F489126

General Info

Members Datasets Scaffolds Average Seq Length
1054 257 2108 143

Family's Representative Sequence

Representative Sequence 3300026095|Ga0207676_11718480|Ga0207676_117184801
Length 175
Sequence MRVSDVMSTDVETVRPDQMVREAARFMLQADAGSIPVTEGNRLVGMITDRDIAVRGVALGYGPDTPVGELMTSGVVSAHADELVEEAARKMGEAQVRRLPVIDNDQRLVGIVSLGDLARETDEDTGSYWLLRYRQWDSDPRMKDGAFLAYRQWLAAFPNHSSVAQAKARLAELRK

Samples

Sample ID Description Type Environment
1 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
115 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
185 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
188 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
195 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
198 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
199 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
200 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
201 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
204 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
205 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
206 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
207 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
208 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
209 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
210 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
211 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
212 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
213 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
214 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
215 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
216 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
217 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
218 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
219 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
220 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
221 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
222 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
223 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
224 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
225 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
226 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
227 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
228 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
229 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
247 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
248 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
249 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
250 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
251 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
252 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
256 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
257 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.96
Metatranscriptomes 1.04
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 4.55
Rhizosphere 95.16
Stem 0
Stem Tuber 0
Unclassified 2.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207676_11718480 3300026095 Unclassified 626
2 JGI24736J21556_1002345 3300001904 Bacteria 3348
3 JGI24752J21851_1002180 3300001976 Bacteria 2615
4 JGI24740J21852_10026932 3300001979 Bacteria 1919
5 JGI24740J21852_10031612 3300001979 Bacteria 1704
6 JGI24739J22299_10005253 3300001989 Bacteria 4934
7 JGI24739J22299_10038074 3300001989 Archaea 1617
8 JGI24737J22298_10001009 3300001990 Bacteria 9974
9 JGI24737J22298_10023149 3300001990 Bacteria 1971
10 JGI24737J22298_10031552 3300001990 Bacteria 1654
11 JGI24737J22298_10040021 3300001990 Archaea 1440
12 JGI24737J22298_10049037 3300001990 Bacteria 1285
13 JGI24743J22301_10002469 3300001991 Bacteria 2790
14 JGI24735J21928_10029930 3300002067 Bacteria 1619
15 JGI24745J21846_1004229 3300002073 Archaea 1531
16 JGI24738J21930_10062290 3300002075 Bacteria 767
17 Ga0058862_12838799 3300004803 Bacteria 684
18 Ga0065715_10192559 3300005293 Bacteria 1406
19 Ga0070658_10007130 3300005327 Bacteria 9023
20 Ga0070658_10056688 3300005327 Bacteria 3185
21 Ga0070658_10085415 3300005327 Bacteria 2595
22 Ga0070658_10132444 3300005327 Bacteria 2078
23 Ga0070658_10160576 3300005327 Bacteria 1885
24 Ga0070658_10165712 3300005327 Bacteria 1855
25 Ga0070658_10250159 3300005327 Bacteria 1504
26 Ga0070658_10698753 3300005327 Bacteria 880
27 Ga0070658_10904313 3300005327 Bacteria 767
28 Ga0070658_11307861 3300005327 Bacteria 630
29 Ga0070676_10123641 3300005328 Bacteria 1627
30 Ga0070676_11134140 3300005328 Bacteria 592
31 Ga0070683_100029243 3300005329 Bacteria 4986
32 Ga0070683_100411323 3300005329 Bacteria 1290
33 Ga0070683_100811123 3300005329 Bacteria 897
34 Ga0070683_100861851 3300005329 Bacteria 869
35 Ga0070683_101446007 3300005329 Bacteria 661
36 Ga0070690_100020417 3300005330 Bacteria 4036
37 Ga0070690_100310300 3300005330 Bacteria 1134
38 Ga0070670_100027960 3300005331 Bacteria 4853
39 Ga0070670_100058375 3300005331 Bacteria 3313
40 Ga0070670_100069108 3300005331 Bacteria 3032
41 Ga0070670_100087831 3300005331 Bacteria 2672
42 Ga0070670_100128434 3300005331 Bacteria 2188
43 Ga0070670_100387676 3300005331 Bacteria 1232
44 Ga0070670_101172108 3300005331 Bacteria 702
45 Ga0070677_10002179 3300005333 Bacteria 6263
46 Ga0070677_10339436 3300005333 Bacteria 775
47 Ga0068869_100040712 3300005334 Bacteria 3324
48 Ga0068869_100414019 3300005334 Bacteria 1111
49 Ga0070666_10153600 3300005335 Bacteria 1606
50 Ga0070666_10279038 3300005335 Bacteria 1187
51 Ga0070666_10596578 3300005335 Bacteria 806
52 Ga0070666_10645487 3300005335 Bacteria 774
53 Ga0070680_100009825 3300005336 Bacteria 7365
54 Ga0070680_101108822 3300005336 Bacteria 684
55 Ga0070682_100044203 3300005337 Bacteria 2757
56 Ga0068868_100006917 3300005338 Bacteria 8059
57 Ga0068868_100031499 3300005338 Bacteria 4074
58 Ga0068868_100075319 3300005338 Bacteria 2697
59 Ga0068868_100127569 3300005338 Bacteria 2080
60 Ga0068868_101061703 3300005338 Bacteria 744
61 Ga0068868_101248379 3300005338 Bacteria 689
62 Ga0070660_100000184 3300005339 Bacteria 41526
63 Ga0070660_100029135 3300005339 Bacteria 4135
64 Ga0070660_100059922 3300005339 Bacteria 2953
65 Ga0070660_100265307 3300005339 Bacteria 1403
66 Ga0070660_100369036 3300005339 Bacteria 1184
67 Ga0070660_100401870 3300005339 Bacteria 1133
68 Ga0070660_100403599 3300005339 Bacteria 1130
69 Ga0070660_100467476 3300005339 Bacteria 1047
70 Ga0070660_100514778 3300005339 Bacteria 996
71 Ga0070660_100539548 3300005339 Bacteria 972
72 Ga0070660_100553295 3300005339 Bacteria 960
73 Ga0070660_100729820 3300005339 Bacteria 831
74 Ga0070660_101645100 3300005339 Bacteria 546
75 Ga0070689_100596885 3300005340 Bacteria 956
76 Ga0070691_10177187 3300005341 Bacteria 1108
77 Ga0070687_100516266 3300005343 Bacteria 807
78 Ga0070661_100009966 3300005344 Bacteria 6592
79 Ga0070661_100015278 3300005344 Bacteria 5419
80 Ga0070661_100023285 3300005344 Bacteria 4438
81 Ga0070661_100032717 3300005344 Bacteria 3765
82 Ga0070661_100034146 3300005344 Bacteria 3688
83 Ga0070661_100036550 3300005344 Bacteria 3570
84 Ga0070661_100039647 3300005344 Bacteria 3433
85 Ga0070661_100098536 3300005344 Bacteria 2171
86 Ga0070661_100143647 3300005344 Bacteria 1800
87 Ga0070661_100703543 3300005344 Bacteria 823
88 Ga0070661_100833958 3300005344 Bacteria 758
89 Ga0070692_10007799 3300005345 Bacteria 4742
90 Ga0070692_10614182 3300005345 Bacteria 721
91 Ga0070668_100116262 3300005347 Bacteria 2133
92 Ga0070668_100460465 3300005347 Bacteria 1095
93 Ga0070668_100842967 3300005347 Bacteria 816
94 Ga0070668_100886839 3300005347 Bacteria 797
95 Ga0070668_101201102 3300005347 Bacteria 687
96 Ga0070669_100017250 3300005353 Bacteria 5150
97 Ga0070669_100080020 3300005353 Bacteria 2431
98 Ga0070669_100093252 3300005353 Bacteria 2261
99 Ga0070669_100480038 3300005353 Bacteria 1028
100 Ga0070675_100014715 3300005354 Bacteria 6172
101 Ga0070675_100082621 3300005354 Bacteria 2680
102 Ga0070675_100148156 3300005354 Bacteria 2011
103 Ga0070675_100272168 3300005354 Bacteria 1486
104 Ga0070675_100300476 3300005354 Bacteria 1414
105 Ga0070675_100637466 3300005354 Bacteria 968
106 Ga0070675_100834318 3300005354 Bacteria 843
107 Ga0070671_100000356 3300005355 Bacteria 31426
108 Ga0070671_100004676 3300005355 Bacteria 10862
109 Ga0070671_100140951 3300005355 Bacteria 2034
110 Ga0070671_100160244 3300005355 Bacteria 1902
111 Ga0070671_100173403 3300005355 Bacteria 1824
112 Ga0070671_100311628 3300005355 Bacteria 1341
113 Ga0070671_100523253 3300005355 Bacteria 1021
114 Ga0070671_101014024 3300005355 Unclassified 727
115 Ga0070671_101098554 3300005355 Unclassified 698
116 Ga0070674_100055109 3300005356 Bacteria 2752
117 Ga0070674_100100759 3300005356 Bacteria 2104
118 Ga0070674_100163233 3300005356 Bacteria 1692
119 Ga0070674_100177754 3300005356 Bacteria 1627
120 Ga0070673_100010659 3300005364 Bacteria 6232
121 Ga0070673_100017044 3300005364 Bacteria 5154
122 Ga0070673_100033380 3300005364 Bacteria 3886
123 Ga0070673_100049587 3300005364 Bacteria 3278
124 Ga0070673_100160989 3300005364 Bacteria 1909
125 Ga0070673_100229502 3300005364 Bacteria 1610
126 Ga0070673_100255665 3300005364 Bacteria 1528
127 Ga0070673_100282114 3300005364 Bacteria 1457
128 Ga0070673_100490346 3300005364 Unclassified 1110
129 Ga0070673_101238899 3300005364 Bacteria 700
130 Ga0070673_101391852 3300005364 Bacteria 660
131 Ga0070659_100001812 3300005366 Bacteria 15374
