacteria | 2643221556 | 2643800212 | 187 |
| 186 | iso_pu_bacteria | 2643221603 | 2644027726 | 187 |
| 187 | iso_pu_bacteria | 2643221645 | 2644251577 | 187 |
| 188 | iso_pu_bacteria | 2643221664 | 2644358246 | 187 |
| 189 | iso_pu_bacteria | 2643221684 | 2644472006 | 187 |
| 190 | iso_pu_bacteria | 2738541280 | 2738742420 | 187 |
| 191 | iso_pu_bacteria | 2738541300 | 2738845373 | 187 |
| 192 | iso_pu_bacteria | 2738543018 | 2739276426 | 187 |
| 193 | iso_pu_bacteria | 2738543030 | 2739345470 | 187 |
| 194 | iso_pu_bacteria | 2821131069 | 2821133472 | 187 |
| 195 | iso_pu_bacteria | 8047673197 | 8047674766 | 187 |
| 196 | 3300037471 | Ga0395905_0042482 | Ga0395905_0042482_2487_3095 | 188 |
| 197 | 3300046474 | Ga0495605_0006348 | Ga0495605_0006348_3904_4479 | 188 |
| 198 | 3300046474 | Ga0495605_0035098 | Ga0495605_0035098_973_1548 | 188 |
| 199 | 3300046491 | Ga0495584_0005376 | Ga0495584_0005376_1042_1617 | 188 |
| 200 | 3300046492 | Ga0495585_0107344 | Ga0495585_0107344_397_972 | 188 |
| 201 | 3300046500 | Ga0495596_0002300 | Ga0495596_0002300_2633_3208 | 188 |
| 202 | 3300046501 | Ga0495607_0001671 | Ga0495607_0001671_14748_15323 | 188 |
| 203 | 3300046501 | Ga0495607_0028377 | Ga0495607_0028377_710_1285 | 188 |
| 204 | 3300046506 | Ga0495583_0001444 | Ga0495583_0001444_17735_18310 | 188 |
| 205 | 3300046507 | Ga0495606_0012677 | Ga0495606_0012677_1102_1677 | 188 |
| 206 | 3300046513 | Ga0495616_0030670 | Ga0495616_0030670_79_654 | 188 |
| 207 | 3300046513 | Ga0495616_0057484 | Ga0495616_0057484_71_646 | 188 |
| 208 | 3300046518 | Ga0495631_0006258 | Ga0495631_0006258_5441_6016 | 188 |
| 209 | 3300046519 | Ga0495632_0000852 | Ga0495632_0000852_3882_4457 | 188 |
| 210 | 3300046519 | Ga0495632_0001985 | Ga0495632_0001985_6076_6651 | 188 |
| 211 | 3300046522 | Ga0495643_0002412 | Ga0495643_0002412_4065_4640 | 188 |
| 212 | 3300046522 | Ga0495643_0012215 | Ga0495643_0012215_3915_4490 | 188 |
| 213 | 3300046524 | Ga0495648_0009310 | Ga0495648_0009310_2731_3306 | 188 |
| 214 | 3300046538 | Ga0495609_0002267 | Ga0495609_0002267_6908_7483 | 188 |
| 215 | 3300046616 | Ga0495668_0011176 | Ga0495668_0011176_2297_2872 | 188 |
| 216 | 3300046648 | Ga0495611_0003505 | Ga0495611_0003505_4299_4874 | 188 |
| 217 | 3300046665 | Ga0495661_0003517 | Ga0495661_0003517_7379_7954 | 188 |
| 218 | 3300046665 | Ga0495661_0047504 | Ga0495661_0047504_1523_2098 | 188 |
| 219 | 3300046665 | Ga0495661_0063816 | Ga0495661_0063816_1563_2138 | 188 |
| 220 | 3300046692 | Ga0495671_0127303 | Ga0495671_0127303_151_726 | 188 |
| 221 | 3300046694 | Ga0495649_0003442 | Ga0495649_0003442_3712_4287 | 188 |
| 222 | 3300046694 | Ga0495649_0048732 | Ga0495649_0048732_660_1235 | 188 |
| 223 | 3300046794 | Ga0495589_0004248 | Ga0495589_0004248_2244_2819 | 188 |
| 224 | 3300046810 | Ga0495660_0004163 | Ga0495660_0004163_5529_6104 | 188 |
| 225 | 3300047320 | Ga0495672_0003293 | Ga0495672_0003293_4346_4921 | 188 |
| 226 | 3300047320 | Ga0495672_0034084 | Ga0495672_0034084_263_838 | 188 |
| 227 | 3300047446 | Ga0495679_008137 | Ga0495679_008137_3202_3777 | 188 |
| 228 | 3300047470 | Ga0495681_0016273 | Ga0495681_0016273_1435_2010 | 188 |
| 229 | 3300048091 | Ga0495626_0003284 | Ga0495626_0003284_2486_3061 | 188 |
| 230 | 3300048091 | Ga0495626_0018518 | Ga0495626_0018518_452_1027 | 188 |
| 231 | 3300048091 | Ga0495626_0021333 | Ga0495626_0021333_2063_2638 | 188 |
| 232 | 3300049459 | Ga0495678_003680 | Ga0495678_003680_2907_3482 | 188 |
| 233 | 3300015261 | Ga0182006_1016620 | Ga0182006_10166202 | 189 |
| 234 | 3300031251 | Ga0265327_10165282 | Ga0265327_101652822 | 189 |
| 235 | 3300032002 | Ga0307416_100005633 | Ga0307416_1000056335 | 189 |
| 236 | 3300035691 | Ga0373931_0114275 | Ga0373931_0114275_148_726 | 189 |
| 237 | 3300046455 | Ga0495603_0044124 | Ga0495603_0044124_77_655 | 189 |
| 238 | 3300046459 | Ga0495629_0014017 | Ga0495629_0014017_1364_1942 | 189 |
| 239 | 3300046473 | Ga0495582_0004649 | Ga0495582_0004649_1142_1720 | 189 |
| 240 | 3300046474 | Ga0495605_0024677 | Ga0495605_0024677_1993_2571 | 189 |
| 241 | 3300046491 | Ga0495584_0069350 | Ga0495584_0069350_486_1064 | 189 |
| 242 | 3300046491 | Ga0495584_0204880 | Ga0495584_0204880_281_859 | 189 |
| 243 | 3300046492 | Ga0495585_0098278 | Ga0495585_0098278_77_655 | 189 |
| 244 | 3300046499 | Ga0495594_0010807 | Ga0495594_0010807_3682_4260 | 189 |
| 245 | 3300046499 | Ga0495594_0028672 | Ga0495594_0028672_789_1367 | 189 |
| 246 | 3300046500 | Ga0495596_0028741 | Ga0495596_0028741_1509_2087 | 189 |
| 247 | 3300046506 | Ga0495583_0033337 | Ga0495583_0033337_1396_1974 | 189 |
| 248 | 3300046506 | Ga0495583_0034886 | Ga0495583_0034886_1717_2295 | 189 |
| 249 | 3300046513 | Ga0495616_0001547 | Ga0495616_0001547_8594_9199 | 189 |
| 250 | 3300046513 | Ga0495616_0033463 | Ga0495616_0033463_1135_1713 | 189 |
| 251 | 3300046518 | Ga0495631_0017560 | Ga0495631_0017560_1669_2247 | 189 |
| 252 | 3300046523 | Ga0495644_0015732 | Ga0495644_0015732_77_655 | 189 |
| 253 | 3300046528 | Ga0495642_0004398 | Ga0495642_0004398_2429_3007 | 189 |
| 254 | 3300046528 | Ga0495642_0029202 | Ga0495642_0029202_695_1300 | 189 |
| 255 | 3300046530 | Ga0495654_0044679 | Ga0495654_0044679_511_1089 | 189 |
| 256 | 3300046558 | Ga0495633_0024214 | Ga0495633_0024214_1289_1867 | 189 |
| 257 | 3300046616 | Ga0495668_0057478 | Ga0495668_0057478_206_784 | 189 |
| 258 | 3300046648 | Ga0495611_0003835 | Ga0495611_0003835_704_1282 | 189 |
| 259 | 3300046674 | Ga0495588_0014347 | Ga0495588_0014347_142_819 | 189 |
| 260 | 3300046674 | Ga0495588_0017075 | Ga0495588_0017075_2020_2598 | 189 |
| 261 | 3300046674 | Ga0495588_0032962 | Ga0495588_0032962_1767_2345 | 189 |
| 262 | 3300046684 | Ga0495669_0000018 | Ga0495669_0000018_93904_94482 | 189 |
| 263 | 3300046810 | Ga0495660_0014127 | Ga0495660_0014127_3948_4526 | 189 |
| 264 | 3300047315 | Ga0495581_0009510 | Ga0495581_0009510_4473_5051 | 189 |
| 265 | 3300047320 | Ga0495672_0004198 | Ga0495672_0004198_3507_4085 | 189 |
| 266 | 3300047323 | Ga0495683_0079896 | Ga0495683_0079896_432_1010 | 189 |
| 267 | 3300047446 | Ga0495679_074564 | Ga0495679_074564_209_787 | 189 |
| 268 | 3300047447 | Ga0495685_016533 | Ga0495685_016533_1486_2064 | 189 |
| 269 | 3300047470 | Ga0495681_0000321 | Ga0495681_0000321_3767_4345 | 189 |
| 270 | 3300048089 | Ga0495614_0001110 | Ga0495614_0001110_5795_6373 | 189 |
| 271 | 3300048091 | Ga0495626_0007634 | Ga0495626_0007634_312_890 | 189 |
| 272 | 3300048906 | Ga0496103_0443694 | Ga0496103_0443694_220_798 | 189 |
| 273 | iso_pu_bacteria | 2511231026 | 2511383608 | 189 |
| 274 | 3300003771 | Ga0055526_1007187 | Ga0055526_10071872 | 190 |
| 275 | 3300003775 | Ga0055524_1000021 | Ga0055524_1000021221 | 190 |
| 276 | 3300003775 | Ga0055524_1003016 | Ga0055524_10030165 | 190 |
| 277 | 3300003775 | Ga0055524_1005587 | Ga0055524_10055875 | 190 |
| 278 | 3300003784 | Ga0055534_1004625 | Ga0055534_10046254 | 190 |
| 279 | 3300003791 | Ga0055530_10003380 | Ga0055530_100033804 | 190 |
| 280 | 3300006948 | Ga0099826_10000041 | Ga0099826_1000004131 | 190 |
| 281 | 3300017792 | Ga0163161_10032386 | Ga0163161_100323865 | 190 |
| 282 | 3300025263 | Ga0209565_1001939 | Ga0209565_10019394 | 190 |
| 283 | 3300025291 | Ga0209675_1001711 | Ga0209675_10017117 | 190 |
| 284 | 3300025295 | Ga0209564_1000071 | Ga0209564_1000071254 | 190 |
| 285 | 3300025295 | Ga0209564_1028688 | Ga0209564_10286882 | 190 |
| 286 | 3300025298 | Ga0209050_1000240 | Ga0209050_100024038 | 190 |
| 287 | 3300025299 | Ga0209256_1000044 | Ga0209256_1000044304 | 190 |
| 288 | 3300025299 | Ga0209256_1003100 | Ga0209256_10031005 | 190 |
| 289 | 3300027666 | Ga0209282_1000001 | Ga0209282_100000131 | 190 |
| 290 | 3300031548 | Ga0307408_100000239 | Ga0307408_10000023911 | 190 |
| 291 | 3300032004 | Ga0307414_10788244 | Ga0307414_107882441 | 190 |
| 292 | 3300046615 | Ga0495656_0119591 | Ga0495656_0119591_157_738 | 190 |
| 293 | 3300047469 | Ga0495673_0000265 | Ga0495673_0000265_26602_27195 | 190 |
| 294 | 3300048924 | Ga0496121_0095442 | Ga0496121_0095442_84_698 | 190 |
| 295 | 3300048929 | Ga0496126_0060200 | Ga0496126_0060200_2383_2976 | 190 |
| 296 | iso_pu_bacteria | 2765235838 | 2765568487 | 190 |
| 297 | iso_pu_bacteria | 2808606386 | 2808981228 | 190 |
| 298 | iso_pu_bacteria | 2808606415 | 2809131718 | 190 |
| 299 | iso_pu_bacteria | 2808606419 | 2809151470 | 190 |