132 Ga0070659_100006023 3300005366 Bacteria 8743
133 Ga0070659_100027562 3300005366 Bacteria 4379
134 Ga0070659_100052931 3300005366 Bacteria 3194
135 Ga0070659_100160709 3300005366 Bacteria 1836
136 Ga0070659_100337803 3300005366 Bacteria 1261
137 Ga0070659_100359998 3300005366 Bacteria 1222
138 Ga0070659_100521450 3300005366 Bacteria 1014
139 Ga0070659_100523181 3300005366 Bacteria 1013
140 Ga0070659_100638728 3300005366 Bacteria 917
141 Ga0070659_100703751 3300005366 Bacteria 874
142 Ga0070659_100741069 3300005366 Bacteria 852
143 Ga0070659_100765757 3300005366 Bacteria 838
144 Ga0070659_100865511 3300005366 Bacteria 788
145 Ga0070659_100918642 3300005366 Bacteria 766
146 Ga0070667_100003895 3300005367 Bacteria 12670
147 Ga0070667_100045987 3300005367 Bacteria 3671
148 Ga0070667_100072111 3300005367 Bacteria 2942
149 Ga0070667_100082243 3300005367 Bacteria 2757
150 Ga0070667_100296804 3300005367 Bacteria 1454
151 Ga0070667_100355773 3300005367 Bacteria 1326
152 Ga0070667_100383495 3300005367 Bacteria 1277
153 Ga0070667_101579253 3300005367 Bacteria 617
154 Ga0070714_100119467 3300005435 Bacteria 2343
155 Ga0070714_100303980 3300005435 Bacteria 1488
156 Ga0070713_100156673 3300005436 Bacteria 2030
157 Ga0070701_10740617 3300005438 Bacteria 665
158 Ga0070705_100392352 3300005440 Bacteria 1025
159 Ga0070705_100882286 3300005440 Bacteria 718
160 Ga0070694_100003284 3300005444 Bacteria 9666
161 Ga0070663_100005406 3300005455 Bacteria 7588
162 Ga0070663_100027770 3300005455 Bacteria 3846
163 Ga0070663_100041178 3300005455 Bacteria 3238
164 Ga0070663_100069608 3300005455 Bacteria 2557
165 Ga0070663_100073983 3300005455 Bacteria 2486
166 Ga0070663_100102571 3300005455 Bacteria 2137
167 Ga0070663_100108069 3300005455 Bacteria 2086
168 Ga0070663_100223468 3300005455 Bacteria 1479
169 Ga0070663_101440348 3300005455 Bacteria 611
170 Ga0070663_101662167 3300005455 Unclassified 570
171 Ga0070678_100065129 3300005456 Bacteria 2704
172 Ga0070678_100229480 3300005456 Bacteria 1547
173 Ga0070662_100028950 3300005457 Bacteria 3860
174 Ga0070662_100047998 3300005457 Bacteria 3074
175 Ga0070662_100062511 3300005457 Bacteria 2721
176 Ga0070662_100077266 3300005457 Bacteria 2470
177 Ga0070662_100081467 3300005457 Bacteria 2411
178 Ga0070662_100087581 3300005457 Bacteria 2331
179 Ga0070662_100123239 3300005457 Bacteria 1989
180 Ga0070662_100301390 3300005457 Bacteria 1302
181 Ga0070662_100493957 3300005457 Bacteria 1020
182 Ga0070662_100500152 3300005457 Bacteria 1014
183 Ga0070662_100593404 3300005457 Bacteria 931
184 Ga0070662_100613501 3300005457 Bacteria 916
185 Ga0070662_100626823 3300005457 Bacteria 906
186 Ga0070662_100663202 3300005457 Bacteria 881
187 Ga0070681_10193979 3300005458 Bacteria 1950
188 Ga0070681_11031279 3300005458 Unclassified 743
189 Ga0070681_11674403 3300005458 Bacteria 562
190 Ga0068867_100011300 3300005459 Bacteria 6298
191 Ga0068867_100088409 3300005459 Bacteria 2348
192 Ga0068867_100266590 3300005459 Bacteria 1398
193 Ga0068867_100321568 3300005459 Bacteria 1282
194 Ga0070679_100081678 3300005530 Bacteria 3221
195 Ga0070679_100120667 3300005530 Bacteria 2607
196 Ga0070679_100418781 3300005530 Bacteria 1285
197 Ga0070679_100679803 3300005530 Bacteria 972
198 Ga0070684_100005483 3300005535 Bacteria 9721
199 Ga0070684_100046674 3300005535 Bacteria 3753
200 Ga0070684_102056498 3300005535 Bacteria 539
201 Ga0068853_100143460 3300005539 Bacteria 2145
202 Ga0068853_100221892 3300005539 Bacteria 1727
203 Ga0068853_100269563 3300005539 Bacteria 1567
204 Ga0068853_100272797 3300005539 Bacteria 1558
205 Ga0070672_100003275 3300005543 Bacteria 10484
206 Ga0070672_100005294 3300005543 Bacteria 8539
207 Ga0070672_100409028 3300005543 Bacteria 1164
208 Ga0070672_100439634 3300005543 Bacteria 1122
209 Ga0070672_100501021 3300005543 Bacteria 1050
210 Ga0070696_100150097 3300005546 Bacteria 1710
211 Ga0070696_101628618 3300005546 Unclassified 555
212 Ga0070693_100379166 3300005547 Bacteria 975
213 Ga0070693_100739733 3300005547 Bacteria 724
214 Ga0070665_100017694 3300005548 Bacteria 7156
215 Ga0070665_100045299 3300005548 Bacteria 4418
216 Ga0070665_100711817 3300005548 Bacteria 1017
217 Ga0070665_101511739 3300005548 Bacteria 680
218 Ga0068855_100000907 3300005563 Bacteria 36754
219 Ga0068855_100139436 3300005563 Bacteria 2765
220 Ga0068855_100141753 3300005563 Bacteria 2739
221 Ga0068855_100190548 3300005563 Bacteria 2313
222 Ga0068855_100330948 3300005563 Bacteria 1681
223 Ga0068855_100536077 3300005563 Bacteria 1268
224 Ga0070664_100007027 3300005564 Bacteria 9084
225 Ga0070664_100009795 3300005564 Bacteria 7764
226 Ga0070664_100039675 3300005564 Bacteria 3968
227 Ga0070664_100119125 3300005564 Bacteria 2310
228 Ga0070664_100271509 3300005564 Bacteria 1527
229 Ga0070664_100300693 3300005564 Bacteria 1450
230 Ga0070664_100703437 3300005564 Bacteria 942
231 Ga0068857_100008428 3300005577 Bacteria 8909
232 Ga0068857_100021397 3300005577 Bacteria 5693
233 Ga0068857_100067778 3300005577 Bacteria 3176
234 Ga0068857_100131504 3300005577 Bacteria 2257
235 Ga0068857_100138034 3300005577 Bacteria 2202
236 Ga0068857_100138632 3300005577 Bacteria 2198
237 Ga0068857_101127333 3300005577 Bacteria 758
238 Ga0068854_100004790 3300005578 Bacteria 8534
239 Ga0068854_100029968 3300005578 Bacteria 3772
240 Ga0068854_100035098 3300005578 Bacteria 3509
241 Ga0068854_100057261 3300005578 Bacteria 2811
242 Ga0068854_100116654 3300005578 Bacteria 2021
243 Ga0068854_100270635 3300005578 Bacteria 1364
244 Ga0068854_100307484 3300005578 Bacteria 1285
245 Ga0068854_100452823 3300005578 Bacteria 1072
246 Ga0068854_100464657 3300005578 Bacteria 1059
247 Ga0068854_101495997 3300005578 Bacteria 613
248 Ga0068854_101758755 3300005578 Bacteria 568
249 Ga0068856_100085899 3300005614 Bacteria 3126
250 Ga0068856_100128962 3300005614 Bacteria 2533
251 Ga0068856_100298110 3300005614 Bacteria 1629
252 Ga0068856_100322927 3300005614 Bacteria 1561
253 Ga0068856_100859178 3300005614 Bacteria 926
254 Ga0070702_101171033 3300005615 Bacteria 618
255 Ga0068852_100023861 3300005616 Bacteria 4932
256 Ga0068852_100046560 3300005616 Bacteria 3697
257 Ga0068852_100058884 3300005616 Bacteria 3329
258 Ga0068852_100178445 3300005616 Bacteria 1995
259 Ga0068852_100207491 3300005616 Bacteria 1857
260 Ga0068852_100299799 3300005616 Bacteria 1555
261 Ga0068852_100349352 3300005616 Bacteria 1444
262 Ga0068852_100398442 3300005616 Unclassified 1354
263 Ga0068852_100621566 3300005616 Bacteria 1086
264 Ga0068852_101138551 3300005616 Bacteria 801
265 Ga0068859_100000689 3300005617 Bacteria 33880
266 Ga0068859_100067080 3300005617 Bacteria 3623
267 Ga0068859_100188658 3300005617 Bacteria 2145
268 Ga0068864_100000713 3300005618 Bacteria 27896
269 Ga0068864_100015969 3300005618 Bacteria 6247
270 Ga0068864_100058944 3300005618 Bacteria 3320
271 Ga0068864_100235568 3300005618 Bacteria 1694
272 Ga0068864_100768552 3300005618 Bacteria 945
273 Ga0068864_100970527 3300005618 Bacteria 842
274 Ga0068866_10053249 3300005718 Bacteria 2068
275 Ga0068866_10189106 3300005718 Bacteria 1222
276 Ga0068866_10704752 3300005718 Bacteria 693
277 Ga0068851_10017873 3300005834 Bacteria 3413
278 Ga0068870_10230465 3300005840 Archaea 1138
279 Ga0068863_100002105 3300005841 Bacteria 19733
280 Ga0068863_100003894 3300005841 Bacteria 14746
281 Ga0068863_100010452 3300005841 Bacteria 9022
282 Ga0068863_100063695 3300005841 Bacteria 3487
283 Ga0068863_100141262 3300005841 Bacteria 2301
284 Ga0068863_100272534 3300005841 Bacteria 1638
285 Ga0068863_101182694 3300005841 Bacteria 770
286 Ga0068863_101499966 3300005841 Bacteria 683
287 Ga0068858_100001407 3300005842 Bacteria 24703
288 Ga0068858_100026940 3300005842 Bacteria 5339
289 Ga0068858_100204830 3300005842 Bacteria 1866
290 Ga0068858_100223323 3300005842 Bacteria 1785
291 Ga0068858_100540512 3300005842 Bacteria 1128
292 Ga0068858_101923498 3300005842 Bacteria 585
293 Ga0068860_100009287 3300005843 Bacteria 9771
294 Ga0068860_100030028 3300005843 Bacteria 5227
295 Ga0068860_100059291 3300005843 Bacteria 3639
296 Ga0068860_100090511 3300005843 Bacteria 2914
297 Ga0068860_100180292 3300005843 Bacteria 2041
298 Ga0068862_100025302 3300005844 Bacteria 4983
299 Ga0068862_100041175 3300005844 Bacteria 3930
300 Ga0068862_100243636 3300005844 Bacteria 1636
301 Ga0068862_100262382 3300005844 Bacteria 1577
302 Ga0068862_100523479 3300005844 Bacteria 1129
303 Ga0081539_10042892 3300005985 Bacteria 2629
304 Ga0070717_10157349 3300006028 Bacteria 1969
305 Ga0070716_100289603 3300006173 Bacteria 1134
306 Ga0070712_100012687 3300006175 Bacteria 5364
307 Ga0075366_10068545 3300006195 Bacteria 2111
308 Ga0097621_100012388 3300006237 Bacteria 6319
309 Ga0097621_100124412 3300006237 Bacteria 2189
310 Ga0097621_100468800 3300006237 Bacteria 1137
311 Ga0097621_100841155 3300006237 Bacteria 852
312 Ga0068871_100088923 3300006358 Bacteria 2571
313 Ga0068871_100349173 3300006358 Bacteria 1308
314 Ga0068871_100765934 3300006358 Bacteria 888
315 Ga0068871_101665658 3300006358 Bacteria 605
316 Ga0075431_101600645 3300006847 Bacteria 609
317 Ga0075433_10013427 3300006852 Bacteria 6659
318 Ga0075434_101780204 3300006871 Bacteria 623
319 Ga0075429_100311560 3300006880 Bacteria 1378
320 Ga0068865_100028250 3300006881 Bacteria 3712
321 Ga0068865_100369286 3300006881 Bacteria 1167
322 Ga0097620_100000689 3300006931 Bacteria 33880
323 Ga0097620_100067080 3300006931 Bacteria 3623
324 Ga0097620_100188656 3300006931 Bacteria 2145
325 Ga0105251_10061781 3300009011 Bacteria 1760