| 300 | iso_pu_bacteria | 2839094727 | 2839096648 | 190 |
| 301 | iso_pu_bacteria | 2852618963 | 2852620954 | 190 |
| 302 | 3300003759 | Ga0055525_1000029 | Ga0055525_100002979 | 191 |
| 303 | 3300003762 | Ga0055542_1021560 | Ga0055542_10215601 | 191 |
| 304 | 3300003771 | Ga0055526_1000068 | Ga0055526_10000688 | 191 |
| 305 | 3300005262 | Ga0065165_1046881 | Ga0065165_10468812 | 191 |
| 306 | 3300005327 | Ga0070658_10447686 | Ga0070658_104476862 | 191 |
| 307 | 3300005339 | Ga0070660_100018151 | Ga0070660_1000181513 | 191 |
| 308 | 3300005339 | Ga0070660_100081746 | Ga0070660_1000817462 | 191 |
| 309 | 3300005339 | Ga0070660_100422141 | Ga0070660_1004221411 | 191 |
| 310 | 3300005344 | Ga0070661_100127414 | Ga0070661_1001274142 | 191 |
| 311 | 3300005366 | Ga0070659_100117647 | Ga0070659_1001176472 | 191 |
| 312 | 3300005366 | Ga0070659_100170659 | Ga0070659_1001706592 | 191 |
| 313 | 3300005563 | Ga0068855_100206715 | Ga0068855_1002067152 | 191 |
| 314 | 3300005563 | Ga0068855_100544190 | Ga0068855_1005441902 | 191 |
| 315 | 3300005564 | Ga0070664_100029568 | Ga0070664_1000295682 | 191 |
| 316 | 3300005564 | Ga0070664_100100244 | Ga0070664_1001002442 | 191 |
| 317 | 3300005614 | Ga0068856_100833244 | Ga0068856_1008332442 | 191 |
| 318 | 3300005616 | Ga0068852_100574624 | Ga0068852_1005746242 | 191 |
| 319 | 3300006237 | Ga0097621_100441709 | Ga0097621_1004417092 | 191 |
| 320 | 3300006358 | Ga0068871_100939794 | Ga0068871_1009397941 | 191 |
| 321 | 3300006946 | Ga0079104_1008344 | Ga0079104_10083444 | 191 |
| 322 | 3300009174 | Ga0105241_10016300 | Ga0105241_100163004 | 191 |
| 323 | 3300009551 | Ga0105238_10150406 | Ga0105238_101504062 | 191 |
| 324 | 3300010375 | Ga0105239_10457761 | Ga0105239_104577612 | 191 |
| 325 | 3300010375 | Ga0105239_11353967 | Ga0105239_113539672 | 191 |
| 326 | 3300013102 | Ga0157371_10000013 | Ga0157371_10000013304 | 191 |
| 327 | 3300013102 | Ga0157371_10374609 | Ga0157371_103746092 | 191 |
| 328 | 3300013297 | Ga0157378_10351285 | Ga0157378_103512852 | 191 |
| 329 | 3300014497 | Ga0182008_10046094 | Ga0182008_100460942 | 191 |
| 330 | 3300015261 | Ga0182006_1050588 | Ga0182006_10505882 | 191 |
| 331 | 3300015261 | Ga0182006_1174230 | Ga0182006_11742301 | 191 |
| 332 | 3300021361 | Ga0213872_10000242 | Ga0213872_1000024218 | 191 |
| 333 | 3300021361 | Ga0213872_10000443 | Ga0213872_1000044322 | 191 |
| 334 | 3300021361 | Ga0213872_10019294 | Ga0213872_100192942 | 191 |
| 335 | 3300021361 | Ga0213872_10044898 | Ga0213872_100448982 | 191 |
| 336 | 3300021361 | Ga0213872_10108111 | Ga0213872_101081112 | 191 |
| 337 | 3300021361 | Ga0213872_10156063 | Ga0213872_101560632 | 191 |
| 338 | 3300025230 | Ga0209563_100003 | Ga0209563_100003243 | 191 |
| 339 | 3300025233 | Ga0209437_110183 | Ga0209437_1101832 | 191 |
| 340 | 3300025246 | Ga0209646_1000077 | Ga0209646_1000077179 | 191 |
| 341 | 3300025254 | Ga0209148_1001819 | Ga0209148_10018199 | 191 |
| 342 | 3300025295 | Ga0209564_1000072 | Ga0209564_100007232 | 191 |
| 343 | 3300025909 | Ga0207705_10017557 | Ga0207705_100175575 | 191 |
| 344 | 3300025911 | Ga0207654_10004697 | Ga0207654_100046977 | 191 |
| 345 | 3300025919 | Ga0207657_10024222 | Ga0207657_100242222 | 191 |
| 346 | 3300025919 | Ga0207657_10034425 | Ga0207657_100344252 | 191 |
| 347 | 3300025919 | Ga0207657_10134734 | Ga0207657_101347342 | 191 |
| 348 | 3300025932 | Ga0207690_10191480 | Ga0207690_101914802 | 191 |
| 349 | 3300025932 | Ga0207690_10819946 | Ga0207690_108199462 | 191 |
| 350 | 3300025933 | Ga0207706_10336169 | Ga0207706_103361692 | 191 |
| 351 | 3300025934 | Ga0207686_10187296 | Ga0207686_101872962 | 191 |
| 352 | 3300025935 | Ga0207709_10112420 | Ga0207709_101124202 | 191 |
| 353 | 3300025945 | Ga0207679_10248449 | Ga0207679_102484491 | 191 |
| 354 | 3300025945 | Ga0207679_10267272 | Ga0207679_102672721 | 191 |
| 355 | 3300025949 | Ga0207667_10041450 | Ga0207667_100414502 | 191 |
| 356 | 3300025949 | Ga0207667_10297414 | Ga0207667_102974142 | 191 |
| 357 | 3300026067 | Ga0207678_10912544 | Ga0207678_109125441 | 191 |
| 358 | 3300026078 | Ga0207702_10885972 | Ga0207702_108859721 | 191 |
| 359 | 3300026116 | Ga0207674_10349182 | Ga0207674_103491822 | 191 |
| 360 | 3300030736 | Ga0316180_1021737 | Ga0316180_10217372 | 191 |
| 361 | 3300030742 | Ga0316183_1190372 | Ga0316183_11903721 | 191 |
| 362 | 3300031548 | Ga0307408_100224828 | Ga0307408_1002248281 | 191 |
| 363 | 3300037312 | Ga0395899_0000128 | Ga0395899_0000128_79128_79712 | 191 |
| 364 | 3300037312 | Ga0395899_0006694 | Ga0395899_0006694_4679_5257 | 191 |
| 365 | 3300037312 | Ga0395899_0010304 | Ga0395899_0010304_3071_3649 | 191 |
| 366 | 3300037312 | Ga0395899_0055314 | Ga0395899_0055314_1941_2519 | 191 |
| 367 | 3300037418 | Ga0395900_0000123 | Ga0395900_0000123_85773_86351 | 191 |
| 368 | 3300037418 | Ga0395900_0007904 | Ga0395900_0007904_7686_8264 | 191 |
| 369 | 3300037418 | Ga0395900_0021826 | Ga0395900_0021826_2766_3344 | 191 |
| 370 | 3300037418 | Ga0395900_0035310 | Ga0395900_0035310_2308_2886 | 191 |
| 371 | 3300037418 | Ga0395900_0073035 | Ga0395900_0073035_2539_3117 | 191 |
| 372 | 3300037418 | Ga0395900_0116934 | Ga0395900_0116934_132_716 | 191 |
| 373 | 3300037418 | Ga0395900_0140769 | Ga0395900_0140769_1394_1972 | 191 |
| 374 | 3300037418 | Ga0395900_0287131 | Ga0395900_0287131_872_1456 | 191 |
| 375 | 3300037418 | Ga0395900_0328620 | Ga0395900_0328620_705_1283 | 191 |
| 376 | 3300037466 | Ga0395898_0109879 | Ga0395898_0109879_501_1079 | 191 |
| 377 | 3300037466 | Ga0395898_0125841 | Ga0395898_0125841_837_1415 | 191 |
| 378 | 3300037466 | Ga0395898_0257386 | Ga0395898_0257386_587_1165 | 191 |
| 379 | 3300037466 | Ga0395898_0383923 | Ga0395898_0383923_380_958 | 191 |
| 380 | 3300037466 | Ga0395898_0517499 | Ga0395898_0517499_215_793 | 191 |
| 381 | 3300037466 | Ga0395898_0628288 | Ga0395898_0628288_360_938 | 191 |
| 382 | 3300037471 | Ga0395905_0078281 | Ga0395905_0078281_872_1450 | 191 |
| 383 | 3300037471 | Ga0395905_0099213 | Ga0395905_0099213_824_1402 | 191 |
| 384 | 3300037471 | Ga0395905_0128099 | Ga0395905_0128099_456_1040 | 191 |
| 385 | 3300037471 | Ga0395905_0310643 | Ga0395905_0310643_668_1246 | 191 |
| 386 | 3300037471 | Ga0395905_0380827 | Ga0395905_0380827_223_807 | 191 |
| 387 | 3300038443 | Ga0395901_0000411 | Ga0395901_0000411_24604_25182 | 191 |
| 388 | 3300038443 | Ga0395901_0001908 | Ga0395901_0001908_17544_18122 | 191 |
| 389 | 3300038443 | Ga0395901_0278987 | Ga0395901_0278987_859_1437 | 191 |
| 390 | 3300038443 | Ga0395901_0355927 | Ga0395901_0355927_619_1197 | 191 |
| 391 | 3300038443 | Ga0395901_0504377 | Ga0395901_0504377_46_624 | 191 |
| 392 | 3300038443 | Ga0395901_0796251 | Ga0395901_0796251_142_720 | 191 |
| 393 | 3300039447 | Ga0436361_0014452 | Ga0436361_0014452_770_1363 | 191 |
| 394 | 3300039447 | Ga0436361_0032641 | Ga0436361_0032641_443_1030 | 191 |
| 395 | 3300039447 | Ga0436361_0161443 | Ga0436361_0161443_740_1333 | 191 |
| 396 | 3300039447 | Ga0436361_0568983 | Ga0436361_0568983_23213_23806 | 191 |
| 397 | 3300039447 | Ga0436361_0746087 | Ga0436361_0746087_804_1397 | 191 |
| 398 | 3300039447 | Ga0436361_0830100 | Ga0436361_0830100_8777_9370 | 191 |
| 399 | 3300039447 | Ga0436361_0973589 | Ga0436361_0973589_84_671 | 191 |
| 400 | 3300042005 | Ga0439448_0010043 | Ga0439448_0010043_615_1193 | 191 |
| 401 | 3300042005 | Ga0439448_0123959 | Ga0439448_0123959_44_622 | 191 |
| 402 | 3300042007 | Ga0439449_0013722 | Ga0439449_0013722_147_725 | 191 |
| 403 | 3300042008 | Ga0439450_010428 | Ga0439450_010428_765_1343 | 191 |
| 404 | 3300042008 | Ga0439450_018780 | Ga0439450_018780_34_612 | 191 |
| 405 | 3300042012 | Ga0439455_0106565 | Ga0439455_0106565_189_767 | 191 |
| 406 | 3300042128 | Ga0450897_013149 | Ga0450897_013149_206_793 | 191 |
| 407 | 3300042157 | Ga0439458_0022881 | Ga0439458_0022881_464_1042 | 191 |
| 408 | 3300044656 | Ga0466969_0038118 | Ga0466969_0038118_1426_2004 | 191 |
| 409 | 3300044656 | Ga0466969_0080543 | Ga0466969_0080543_768_1346 | 191 |
| 410 | 3300044658 | Ga0466972_0001100 | Ga0466972_0001100_2944_3522 | 191 |
| 411 | 3300044683 | Ga0466965_0010006 | Ga0466965_0010006_2556_3134 | 191 |
| 412 | 3300044683 | Ga0466965_0011686 | Ga0466965_0011686_2564_3148 | 191 |
| 413 | 3300044683 | Ga0466965_0065720 | Ga0466965_0065720_1124_1699 | 191 |
| 414 | 3300044684 | Ga0466966_0011821 | Ga0466966_0011821_2490_3068 | 191 |
| 415 | 3300044684 | Ga0466966_0068924 | Ga0466966_0068924_293_868 | 191 |
| 416 | 3300044684 | Ga0466966_0082220 | Ga0466966_0082220_1210_1791 | 191 |
| 417 | 3300044693 | Ga0466961_0159699 | Ga0466961_0159699_379_957 | 191 |
| 418 | 3300044706 | Ga0466964_0000256 | Ga0466964_0000256_4414_4992 | 191 |
| 419 | 3300044706 | Ga0466964_0199537 | Ga0466964_0199537_317_937 | 191 |
| 420 | 3300044719 | Ga0466971_0017407 | Ga0466971_0017407_1740_2315 | 191 |
| 421 | 3300044735 | Ga0466968_0001835 | Ga0466968_0001835_3535_4113 | 191 |
| 422 | 3300044735 | Ga0466968_0117279 | Ga0466968_0117279_159_734 | 191 |
| 423 | 3300044765 | Ga0466970_0016339 | Ga0466970_0016339_2729_3316 | 191 |
| 424 | 3300044842 | Ga0466957_0009721 | Ga0466957_0009721_1797_2375 | 191 |
| 425 | 3300045049 | Ga0466959_0009557 | Ga0466959_0009557_4636_5214 | 191 |
| 426 | 3300045049 | Ga0466959_0011644 | Ga0466959_0011644_3065_3640 | 191 |
| 427 | 3300045049 | Ga0466959_0052704 | Ga0466959_0052704_487_1074 | 191 |
| 428 | 3300045049 | Ga0466959_0054139 | Ga0466959_0054139_1847_2425 | 191 |
| 429 | 3300045049 | Ga0466959_0586236 | Ga0466959_0586236_145_723 | 191 |
| 430 | 3300045836 | Ga0466958_0275718 | Ga0466958_0275718_45_623 | 191 |
| 431 | 3300045836 | Ga0466958_0396809 | Ga0466958_0396809_135_710 | 191 |
| 432 | 3300045976 | Ga0466967_0005324 | Ga0466967_0005324_2725_3303 | 191 |
| 433 | 3300046452 | Ga0495617_000034 | Ga0495617_000034_67889_68473 | 191 |
| 434 | 3300046452 | Ga0495617_002482 | Ga0495617_002482_2446_3030 | 191 |
| 435 | 3300046452 | Ga0495617_002980 | Ga0495617_002980_64_648 | 191 |
| 436 | 3300046452 | Ga0495617_008361 | Ga0495617_008361_899_1495 | 191 |
| 437 | 3300046453 | Ga0495627_000876 | Ga0495627_000876_16235_16819 | 191 |
| 438 | 3300046453 | Ga0495627_024085 | Ga0495627_024085_900_1484 | 191 |
| 439 | 3300046455 | Ga0495603_0033409 | Ga0495603_0033409_507_1091 | 191 |
| 440 | 3300046457 | Ga0495590_0000027 | Ga0495590_0000027_4213_4797 | 191 |
| 441 | 3300046457 | Ga0495590_0000257 | Ga0495590_0000257_18884_19480 | 191 |
| 442 | 3300046457 | Ga0495590_0033182 | Ga0495590_0033182_1046_1624 | 191 |
| 443 | 3300046457 | Ga0495590_0085440 | Ga0495590_0085440_218_802 | 191 |
| 444 | 3300046458 | Ga0495591_000272 | Ga0495591_000272_19240_19824 | 191 |
| 445 | 3300046460 | Ga0495638_0000098 | Ga0495638_0000098_129222_129818 | 191 |
| 446 | 3300046471 | Ga0495650_0002150 | Ga0495650_0002150_9588_10184 | 191 |
| 447 | 3300046472 | Ga0495580_0445460 | Ga0495580_0445460_276_857 | 191 |
| 448 | 3300046473 | Ga0495582_0114750 | Ga0495582_0114750_441_1028 | 191 |
| 449 | 3300046474 | Ga0495605_0000029 | Ga0495605_0000029_69541_70119 | 191 |
| 450 | 3300046474 | Ga0495605_0000042 | Ga0495605_0000042_160150_160746 | 191 |
| 451 | 3300046474 | Ga0495605_0000151 | Ga0495605_0000151_73901_74485 | 191 |
| 452 | 3300046474 | Ga0495605_0007689 | Ga0495605_0007689_1475_2059 | 191 |
| 453 | 3300046474 | Ga0495605_0010229 | Ga0495605_0010229_3538_4122 | 191 |
| 454 | 3300046475 | Ga0495639_0309380 | Ga0495639_0309380_83_679 | 191 |
| 455 | 3300046491 | Ga0495584_0000007 | Ga0495584_0000007_225030_225614 | 191 |
| 456 | 3300046491 | Ga0495584_0000122 | Ga0495584_0000122_34079_34663 | 191 |
| 457 | 3300046491 | Ga0495584_0000506 | Ga0495584_0000506_14188_14772 | 191 |
| 458 | 3300046491 | Ga0495584_0002007 | Ga0495584_0002007_7149_7727 | 191 |
| 459 | 3300046491 | Ga0495584_0002049 | Ga0495584_0002049_6643_7227 | 191 |
| 460 | 3300046491 | Ga0495584_0003276 | Ga0495584_0003276_2097_2684 | 191 |
| 461 | 3300046491 | Ga0495584_0005715 | Ga0495584_0005715_346_924 | 191 |
| 462 | 3300046491 | Ga0495584_0006099 | Ga0495584_0006099_565_1149 | 191 |
| 463 | 3300046491 | Ga0495584_0010896 | Ga0495584_0010896_2435_3022 | 191 |
| 464 | 3300046491 | Ga0495584_0110508 | Ga0495584_0110508_574_1158 | 191 |
| 465 | 3300046491 | Ga0495584_0163756 | Ga0495584_0163756_59_643 | 191 |
| 466 | 3300046491 | Ga0495584_0173545 | Ga0495584_0173545_482_1066 | 191 |
| 467 | 3300046492 | Ga0495585_0000115 | Ga0495585_0000115_827_1411 | 191 |
| 468 | 3300046492 | Ga0495585_0000421 | Ga0495585_0000421_31079_31663 | 191 |
| 469 | 3300046492 | Ga0495585_0002934 | Ga0495585_0002934_8557_9141 | 191 |
| 470 | 3300046492 | Ga0495585_0003505 | Ga0495585_0003505_6068_6652 | 191 |
| 471 | 3300046492 | Ga0495585_0010560 | Ga0495585_0010560_822_1406 | 191 |
| 472 | 3300046492 | Ga0495585_0017306 | Ga0495585_0017306_2669_3253 | 191 |
| 473 | 3300046492 | Ga0495585_0018451 | Ga0495585_0018451_415_999 | 191 |
| 474 | 3300046492 | Ga0495585_0020952 | Ga0495585_0020952_3087_3674 | 191 |
| 475 | 3300046492 | Ga0495585_0024454 | Ga0495585_0024454_1936_2520 | 191 |
| 476 | 3300046492 | Ga0495585_0029130 | Ga0495585_0029130_1391_1975 | 191 |
| 477 | 3300046492 | Ga0495585_0040655 | Ga0495585_0040655_1874_2461 | 191 |
| 478 | 3300046492 | Ga0495585_0062272 | Ga0495585_0062272_1282_1866 | 191 |
| 479 | 3300046499 | Ga0495594_0003496 | Ga0495594_0003496_4121_4708 | 191 |
| 480 | 3300046499 | Ga0495594_0013150 | Ga0495594_0013150_2947_3534 | 191 |
| 481 | 3300046500 | Ga0495596_0000474 | Ga0495596_0000474_18360_18944 | 191 |
| 482 | 3300046500 | Ga0495596_0000530 | Ga0495596_0000530_22448_23032 | 191 |
| 483 | 3300046500 | Ga0495596_0002008 | Ga0495596_0002008_1835_2419 | 191 |
| 484 | 3300046500 | Ga0495596_0004690 | Ga0495596_0004690_2531_3115 | 191 |
| 485 | 3300046500 | Ga0495596_0014436 | Ga0495596_0014436_819_1403 | 191 |
| 486 | 3300046500 | Ga0495596_0019973 | Ga0495596_0019973_1940_2524 | 191 |
| 487 | 3300046501 | Ga0495607_0002476 | Ga0495607_0002476_12801_13379 | 191 |
| 488 | 3300046501 | Ga0495607_0002735 | Ga0495607_0002735_3221_3805 | 191 |
| 489 | 3300046501 | Ga0495607_0004292 | Ga0495607_0004292_5616_6200 | 191 |
| 490 | 3300046501 | Ga0495607_0017561 | Ga0495607_0017561_2176_2772 | 191 |
| 491 | 3300046501 | Ga0495607_0020165 | Ga0495607_0020165_1463_2047 | 191 |
| 492 | 3300046501 | Ga0495607_0025435 | Ga0495607_0025435_898_1482 | 191 |
| 493 | 3300046501 | Ga0495607_0051721 | Ga0495607_0051721_1233_1811 | 191 |
| 494 | 3300046501 | Ga0495607_0071761 | Ga0495607_0071761_70_654 | 191 |
| 495 | 3300046501 | Ga0495607_0077910 | Ga0495607_0077910_379_975 | 191 |
| 496 | 3300046501 | Ga0495607_0083439 | Ga0495607_0083439_462_1046 | 191 |
| 497 | 3300046501 | Ga0495607_0225317 | Ga0495607_0225317_250_834 | 191 |
| 498 | 3300046506 | Ga0495583_0000348 | Ga0495583_0000348_27537_28121 | 191 |
| 499 | 3300046506 | Ga0495583_0000472 | Ga0495583_0000472_51277_51873 | 191 |
| 500 | 3300046506 | Ga0495583_0000569 | Ga0495583_0000569_36174_36758 | 191 |
| 501 | 3300046506 | Ga0495583_0049226 | Ga0495583_0049226_1146_1730 | 191 |
| 502 | 3300046506 | Ga0495583_0110774 | Ga0495583_0110774_390_974 | 191 |
| 503 | 3300046506 | Ga0495583_0194134 | Ga0495583_0194134_168_752 | 191 |
| 504 | 3300046507 | Ga0495606_0000084 | Ga0495606_0000084_22034_22618 | 191 |
| 505 | 3300046507 | Ga0495606_0000652 | Ga0495606_0000652_25778_26374 | 191 |
| 506 | 3300046507 | Ga0495606_0000787 | Ga0495606_0000787_29167_29748 | 191 |
| 507 | 3300046507 | Ga0495606_0001481 | Ga0495606_0001481_23523_24119 | 191 |
| 508 | 3300046507 | Ga0495606_0021021 | Ga0495606_0021021_1707_2291 | 191 |
| 509 | 3300046507 | Ga0495606_0029545 | Ga0495606_0029545_690_1274 | 191 |
| 510 | 3300046507 | Ga0495606_0031347 | Ga0495606_0031347_1730_2308 | 191 |
| 511 | 3300046507 | Ga0495606_0034767 | Ga0495606_0034767_1423_2007 | 191 |
| 512 | 3300046507 | Ga0495606_0047069 | Ga0495606_0047069_1678_2262 | 191 |
| 513 | 3300046507 | Ga0495606_0106051 | Ga0495606_0106051_1041_1625 | 191 |
| 514 | 3300046507 | Ga0495606_0349720 | Ga0495606_0349720_74_658 | 191 |
| 515 | 3300046512 | Ga0495610_0000473 | Ga0495610_0000473_38881_39465 | 191 |
| 516 | 3300046512 | Ga0495610_0148582 | Ga0495610_0148582_226_810 | 191 |
| 517 | 3300046513 | Ga0495616_0001479 | Ga0495616_0001479_15154_15732 | 191 |
| 518 | 3300046513 | Ga0495616_0004099 | Ga0495616_0004099_6196_6780 | 191 |
| 519 | 3300046513 | Ga0495616_0007026 | Ga0495616_0007026_3490_4074 | 191 |
| 520 | 3300046513 | Ga0495616_0008239 | Ga0495616_0008239_3095_3679 | 191 |
| 521 | 3300046513 | Ga0495616_0010806 | Ga0495616_0010806_4041_4625 | 191 |
| 522 | 3300046513 | Ga0495616_0021408 | Ga0495616_0021408_194_778 | 191 |
| 523 | 3300046513 | Ga0495616_0025599 | Ga0495616_0025599_799_1383 | 191 |