326 Ga0105250_10009409 3300009092 Bacteria 4116
327 Ga0105240_10061483 3300009093 Bacteria 4680
328 Ga0105240_10079134 3300009093 Bacteria 4046
329 Ga0105240_10248473 3300009093 Bacteria 2059
330 Ga0105240_10783469 3300009093 Bacteria 1034
331 Ga0111539_10188732 3300009094 Bacteria 2406
332 Ga0111539_12770693 3300009094 Bacteria 568
333 Ga0105245_10198934 3300009098 Bacteria 1923
334 Ga0105245_10425170 3300009098 Bacteria 1332
335 Ga0105243_10115062 3300009148 Bacteria 2258
336 Ga0105243_10636222 3300009148 Bacteria 1032
337 Ga0105243_10661282 3300009148 Bacteria 1014
338 Ga0105243_10819672 3300009148 Bacteria 919
339 Ga0105243_11040238 3300009148 Bacteria 824
340 Ga0105243_13057682 3300009148 Bacteria 507
341 Ga0105241_10531542 3300009174 Bacteria 1053
342 Ga0105242_10439443 3300009176 Unclassified 1227
343 Ga0105248_10001002 3300009177 Bacteria 31241
344 Ga0105248_10001965 3300009177 Bacteria 22859
345 Ga0105248_10047463 3300009177 Bacteria 4816
346 Ga0105248_10052676 3300009177 Bacteria 4567
347 Ga0105248_10093908 3300009177 Bacteria 3378
348 Ga0105248_10345628 3300009177 Bacteria 1675
349 Ga0105237_10027499 3300009545 Bacteria 5805
350 Ga0105238_10021856 3300009551 Bacteria 6517
351 Ga0105238_10110411 3300009551 Bacteria 2730
352 Ga0105238_12233605 3300009551 Bacteria 582
353 Ga0105249_10001380 3300009553 Bacteria 21246
354 Ga0105249_10012623 3300009553 Bacteria 7449
355 Ga0105249_10070687 3300009553 Bacteria 3223
356 Ga0105249_10994936 3300009553 Bacteria 907
357 Ga0105249_11029201 3300009553 Bacteria 893
358 Ga0105032_101608 3300009979 Bacteria 2050
359 Ga0105239_10286361 3300010375 Bacteria 1855
360 Ga0105239_10618303 3300010375 Bacteria 1236
361 Ga0105239_11249713 3300010375 Bacteria 856
362 Ga0105246_10167031 3300011119 Archaea 1682
363 Ga0105246_10242977 3300011119 Bacteria 1424
364 Ga0105246_10538569 3300011119 Bacteria 998
365 Ga0157373_10006351 3300013100 Bacteria 8827
366 Ga0157373_10096027 3300013100 Bacteria 2087
367 Ga0157373_10141424 3300013100 Bacteria 1693
368 Ga0157373_10157284 3300013100 Bacteria 1599
369 Ga0157373_10203749 3300013100 Bacteria 1395
370 Ga0157373_10303603 3300013100 Bacteria 1133
371 Ga0157373_10316026 3300013100 Bacteria 1110
372 Ga0157373_10499057 3300013100 Bacteria 879
373 Ga0157373_10562940 3300013100 Bacteria 827
374 Ga0157373_10727876 3300013100 Bacteria 728
375 Ga0157371_10000705 3300013102 Bacteria 39219
376 Ga0157371_10051798 3300013102 Bacteria 2916
377 Ga0157371_10102762 3300013102 Bacteria 2028
378 Ga0157371_10105846 3300013102 Bacteria 1996
379 Ga0157371_10119843 3300013102 Bacteria 1870
380 Ga0157371_10146843 3300013102 Bacteria 1681
381 Ga0157371_10156703 3300013102 Bacteria 1625
382 Ga0157371_10170900 3300013102 Bacteria 1553
383 Ga0157371_10457735 3300013102 Bacteria 939
384 Ga0157371_10686723 3300013102 Bacteria 766
385 Ga0157371_10827575 3300013102 Bacteria 699
386 Ga0157370_10000534 3300013104 Bacteria 47653
387 Ga0157370_10103483 3300013104 Bacteria 2665
388 Ga0157370_10234792 3300013104 Bacteria 1697
389 Ga0157370_10380558 3300013104 Bacteria 1300
390 Ga0157370_10476381 3300013104 Bacteria 1147
391 Ga0157370_10491947 3300013104 Bacteria 1127
392 Ga0157370_10539245 3300013104 Bacteria 1070
393 Ga0157370_10775835 3300013104 Bacteria 873
394 Ga0157369_10065712 3300013105 Bacteria 3903
395 Ga0157369_10119236 3300013105 Bacteria 2800
396 Ga0157369_10199985 3300013105 Bacteria 2098
397 Ga0157369_10233006 3300013105 Bacteria 1925
398 Ga0157369_10291293 3300013105 Bacteria 1699
399 Ga0157369_11746073 3300013105 Bacteria 632
400 Ga0157374_10012083 3300013296 Bacteria 7498
401 Ga0157374_10258616 3300013296 Bacteria 1714
402 Ga0157374_10393620 3300013296 Bacteria 1381
403 Ga0157378_10063086 3300013297 Bacteria 3310
404 Ga0157378_10142848 3300013297 Bacteria 2224
405 Ga0163162_10019524 3300013306 Bacteria 6651
406 Ga0163162_10030175 3300013306 Bacteria 5372
407 Ga0163162_10069109 3300013306 Bacteria 3584
408 Ga0157372_10264048 3300013307 Bacteria 1999
409 Ga0157372_10270333 3300013307 Bacteria 1975
410 Ga0157372_10453449 3300013307 Bacteria 1494
411 Ga0157372_10695660 3300013307 Bacteria 1183
412 Ga0157372_10713030 3300013307 Bacteria 1167
413 Ga0157375_10007560 3300013308 Bacteria 9501
414 Ga0157375_10033612 3300013308 Bacteria 4875
415 Ga0157375_10484861 3300013308 Bacteria 1401
416 Ga0163163_10000991 3300014325 Bacteria 24023
417 Ga0163163_10013315 3300014325 Bacteria 7526
418 Ga0163163_10119353 3300014325 Bacteria 2670
419 Ga0163163_10120330 3300014325 Bacteria 2659
420 Ga0163163_10940964 3300014325 Bacteria 927
421 Ga0157380_10127608 3300014326 Bacteria 2165
422 Ga0157380_11268354 3300014326 Bacteria 783
423 Ga0182008_10591134 3300014497 Bacteria 622
424 Ga0157377_10021411 3300014745 Bacteria 3401
425 Ga0157379_10001787 3300014968 Bacteria 17755
426 Ga0157379_10006649 3300014968 Bacteria 9978
427 Ga0157379_10032029 3300014968 Bacteria 4685
428 Ga0197907_10005564 3300020069 Bacteria 788
429 Ga0197907_11430954 3300020069 Bacteria 561
430 Ga0206355_1312482 3300020076 Bacteria 513
431 Ga0206355_1510024 3300020076 Bacteria 568
432 Ga0206351_10097986 3300020077 Bacteria 524
433 Ga0206352_10904873 3300020078 Bacteria 591
434 Ga0206354_10113205 3300020081 Bacteria 550
435 Ga0206354_10113898 3300020081 Bacteria 585
436 Ga0206353_10453748 3300020082 Bacteria 1933
437 Ga0206353_11652008 3300020082 Bacteria 595
438 Ga0207673_1023215 3300025290 Bacteria 844
439 Ga0207697_10011949 3300025315 Bacteria 3656
440 Ga0207656_10227505 3300025321 Bacteria 908
441 Ga0207696_1016165 3300025711 Bacteria 2504
442 Ga0207713_1116360 3300025735 Bacteria 902
443 Ga0207682_10003183 3300025893 Bacteria 7189
444 Ga0207682_10039671 3300025893 Bacteria 1915
445 Ga0207682_10090606 3300025893 Bacteria 1325
446 Ga0207642_10238105 3300025899 Bacteria 1026
447 Ga0207642_10442379 3300025899 Bacteria 786
448 Ga0207642_10492556 3300025899 Bacteria 749
449 Ga0207688_10081307 3300025901 Bacteria 1851
450 Ga0207688_10134725 3300025901 Bacteria 1450
451 Ga0207680_10000271 3300025903 Bacteria 24747
452 Ga0207680_10090477 3300025903 Bacteria 1945
453 Ga0207680_10233149 3300025903 Bacteria 1266
454 Ga0207680_10280730 3300025903 Bacteria 1157
455 Ga0207680_11225876 3300025903 Bacteria 535
456 Ga0207647_10001771 3300025904 Bacteria 16572
457 Ga0207647_10002227 3300025904 Bacteria 14775
458 Ga0207647_10014477 3300025904 Bacteria 5436
459 Ga0207647_10016675 3300025904 Bacteria 5007
460 Ga0207647_10054852 3300025904 Bacteria 2451
461 Ga0207647_10070781 3300025904 Bacteria 2106
462 Ga0207647_10096939 3300025904 Bacteria 1754
463 Ga0207647_10142100 3300025904 Bacteria 1407
464 Ga0207647_10143982 3300025904 Bacteria 1396
465 Ga0207647_10149030 3300025904 Bacteria 1368
466 Ga0207647_10158528 3300025904 Bacteria 1321
467 Ga0207645_10112352 3300025907 Bacteria 1764
468 Ga0207705_10000050 3300025909 Bacteria 170078
469 Ga0207705_10001324 3300025909 Bacteria 19811
470 Ga0207705_10001792 3300025909 Bacteria 16928
471 Ga0207705_10001951 3300025909 Bacteria 16098
472 Ga0207705_10001965 3300025909 Bacteria 16037
473 Ga0207705_10018413 3300025909 Bacteria 4995
474 Ga0207705_10037361 3300025909 Bacteria 3475
475 Ga0207705_10042036 3300025909 Bacteria 3281
476 Ga0207705_10076673 3300025909 Bacteria 2431
477 Ga0207705_10094160 3300025909 Bacteria 2196
478 Ga0207705_10095791 3300025909 Bacteria 2178
479 Ga0207705_10175221 3300025909 Bacteria 1616
480 Ga0207705_10187664 3300025909 Bacteria 1562
481 Ga0207705_10191241 3300025909 Bacteria 1548
482 Ga0207705_10440127 3300025909 Bacteria 1010
483 Ga0207705_10801569 3300025909 Unclassified 731
484 Ga0207705_11098258 3300025909 Bacteria 613
485 Ga0207654_10631216 3300025911 Bacteria 766
486 Ga0207707_10006787 3300025912 Bacteria 9990
487 Ga0207707_10026570 3300025912 Bacteria 5060
488 Ga0207707_10222281 3300025912 Bacteria 1644
489 Ga0207707_10398533 3300025912 Bacteria 1182
490 Ga0207707_10874301 3300025912 Bacteria 744
491 Ga0207695_10045313 3300025913 Bacteria 4669
492 Ga0207695_10045822 3300025913 Bacteria 4639
493 Ga0207695_10264273 3300025913 Bacteria 1618
494 Ga0207695_11004942 3300025913 Bacteria 714
495 Ga0207671_10111965 3300025914 Bacteria 2077
496 Ga0207693_10016182 3300025915 Bacteria 5964
497 Ga0207660_10005638 3300025917 Bacteria 8128
498 Ga0207660_10300847 3300025917 Bacteria 1277
499 Ga0207662_10298907 3300025918 Bacteria 1069
500 Ga0207657_10000210 3300025919 Bacteria 60425
501 Ga0207657_10000301 3300025919 Bacteria 52361
502 Ga0207657_10002057 3300025919 Bacteria 21773
503 Ga0207657_10007540 3300025919 Bacteria 11152
504 Ga0207657_10009014 3300025919 Bacteria 10077
505 Ga0207657_10009396 3300025919 Bacteria 9834
506 Ga0207657_10031796 3300025919 Bacteria 4774
507 Ga0207657_10176834 3300025919 Bacteria 1727
508 Ga0207657_10327980 3300025919 Bacteria 1209
509 Ga0207657_10397703 3300025919 Bacteria 1084
510 Ga0207657_10416635 3300025919 Bacteria 1056
511 Ga0207657_10431972 3300025919 Bacteria 1034
512 Ga0207657_10827109 3300025919 Bacteria 715
513 Ga0207657_11009495 3300025919 Bacteria 638
514 Ga0207649_10003557 3300025920 Bacteria 8514
515 Ga0207649_10008987 3300025920 Bacteria 5459
516 Ga0207649_10029663 3300025920 Bacteria 3232
517 Ga0207649_10084366 3300025920 Bacteria 2065
518 Ga0207649_10110203 3300025920 Bacteria 1838
519 Ga0207649_10110568 3300025920 Bacteria 1835
520 Ga0207649_10257187 3300025920 Bacteria 1260
521 Ga0207649_10840886 3300025920 Bacteria 718
522 Ga0207652_10011268 3300025921 Bacteria 7203