| 524 | 3300046513 | Ga0495616_0042972 | Ga0495616_0042972_922_1506 | 191 |
| 525 | 3300046513 | Ga0495616_0094410 | Ga0495616_0094410_755_1339 | 191 |
| 526 | 3300046515 | Ga0495620_0003439 | Ga0495620_0003439_4426_5010 | 191 |
| 527 | 3300046516 | Ga0495628_0305552 | Ga0495628_0305552_523_1104 | 191 |
| 528 | 3300046517 | Ga0495630_0332897 | Ga0495630_0332897_272_853 | 191 |
| 529 | 3300046518 | Ga0495631_0000810 | Ga0495631_0000810_11739_12323 | 191 |
| 530 | 3300046518 | Ga0495631_0001888 | Ga0495631_0001888_3819_4403 | 191 |
| 531 | 3300046518 | Ga0495631_0002771 | Ga0495631_0002771_8833_9414 | 191 |
| 532 | 3300046518 | Ga0495631_0005099 | Ga0495631_0005099_2910_3494 | 191 |
| 533 | 3300046518 | Ga0495631_0015840 | Ga0495631_0015840_1779_2363 | 191 |
| 534 | 3300046518 | Ga0495631_0272480 | Ga0495631_0272480_45_629 | 191 |
| 535 | 3300046519 | Ga0495632_0000903 | Ga0495632_0000903_2980_3564 | 191 |
| 536 | 3300046519 | Ga0495632_0007957 | Ga0495632_0007957_3505_4089 | 191 |
| 537 | 3300046519 | Ga0495632_0042567 | Ga0495632_0042567_1507_2091 | 191 |
| 538 | 3300046520 | Ga0495637_0000013 | Ga0495637_0000013_214417_215001 | 191 |
| 539 | 3300046520 | Ga0495637_0008688 | Ga0495637_0008688_3879_4475 | 191 |
| 540 | 3300046522 | Ga0495643_0000551 | Ga0495643_0000551_5998_6594 | 191 |
| 541 | 3300046522 | Ga0495643_0024119 | Ga0495643_0024119_2173_2751 | 191 |
| 542 | 3300046522 | Ga0495643_0025001 | Ga0495643_0025001_625_1209 | 191 |
| 543 | 3300046522 | Ga0495643_0071122 | Ga0495643_0071122_61_645 | 191 |
| 544 | 3300046522 | Ga0495643_0072128 | Ga0495643_0072128_192_776 | 191 |
| 545 | 3300046523 | Ga0495644_0004268 | Ga0495644_0004268_2134_2718 | 191 |
| 546 | 3300046523 | Ga0495644_0004891 | Ga0495644_0004891_2755_3339 | 191 |
| 547 | 3300046523 | Ga0495644_0005339 | Ga0495644_0005339_1729_2313 | 191 |
| 548 | 3300046523 | Ga0495644_0011582 | Ga0495644_0011582_836_1420 | 191 |
| 549 | 3300046523 | Ga0495644_0017413 | Ga0495644_0017413_1017_1601 | 191 |
| 550 | 3300046523 | Ga0495644_0020348 | Ga0495644_0020348_1218_1802 | 191 |
| 551 | 3300046523 | Ga0495644_0036772 | Ga0495644_0036772_870_1454 | 191 |
| 552 | 3300046524 | Ga0495648_0000112 | Ga0495648_0000112_69394_69978 | 191 |
| 553 | 3300046524 | Ga0495648_0000169 | Ga0495648_0000169_23255_23851 | 191 |
| 554 | 3300046524 | Ga0495648_0001096 | Ga0495648_0001096_23130_23714 | 191 |
| 555 | 3300046524 | Ga0495648_0002536 | Ga0495648_0002536_7444_8028 | 191 |
| 556 | 3300046524 | Ga0495648_0007990 | Ga0495648_0007990_3638_4216 | 191 |
| 557 | 3300046524 | Ga0495648_0034097 | Ga0495648_0034097_750_1346 | 191 |
| 558 | 3300046524 | Ga0495648_0051763 | Ga0495648_0051763_59_643 | 191 |
| 559 | 3300046524 | Ga0495648_0054917 | Ga0495648_0054917_1509_2093 | 191 |
| 560 | 3300046524 | Ga0495648_0177240 | Ga0495648_0177240_66_650 | 191 |
| 561 | 3300046525 | Ga0495663_0004796 | Ga0495663_0004796_396_980 | 191 |
| 562 | 3300046525 | Ga0495663_0032141 | Ga0495663_0032141_670_1254 | 191 |
| 563 | 3300046526 | Ga0495666_0015313 | Ga0495666_0015313_1370_1951 | 191 |
| 564 | 3300046526 | Ga0495666_0049841 | Ga0495666_0049841_960_1547 | 191 |
| 565 | 3300046528 | Ga0495642_0000050 | Ga0495642_0000050_66595_67179 | 191 |
| 566 | 3300046528 | Ga0495642_0001068 | Ga0495642_0001068_4703_5281 | 191 |
| 567 | 3300046528 | Ga0495642_0001340 | Ga0495642_0001340_2381_2965 | 191 |
| 568 | 3300046528 | Ga0495642_0001809 | Ga0495642_0001809_2399_2995 | 191 |
| 569 | 3300046528 | Ga0495642_0003687 | Ga0495642_0003687_2431_3015 | 191 |
| 570 | 3300046528 | Ga0495642_0008082 | Ga0495642_0008082_889_1473 | 191 |
| 571 | 3300046528 | Ga0495642_0056547 | Ga0495642_0056547_334_915 | 191 |
| 572 | 3300046528 | Ga0495642_0134247 | Ga0495642_0134247_79_660 | 191 |
| 573 | 3300046528 | Ga0495642_0186853 | Ga0495642_0186853_156_740 | 191 |
| 574 | 3300046530 | Ga0495654_0004305 | Ga0495654_0004305_2964_3548 | 191 |
| 575 | 3300046530 | Ga0495654_0010005 | Ga0495654_0010005_2818_3402 | 191 |
| 576 | 3300046531 | Ga0495665_0035779 | Ga0495665_0035779_935_1519 | 191 |
| 577 | 3300046531 | Ga0495665_0102901 | Ga0495665_0102901_270_851 | 191 |
| 578 | 3300046531 | Ga0495665_0103170 | Ga0495665_0103170_130_711 | 191 |
| 579 | 3300046535 | Ga0495586_0018982 | Ga0495586_0018982_1296_1877 | 191 |
| 580 | 3300046536 | Ga0495587_0008756 | Ga0495587_0008756_2733_3314 | 191 |
| 581 | 3300046538 | Ga0495609_0000022 | Ga0495609_0000022_157391_157969 | 191 |
| 582 | 3300046538 | Ga0495609_0001355 | Ga0495609_0001355_7815_8399 | 191 |
| 583 | 3300046538 | Ga0495609_0003271 | Ga0495609_0003271_2870_3454 | 191 |
| 584 | 3300046538 | Ga0495609_0026941 | Ga0495609_0026941_1297_1881 | 191 |
| 585 | 3300046538 | Ga0495609_0031532 | Ga0495609_0031532_736_1320 | 191 |
| 586 | 3300046538 | Ga0495609_0047144 | Ga0495609_0047144_173_757 | 191 |
| 587 | 3300046538 | Ga0495609_0080225 | Ga0495609_0080225_688_1272 | 191 |
| 588 | 3300046542 | Ga0495597_0000064 | Ga0495597_0000064_85305_85889 | 191 |
| 589 | 3300046542 | Ga0495597_0000266 | Ga0495597_0000266_40201_40797 | 191 |
| 590 | 3300046542 | Ga0495597_0000566 | Ga0495597_0000566_3947_4531 | 191 |
| 591 | 3300046542 | Ga0495597_0002770 | Ga0495597_0002770_6320_6904 | 191 |
| 592 | 3300046542 | Ga0495597_0006959 | Ga0495597_0006959_4392_4976 | 191 |
| 593 | 3300046542 | Ga0495597_0013020 | Ga0495597_0013020_2115_2699 | 191 |
| 594 | 3300046542 | Ga0495597_0074237 | Ga0495597_0074237_57_641 | 191 |
| 595 | 3300046542 | Ga0495597_0240246 | Ga0495597_0240246_102_683 | 191 |
| 596 | 3300046557 | Ga0495622_0000311 | Ga0495622_0000311_7010_7606 | 191 |
| 597 | 3300046557 | Ga0495622_0000707 | Ga0495622_0000707_11322_11918 | 191 |
| 598 | 3300046557 | Ga0495622_0007277 | Ga0495622_0007277_2138_2722 | 191 |
| 599 | 3300046557 | Ga0495622_0039684 | Ga0495622_0039684_240_824 | 191 |
| 600 | 3300046557 | Ga0495622_0085890 | Ga0495622_0085890_157_741 | 191 |
| 601 | 3300046557 | Ga0495622_0228631 | Ga0495622_0228631_131_718 | 191 |
| 602 | 3300046558 | Ga0495633_0001165 | Ga0495633_0001165_9715_10311 | 191 |
| 603 | 3300046558 | Ga0495633_0001850 | Ga0495633_0001850_919_1503 | 191 |
| 604 | 3300046558 | Ga0495633_0010505 | Ga0495633_0010505_3791_4375 | 191 |
| 605 | 3300046558 | Ga0495633_0016664 | Ga0495633_0016664_3124_3708 | 191 |
| 606 | 3300046558 | Ga0495633_0018317 | Ga0495633_0018317_2232_2816 | 191 |
| 607 | 3300046558 | Ga0495633_0020708 | Ga0495633_0020708_1602_2186 | 191 |
| 608 | 3300046558 | Ga0495633_0047924 | Ga0495633_0047924_418_1002 | 191 |
| 609 | 3300046558 | Ga0495633_0086336 | Ga0495633_0086336_675_1259 | 191 |
| 610 | 3300046558 | Ga0495633_0123951 | Ga0495633_0123951_505_1089 | 191 |
| 611 | 3300046615 | Ga0495656_0001658 | Ga0495656_0001658_4869_5453 | 191 |
| 612 | 3300046615 | Ga0495656_0002958 | Ga0495656_0002958_3054_3638 | 191 |
| 613 | 3300046615 | Ga0495656_0006533 | Ga0495656_0006533_3095_3679 | 191 |
| 614 | 3300046615 | Ga0495656_0026222 | Ga0495656_0026222_964_1548 | 191 |
| 615 | 3300046615 | Ga0495656_0100038 | Ga0495656_0100038_568_1146 | 191 |
| 616 | 3300046616 | Ga0495668_0001322 | Ga0495668_0001322_19646_20230 | 191 |
| 617 | 3300046616 | Ga0495668_0001809 | Ga0495668_0001809_15019_15603 | 191 |
| 618 | 3300046616 | Ga0495668_0002020 | Ga0495668_0002020_9304_9900 | 191 |
| 619 | 3300046616 | Ga0495668_0013456 | Ga0495668_0013456_420_1007 | 191 |
| 620 | 3300046616 | Ga0495668_0029492 | Ga0495668_0029492_420_1004 | 191 |
| 621 | 3300046616 | Ga0495668_0061174 | Ga0495668_0061174_857_1441 | 191 |
| 622 | 3300046616 | Ga0495668_0093914 | Ga0495668_0093914_69_653 | 191 |
| 623 | 3300046616 | Ga0495668_0395699 | Ga0495668_0395699_107_691 | 191 |
| 624 | 3300046648 | Ga0495611_0000515 | Ga0495611_0000515_3442_4026 | 191 |
| 625 | 3300046648 | Ga0495611_0007685 | Ga0495611_0007685_3271_3855 | 191 |
| 626 | 3300046648 | Ga0495611_0009941 | Ga0495611_0009941_2424_3008 | 191 |
| 627 | 3300046648 | Ga0495611_0010893 | Ga0495611_0010893_2305_2889 | 191 |
| 628 | 3300046648 | Ga0495611_0015786 | Ga0495611_0015786_1920_2504 | 191 |
| 629 | 3300046648 | Ga0495611_0016265 | Ga0495611_0016265_2000_2587 | 191 |
| 630 | 3300046648 | Ga0495611_0055477 | Ga0495611_0055477_646_1230 | 191 |
| 631 | 3300046648 | Ga0495611_0056545 | Ga0495611_0056545_1147_1731 | 191 |
| 632 | 3300046648 | Ga0495611_0098122 | Ga0495611_0098122_408_992 | 191 |