523 Ga0207652_10075220 3300025921 Bacteria 2943
524 Ga0207652_10114125 3300025921 Bacteria 2398
525 Ga0207652_10280047 3300025921 Bacteria 1504
526 Ga0207652_10788681 3300025921 Bacteria 844
527 Ga0207652_10876776 3300025921 Bacteria 794
528 Ga0207652_11672754 3300025921 Bacteria 541
529 Ga0207681_10048622 3300025923 Bacteria 2863
530 Ga0207681_10078376 3300025923 Bacteria 2325
531 Ga0207681_10083421 3300025923 Bacteria 2262
532 Ga0207681_10092182 3300025923 Bacteria 2166
533 Ga0207681_10309049 3300025923 Bacteria 1253
534 Ga0207681_11200348 3300025923 Bacteria 637
535 Ga0207694_10058635 3300025924 Bacteria 2995
536 Ga0207694_10602261 3300025924 Bacteria 924
537 Ga0207650_10013566 3300025925 Bacteria 5644
538 Ga0207650_10266825 3300025925 Unclassified 1390
539 Ga0207650_10489652 3300025925 Bacteria 1027
540 Ga0207650_10581288 3300025925 Bacteria 941
541 Ga0207659_10011067 3300025926 Bacteria 5687
542 Ga0207659_10045121 3300025926 Bacteria 3105
543 Ga0207659_10048892 3300025926 Bacteria 2997
544 Ga0207659_10220438 3300025926 Bacteria 1525
545 Ga0207659_10520351 3300025926 Bacteria 1009
546 Ga0207687_10089967 3300025927 Bacteria 2236
547 Ga0207700_10064810 3300025928 Bacteria 2785
548 Ga0207664_10199825 3300025929 Bacteria 1725
549 Ga0207644_10000794 3300025931 Bacteria 20032
550 Ga0207644_10008227 3300025931 Bacteria 6832
551 Ga0207644_10024783 3300025931 Bacteria 4121
552 Ga0207644_10054771 3300025931 Bacteria 2873
553 Ga0207644_10071851 3300025931 Bacteria 2532
554 Ga0207644_10132821 3300025931 Bacteria 1908
555 Ga0207644_10235812 3300025931 Bacteria 1455
556 Ga0207644_10355786 3300025931 Bacteria 1190
557 Ga0207644_11554536 3300025931 Bacteria 555
558 Ga0207690_10001735 3300025932 Bacteria 13389
559 Ga0207690_10008620 3300025932 Bacteria 6048
560 Ga0207690_10088788 3300025932 Bacteria 2178
561 Ga0207690_10166568 3300025932 Bacteria 1647
562 Ga0207690_10321390 3300025932 Bacteria 1217
563 Ga0207690_10392999 3300025932 Bacteria 1104
564 Ga0207690_10437875 3300025932 Bacteria 1048
565 Ga0207690_10479268 3300025932 Bacteria 1004
566 Ga0207690_10895745 3300025932 Bacteria 736
567 Ga0207690_11054466 3300025932 Unclassified 677
568 Ga0207690_11180462 3300025932 Bacteria 639
569 Ga0207706_10000675 3300025933 Bacteria 35813
570 Ga0207706_10001971 3300025933 Bacteria 20129
571 Ga0207706_10015533 3300025933 Bacteria 6879
572 Ga0207706_10015844 3300025933 Bacteria 6816
573 Ga0207706_10024853 3300025933 Bacteria 5369
574 Ga0207706_10035232 3300025933 Bacteria 4451
575 Ga0207706_10048449 3300025933 Bacteria 3758
576 Ga0207706_10337117 3300025933 Bacteria 1312
577 Ga0207706_10473450 3300025933 Bacteria 1082
578 Ga0207706_10481125 3300025933 Bacteria 1073
579 Ga0207706_10488851 3300025933 Bacteria 1063
580 Ga0207706_10500420 3300025933 Bacteria 1049
581 Ga0207706_10625045 3300025933 Bacteria 924
582 Ga0207706_10730781 3300025933 Bacteria 844
583 Ga0207686_10224807 3300025934 Bacteria 1357
584 Ga0207686_10349466 3300025934 Unclassified 1113
585 Ga0207669_10158254 3300025937 Bacteria 1596
586 Ga0207669_10222015 3300025937 Bacteria 1387
587 Ga0207669_10225446 3300025937 Bacteria 1379
588 Ga0207669_10959213 3300025937 Bacteria 717
589 Ga0207704_10484002 3300025938 Bacteria 994
590 Ga0207665_10180217 3300025939 Bacteria 1530
591 Ga0207691_10003690 3300025940 Bacteria 14849
592 Ga0207691_10014594 3300025940 Bacteria 7488
593 Ga0207691_10016405 3300025940 Bacteria 7033
594 Ga0207691_10172024 3300025940 Bacteria 1896
595 Ga0207711_10000044 3300025941 Bacteria 157113
596 Ga0207711_10000823 3300025941 Bacteria 30322
597 Ga0207711_10037413 3300025941 Bacteria 4122
598 Ga0207711_10116326 3300025941 Bacteria 2384
599 Ga0207711_10209272 3300025941 Bacteria 1781
600 Ga0207711_10236332 3300025941 Bacteria 1675
601 Ga0207711_10575085 3300025941 Bacteria 1051
602 Ga0207711_11970198 3300025941 Bacteria 527
603 Ga0207689_10009583 3300025942 Bacteria 8352
604 Ga0207689_10530192 3300025942 Bacteria 988
605 Ga0207689_10641054 3300025942 Bacteria 895
606 Ga0207661_10307010 3300025944 Bacteria 1423
607 Ga0207661_10357893 3300025944 Bacteria 1318
608 Ga0207661_11124200 3300025944 Bacteria 723
609 Ga0207679_10003346 3300025945 Bacteria 9903
610 Ga0207679_10012302 3300025945 Bacteria 5576
611 Ga0207679_10028900 3300025945 Bacteria 3855
612 Ga0207679_10044415 3300025945 Bacteria 3206
613 Ga0207679_10083793 3300025945 Bacteria 2445
614 Ga0207679_10114027 3300025945 Bacteria 2139
615 Ga0207679_10199399 3300025945 Bacteria 1671
616 Ga0207679_10255163 3300025945 Bacteria 1493
617 Ga0207679_10372985 3300025945 Bacteria 1249
618 Ga0207679_10410681 3300025945 Bacteria 1193
619 Ga0207679_10419510 3300025945 Bacteria 1181
620 Ga0207679_10775502 3300025945 Bacteria 873
621 Ga0207679_10920042 3300025945 Bacteria 800
622 Ga0207667_10000327 3300025949 Bacteria 66205
623 Ga0207667_10032612 3300025949 Bacteria 5610
624 Ga0207667_10060365 3300025949 Bacteria 3969
625 Ga0207667_10111498 3300025949 Bacteria 2822
626 Ga0207667_10118664 3300025949 Bacteria 2726
627 Ga0207667_10126753 3300025949 Bacteria 2630
628 Ga0207667_10780530 3300025949 Bacteria 953
629 Ga0207651_10006297 3300025960 Bacteria 6191
630 Ga0207651_10044094 3300025960 Bacteria 2982
631 Ga0207651_10055402 3300025960 Bacteria 2723
632 Ga0207651_10080673 3300025960 Bacteria 2343
633 Ga0207651_10260821 3300025960 Bacteria 1423
634 Ga0207651_10390576 3300025960 Archaea 1181
635 Ga0207651_10400407 3300025960 Bacteria 1167
636 Ga0207651_10555610 3300025960 Unclassified 999
637 Ga0207651_11471691 3300025960 Bacteria 613
638 Ga0207712_10000146 3300025961 Bacteria 73378
639 Ga0207712_10006709 3300025961 Bacteria 7258
640 Ga0207712_10367875 3300025961 Bacteria 1200
641 Ga0207712_11265996 3300025961 Bacteria 659
642 Ga0207668_10225927 3300025972 Bacteria 1506
643 Ga0207668_10350441 3300025972 Bacteria 1234
644 Ga0207668_10847616 3300025972 Bacteria 811
645 Ga0207668_11039357 3300025972 Bacteria 733
646 Ga0207640_10015002 3300025981 Bacteria 4474
647 Ga0207640_10016771 3300025981 Bacteria 4269
648 Ga0207640_10018099 3300025981 Bacteria 4133
649 Ga0207640_10021579 3300025981 Bacteria 3841
650 Ga0207640_10050953 3300025981 Bacteria 2689
651 Ga0207640_10494233 3300025981 Bacteria 1017
652 Ga0207640_11104451 3300025981 Bacteria 702
653 Ga0207640_11129353 3300025981 Bacteria 694
654 Ga0207640_11939546 3300025981 Bacteria 533
655 Ga0207658_10002505 3300025986 Bacteria 13372
656 Ga0207658_10008803 3300025986 Bacteria 6852
657 Ga0207658_10055747 3300025986 Bacteria 2930
658 Ga0207658_10065598 3300025986 Bacteria 2727
659 Ga0207658_10170805 3300025986 Bacteria 1791
660 Ga0207658_10184356 3300025986 Bacteria 1730
661 Ga0207658_10949514 3300025986 Bacteria 784
662 Ga0207677_10044492 3300026023 Bacteria 2959
663 Ga0207677_10079209 3300026023 Bacteria 2349
664 Ga0207677_10260941 3300026023 Archaea 1412
665 Ga0207677_11011966 3300026023 Bacteria 754
666 Ga0207703_10000661 3300026035 Bacteria 34492
667 Ga0207703_10001894 3300026035 Bacteria 18548
668 Ga0207703_10183319 3300026035 Bacteria 1849
669 Ga0207703_10204413 3300026035 Bacteria 1757
670 Ga0207703_10344153 3300026035 Bacteria 1371
671 Ga0207703_10474269 3300026035 Bacteria 1172
672 Ga0207639_10032745 3300026041 Bacteria 3829
673 Ga0207639_10106569 3300026041 Bacteria 2275
674 Ga0207639_10164791 3300026041 Bacteria 1871
675 Ga0207639_10629087 3300026041 Bacteria 991
676 Ga0207639_11264474 3300026041 Bacteria 693
677 Ga0207678_10002367 3300026067 Bacteria 17102
678 Ga0207678_10005390 3300026067 Bacteria 11460
679 Ga0207678_10006909 3300026067 Bacteria 10069
680 Ga0207678_10030207 3300026067 Bacteria 4730
681 Ga0207678_10032095 3300026067 Bacteria 4578
682 Ga0207678_10061471 3300026067 Bacteria 3231
683 Ga0207678_10084615 3300026067 Bacteria 2712
684 Ga0207678_10384510 3300026067 Bacteria 1213
685 Ga0207678_10871676 3300026067 Bacteria 796
686 Ga0207678_11412370 3300026067 Unclassified 615
687 Ga0207702_10005600 3300026078 Bacteria 10963
688 Ga0207702_10041421 3300026078 Bacteria 3862
689 Ga0207702_10042227 3300026078 Bacteria 3825
690 Ga0207702_10120007 3300026078 Bacteria 2352
691 Ga0207702_10229291 3300026078 Bacteria 1735
692 Ga0207702_10273794 3300026078 Bacteria 1593
693 Ga0207702_10600662 3300026078 Bacteria 1080
694 Ga0207702_10624732 3300026078 Bacteria 1058
695 Ga0207641_10001621 3300026088 Bacteria 21953
696 Ga0207641_10071552 3300026088 Bacteria 2983
697 Ga0207641_10114881 3300026088 Bacteria 2392
698 Ga0207641_10148096 3300026088 Bacteria 2124
699 Ga0207641_10286008 3300026088 Bacteria 1552
700 Ga0207641_10368892 3300026088 Bacteria 1372
701 Ga0207641_10961139 3300026088 Bacteria 850
702 Ga0207641_11548404 3300026088 Bacteria 665
703 Ga0207648_10032359 3300026089 Bacteria 4618
704 Ga0207648_10350174 3300026089 Bacteria 1331
705 Ga0207648_10501809 3300026089 Bacteria 1110
706 Ga0207676_10000446 3300026095 Bacteria 34960
707 Ga0207676_10026462 3300026095 Bacteria 4315
708 Ga0207676_10052186 3300026095 Bacteria 3195
709 Ga0207676_10546423 3300026095 Bacteria 1106
710 Ga0207676_10592705 3300026095 Bacteria 1064
711 Ga0207676_10859188 3300026095 Bacteria 888
712 Ga0207674_10000308 3300026116 Bacteria 62120
713 Ga0207674_10002878 3300026116 Bacteria 21384
714 Ga0207674_10006480 3300026116 Bacteria 13763
715 Ga0207674_10025620 3300026116 Bacteria 6282
716 Ga0207674_10103502 3300026116 Bacteria 2826
717 Ga0207674_10116548 3300026116 Bacteria 2642
718 Ga0207674_10127343 3300026116 Bacteria 2511
719 Ga0207674_10472048 3300026116 Bacteria 1213
720 Ga0207674_10919528 3300026116 Bacteria 843
721 Ga0207674_11362448 3300026116 Bacteria 679
722 Ga0207675_101169796 3300026118 Unclassified 789
723 Ga0207683_10002606 3300026121 Bacteria 15748
724 Ga0207683_10034988 3300026121 Bacteria 4369
725 Ga0207683_10061392 3300026121 Bacteria 3308
726 Ga0207683_10213397 3300026121 Bacteria 1757
727 Ga0207698_10004660 3300026142 Bacteria 8379
728 Ga0207698_10032766 3300026142 Bacteria 3768
729 Ga0207698_10049154 3300026142 Bacteria 3208
730 Ga0207698_10079832 3300026142 Bacteria 2633
731 Ga0207698_10224845 3300026142 Bacteria 1699
732 Ga0207698_10234926 3300026142 Bacteria 1667
733 Ga0207698_10242880 3300026142 Bacteria 1642
734 Ga0207698_10277442 3300026142 Bacteria 1548
735 Ga0207698_10415312 3300026142 Unclassified 1290
736 Ga0207698_10738627 3300026142 Bacteria 982
737 Ga0207698_11580601 3300026142 Bacteria 671
738 Ga0209971_1139748 3300027682 Bacteria 597
739 Ga0209974_10140707 3300027876 Bacteria 865
740 Ga0209974_10252959 3300027876 Bacteria 663
741 Ga0209974_10315247 3300027876 Bacteria 601
742 Ga0268266_10465426 3300028379 Bacteria 1203
743 Ga0268266_10568339 3300028379 Bacteria 1088
744 Ga0268266_11832716 3300028379 Bacteria 581
745 Ga0268265_10013723 3300028380 Bacteria 5512
746 Ga0268265_10028171 3300028380 Bacteria 4019
747 Ga0268265_10053112 3300028380 Bacteria 3068
748 Ga0268265_10057011 3300028380 Bacteria 2975
749 Ga0268265_10114185 3300028380 Bacteria 2211
750 Ga0268265_10195193 3300028380 Bacteria 1751
751 Ga0268265_10208150 3300028380 Bacteria 1702
752 Ga0268265_10466887 3300028380 Bacteria 1182
753 Ga0268264_10000594 3300028381 Bacteria 43886
754 Ga0268264_10001254 3300028381 Bacteria 24199
755 Ga0268264_10050338 3300028381 Bacteria 3469
756 Ga0268264_10070651 3300028381 Bacteria 2956
757 Ga0268264_10107756 3300028381 Bacteria 2434
758 Ga0268264_12174328 3300028381 Bacteria 563
759 Ga0307408_100029218 3300031548 Bacteria 3817
760 Ga0307408_100228862 3300031548 Bacteria 1521
761 Ga0307408_100464162 3300031548 Bacteria 1101
762 Ga0307408_100820026 3300031548 Bacteria 846
763 Ga0307408_100928536 3300031548 Bacteria 798
764 Ga0307408_101466268 3300031548 Bacteria 644
765 Ga0307408_101930890 3300031548 Bacteria 566
766 Ga0307405_10019031 3300031731 Bacteria 3804
767 Ga0307405_10184163 3300031731 Bacteria 1502
768 Ga0307405_10226295 3300031731 Bacteria 1376
769 Ga0307405_10450387 3300031731 Bacteria 1020
770 Ga0307405_11168305 3300031731 Bacteria 664
771 Ga0307405_11174850 3300031731 Bacteria 663
772 Ga0307413_10226986 3300031824 Bacteria 1368
773 Ga0307413_10523729 3300031824 Bacteria 956
774 Ga0307413_10645523 3300031824 Bacteria 872
775 Ga0307413_10711779 3300031824 Bacteria 835
776 Ga0307410_10005397 3300031852 Bacteria 6759
777 Ga0307410_10022098 3300031852 Bacteria 3926
778 Ga0307410_10332747 3300031852 Bacteria 1208
779 Ga0307410_10361657 3300031852 Bacteria 1162
780 Ga0307410_10545047 3300031852 Bacteria 961
781 Ga0307410_10637718 3300031852 Bacteria 892
782 Ga0307410_11018963 3300031852 Bacteria 715
783 Ga0307406_10047481 3300031901 Bacteria 2706
784 Ga0307406_10281676 3300031901 Bacteria 1268
785 Ga0307406_10426170 3300031901 Bacteria 1058
786 Ga0307407_10110599 3300031903 Unclassified 1724
787 Ga0307407_10934970 3300031903 Bacteria 667
788 Ga0307412_10064621 3300031911 Bacteria 2473
789 Ga0307412_10122268 3300031911 Bacteria 1876
790 Ga0307412_10161984 3300031911 Bacteria 1663
791 Ga0307412_10246847 3300031911 Bacteria 1384
792 Ga0307412_10472845 3300031911 Bacteria 1037
793 Ga0307412_12165495 3300031911 Bacteria 517
794 Ga0307409_100000982 3300031995 Bacteria 13335
795 Ga0307409_100021330 3300031995 Bacteria 4438
796 Ga0307409_100045130 3300031995 Bacteria 3325
797 Ga0307409_100099291 3300031995 Bacteria 2410
798 Ga0307409_100261294 3300031995 Bacteria 1589
799 Ga0307409_100602241 3300031995 Bacteria 1086
800 Ga0307409_100687259 3300031995 Bacteria 1021
801 Ga0307409_101440671 3300031995 Unclassified 715
802 Ga0307409_101997400 3300031995 Bacteria 609
803 Ga0307416_100045474 3300032002 Bacteria 3457
804 Ga0307416_100051508 3300032002 Bacteria 3289
805 Ga0307416_100053084 3300032002 Bacteria 3250
806 Ga0307416_100061594 3300032002 Bacteria 3063
807 Ga0307416_101285361 3300032002 Bacteria 837
808 Ga0307416_103007650 3300032002 Unclassified 564
809 Ga0307414_10003702 3300032004 Bacteria 8196
810 Ga0307414_10822862 3300032004 Bacteria 848
811 Ga0307414_10989896 3300032004 Bacteria 774
812 Ga0307414_11164926 3300032004 Bacteria 713
813 Ga0307411_10001476 3300032005 Bacteria 9660
814 Ga0307411_10027875 3300032005 Bacteria 3425
815 Ga0307411_10046498 3300032005 Bacteria 2799
816 Ga0307411_10154460 3300032005 Bacteria 1710
817 Ga0307411_10217812 3300032005 Bacteria 1479
818 Ga0307415_100058072 3300032126 Bacteria 2662
819 Ga0307415_100064417 3300032126 Bacteria 2550
820 Ga0307415_101068220 3300032126 Bacteria 754
821 Ga0373939_0469325 3300035114 Unclassified 533
822 Ga0373946_0186444 3300035171 Bacteria 987
823 Ga0373931_1018914 3300035691 Bacteria 561
824 Ga0395899_0005982 3300037312 Bacteria 9447
825 Ga0395899_0013068 3300037312 Bacteria 6350
826 Ga0395899_0016719 3300037312 Bacteria 5592
827 Ga0395899_0041445 3300037312 Bacteria 3440
828 Ga0395899_0053982 3300037312 Bacteria 2974
829 Ga0395899_0058987 3300037312 Bacteria 2829
830 Ga0395899_0151885 3300037312 Bacteria 1641
831 Ga0395899_0295214 3300037312 Bacteria 1098
832 Ga0395899_0544275 3300037312 Bacteria 747
833 Ga0395900_0000254 3300037418 Bacteria 83296
834 Ga0395900_0007369 3300037418 Bacteria 11372
835 Ga0395900_0056809 3300037418 Bacteria 4029
836 Ga0395900_0060058 3300037418 Bacteria 3913
837 Ga0395900_0063113 3300037418 Bacteria 3808
838 Ga0395900_0080858 3300037418 Bacteria 3339
839 Ga0395900_0104823 3300037418 Bacteria 2905
840 Ga0395900_0131143 3300037418 Bacteria 2569
841 Ga0395900_0141720 3300037418 Bacteria 2461
842 Ga0395900_0159487 3300037418 Bacteria 2301
843 Ga0395900_0171458 3300037418 Bacteria 2208
844 Ga0395900_0183929 3300037418 Bacteria 2122
845 Ga0395900_0285964 3300037418 Bacteria 1639
846 Ga0395900_0335167 3300037418 Bacteria 1489
847 Ga0395900_0364220 3300037418 Bacteria 1416
848 Ga0395900_0386541 3300037418 Bacteria 1366
849 Ga0395900_0391273 3300037418 Bacteria 1356
850 Ga0395900_0446921 3300037418 Bacteria 1249
851 Ga0395900_0606000 3300037418 Bacteria 1035
852 Ga0395900_1056322 3300037418 Bacteria 730
853 Ga0395900_1258255 3300037418 Bacteria 654
854 Ga0395900_1336393 3300037418 Unclassified 630
855 Ga0395900_1352408 3300037418 Bacteria 626
856 Ga0395900_1593534 3300037418 Bacteria 564
857 Ga0395898_0019860 3300037466 Bacteria 6834
858 Ga0395898_0039150 3300037466 Bacteria 4694
859 Ga0395898_0039524 3300037466 Bacteria 4670
860 Ga0395898_0078565 3300037466 Bacteria 3183
861 Ga0395898_0130906 3300037466 Bacteria 2403
862 Ga0395898_0181301 3300037466 Bacteria 2013
863 Ga0395898_0192203 3300037466 Bacteria 1950
864 Ga0395898_0387576 3300037466 Bacteria 1332
865 Ga0395898_0449243 3300037466 Bacteria 1227
866 Ga0395898_0493812 3300037466 Bacteria 1164
867 Ga0395898_0673127 3300037466 Bacteria 977
868 Ga0395898_0700349 3300037466 Bacteria 955
869 Ga0395898_0760970 3300037466 Bacteria 910
870 Ga0395898_0978525 3300037466 Bacteria 782
871 Ga0395898_1313679 3300037466 Bacteria 652
872 Ga0395905_0000259 3300037471 Bacteria 79396
873 Ga0395905_0001373 3300037471 Bacteria 29537
874 Ga0395905_0001843 3300037471 Bacteria 24471
875 Ga0395905_0002116 3300037471 Bacteria 22546
876 Ga0395905_0002525 3300037471 Bacteria 20191
877 Ga0395905_0005106 3300037471 Bacteria 13488
878 Ga0395905_0008973 3300037471 Bacteria 9813
879 Ga0395905_0009843 3300037471 Bacteria 9318
880 Ga0395905_0016724 3300037471 Bacteria 6971
881 Ga0395905_0038888 3300037471 Bacteria 4462
882 Ga0395905_0068210 3300037471 Bacteria 3331
883 Ga0395905_0074007 3300037471 Bacteria 3193
884 Ga0395905_0090261 3300037471 Bacteria 2872
885 Ga0395905_0105559 3300037471 Bacteria 2645
886 Ga0395905_0121222 3300037471 Bacteria 2458
887 Ga0395905_0123197 3300037471 Bacteria 2437
888 Ga0395905_0156711 3300037471 Bacteria 2142
889 Ga0395905_0165255 3300037471 Bacteria 2079
890 Ga0395905_0171844 3300037471 Bacteria 2036
891 Ga0395905_0176084 3300037471 Bacteria 2008
892 Ga0395905_0208039 3300037471 Bacteria 1833
893 Ga0395905_0213129 3300037471 Bacteria 1809
894 Ga0395905_0215454 3300037471 Bacteria 1798
895 Ga0395905_0241338 3300037471 Bacteria 1688
896 Ga0395905_0586825 3300037471 Bacteria 1016
897 Ga0395905_0651607 3300037471 Bacteria 955
898 Ga0395905_0671691 3300037471 Bacteria 938
899 Ga0395905_0749263 3300037471 Bacteria 879
900 Ga0395905_0812414 3300037471 Bacteria 838
901 Ga0395905_0894131 3300037471 Bacteria 791
902 Ga0395905_0939843 3300037471 Bacteria 767
903 Ga0395905_0963294 3300037471 Bacteria 756
904 Ga0395905_1116376 3300037471 Bacteria 692
905 Ga0436364_0175729 3300037853 Bacteria 836
906 Ga0395901_0000030 3300038443 Bacteria 241916
907 Ga0395901_0002677 3300038443 Bacteria 17972
908 Ga0395901_0042121 3300038443 Bacteria 4733
909 Ga0395901_0054951 3300038443 Bacteria 4140
910 Ga0395901_0055144 3300038443 Bacteria 4132
911 Ga0395901_0055540 3300038443 Bacteria 4118
912 Ga0395901_0065331 3300038443 Bacteria 3788
913 Ga0395901_0077217 3300038443 Bacteria 3476
914 Ga0395901_0094907 3300038443 Bacteria 3125
915 Ga0395901_0100699 3300038443 Bacteria 3031
916 Ga0395901_0126257 3300038443 Bacteria 2688
917 Ga0395901_0128807 3300038443 Bacteria 2660
918 Ga0395901_0144878 3300038443 Bacteria 2497