| 633 | 3300046660 | Ga0495625_0000810 | Ga0495625_0000810_35751_36347 | 191 |
| 634 | 3300046660 | Ga0495625_0011709 | Ga0495625_0011709_842_1426 | 191 |
| 635 | 3300046660 | Ga0495625_0013813 | Ga0495625_0013813_4183_4767 | 191 |
| 636 | 3300046660 | Ga0495625_0020304 | Ga0495625_0020304_747_1328 | 191 |
| 637 | 3300046660 | Ga0495625_0061488 | Ga0495625_0061488_285_869 | 191 |
| 638 | 3300046660 | Ga0495625_0203186 | Ga0495625_0203186_401_985 | 191 |
| 639 | 3300046664 | Ga0495659_0000019 | Ga0495659_0000019_7540_8124 | 191 |
| 640 | 3300046664 | Ga0495659_0001683 | Ga0495659_0001683_97_681 | 191 |
| 641 | 3300046664 | Ga0495659_0009447 | Ga0495659_0009447_1830_2414 | 191 |
| 642 | 3300046664 | Ga0495659_0020073 | Ga0495659_0020073_903_1487 | 191 |
| 643 | 3300046665 | Ga0495661_0000151 | Ga0495661_0000151_4307_4885 | 191 |
| 644 | 3300046665 | Ga0495661_0000590 | Ga0495661_0000590_3014_3598 | 191 |
| 645 | 3300046665 | Ga0495661_0012488 | Ga0495661_0012488_1042_1626 | 191 |
| 646 | 3300046665 | Ga0495661_0020506 | Ga0495661_0020506_2075_2659 | 191 |
| 647 | 3300046665 | Ga0495661_0023945 | Ga0495661_0023945_160_738 | 191 |
| 648 | 3300046665 | Ga0495661_0028727 | Ga0495661_0028727_2083_2667 | 191 |
| 649 | 3300046665 | Ga0495661_0039994 | Ga0495661_0039994_406_990 | 191 |
| 650 | 3300046665 | Ga0495661_0043396 | Ga0495661_0043396_1714_2295 | 191 |
| 651 | 3300046665 | Ga0495661_0166458 | Ga0495661_0166458_152_736 | 191 |
| 652 | 3300046665 | Ga0495661_0213394 | Ga0495661_0213394_227_811 | 191 |
| 653 | 3300046674 | Ga0495588_0000086 | Ga0495588_0000086_110220_110798 | 191 |
| 654 | 3300046674 | Ga0495588_0011973 | Ga0495588_0011973_1166_1750 | 191 |
| 655 | 3300046674 | Ga0495588_0058010 | Ga0495588_0058010_681_1265 | 191 |
| 656 | 3300046674 | Ga0495588_0116559 | Ga0495588_0116559_51_632 | 191 |
| 657 | 3300046679 | Ga0495623_0048369 | Ga0495623_0048369_285_866 | 191 |
| 658 | 3300046684 | Ga0495669_0093968 | Ga0495669_0093968_18_602 | 191 |
| 659 | 3300046689 | Ga0495613_0089487 | Ga0495613_0089487_678_1259 | 191 |
| 660 | 3300046690 | Ga0495624_0033919 | Ga0495624_0033919_1284_1865 | 191 |
| 661 | 3300046691 | Ga0495670_0000143 | Ga0495670_0000143_21981_22565 | 191 |
| 662 | 3300046691 | Ga0495670_0001120 | Ga0495670_0001120_8528_9112 | 191 |
| 663 | 3300046691 | Ga0495670_0010421 | Ga0495670_0010421_2006_2590 | 191 |
| 664 | 3300046691 | Ga0495670_0013539 | Ga0495670_0013539_1680_2267 | 191 |
| 665 | 3300046691 | Ga0495670_0035185 | Ga0495670_0035185_162_746 | 191 |
| 666 | 3300046691 | Ga0495670_0079714 | Ga0495670_0079714_438_1022 | 191 |
| 667 | 3300046691 | Ga0495670_0081229 | Ga0495670_0081229_718_1302 | 191 |
| 668 | 3300046691 | Ga0495670_0247697 | Ga0495670_0247697_149_745 | 191 |
| 669 | 3300046692 | Ga0495671_0000658 | Ga0495671_0000658_6601_7185 | 191 |
| 670 | 3300046692 | Ga0495671_0001049 | Ga0495671_0001049_3848_4432 | 191 |
| 671 | 3300046692 | Ga0495671_0031072 | Ga0495671_0031072_1180_1761 | 191 |
| 672 | 3300046692 | Ga0495671_0154071 | Ga0495671_0154071_308_892 | 191 |
| 673 | 3300046694 | Ga0495649_0015222 | Ga0495649_0015222_2323_2919 | 191 |
| 674 | 3300046694 | Ga0495649_0027732 | Ga0495649_0027732_1942_2520 | 191 |
| 675 | 3300046794 | Ga0495589_0000017 | Ga0495589_0000017_121892_122470 | 191 |
| 676 | 3300046794 | Ga0495589_0001742 | Ga0495589_0001742_10875_11453 | 191 |
| 677 | 3300046794 | Ga0495589_0011131 | Ga0495589_0011131_2278_2862 | 191 |
| 678 | 3300046794 | Ga0495589_0013061 | Ga0495589_0013061_1137_1721 | 191 |
| 679 | 3300046794 | Ga0495589_0020691 | Ga0495589_0020691_997_1581 | 191 |
| 680 | 3300046794 | Ga0495589_0022368 | Ga0495589_0022368_2358_2945 | 191 |
| 681 | 3300046794 | Ga0495589_0043009 | Ga0495589_0043009_1622_2206 | 191 |
| 682 | 3300046794 | Ga0495589_0082237 | Ga0495589_0082237_148_732 | 191 |
| 683 | 3300046809 | Ga0495600_0131479 | Ga0495600_0131479_890_1474 | 191 |
| 684 | 3300046810 | Ga0495660_0000067 | Ga0495660_0000067_61316_61894 | 191 |
| 685 | 3300046810 | Ga0495660_0007858 | Ga0495660_0007858_4475_5071 | 191 |
| 686 | 3300046810 | Ga0495660_0047272 | Ga0495660_0047272_1231_1815 | 191 |
| 687 | 3300046810 | Ga0495660_0059026 | Ga0495660_0059026_1041_1619 | 191 |
| 688 | 3300046810 | Ga0495660_0063365 | Ga0495660_0063365_571_1155 | 191 |
| 689 | 3300046810 | Ga0495660_0166579 | Ga0495660_0166579_62_646 | 191 |
| 690 | 3300047315 | Ga0495581_0018889 | Ga0495581_0018889_749_1333 | 191 |
| 691 | 3300047315 | Ga0495581_0055668 | Ga0495581_0055668_748_1329 | 191 |
| 692 | 3300047317 | Ga0495604_0246697 | Ga0495604_0246697_73_657 | 191 |
| 693 | 3300047318 | Ga0495636_0003301 | Ga0495636_0003301_1354_1938 | 191 |
| 694 | 3300047318 | Ga0495636_0004667 | Ga0495636_0004667_1005_1592 | 191 |
| 695 | 3300047318 | Ga0495636_0009037 | Ga0495636_0009037_582_1166 | 191 |
| 696 | 3300047318 | Ga0495636_0023781 | Ga0495636_0023781_629_1213 | 191 |
| 697 | 3300047318 | Ga0495636_0061353 | Ga0495636_0061353_656_1240 | 191 |
| 698 | 3300047318 | Ga0495636_0135464 | Ga0495636_0135464_283_867 | 191 |
| 699 | 3300047319 | Ga0495674_0221331 | Ga0495674_0221331_819_1403 | 191 |
| 700 | 3300047320 | Ga0495672_0000067 | Ga0495672_0000067_171172_171756 | 191 |
| 701 | 3300047320 | Ga0495672_0000343 | Ga0495672_0000343_30845_31429 | 191 |
| 702 | 3300047320 | Ga0495672_0000718 | Ga0495672_0000718_22744_23328 | 191 |
| 703 | 3300047320 | Ga0495672_0001478 | Ga0495672_0001478_18128_18706 | 191 |
| 704 | 3300047320 | Ga0495672_0052482 | Ga0495672_0052482_510_1094 | 191 |
| 705 | 3300047320 | Ga0495672_0128740 | Ga0495672_0128740_95_679 | 191 |
| 706 | 3300047321 | Ga0495676_0000067 | Ga0495676_0000067_78712_79296 | 191 |
| 707 | 3300047321 | Ga0495676_0028953 | Ga0495676_0028953_3449_4033 | 191 |
| 708 | 3300047321 | Ga0495676_0461324 | Ga0495676_0461324_239_823 | 191 |
| 709 | 3300047323 | Ga0495683_0000083 | Ga0495683_0000083_47004_47588 | 191 |
| 710 | 3300047323 | Ga0495683_0000348 | Ga0495683_0000348_22704_23288 | 191 |
| 711 | 3300047323 | Ga0495683_0002803 | Ga0495683_0002803_8929_9513 | 191 |
| 712 | 3300047323 | Ga0495683_0006314 | Ga0495683_0006314_2517_3101 | 191 |
| 713 | 3300047323 | Ga0495683_0019894 | Ga0495683_0019894_1964_2548 | 191 |
| 714 | 3300047323 | Ga0495683_0022607 | Ga0495683_0022607_2176_2760 | 191 |
| 715 | 3300047323 | Ga0495683_0057907 | Ga0495683_0057907_1175_1759 | 191 |
| 716 | 3300047323 | Ga0495683_0078187 | Ga0495683_0078187_278_862 | 191 |
| 717 | 3300047443 | Ga0495687_000033 | Ga0495687_000033_62581_63159 | 191 |
| 718 | 3300047443 | Ga0495687_000126 | Ga0495687_000126_82068_82652 | 191 |
| 719 | 3300047443 | Ga0495687_000640 | Ga0495687_000640_8726_9304 | 191 |
| 720 | 3300047443 | Ga0495687_008102 | Ga0495687_008102_3053_3637 | 191 |
| 721 | 3300047443 | Ga0495687_010751 | Ga0495687_010751_1058_1654 | 191 |
| 722 | 3300047443 | Ga0495687_010893 | Ga0495687_010893_2699_3277 | 191 |
| 723 | 3300047444 | Ga0495675_0030000 | Ga0495675_0030000_2879_3460 | 191 |
| 724 | 3300047444 | Ga0495675_0088516 | Ga0495675_0088516_743_1324 | 191 |
| 725 | 3300047445 | Ga0495677_0000002 | Ga0495677_0000002_145986_146564 | 191 |
| 726 | 3300047445 | Ga0495677_0005091 | Ga0495677_0005091_1011_1595 | 191 |
| 727 | 3300047445 | Ga0495677_0008164 | Ga0495677_0008164_2362_2946 | 191 |
| 728 | 3300047445 | Ga0495677_0014812 | Ga0495677_0014812_1816_2400 | 191 |
| 729 | 3300047445 | Ga0495677_0021668 | Ga0495677_0021668_724_1308 | 191 |
| 730 | 3300047445 | Ga0495677_0032123 | Ga0495677_0032123_621_1205 | 191 |
| 731 | 3300047445 | Ga0495677_0044837 | Ga0495677_0044837_664_1242 | 191 |
| 732 | 3300047445 | Ga0495677_0051623 | Ga0495677_0051623_262_843 | 191 |
| 733 | 3300047445 | Ga0495677_0098020 | Ga0495677_0098020_177_764 | 191 |
| 734 | 3300047446 | Ga0495679_008082 | Ga0495679_008082_2311_2895 | 191 |
| 735 | 3300047447 | Ga0495685_000053 | Ga0495685_000053_27537_28121 | 191 |
| 736 | 3300047447 | Ga0495685_004689 | Ga0495685_004689_489_1073 | 191 |
| 737 | 3300047470 | Ga0495681_0007275 | Ga0495681_0007275_4612_5196 | 191 |
| 738 | 3300047470 | Ga0495681_0030372 | Ga0495681_0030372_1079_1666 | 191 |
| 739 | 3300047470 | Ga0495681_0046396 | Ga0495681_0046396_669_1253 | 191 |
| 740 | 3300047472 | Ga0495686_0000628 | Ga0495686_0000628_32553_33137 | 191 |
| 741 | 3300047472 | Ga0495686_0033337 | Ga0495686_0033337_2451_3035 | 191 |