919 Ga0395901_0172602 3300038443 Bacteria 2268
920 Ga0395901_0193105 3300038443 Bacteria 2135
921 Ga0395901_0250470 3300038443 Bacteria 1845
922 Ga0395901_0307525 3300038443 Bacteria 1642
923 Ga0395901_0451725 3300038443 Bacteria 1314
924 Ga0395901_1092528 3300038443 Bacteria 768
925 Ga0395901_1384078 3300038443 Bacteria 662
926 Ga0395901_1556931 3300038443 Bacteria 615
927 Ga0395901_1644779 3300038443 Bacteria 595
928 Ga0439432_048711 3300042006 Bacteria 1326
929 Ga0439432_090395 3300042006 Bacteria 922
930 Ga0439452_057664 3300042010 Bacteria 876
931 Ga0450920_029769 3300042122 Bacteria 1072
932 Ga0439458_0000003 3300042157 Bacteria 33633
933 Ga0439458_0000100 3300042157 Bacteria 16893
934 Ga0439464_0001273 3300042439 Bacteria 5861
935 Ga0439460_0086825 3300042461 Bacteria 989
936 Ga0466969_0046863 3300044656 Bacteria 2142
937 Ga0466969_0077966 3300044656 Bacteria 1585
938 Ga0466972_0031573 3300044658 Bacteria 2604
939 Ga0466972_0032078 3300044658 Bacteria 2580
940 Ga0466966_0000040 3300044684 Bacteria 97159
941 Ga0466966_0003997 3300044684 Bacteria 9739
942 Ga0466966_0023733 3300044684 Bacteria 4013
943 Ga0466966_0035641 3300044684 Bacteria 3213
944 Ga0466966_0114363 3300044684 Bacteria 1662
945 Ga0466966_0161218 3300044684 Bacteria 1365
946 Ga0466961_0020081 3300044693 Bacteria 4299
947 Ga0466961_0040967 3300044693 Bacteria 2969
948 Ga0466961_0054346 3300044693 Bacteria 2554
949 Ga0466961_0061493 3300044693 Bacteria 2387
950 Ga0466961_0265237 3300044693 Bacteria 1053
951 Ga0466963_0009039 3300044694 Bacteria 5986
952 Ga0466963_0054644 3300044694 Bacteria 2655
953 Ga0466963_0058373 3300044694 Bacteria 2572
954 Ga0466963_0203082 3300044694 Bacteria 1386
955 Ga0466963_0247828 3300044694 Bacteria 1250
956 Ga0466963_0711786 3300044694 Bacteria 708
957 Ga0466964_0007055 3300044706 Bacteria 4203
958 Ga0453684_2468266 3300044712 Bacteria 514
959 Ga0466971_0039340 3300044719 Bacteria 2122
960 Ga0466971_0094072 3300044719 Bacteria 1373
961 Ga0466970_0006716 3300044765 Bacteria 5757
962 Ga0466970_0023232 3300044765 Bacteria 3237
963 Ga0466957_0009860 3300044842 Bacteria 5461
964 Ga0466957_0013721 3300044842 Bacteria 4706
965 Ga0466957_0027323 3300044842 Bacteria 3391
966 Ga0466957_0059908 3300044842 Bacteria 2334
967 Ga0466957_0395786 3300044842 Bacteria 944
968 Ga0466960_0042280 3300044901 Bacteria 2163
969 Ga0466960_0179575 3300044901 Bacteria 1146
970 Ga0466959_0009381 3300045049 Bacteria 6957
971 Ga0466959_0084305 3300045049 Bacteria 2287
972 Ga0466959_0094129 3300045049 Bacteria 2149
973 Ga0466959_0174691 3300045049 Bacteria 1505
974 Ga0466959_0974316 3300045049 Unclassified 565
975 Ga0466958_0010790 3300045836 Bacteria 5127
976 Ga0466958_0024787 3300045836 Bacteria 3530
977 Ga0466958_0050383 3300045836 Bacteria 2521
978 Ga0466958_0290351 3300045836 Bacteria 1049
979 Ga0466958_0638767 3300045836 Bacteria 693
980 Ga0466967_0140202 3300045976 Bacteria 2251
981 Ga0466967_0181116 3300045976 Bacteria 1988
982 Ga0466967_0216114 3300045976 Bacteria 1820
983 Ga0466967_1492801 3300045976 Bacteria 673
984 Ga0495643_0421655 3300046522 Bacteria 585
985 Ga0495663_0102764 3300046525 Bacteria 943
986 Ga0495668_0062198 3300046616 Bacteria 2057
987 Ga0495625_0372400 3300046660 Bacteria 898
988 Ga0495669_0024216 3300046684 Bacteria 2645
989 Ga0495670_0290512 3300046691 Bacteria 875
990 Ga0495677_0224392 3300047445 Bacteria 732
991 Ga0496100_0151100 3300048903 Bacteria 1656
992 Ga0496100_0971693 3300048903 Bacteria 668
993 Ga0496101_0063491 3300048904 Bacteria 2688
994 Ga0496101_0141676 3300048904 Bacteria 1833
995 Ga0496101_0424353 3300048904 Bacteria 1048
996 Ga0496102_0020707 3300048905 Bacteria 5812
997 Ga0496102_0291559 3300048905 Bacteria 1538
998 Ga0496102_0439840 3300048905 Bacteria 1224
999 Ga0496102_0608293 3300048905 Bacteria 1016
1000 Ga0496102_0806358 3300048905 Bacteria 861
1001 Ga0496103_0007362 3300048906 Bacteria 6560
1002 Ga0496104_0166249 3300048907 Bacteria 2116
1003 Ga0496104_0596402 3300048907 Bacteria 1015
1004 Ga0496105_0133648 3300048908 Bacteria 2044
1005 Ga0496106_0016894 3300048909 Bacteria 5401
1006 Ga0496106_0524506 3300048909 Bacteria 951
1007 Ga0496107_0036931 3300048910 Bacteria 3505
1008 Ga0496107_0081166 3300048910 Bacteria 2365
1009 Ga0496107_0106943 3300048910 Bacteria 2055
1010 Ga0496107_0271040 3300048910 Bacteria 1263
1011 Ga0496107_0674672 3300048910 Bacteria 761
1012 Ga0496108_0069017 3300048911 Bacteria 2982
1013 Ga0496108_0071546 3300048911 Bacteria 2926
1014 Ga0496108_0086998 3300048911 Bacteria 2653
1015 Ga0496109_0050692 3300048912 Bacteria 3779
1016 Ga0496109_0075801 3300048912 Bacteria 3092
1017 Ga0496109_0098041 3300048912 Bacteria 2717
1018 Ga0496109_0438934 3300048912 Bacteria 1233
1019 Ga0496109_1758415 3300048912 Bacteria 553
1020 Ga0496110_0002515 3300048913 Bacteria 13774
1021 Ga0496110_0023537 3300048913 Bacteria 5240
1022 Ga0496110_0068362 3300048913 Bacteria 3144
1023 Ga0496111_0000518 3300048914 Bacteria 19932
1024 Ga0496111_0003916 3300048914 Bacteria 9331
1025 Ga0496111_0091805 3300048914 Bacteria 2225
1026 Ga0496111_0604806 3300048914 Bacteria 802
1027 Ga0496112_0003787 3300048915 Bacteria 12636
1028 Ga0496112_0023834 3300048915 Bacteria 5854
1029 Ga0496112_0053964 3300048915 Bacteria 3948
1030 Ga0496112_0179700 3300048915 Bacteria 2080
1031 Ga0496112_0202928 3300048915 Bacteria 1941
1032 Ga0496112_1391113 3300048915 Bacteria 616
1033 Ga0496113_0016888 3300048916 Bacteria 5052
1034 Ga0496113_0067863 3300048916 Bacteria 2705
1035 Ga0496113_0092522 3300048916 Bacteria 2332
1036 Ga0496114_0048078 3300048917 Bacteria 3548
1037 Ga0496115_0000488 3300048918 Bacteria 31339
1038 Ga0496115_0409644 3300048918 Bacteria 1099
1039 Ga0501067_0010970 3300049583 Bacteria 5018
1040 Ga0501067_0419157 3300049583 Bacteria 747
1041 Ga0501069_0770106 3300049585 Unclassified 582
1042 Ga0501070_0141925 3300049586 Bacteria 1983
1043 Ga0501074_0191303 3300049590 Bacteria 1459
1044 Ga0501209_274112 3300049656 Unclassified 529
1045 nmdc:mga03683_186908_c1 3300050489 Bacteria 947
1046 nmdc:mga06r32_548503_c1 3300050510 Bacteria 1130
1047 nmdc:mga08y16_1445317_c1 3300050511 Bacteria 649
1048 nmdc:mga0n895_1392335_c1 3300050512 Bacteria 670
1049 nmdc:mga0n895_577200_c1 3300050512 Bacteria 1128
1050 nmdc:mga0a205_11550_c1 3300050515 Bacteria 8136
1051 Ga0590077_044713 3300059426 Bacteria 989
1052 Ga0466962_0004600 3300061719 Bacteria 6619
1053 Ga0466962_0184642 3300061719 Bacteria 1017
1054 Ga0466962_0211639 3300061719 Bacteria 948
1055 Ga0207676_11718480
1056 JGI24736J21556_1002345
1057 JGI24752J21851_1002180
1058 JGI24740J21852_10026932
1059 JGI24740J21852_10031612
1060 JGI24739J22299_10005253
1061 JGI24739J22299_10038074
1062 JGI24737J22298_10001009
1063 JGI24737J22298_10023149
1064 JGI24737J22298_10031552
1065 JGI24737J22298_10040021
1066 JGI24737J22298_10049037
1067 JGI24743J22301_10002469
1068 JGI24735J21928_10029930
1069 JGI24745J21846_1004229
1070 JGI24738J21930_10062290
1071 Ga0058862_12838799
1072 Ga0065715_10192559
1073 Ga0070658_10007130
1074 Ga0070658_10056688
1075 Ga0070658_10085415
1076 Ga0070658_10132444
1077 Ga0070658_10160576
1078 Ga0070658_10165712
1079 Ga0070658_10250159
1080 Ga0070658_10698753
1081 Ga0070658_10904313
1082 Ga0070658_11307861
1083 Ga0070676_10123641
1084 Ga0070676_11134140
1085 Ga0070683_100029243
1086 Ga0070683_100411323
1087 Ga0070683_100811123
1088 Ga0070683_100861851
1089 Ga0070683_101446007
1090 Ga0070690_100020417
1091 Ga0070690_100310300
1092 Ga0070670_100027960
1093 Ga0070670_100058375
1094 Ga0070670_100069108
1095 Ga0070670_100087831
1096 Ga0070670_100128434
1097 Ga0070670_100387676
1098 Ga0070670_101172108
1099 Ga0070677_10002179
1100 Ga0070677_10339436
1101 Ga0068869_100040712
1102 Ga0068869_100414019
1103 Ga0070666_10153600
1104 Ga0070666_10279038
1105 Ga0070666_10596578
1106 Ga0070666_10645487
1107 Ga0070680_100009825
1108 Ga0070680_101108822
1109 Ga0070682_100044203
1110 Ga0068868_100006917
1111 Ga0068868_100031499
1112 Ga0068868_100075319
1113 Ga0068868_100127569
1114 Ga0068868_101061703
1115 Ga0068868_101248379
1116 Ga0070660_100000184
1117 Ga0070660_100029135
1118 Ga0070660_100059922
1119 Ga0070660_100265307
1120 Ga0070660_100369036
1121 Ga0070660_100401870
1122 Ga0070660_100403599
1123 Ga0070660_100467476
1124 Ga0070660_100514778
1125 Ga0070660_100539548
1126 Ga0070660_100553295
1127 Ga0070660_100729820
1128 Ga0070660_101645100
1129 Ga0070689_100596885
1130 Ga0070691_10177187
1131 Ga0070687_100516266
1132 Ga0070661_100009966
1133 Ga0070661_100015278
1134 Ga0070661_100023285
1135 Ga0070661_100032717
1136 Ga0070661_100034146
1137 Ga0070661_100036550
1138 Ga0070661_100039647
1139 Ga0070661_100098536
1140 Ga0070661_100143647
1141 Ga0070661_100703543
1142 Ga0070661_100833958
1143 Ga0070692_10007799
1144 Ga0070692_10614182
1145 Ga0070668_100116262
1146 Ga0070668_100460465
1147 Ga0070668_100842967
1148 Ga0070668_100886839
1149 Ga0070668_101201102
1150 Ga0070669_100017250
1151 Ga0070669_100080020
1152 Ga0070669_100093252
1153 Ga0070669_100480038
1154 Ga0070675_100014715
1155 Ga0070675_100082621
1156 Ga0070675_100148156
1157 Ga0070675_100272168
1158 Ga0070675_100300476
1159 Ga0070675_100637466
1160 Ga0070675_100834318
1161 Ga0070671_100000356
1162 Ga0070671_100004676
1163 Ga0070671_100140951
1164 Ga0070671_100160244
1165 Ga0070671_100173403
1166 Ga0070671_100311628
1167 Ga0070671_100523253
1168 Ga0070671_101014024
1169 Ga0070671_101098554
1170 Ga0070674_100055109
1171 Ga0070674_100100759
1172 Ga0070674_100163233
1173 Ga0070674_100177754
1174 Ga0070673_100010659
1175 Ga0070673_100017044
1176 Ga0070673_100033380
1177 Ga0070673_100049587
1178 Ga0070673_100160989
1179 Ga0070673_100229502
1180 Ga0070673_100255665
1181 Ga0070673_100282114
1182 Ga0070673_100490346
1183 Ga0070673_101238899
1184 Ga0070673_101391852
1185 Ga0070659_100001812
1186 Ga0070659_100006023
1187 Ga0070659_100027562
1188 Ga0070659_100052931
1189 Ga0070659_100160709
1190 Ga0070659_100337803
1191 Ga0070659_100359998
1192 Ga0070659_100521450
1193 Ga0070659_100523181
1194 Ga0070659_100638728
1195 Ga0070659_100703751
1196 Ga0070659_100741069
1197 Ga0070659_100765757
1198 Ga0070659_100865511
1199 Ga0070659_100918642
1200 Ga0070667_100003895
1201 Ga0070667_100045987
1202 Ga0070667_100072111
1203 Ga0070667_100082243
1204 Ga0070667_100296804
1205 Ga0070667_100355773
1206 Ga0070667_100383495
1207 Ga0070667_101579253
1208 Ga0070714_100119467
1209 Ga0070714_100303980
1210 Ga0070713_100156673
1211 Ga0070701_10740617
1212 Ga0070705_100392352
1213 Ga0070705_100882286
1214 Ga0070694_100003284
1215 Ga0070663_100005406
1216 Ga0070663_100027770
1217 Ga0070663_100041178
1218 Ga0070663_100069608
1219 Ga0070663_100073983
1220 Ga0070663_100102571
1221 Ga0070663_100108069
1222 Ga0070663_100223468
1223 Ga0070663_101440348
1224 Ga0070663_101662167
1225 Ga0070678_100065129
1226 Ga0070678_100229480
1227 Ga0070662_100028950
1228 Ga0070662_100047998
1229 Ga0070662_100062511
1230 Ga0070662_100077266
1231 Ga0070662_100081467
1232 Ga0070662_100087581
1233 Ga0070662_100123239
1234 Ga0070662_100301390
1235 Ga0070662_100493957
1236 Ga0070662_100500152
1237 Ga0070662_100593404
1238 Ga0070662_100613501
1239 Ga0070662_100626823
1240 Ga0070662_100663202
1241 Ga0070681_10193979
1242 Ga0070681_11031279
1243 Ga0070681_11674403
1244 Ga0068867_100011300
1245 Ga0068867_100088409
1246 Ga0068867_100266590
1247 Ga0068867_100321568
1248 Ga0070679_100081678
1249 Ga0070679_100120667
1250 Ga0070679_100418781
1251 Ga0070679_100679803
1252 Ga0070684_100005483
1253 Ga0070684_100046674
1254 Ga0070684_102056498
1255 Ga0068853_100143460
1256 Ga0068853_100221892
1257 Ga0068853_100269563
1258 Ga0068853_100272797
1259 Ga0070672_100003275
1260 Ga0070672_100005294
1261 Ga0070672_100409028
1262 Ga0070672_100439634
1263 Ga0070672_100501021
1264 Ga0070696_100150097
1265 Ga0070696_101628618
1266 Ga0070693_100379166
1267 Ga0070693_100739733
1268 Ga0070665_100017694
1269 Ga0070665_100045299
1270 Ga0070665_100711817
1271 Ga0070665_101511739
1272 Ga0068855_100000907
1273 Ga0068855_100139436
1274 Ga0068855_100141753
1275 Ga0068855_100190548
1276 Ga0068855_100330948
1277 Ga0068855_100536077
1278 Ga0070664_100007027
1279 Ga0070664_100009795
1280 Ga0070664_100039675
1281 Ga0070664_100119125
1282 Ga0070664_100271509
1283 Ga0070664_100300693
1284 Ga0070664_100703437
1285 Ga0068857_100008428
1286 Ga0068857_100021397
1287 Ga0068857_100067778
1288 Ga0068857_100131504
1289 Ga0068857_100138034
1290 Ga0068857_100138632
1291 Ga0068857_101127333
1292 Ga0068854_100004790
1293 Ga0068854_100029968
1294 Ga0068854_100035098
1295 Ga0068854_100057261
1296 Ga0068854_100116654
1297 Ga0068854_100270635
1298 Ga0068854_100307484
1299 Ga0068854_100452823
1300 Ga0068854_100464657
1301 Ga0068854_101495997
1302 Ga0068854_101758755
1303 Ga0068856_100085899
1304 Ga0068856_100128962
1305 Ga0068856_100298110
1306 Ga0068856_100322927
1307 Ga0068856_100859178
1308 Ga0070702_101171033
1309 Ga0068852_100023861
1310 Ga0068852_100046560
1311 Ga0068852_100058884
1312 Ga0068852_100178445
1313 Ga0068852_100207491
1314 Ga0068852_100299799
1315 Ga0068852_100349352
1316 Ga0068852_100398442
1317 Ga0068852_100621566
1318 Ga0068852_101138551
1319 Ga0068859_100000689
1320 Ga0068859_100067080
1321 Ga0068859_100188658
1322 Ga0068864_100000713
1323 Ga0068864_100015969
1324 Ga0068864_100058944
1325 Ga0068864_100235568
1326 Ga0068864_100768552
1327 Ga0068864_100970527
1328 Ga0068866_10053249
1329 Ga0068866_10189106
1330 Ga0068866_10704752
1331 Ga0068851_10017873
1332 Ga0068870_10230465
1333 Ga0068863_100002105
1334 Ga0068863_100003894
1335 Ga0068863_100010452
1336 Ga0068863_100063695
1337 Ga0068863_100141262
1338 Ga0068863_100272534
1339 Ga0068863_101182694
1340 Ga0068863_101499966
1341 Ga0068858_100001407
1342 Ga0068858_100026940
1343 Ga0068858_100204830
1344 Ga0068858_100223323
1345 Ga0068858_100540512
1346 Ga0068858_101923498
1347 Ga0068860_100009287
1348 Ga0068860_100030028
1349 Ga0068860_100059291
1350 Ga0068860_100090511
1351 Ga0068860_100180292
1352 Ga0068862_100025302
1353 Ga0068862_100041175
1354 Ga0068862_100243636
1355 Ga0068862_100262382
1356 Ga0068862_100523479
1357 Ga0081539_10042892
1358 Ga0070717_10157349
1359 Ga0070716_100289603
1360 Ga0070712_100012687
1361 Ga0075366_10068545
1362 Ga0097621_100012388
1363 Ga0097621_100124412
1364 Ga0097621_100468800
1365 Ga0097621_100841155
1366 Ga0068871_100088923
1367 Ga0068871_100349173
1368 Ga0068871_100765934
1369 Ga0068871_101665658
1370 Ga0075431_101600645
1371 Ga0075433_10013427
1372 Ga0075434_101780204
1373 Ga0075429_100311560
1374 Ga0068865_100028250
1375 Ga0068865_100369286
1376 Ga0097620_100000689
1377 Ga0097620_100067080
1378 Ga0097620_100188656
1379 Ga0105251_10061781
1380 Ga0105250_10009409
1381 Ga0105240_10061483
1382 Ga0105240_10079134
1383 Ga0105240_10248473
1384 Ga0105240_10783469
1385 Ga0111539_10188732
1386 Ga0111539_12770693
1387 Ga0105245_10198934
1388 Ga0105245_10425170
1389 Ga0105243_10115062
1390 Ga0105243_10636222
1391 Ga0105243_10661282
1392 Ga0105243_10819672
1393 Ga0105243_11040238
1394 Ga0105243_13057682
1395 Ga0105241_10531542
1396 Ga0105242_10439443
1397 Ga0105248_10001002
1398 Ga0105248_10001965
1399 Ga0105248_10047463
1400 Ga0105248_10052676
1401 Ga0105248_10093908
1402 Ga0105248_10345628
1403 Ga0105237_10027499
1404 Ga0105238_10021856
1405 Ga0105238_10110411
1406 Ga0105238_12233605
1407 Ga0105249_10001380
1408 Ga0105249_10012623
1409 Ga0105249_10070687
1410 Ga0105249_10994936
1411 Ga0105249_11029201
1412 Ga0105032_101608
1413 Ga0105239_10286361
1414 Ga0105239_10618303
1415 Ga0105239_11249713
1416 Ga0105246_10167031
1417 Ga0105246_10242977
1418 Ga0105246_10538569
1419 Ga0157373_10006351
1420 Ga0157373_10096027
1421 Ga0157373_10141424
1422 Ga0157373_10157284
1423 Ga0157373_10203749
1424 Ga0157373_10303603
1425 Ga0157373_10316026
1426 Ga0157373_10499057
1427 Ga0157373_10562940
1428 Ga0157373_10727876
1429 Ga0157371_10000705
1430 Ga0157371_10051798
1431 Ga0157371_10102762
1432 Ga0157371_10105846
1433 Ga0157371_10119843
1434 Ga0157371_10146843
1435 Ga0157371_10156703
1436 Ga0157371_10170900
1437 Ga0157371_10457735
1438 Ga0157371_10686723
1439 Ga0157371_10827575
1440 Ga0157370_10000534
1441 Ga0157370_10103483
1442 Ga0157370_10234792
1443 Ga0157370_10380558
1444 Ga0157370_10476381
1445 Ga0157370_10491947
1446 Ga0157370_10539245
1447 Ga0157370_10775835
1448 Ga0157369_10065712
1449 Ga0157369_10119236
1450 Ga0157369_10199985
1451 Ga0157369_10233006
1452 Ga0157369_10291293
1453 Ga0157369_11746073
1454 Ga0157374_10012083
1455 Ga0157374_10258616
1456 Ga0157374_10393620
1457 Ga0157378_10063086
1458 Ga0157378_10142848
1459 Ga0163162_10019524
1460 Ga0163162_10030175
1461 Ga0163162_10069109
1462 Ga0157372_10264048
1463 Ga0157372_10270333
1464 Ga0157372_10453449
1465 Ga0157372_10695660
1466 Ga0157372_10713030
1467 Ga0157375_10007560
1468 Ga0157375_10033612
1469 Ga0157375_10484861
1470 Ga0163163_10000991
1471 Ga0163163_10013315
1472 Ga0163163_10119353
1473 Ga0163163_10120330
1474 Ga0163163_10940964
1475 Ga0157380_10127608
1476 Ga0157380_11268354
1477 Ga0182008_10591134
1478 Ga0157377_10021411
1479 Ga0157379_10001787
1480 Ga0157379_10006649
1481 Ga0157379_10032029
1482 Ga0197907_10005564
1483 Ga0197907_11430954
1484 Ga0206355_1312482
1485 Ga0206355_1510024
1486 Ga0206351_10097986
1487 Ga0206352_10904873
1488 Ga0206354_10113205
1489 Ga0206354_10113898
1490 Ga0206353_10453748
1491 Ga0206353_11652008
1492 Ga0207673_1023215
1493 Ga0207697_10011949
1494 Ga0207656_10227505
1495 Ga0207696_1016165
1496 Ga0207713_1116360
1497 Ga0207682_10003183
1498 Ga0207682_10039671
1499 Ga0207682_10090606
1500 Ga0207642_10238105
1501 Ga0207642_10442379
1502 Ga0207642_10492556
1503 Ga0207688_10081307
1504 Ga0207688_10134725
1505 Ga0207680_10000271
1506 Ga0207680_10090477
1507 Ga0207680_10233149
1508 Ga0207680_10280730
1509 Ga0207680_11225876
1510 Ga0207647_10001771
1511 Ga0207647_10002227
1512 Ga0207647_10014477
1513 Ga0207647_10016675
1514 Ga0207647_10054852
1515 Ga0207647_10070781
1516 Ga0207647_10096939
1517 Ga0207647_10142100
1518 Ga0207647_10143982
1519 Ga0207647_10149030
1520 Ga0207647_10158528
1521 Ga0207645_10112352
1522 Ga0207705_10000050
1523 Ga0207705_10001324
1524 Ga0207705_10001792
1525 Ga0207705_10001951
1526 Ga0207705_10001965
1527 Ga0207705_10018413
1528 Ga0207705_10037361
1529 Ga0207705_10042036
1530 Ga0207705_10076673
1531 Ga0207705_10094160
1532 Ga0207705_10095791
1533 Ga0207705_10175221
1534 Ga0207705_10187664
1535 Ga0207705_10191241
1536 Ga0207705_10440127
1537 Ga0207705_10801569
1538 Ga0207705_11098258
1539 Ga0207654_10631216
1540 Ga0207707_10006787
1541 Ga0207707_10026570
1542 Ga0207707_10222281
1543 Ga0207707_10398533
1544 Ga0207707_10874301
1545 Ga0207695_10045313
1546 Ga0207695_10045822
1547 Ga0207695_10264273
1548 Ga0207695_11004942
1549 Ga0207671_10111965
1550 Ga0207693_10016182
1551 Ga0207660_10005638
1552 Ga0207660_10300847
1553 Ga0207662_10298907
1554 Ga0207657_10000210
1555 Ga0207657_10000301
1556 Ga0207657_10002057
1557 Ga0207657_10007540