| 742 | 3300047472 | Ga0495686_0040123 | Ga0495686_0040123_981_1565 | 191 |
| 743 | 3300047472 | Ga0495686_0091644 | Ga0495686_0091644_732_1316 | 191 |
| 744 | 3300047673 | Ga0495593_0054376 | Ga0495593_0054376_748_1329 | 191 |
| 745 | 3300048088 | Ga0495602_0104784 | Ga0495602_0104784_1705_2286 | 191 |
| 746 | 3300048089 | Ga0495614_0018070 | Ga0495614_0018070_96_680 | 191 |
| 747 | 3300048090 | Ga0495615_0001150 | Ga0495615_0001150_442_1026 | 191 |
| 748 | 3300048091 | Ga0495626_0000097 | Ga0495626_0000097_4526_5104 | 191 |
| 749 | 3300048091 | Ga0495626_0000258 | Ga0495626_0000258_29645_30223 | 191 |
| 750 | 3300048091 | Ga0495626_0011560 | Ga0495626_0011560_1813_2397 | 191 |
| 751 | 3300048091 | Ga0495626_0016093 | Ga0495626_0016093_3200_3784 | 191 |
| 752 | 3300048091 | Ga0495626_0044605 | Ga0495626_0044605_522_1106 | 191 |
| 753 | 3300048091 | Ga0495626_0049911 | Ga0495626_0049911_1026_1613 | 191 |
| 754 | 3300048091 | Ga0495626_0059885 | Ga0495626_0059885_820_1404 | 191 |
| 755 | 3300048091 | Ga0495626_0145896 | Ga0495626_0145896_139_723 | 191 |
| 756 | 3300048903 | Ga0496100_0052012 | Ga0496100_0052012_492_1076 | 191 |
| 757 | 3300048904 | Ga0496101_0044781 | Ga0496101_0044781_1454_2038 | 191 |
| 758 | 3300048905 | Ga0496102_0000487 | Ga0496102_0000487_6995_7579 | 191 |
| 759 | 3300048905 | Ga0496102_0055639 | Ga0496102_0055639_1892_2476 | 191 |
| 760 | 3300048905 | Ga0496102_0420493 | Ga0496102_0420493_399_986 | 191 |
| 761 | 3300048906 | Ga0496103_0091804 | Ga0496103_0091804_327_911 | 191 |
| 762 | 3300048906 | Ga0496103_0231148 | Ga0496103_0231148_314_898 | 191 |
| 763 | 3300048906 | Ga0496103_0422697 | Ga0496103_0422697_79_663 | 191 |
| 764 | 3300048906 | Ga0496103_0450071 | Ga0496103_0450071_212_790 | 191 |
| 765 | 3300048907 | Ga0496104_0848884 | Ga0496104_0848884_156_740 | 191 |
| 766 | 3300048909 | Ga0496106_0006127 | Ga0496106_0006127_4223_4801 | 191 |
| 767 | 3300048910 | Ga0496107_0075821 | Ga0496107_0075821_1823_2401 | 191 |
| 768 | 3300048911 | Ga0496108_0711016 | Ga0496108_0711016_187_771 | 191 |
| 769 | 3300048913 | Ga0496110_0000024 | Ga0496110_0000024_60591_61175 | 191 |
| 770 | 3300048913 | Ga0496110_0570064 | Ga0496110_0570064_150_734 | 191 |
| 771 | 3300048915 | Ga0496112_0367515 | Ga0496112_0367515_536_1114 | 191 |
| 772 | 3300048915 | Ga0496112_0755078 | Ga0496112_0755078_73_657 | 191 |
| 773 | 3300048916 | Ga0496113_0019700 | Ga0496113_0019700_1998_2576 | 191 |
| 774 | 3300048917 | Ga0496114_0067969 | Ga0496114_0067969_833_1411 | 191 |
| 775 | 3300048918 | Ga0496115_0026659 | Ga0496115_0026659_439_1020 | 191 |
| 776 | 3300048918 | Ga0496115_0056234 | Ga0496115_0056234_1081_1665 | 191 |
| 777 | 3300048918 | Ga0496115_0082225 | Ga0496115_0082225_1433_2017 | 191 |
| 778 | 3300048918 | Ga0496115_0215720 | Ga0496115_0215720_262_849 | 191 |
| 779 | 3300048918 | Ga0496115_0555710 | Ga0496115_0555710_159_740 | 191 |
| 780 | 3300048924 | Ga0496121_0514578 | Ga0496121_0514578_139_723 | 191 |
| 781 | 3300048925 | Ga0496122_0000439 | Ga0496122_0000439_81671_82255 | 191 |
| 782 | 3300048925 | Ga0496122_0002153 | Ga0496122_0002153_5569_6147 | 191 |
| 783 | 3300048925 | Ga0496122_0011837 | Ga0496122_0011837_2646_3224 | 191 |
| 784 | 3300048926 | Ga0496123_0000487 | Ga0496123_0000487_3953_4537 | 191 |
| 785 | 3300048926 | Ga0496123_0022480 | Ga0496123_0022480_2366_2944 | 191 |
| 786 | 3300048927 | Ga0496124_0016901 | Ga0496124_0016901_2667_3245 | 191 |
| 787 | 3300048927 | Ga0496124_0023141 | Ga0496124_0023141_4941_5525 | 191 |
| 788 | 3300048927 | Ga0496124_0045759 | Ga0496124_0045759_142_720 | 191 |
| 789 | 3300048927 | Ga0496124_0076458 | Ga0496124_0076458_1666_2250 | 191 |
| 790 | 3300048927 | Ga0496124_0303252 | Ga0496124_0303252_84_662 | 191 |
| 791 | 3300048928 | Ga0496125_0182288 | Ga0496125_0182288_685_1263 | 191 |
| 792 | 3300048928 | Ga0496125_0246345 | Ga0496125_0246345_477_1055 | 191 |
| 793 | 3300049128 | Ga0501308_013232 | Ga0501308_013232_265_849 | 191 |
| 794 | 3300049160 | Ga0501304_003196 | Ga0501304_003196_533_1111 | 191 |
| 795 | 3300049459 | Ga0495678_000355 | Ga0495678_000355_16254_16838 | 191 |
| 796 | 3300049459 | Ga0495678_004358 | Ga0495678_004358_2066_2650 | 191 |
| 797 | 3300049460 | Ga0495682_0000779 | Ga0495682_0000779_11695_12279 | 191 |
| 798 | 3300049460 | Ga0495682_0001850 | Ga0495682_0001850_8094_8678 | 191 |
| 799 | 3300049460 | Ga0495682_0002874 | Ga0495682_0002874_7309_7893 | 191 |
| 800 | 3300049460 | Ga0495682_0004757 | Ga0495682_0004757_4032_4616 | 191 |
| 801 | 3300049654 | Ga0501207_006845 | Ga0501207_006845_1001_1588 | 191 |
| 802 | 3300049822 | Ga0501035_0005808 | Ga0501035_0005808_7923_8501 | 191 |
| 803 | 3300053118 | Ga0500594_0017715 | Ga0500594_0017715_859_1455 | 191 |
| 804 | 3300053125 | Ga0500618_000301 | Ga0500618_000301_18441_19037 | 191 |
| 805 | 3300053125 | Ga0500618_000821 | Ga0500618_000821_10962_11555 | 191 |
| 806 | 3300059490 | Ga0587066_089812 | Ga0587066_089812_41_619 | 191 |
| 807 | 3300059503 | Ga0587080_010270 | Ga0587080_010270_788_1366 | 191 |
| 808 | 3300059510 | Ga0587090_013222 | Ga0587090_013222_211_789 | 191 |
| 809 | 3300059511 | Ga0587091_019940 | Ga0587091_019940_336_914 | 191 |
| 810 | 3300059605 | Ga0587106_021228 | Ga0587106_021228_105_683 | 191 |
| 811 | 3300059623 | Ga0587101_054991 | Ga0587101_054991_73_651 | 191 |
| 812 | 3300059640 | Ga0587067_015649 | Ga0587067_015649_119_697 | 191 |
| 813 | 3300059642 | Ga0587069_022812 | Ga0587069_022812_75_653 | 191 |
| 814 | 3300059643 | Ga0587072_025780 | Ga0587072_025780_205_783 | 191 |
| 815 | 3300059647 | Ga0587079_043002 | Ga0587079_043002_58_636 | 191 |
| 816 | 3300059651 | Ga0587105_003927 | Ga0587105_003927_103_681 | 191 |
| 817 | 3300060344 | Ga0587071_065599 | Ga0587071_065599_82_660 | 191 |
| 818 | 3300061719 | Ga0466962_0032893 | Ga0466962_0032893_1510_2085 | 191 |
| 819 | 3300061719 | Ga0466962_0091908 | Ga0466962_0091908_171_749 | 191 |
| 820 | iso_pu_bacteria | 2818991436 | 2819543187 | 191 |
| 821 | 3300003771 | Ga0055526_1001163 | Ga0055526_10011638 | 192 |
| 822 | 3300003773 | Ga0055537_1000678 | Ga0055537_100067811 | 192 |
| 823 | 3300003775 | Ga0055524_1013711 | Ga0055524_10137113 | 192 |
| 824 | 3300003784 | Ga0055534_1000195 | Ga0055534_100019521 | 192 |
| 825 | 3300003790 | Ga0055528_1000368 | Ga0055528_100036810 | 192 |
| 826 | 3300005339 | Ga0070660_100000420 | Ga0070660_1000004208 | 192 |
| 827 | 3300005344 | Ga0070661_100098624 | Ga0070661_1000986241 | 192 |
| 828 | 3300005366 | Ga0070659_100115125 | Ga0070659_1001151252 | 192 |
| 829 | 3300005455 | Ga0070663_100390729 | Ga0070663_1003907292 | 192 |
| 830 | 3300005564 | Ga0070664_100057458 | Ga0070664_1000574582 | 192 |
| 831 | 3300005614 | Ga0068856_100506920 | Ga0068856_1005069201 | 192 |
| 832 | 3300015262 | Ga0182007_10115956 | Ga0182007_101159561 | 192 |
| 833 | 3300021361 | Ga0213872_10001513 | Ga0213872_100015134 | 192 |
| 834 | 3300025233 | Ga0209437_108693 | Ga0209437_1086932 | 192 |
| 835 | 3300025250 | Ga0209026_1009492 | Ga0209026_10094922 | 192 |
| 836 | 3300025263 | Ga0209565_1000015 | Ga0209565_100001543 | 192 |
| 837 | 3300025272 | Ga0209455_1000169 | Ga0209455_10001698 | 192 |
| 838 | 3300025273 | Ga0209673_1000394 | Ga0209673_100039443 | 192 |
| 839 | 3300025291 | Ga0209675_1000012 | Ga0209675_1000012439 | 192 |
| 840 | 3300025295 | Ga0209564_1000016 | Ga0209564_1000016552 | 192 |
| 841 | 3300025299 | Ga0209256_1000076 | Ga0209256_10000764 | 192 |
| 842 | 3300025302 | Ga0207426_1054078 | Ga0207426_10540781 | 192 |
| 843 | 3300025913 | Ga0207695_10438637 | Ga0207695_104386372 | 192 |
| 844 | 3300025919 | Ga0207657_10001145 | Ga0207657_1000114521 | 192 |
| 845 | 3300025920 | Ga0207649_10026917 | Ga0207649_100269172 | 192 |
| 846 | 3300025932 | Ga0207690_10084366 | Ga0207690_100843662 | 192 |
| 847 | 3300025945 | Ga0207679_10019205 | Ga0207679_100192056 | 192 |
| 848 | 3300026067 | Ga0207678_10312327 | Ga0207678_103123272 | 192 |
| 849 | 3300026078 | Ga0207702_10478919 | Ga0207702_104789192 | 192 |
| 850 | 3300037312 | Ga0395899_0000753 | Ga0395899_0000753_21566_22153 | 192 |
| 851 | 3300037312 | Ga0395899_0012339 | Ga0395899_0012339_807_1394 | 192 |
| 852 | 3300037312 | Ga0395899_0013728 | Ga0395899_0013728_4889_5476 | 192 |
| 853 | 3300037312 | Ga0395899_0293240 | Ga0395899_0293240_178_804 | 192 |