1558 Ga0207657_10009014
1559 Ga0207657_10009396
1560 Ga0207657_10031796
1561 Ga0207657_10176834
1562 Ga0207657_10327980
1563 Ga0207657_10397703
1564 Ga0207657_10416635
1565 Ga0207657_10431972
1566 Ga0207657_10827109
1567 Ga0207657_11009495
1568 Ga0207649_10003557
1569 Ga0207649_10008987
1570 Ga0207649_10029663
1571 Ga0207649_10084366
1572 Ga0207649_10110203
1573 Ga0207649_10110568
1574 Ga0207649_10257187
1575 Ga0207649_10840886
1576 Ga0207652_10011268
1577 Ga0207652_10075220
1578 Ga0207652_10114125
1579 Ga0207652_10280047
1580 Ga0207652_10788681
1581 Ga0207652_10876776
1582 Ga0207652_11672754
1583 Ga0207681_10048622
1584 Ga0207681_10078376
1585 Ga0207681_10083421
1586 Ga0207681_10092182
1587 Ga0207681_10309049
1588 Ga0207681_11200348
1589 Ga0207694_10058635
1590 Ga0207694_10602261
1591 Ga0207650_10013566
1592 Ga0207650_10266825
1593 Ga0207650_10489652
1594 Ga0207650_10581288
1595 Ga0207659_10011067
1596 Ga0207659_10045121
1597 Ga0207659_10048892
1598 Ga0207659_10220438
1599 Ga0207659_10520351
1600 Ga0207687_10089967
1601 Ga0207700_10064810
1602 Ga0207664_10199825
1603 Ga0207644_10000794
1604 Ga0207644_10008227
1605 Ga0207644_10024783
1606 Ga0207644_10054771
1607 Ga0207644_10071851
1608 Ga0207644_10132821
1609 Ga0207644_10235812
1610 Ga0207644_10355786
1611 Ga0207644_11554536
1612 Ga0207690_10001735
1613 Ga0207690_10008620
1614 Ga0207690_10088788
1615 Ga0207690_10166568
1616 Ga0207690_10321390
1617 Ga0207690_10392999
1618 Ga0207690_10437875
1619 Ga0207690_10479268
1620 Ga0207690_10895745
1621 Ga0207690_11054466
1622 Ga0207690_11180462
1623 Ga0207706_10000675
1624 Ga0207706_10001971
1625 Ga0207706_10015533
1626 Ga0207706_10015844
1627 Ga0207706_10024853
1628 Ga0207706_10035232
1629 Ga0207706_10048449
1630 Ga0207706_10337117
1631 Ga0207706_10473450
1632 Ga0207706_10481125
1633 Ga0207706_10488851
1634 Ga0207706_10500420
1635 Ga0207706_10625045
1636 Ga0207706_10730781
1637 Ga0207686_10224807
1638 Ga0207686_10349466
1639 Ga0207669_10158254
1640 Ga0207669_10222015
1641 Ga0207669_10225446
1642 Ga0207669_10959213
1643 Ga0207704_10484002
1644 Ga0207665_10180217
1645 Ga0207691_10003690
1646 Ga0207691_10014594
1647 Ga0207691_10016405
1648 Ga0207691_10172024
1649 Ga0207711_10000044
1650 Ga0207711_10000823
1651 Ga0207711_10037413
1652 Ga0207711_10116326
1653 Ga0207711_10209272
1654 Ga0207711_10236332
1655 Ga0207711_10575085
1656 Ga0207711_11970198
1657 Ga0207689_10009583
1658 Ga0207689_10530192
1659 Ga0207689_10641054
1660 Ga0207661_10307010
1661 Ga0207661_10357893
1662 Ga0207661_11124200
1663 Ga0207679_10003346
1664 Ga0207679_10012302
1665 Ga0207679_10028900
1666 Ga0207679_10044415
1667 Ga0207679_10083793
1668 Ga0207679_10114027
1669 Ga0207679_10199399
1670 Ga0207679_10255163
1671 Ga0207679_10372985
1672 Ga0207679_10410681
1673 Ga0207679_10419510
1674 Ga0207679_10775502
1675 Ga0207679_10920042
1676 Ga0207667_10000327
1677 Ga0207667_10032612
1678 Ga0207667_10060365
1679 Ga0207667_10111498
1680 Ga0207667_10118664
1681 Ga0207667_10126753
1682 Ga0207667_10780530
1683 Ga0207651_10006297
1684 Ga0207651_10044094
1685 Ga0207651_10055402
1686 Ga0207651_10080673
1687 Ga0207651_10260821
1688 Ga0207651_10390576
1689 Ga0207651_10400407
1690 Ga0207651_10555610
1691 Ga0207651_11471691
1692 Ga0207712_10000146
1693 Ga0207712_10006709
1694 Ga0207712_10367875
1695 Ga0207712_11265996
1696 Ga0207668_10225927
1697 Ga0207668_10350441
1698 Ga0207668_10847616
1699 Ga0207668_11039357
1700 Ga0207640_10015002
1701 Ga0207640_10016771
1702 Ga0207640_10018099
1703 Ga0207640_10021579
1704 Ga0207640_10050953
1705 Ga0207640_10494233
1706 Ga0207640_11104451
1707 Ga0207640_11129353
1708 Ga0207640_11939546
1709 Ga0207658_10002505
1710 Ga0207658_10008803
1711 Ga0207658_10055747
1712 Ga0207658_10065598
1713 Ga0207658_10170805
1714 Ga0207658_10184356
1715 Ga0207658_10949514
1716 Ga0207677_10044492
1717 Ga0207677_10079209
1718 Ga0207677_10260941
1719 Ga0207677_11011966
1720 Ga0207703_10000661
1721 Ga0207703_10001894
1722 Ga0207703_10183319
1723 Ga0207703_10204413
1724 Ga0207703_10344153
1725 Ga0207703_10474269
1726 Ga0207639_10032745
1727 Ga0207639_10106569
1728 Ga0207639_10164791
1729 Ga0207639_10629087
1730 Ga0207639_11264474
1731 Ga0207678_10002367
1732 Ga0207678_10005390
1733 Ga0207678_10006909
1734 Ga0207678_10030207
1735 Ga0207678_10032095
1736 Ga0207678_10061471
1737 Ga0207678_10084615
1738 Ga0207678_10384510
1739 Ga0207678_10871676
1740 Ga0207678_11412370
1741 Ga0207702_10005600
1742 Ga0207702_10041421
1743 Ga0207702_10042227
1744 Ga0207702_10120007
1745 Ga0207702_10229291
1746 Ga0207702_10273794
1747 Ga0207702_10600662
1748 Ga0207702_10624732
1749 Ga0207641_10001621
1750 Ga0207641_10071552
1751 Ga0207641_10114881
1752 Ga0207641_10148096
1753 Ga0207641_10286008
1754 Ga0207641_10368892
1755 Ga0207641_10961139
1756 Ga0207641_11548404
1757 Ga0207648_10032359
1758 Ga0207648_10350174
1759 Ga0207648_10501809
1760 Ga0207676_10000446
1761 Ga0207676_10026462
1762 Ga0207676_10052186
1763 Ga0207676_10546423
1764 Ga0207676_10592705
1765 Ga0207676_10859188
1766 Ga0207674_10000308
1767 Ga0207674_10002878
1768 Ga0207674_10006480
1769 Ga0207674_10025620
1770 Ga0207674_10103502
1771 Ga0207674_10116548
1772 Ga0207674_10127343
1773 Ga0207674_10472048
1774 Ga0207674_10919528
1775 Ga0207674_11362448
1776 Ga0207675_101169796
1777 Ga0207683_10002606
1778 Ga0207683_10034988
1779 Ga0207683_10061392
1780 Ga0207683_10213397
1781 Ga0207698_10004660
1782 Ga0207698_10032766
1783 Ga0207698_10049154
1784 Ga0207698_10079832
1785 Ga0207698_10224845
1786 Ga0207698_10234926
1787 Ga0207698_10242880
1788 Ga0207698_10277442
1789 Ga0207698_10415312
1790 Ga0207698_10738627
1791 Ga0207698_11580601
1792 Ga0209971_1139748
1793 Ga0209974_10140707
1794 Ga0209974_10252959
1795 Ga0209974_10315247
1796 Ga0268266_10465426
1797 Ga0268266_10568339
1798 Ga0268266_11832716
1799 Ga0268265_10013723
1800 Ga0268265_10028171
1801 Ga0268265_10053112
1802 Ga0268265_10057011
1803 Ga0268265_10114185
1804 Ga0268265_10195193
1805 Ga0268265_10208150
1806 Ga0268265_10466887
1807 Ga0268264_10000594
1808 Ga0268264_10001254
1809 Ga0268264_10050338
1810 Ga0268264_10070651
1811 Ga0268264_10107756
1812 Ga0268264_12174328
1813 Ga0307408_100029218
1814 Ga0307408_100228862
1815 Ga0307408_100464162
1816 Ga0307408_100820026
1817 Ga0307408_100928536
1818 Ga0307408_101466268
1819 Ga0307408_101930890
1820 Ga0307405_10019031
1821 Ga0307405_10184163
1822 Ga0307405_10226295
1823 Ga0307405_10450387
1824 Ga0307405_11168305
1825 Ga0307405_11174850
1826 Ga0307413_10226986
1827 Ga0307413_10523729
1828 Ga0307413_10645523
1829 Ga0307413_10711779
1830 Ga0307410_10005397
1831 Ga0307410_10022098
1832 Ga0307410_10332747
1833 Ga0307410_10361657
1834 Ga0307410_10545047
1835 Ga0307410_10637718
1836 Ga0307410_11018963
1837 Ga0307406_10047481
1838 Ga0307406_10281676
1839 Ga0307406_10426170
1840 Ga0307407_10110599
1841 Ga0307407_10934970
1842 Ga0307412_10064621
1843 Ga0307412_10122268
1844 Ga0307412_10161984
1845 Ga0307412_10246847
1846 Ga0307412_10472845
1847 Ga0307412_12165495
1848 Ga0307409_100000982
1849 Ga0307409_100021330
1850 Ga0307409_100045130
1851 Ga0307409_100099291
1852 Ga0307409_100261294
1853 Ga0307409_100602241
1854 Ga0307409_100687259
1855 Ga0307409_101440671
1856 Ga0307409_101997400
1857 Ga0307416_100045474
1858 Ga0307416_100051508
1859 Ga0307416_100053084
1860 Ga0307416_100061594
1861 Ga0307416_101285361
1862 Ga0307416_103007650
1863 Ga0307414_10003702
1864 Ga0307414_10822862
1865 Ga0307414_10989896
1866 Ga0307414_11164926
1867 Ga0307411_10001476
1868 Ga0307411_10027875
1869 Ga0307411_10046498
1870 Ga0307411_10154460
1871 Ga0307411_10217812
1872 Ga0307415_100058072
1873 Ga0307415_100064417
1874 Ga0307415_101068220
1875 Ga0373939_0469325
1876 Ga0373946_0186444
1877 Ga0373931_1018914
1878 Ga0395899_0005982
1879 Ga0395899_0013068
1880 Ga0395899_0016719
1881 Ga0395899_0041445
1882 Ga0395899_0053982
1883 Ga0395899_0058987
1884 Ga0395899_0151885
1885 Ga0395899_0295214
1886 Ga0395899_0544275
1887 Ga0395900_0000254
1888 Ga0395900_0007369
1889 Ga0395900_0056809
1890 Ga0395900_0060058
1891 Ga0395900_0063113
1892 Ga0395900_0080858
1893 Ga0395900_0104823
1894 Ga0395900_0131143
1895 Ga0395900_0141720
1896 Ga0395900_0159487
1897 Ga0395900_0171458
1898 Ga0395900_0183929
1899 Ga0395900_0285964
1900 Ga0395900_0335167
1901 Ga0395900_0364220
1902 Ga0395900_0386541
1903 Ga0395900_0391273
1904 Ga0395900_0446921
1905 Ga0395900_0606000
1906 Ga0395900_1056322
1907 Ga0395900_1258255
1908 Ga0395900_1336393
1909 Ga0395900_1352408
1910 Ga0395900_1593534
1911 Ga0395898_0019860
1912 Ga0395898_0039150
1913 Ga0395898_0039524
1914 Ga0395898_0078565
1915 Ga0395898_0130906
1916 Ga0395898_0181301
1917 Ga0395898_0192203
1918 Ga0395898_0387576
1919 Ga0395898_0449243
1920 Ga0395898_0493812
1921 Ga0395898_0673127
1922 Ga0395898_0700349
1923 Ga0395898_0760970
1924 Ga0395898_0978525
1925 Ga0395898_1313679
1926 Ga0395905_0000259
1927 Ga0395905_0001373
1928 Ga0395905_0001843
1929 Ga0395905_0002116
1930 Ga0395905_0002525
1931 Ga0395905_0005106
1932 Ga0395905_0008973
1933 Ga0395905_0009843
1934 Ga0395905_0016724
1935 Ga0395905_0038888
1936 Ga0395905_0068210
1937 Ga0395905_0074007
1938 Ga0395905_0090261
1939 Ga0395905_0105559
1940 Ga0395905_0121222
1941 Ga0395905_0123197
1942 Ga0395905_0156711
1943 Ga0395905_0165255
1944 Ga0395905_0171844
1945 Ga0395905_0176084
1946 Ga0395905_0208039
1947 Ga0395905_0213129
1948 Ga0395905_0215454
1949 Ga0395905_0241338
1950 Ga0395905_0586825
1951 Ga0395905_0651607
1952 Ga0395905_0671691
1953 Ga0395905_0749263
1954 Ga