| 854 | 3300037418 | Ga0395900_0008621 | Ga0395900_0008621_9716_10303 | 192 |
| 855 | 3300037418 | Ga0395900_0209971 | Ga0395900_0209971_1122_1709 | 192 |
| 856 | 3300037418 | Ga0395900_0323735 | Ga0395900_0323735_447_1034 | 192 |
| 857 | 3300037466 | Ga0395898_0075038 | Ga0395898_0075038_2641_3228 | 192 |
| 858 | 3300037471 | Ga0395905_0000905 | Ga0395905_0000905_16860_17447 | 192 |
| 859 | 3300037471 | Ga0395905_0001709 | Ga0395905_0001709_14735_15322 | 192 |
| 860 | 3300037471 | Ga0395905_0012941 | Ga0395905_0012941_6199_6834 | 192 |
| 861 | 3300037471 | Ga0395905_0013998 | Ga0395905_0013998_5767_6354 | 192 |
| 862 | 3300037471 | Ga0395905_0503627 | Ga0395905_0503627_131_712 | 192 |
| 863 | 3300037471 | Ga0395905_0623628 | Ga0395905_0623628_250_840 | 192 |
| 864 | 3300038443 | Ga0395901_0021000 | Ga0395901_0021000_4818_5405 | 192 |
| 865 | 3300038443 | Ga0395901_0346430 | Ga0395901_0346430_807_1394 | 192 |
| 866 | 3300039447 | Ga0436361_0458162 | Ga0436361_0458162_543_1139 | 192 |
| 867 | 3300039447 | Ga0436361_0938544 | Ga0436361_0938544_25039_25635 | 192 |
| 868 | 3300042139 | Ga0450904_000276 | Ga0450904_000276_412_1008 | 192 |
| 869 | 3300044658 | Ga0466972_0000087 | Ga0466972_0000087_76324_76911 | 192 |
| 870 | 3300044658 | Ga0466972_0006991 | Ga0466972_0006991_1059_1646 | 192 |
| 871 | 3300044658 | Ga0466972_0097290 | Ga0466972_0097290_510_1097 | 192 |
| 872 | 3300044683 | Ga0466965_0002700 | Ga0466965_0002700_876_1463 | 192 |
| 873 | 3300044683 | Ga0466965_0107579 | Ga0466965_0107579_650_1237 | 192 |
| 874 | 3300044684 | Ga0466966_0013678 | Ga0466966_0013678_4257_4844 | 192 |
| 875 | 3300044706 | Ga0466964_0206904 | Ga0466964_0206904_186_773 | 192 |
| 876 | 3300044735 | Ga0466968_0037123 | Ga0466968_0037123_674_1261 | 192 |
| 877 | 3300046457 | Ga0495590_0006267 | Ga0495590_0006267_2416_2997 | 192 |
| 878 | 3300046460 | Ga0495638_0050498 | Ga0495638_0050498_999_1604 | 192 |
| 879 | 3300046463 | Ga0495653_0144561 | Ga0495653_0144561_430_1011 | 192 |
| 880 | 3300046463 | Ga0495653_0169254 | Ga0495653_0169254_720_1301 | 192 |
| 881 | 3300046471 | Ga0495650_0000011 | Ga0495650_0000011_418418_419002 | 192 |
| 882 | 3300046472 | Ga0495580_0030809 | Ga0495580_0030809_1518_2111 | 192 |
| 883 | 3300046473 | Ga0495582_0017936 | Ga0495582_0017936_2556_3149 | 192 |
| 884 | 3300046474 | Ga0495605_0132566 | Ga0495605_0132566_63_668 | 192 |
| 885 | 3300046491 | Ga0495584_0021540 | Ga0495584_0021540_2170_2775 | 192 |
| 886 | 3300046499 | Ga0495594_0010511 | Ga0495594_0010511_521_1114 | 192 |
| 887 | 3300046501 | Ga0495607_0001966 | Ga0495607_0001966_6976_7581 | 192 |
| 888 | 3300046506 | Ga0495583_0015121 | Ga0495583_0015121_2895_3500 | 192 |
| 889 | 3300046507 | Ga0495606_0039821 | Ga0495606_0039821_2544_3137 | 192 |
| 890 | 3300046513 | Ga0495616_0044363 | Ga0495616_0044363_743_1348 | 192 |
| 891 | 3300046517 | Ga0495630_0009137 | Ga0495630_0009137_2346_2939 | 192 |
| 892 | 3300046522 | Ga0495643_0004464 | Ga0495643_0004464_1160_1747 | 192 |
| 893 | 3300046524 | Ga0495648_0313657 | Ga0495648_0313657_68_673 | 192 |
| 894 | 3300046528 | Ga0495642_0021157 | Ga0495642_0021157_1281_1886 | 192 |
| 895 | 3300046529 | Ga0495652_0005056 | Ga0495652_0005056_7640_8233 | 192 |
| 896 | 3300046531 | Ga0495665_0005554 | Ga0495665_0005554_3879_4472 | 192 |
| 897 | 3300046535 | Ga0495586_0019447 | Ga0495586_0019447_1920_2513 | 192 |
| 898 | 3300046538 | Ga0495609_0000163 | Ga0495609_0000163_42386_42991 | 192 |
| 899 | 3300046542 | Ga0495597_0006826 | Ga0495597_0006826_3990_4577 | 192 |
| 900 | 3300046558 | Ga0495633_0230476 | Ga0495633_0230476_195_782 | 192 |
| 901 | 3300046642 | Ga0495634_0015301 | Ga0495634_0015301_1103_1696 | 192 |
| 902 | 3300046660 | Ga0495625_0002543 | Ga0495625_0002543_4884_5489 | 192 |
| 903 | 3300046664 | Ga0495659_0000167 | Ga0495659_0000167_5928_6533 | 192 |
| 904 | 3300046665 | Ga0495661_0007238 | Ga0495661_0007238_680_1285 | 192 |
| 905 | 3300046665 | Ga0495661_0007385 | Ga0495661_0007385_1912_2499 | 192 |
| 906 | 3300046665 | Ga0495661_0165231 | Ga0495661_0165231_111_707 | 192 |
| 907 | 3300046665 | Ga0495661_0255821 | Ga0495661_0255821_71_658 | 192 |
| 908 | 3300046674 | Ga0495588_0034728 | Ga0495588_0034728_1362_1955 | 192 |
| 909 | 3300046679 | Ga0495623_0008207 | Ga0495623_0008207_113_706 | 192 |
| 910 | 3300046679 | Ga0495623_0041958 | Ga0495623_0041958_1223_1804 | 192 |
| 911 | 3300046684 | Ga0495669_0026346 | Ga0495669_0026346_1548_2153 | 192 |
| 912 | 3300046694 | Ga0495649_0009418 | Ga0495649_0009418_1438_2043 | 192 |
| 913 | 3300046809 | Ga0495600_0006403 | Ga0495600_0006403_1101_1694 | 192 |
| 914 | 3300047317 | Ga0495604_0034285 | Ga0495604_0034285_1110_1703 | 192 |
| 915 | 3300047318 | Ga0495636_0000388 | Ga0495636_0000388_5760_6365 | 192 |
| 916 | 3300047443 | Ga0495687_000252 | Ga0495687_000252_57622_58218 | 192 |
| 917 | 3300047443 | Ga0495687_022520 | Ga0495687_022520_893_1480 | 192 |
| 918 | 3300047444 | Ga0495675_0003787 | Ga0495675_0003787_4080_4673 | 192 |
| 919 | 3300047445 | Ga0495677_0008034 | Ga0495677_0008034_388_993 | 192 |
| 920 | 3300047446 | Ga0495679_034537 | Ga0495679_034537_105_710 | 192 |
| 921 | 3300047447 | Ga0495685_000183 | Ga0495685_000183_3972_4577 | 192 |
| 922 | 3300047470 | Ga0495681_0032989 | Ga0495681_0032989_806_1411 | 192 |
| 923 | 3300048088 | Ga0495602_0159563 | Ga0495602_0159563_464_1045 | 192 |
| 924 | 3300048090 | Ga0495615_0029638 | Ga0495615_0029638_439_1041 | 192 |
| 925 | 3300048903 | Ga0496100_0159307 | Ga0496100_0159307_372_971 | 192 |
| 926 | 3300048904 | Ga0496101_0092574 | Ga0496101_0092574_136_723 | 192 |
| 927 | 3300048910 | Ga0496107_0293454 | Ga0496107_0293454_399_986 | 192 |
| 928 | 3300048911 | Ga0496108_0217414 | Ga0496108_0217414_315_902 | 192 |
| 929 | 3300048912 | Ga0496109_0068134 | Ga0496109_0068134_700_1287 | 192 |
| 930 | 3300048913 | Ga0496110_0104634 | Ga0496110_0104634_309_896 | 192 |
| 931 | 3300048914 | Ga0496111_0635735 | Ga0496111_0635735_65_652 | 192 |
| 932 | 3300049459 | Ga0495678_001074 | Ga0495678_001074_19526_20110 | 192 |
| 933 | 3300049459 | Ga0495678_015158 | Ga0495678_015158_942_1526 | 192 |
| 934 | 3300053083 | Ga0495655_0154964 | Ga0495655_0154964_92_679 | 192 |
| 935 | 3300053156 | Ga0500622_0279307 | Ga0500622_0279307_62_649 | 192 |
| 936 | 3300059491 | Ga0587070_012124 | Ga0587070_012124_459_1046 | 192 |
| 937 | 3300059493 | Ga0587077_006576 | Ga0587077_006576_203_790 | 192 |
| 938 | 3300059493 | Ga0587077_025555 | Ga0587077_025555_262_849 | 192 |
| 939 | 3300059505 | Ga0587083_0023065 | Ga0587083_0023065_437_1024 | 192 |
| 940 | 3300059506 | Ga0587085_003884 | Ga0587085_003884_134_721 | 192 |
| 941 | 3300059507 | Ga0587086_011885 | Ga0587086_011885_435_1022 | 192 |
| 942 | 3300059510 | Ga0587090_001134 | Ga0587090_001134_1299_1886 | 192 |
| 943 | 3300059511 | Ga0587091_019150 | Ga0587091_019150_217_804 | 192 |
| 944 | 3300059624 | Ga0587109_014206 | Ga0587109_014206_499_1086 | 192 |
| 945 | 3300059627 | Ga0587117_016597 | Ga0587117_016597_261_848 | 192 |
| 946 | 3300059639 | Ga0587062_011715 | Ga0587062_011715_426_1013 | 192 |
| 947 | 3300059640 | Ga0587067_020457 | Ga0587067_020457_416_1003 | 192 |
| 948 | 3300059641 | Ga0587068_016177 | Ga0587068_016177_467_1054 | 192 |
| 949 | 3300059642 | Ga0587069_016163 | Ga0587069_016163_269_856 | 192 |
| 950 | 3300059643 | Ga0587072_005287 | Ga0587072_005287_379_966 | 192 |
| 951 | 3300059646 | Ga0587078_011383 | Ga0587078_011383_343_981 | 192 |
| 952 | 3300060346 | Ga0587111_0001153 | Ga0587111_0001153_647_1234 | 192 |
| 953 | iso_pu_bacteria | 2511231003 | 2511250064 | 192 |
| 954 | iso_pu_bacteria | 2818991445 | 2819592044 | 192 |
| 955 | iso_pu_bacteria | 2884811622 | 2884813179 | 192 |
| 956 | iso_pu_bacteria | 2884836552 | 2884840539 | 192 |
| 957 | iso_pu_bacteria | 2884852848 | 2884855796 | 192 |
| 958 | iso_pu_bacteria | 2896154374 | 2896157279 | 192 |
| 959 | 3300005337 | Ga0070682_100516816 | Ga0070682_1005168161 | 193 |
| 960 | 3300046460 | Ga0495638_0045252 | Ga0495638_0045252_1930_2526 | 193 |
| 961 | 3300048091 | Ga0495626_0000209 | Ga0495626_0000209_4301_4894 | 193 |
| 962 | 3300046522 | Ga0495643_0000200 | Ga0495643_0000200_27607_28212 | 194 |
| 963 | 3300002737 | JGI25162J39368_1000026 | JGI25162J39368_1000026186 | 195 |
| 964 | 3300003214 | JGI25165J46597_1000031 | JGI25165J46597_100003160 | 195 |
| 965 | 3300003544 | Ga0007417J51691_1071950 | Ga0007417J51691_10719502 | 195 |
| 966 | 3300003577 | Ga0007416J51690_1059972 | Ga0007416J51690_10599721 | 195 |
| 967 | 3300003693 | Ga0032354_1079230 | Ga0032354_10792301 | 195 |
| 968 | 3300003751 | Ga0055538_1000018 | Ga0055538_100001860 | 195 |
| 969 | 3300003752 | Ga0055539_1000023 | Ga0055539_100002360 | 195 |
| 970 | 3300003756 | Ga0055533_1000031 | Ga0055533_1000031234 | 195 |
| 971 | 3300003759 | Ga0055525_1000039 | Ga0055525_100003960 | 195 |
| 972 | 3300003841 | Ga0055541_1000016 | Ga0055541_100001660 | 195 |
| 973 | 3300015262 | Ga0182007_10031167 | Ga0182007_100311672 | 195 |
| 974 | 3300015265 | Ga0182005_1003156 | Ga0182005_10031563 | 195 |
| 975 | 3300025207 | Ga0209760_100622 | Ga0209760_1006221 | 195 |
| 976 | 3300025224 | Ga0209784_100027 | Ga0209784_10002761 | 195 |
| 977 | 3300025225 | Ga0209566_100027 | Ga0209566_10002761 | 195 |
| 978 | 3300025226 | Ga0209674_100044 | Ga0209674_10004461 | 195 |
| 979 | 3300025230 | Ga0209563_100048 | Ga0209563_10004861 | 195 |
| 980 | 3300025231 | Ga0207427_100643 | Ga0207427_1006432 | 195 |
| 981 | 3300025233 | Ga0209437_100055 | Ga0209437_10005561 | 195 |
| 982 | 3300025253 | Ga0209677_100028 | Ga0209677_10002861 | 195 |
| 983 | 3300025261 | Ga0209233_1000070 | Ga0209233_100007061 | 195 |
| 984 | 3300046454 | Ga0495592_0003280 | Ga0495592_0003280_3049_3657 | 195 |
| 985 | 3300046454 | Ga0495592_0405274 | Ga0495592_0405274_151_756 | 195 |
| 986 | 3300046462 | Ga0495651_0015119 | Ga0495651_0015119_4441_5046 | 195 |
| 987 | 3300046462 | Ga0495651_0058856 | Ga0495651_0058856_439_1047 | 195 |
| 988 | 3300046463 | Ga0495653_0002089 | Ga0495653_0002089_10123_10731 | 195 |
| 989 | 3300046511 | Ga0495608_0001512 | Ga0495608_0001512_2923_3531 | 195 |
| 990 | 3300046511 | Ga0495608_0013677 | Ga0495608_0013677_3878_4483 | 195 |
| 991 | 3300046516 | Ga0495628_0004339 | Ga0495628_0004339_2726_3334 | 195 |
| 992 | 3300046516 | Ga0495628_0018273 | Ga0495628_0018273_2944_3549 | 195 |
| 993 | 3300046529 | Ga0495652_0019388 | Ga0495652_0019388_1810_2418 | 195 |
| 994 | 3300046529 | Ga0495652_0049462 | Ga0495652_0049462_2185_2790 | 195 |
| 995 | 3300046543 | Ga0495645_0042584 | Ga0495645_0042584_664_1272 | 195 |
| 996 | 3300046557 | Ga0495622_0039180 | Ga0495622_0039180_1127_1735 | 195 |
| 997 | 3300046675 | Ga0495657_0058805 | Ga0495657_0058805_434_1042 | 195 |
| 998 | 3300046678 | Ga0495599_0003514 | Ga0495599_0003514_2781_3389 | 195 |
| 999 | 3300046679 | Ga0495623_0011302 | Ga0495623_0011302_130_735 | 195 |
| 1000 | 3300046679 | Ga0495623_0035632 | Ga0495623_0035632_1772_2380 | 195 |
| 1001 | 3300046690 | Ga0495624_0036132 | Ga0495624_0036132_1801_2409 | 195 |
| 1002 | 3300046809 | Ga0495600_0000834 | Ga0495600_0000834_13914_14522 | 195 |
| 1003 | 3300047317 | Ga0495604_0004591 | Ga0495604_0004591_974_1582 | 195 |
| 1004 | 3300048088 | Ga0495602_0024798 | Ga0495602_0024798_3805_4413 | 195 |
| 1005 | 3300048917 | Ga0496114_0047812 | Ga0496114_0047812_1496_2092 | 195 |
| 1006 | 3300048928 | Ga0496125_0001079 | Ga0496125_0001079_11635_12231 | 195 |
| 1007 | 3300053077 | Ga0495601_0021365 | Ga0495601_0021365_2722_3330 | 195 |
| 1008 | 3300053077 | Ga0495601_0323983 | Ga0495601_0323983_374_979 | 195 |
| 1009 | 3300053141 | Ga0500574_000358 | Ga0500574_000358_2801_3409 | 195 |
| 1010 | 3300002704 | JGI25155J39150_1000363 | JGI25155J39150_10003634 | 196 |
| 1011 | 3300002704 | JGI25155J39150_1000557 | JGI25155J39150_10005576 | 196 |
| 1012 | 3300002705 | JGI25156J39149_1000170 | JGI25156J39149_100017031 | 196 |
| 1013 | 3300002705 | JGI25156J39149_1001095 | JGI25156J39149_10010954 | 196 |
| 1014 | 3300002737 | JGI25162J39368_1010038 | JGI25162J39368_10100382 | 196 |
| 1015 | 3300002738 | JGI25154J39366_1000351 | JGI25154J39366_100035114 | 196 |
| 1016 | 3300002738 | JGI25154J39366_1000415 | JGI25154J39366_100041511 | 196 |
| 1017 | 3300002741 | JGI25157J39369_1000170 | JGI25157J39369_100017040 | 196 |
| 1018 | 3300002741 | JGI25157J39369_1000605 | JGI25157J39369_100060511 | 196 |
| 1019 | 3300003758 | Ga0055532_1000017 | Ga0055532_1000017142 | 196 |
| 1020 | 3300005563 | Ga0068855_100018683 | Ga0068855_1000186836 | 196 |
| 1021 | 3300005616 | Ga0068852_100220358 | Ga0068852_1002203582 | 196 |
| 1022 | 3300009011 | Ga0105251_10236994 | Ga0105251_102369941 | 196 |
| 1023 | 3300009093 | Ga0105240_10009083 | Ga0105240_1000908311 | 196 |
| 1024 | 3300009093 | Ga0105240_10011970 | Ga0105240_100119707 | 196 |
| 1025 | 3300009545 | Ga0105237_10259678 | Ga0105237_102596782 | 196 |
| 1026 | 3300009551 | Ga0105238_10233962 | Ga0105238_102339622 | 196 |
| 1027 | 3300013100 | Ga0157373_10037009 | Ga0157373_100370094 | 196 |
| 1028 | 3300014497 | Ga0182008_10057555 | Ga0182008_100575552 | 196 |
| 1029 | 3300025206 | Ga0209435_100015 | Ga0209435_100015157 | 196 |
| 1030 | 3300025206 | Ga0209435_100161 | Ga0209435_10016111 | 196 |
| 1031 | 3300025229 | Ga0209147_100004 | Ga0209147_1000041069 | 196 |
| 1032 | 3300025233 | Ga0209437_100045 | Ga0209437_100045378 | 196 |
| 1033 | 3300025242 | Ga0209258_100226 | Ga0209258_10022658 | 196 |
| 1034 | 3300025246 | Ga0209646_1000020 | Ga0209646_1000020141 | 196 |
| 1035 | 3300025246 | Ga0209646_1000040 | Ga0209646_1000040187 | 196 |
| 1036 | 3300025250 | Ga0209026_1000034 | Ga0209026_1000034132 | 196 |
| 1037 | 3300025250 | Ga0209026_1016102 | Ga0209026_10161022 | 196 |
| 1038 | 3300025256 | Ga0209759_1000049 | Ga0209759_100004971 | 196 |
| 1039 | 3300025256 | Ga0209759_1000357 | Ga0209759_100035744 | 196 |
| 1040 | 3300025272 | Ga0209455_1008089 | Ga0209455_10080894 | 196 |
| 1041 | 3300025913 | Ga0207695_10001341 | Ga0207695_1000134115 | 196 |
| 1042 | 3300025914 | Ga0207671_10307253 | Ga0207671_103072532 | 196 |
| 1043 | 3300025924 | Ga0207694_10189850 | Ga0207694_101898502 | 196 |
| 1044 | 3300025949 | Ga0207667_10217165 | Ga0207667_102171652 | 196 |
| 1045 | 3300026142 | Ga0207698_10158976 | Ga0207698_101589762 | 196 |
| 1046 | 3300046660 | Ga0495625_0005310 | Ga0495625_0005310_11095_11685 | 196 |
| 1047 | 3300048919 | Ga0496116_0026481 | Ga0496116_0026481_3630_4220 | 196 |
| 1048 | 3300048921 | Ga0496118_0131119 | Ga0496118_0131119_603_1193 | 196 |
| 1049 | 3300048924 | Ga0496121_0154136 | Ga0496121_0154136_180_770 | 196 |
| 1050 | 3300048925 | Ga0496122_0004757 | Ga0496122_0004757_11319_11909 | 196 |
| 1051 | 3300048926 | Ga0496123_0003789 | Ga0496123_0003789_11293_11883 | 196 |
| 1052 | 3300048928 | Ga0496125_0003984 | Ga0496125_0003984_9879_10469 | 196 |
| 1053 | 3300048928 | Ga0496125_0099527 | Ga0496125_0099527_1405_1995 | 196 |
| 1054 | iso_pu_bacteria | 2548876994 | 2550693247 | 196 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5cy4-assembly1.cif.gz_B | crystal structure of an oligoribonuclease from acinetobacter baumannii | 0.9744 | 20 | 193 |
| 3tr8-assembly1.cif.gz_B | structure of an oligoribonuclease (orn) from coxiella burnetii | 0.9732 | 18 | 196 |
| 5cy4-assembly2.cif.gz_C | crystal structure of an oligoribonuclease from acinetobacter baumannii | 0.973 | 20 | 193 |
| 6n6h-assembly1.cif.gz_A | vibrio cholerae oligoribonuclease bound to pcpu | 0.9726 | 18 | 196 |
| 5cy4-assembly3.cif.gz_E | crystal structure of an oligoribonuclease from acinetobacter baumannii | 0.9713 | 20 | 193 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WIU1_1_181_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9546 | 19 | 192 | 3.30.420.10 |
| af_Q556Y2_11_190_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9441 | 21 | 195 | 3.30.420.10 |
| af_Q17819_4_192_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9431 | 21 | 196 | 3.30.420.10 |
| af_Q6K4V8_62_244_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9364 | 20 | 196 | 3.30.420.10 |
| 1ytaA00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9199 | 18 | 196 | 3.30.420.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X1BLJ9-F1-model_v4 | Exonuclease domain-containing protein | 0.995 | 20 | 112 |
GO:0000175
GO:0003676 |
| AF-A0A353PFZ1-F1-model_v4 | Oligoribonuclease | 0.9949 | 18 | 115 |
GO:0003676
GO:0004527 GO:0006259 |
| AF-A0A3D2DDW7-F1-model_v4 | deleted | 0.9944 | 18 | 113 |
|
| AF-U6CZQ9-F1-model_v4 | Oligoribonuclease, mitochondrial | 0.9895 | 21 | 113 |
GO:0000175
GO:0003676 GO:0005739 |
| AF-A0A227J347-F1-model_v4 | Oligoribonuclease | 0.9894 | 19 | 99 |
GO:0000175
GO:0003676 GO:0006259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar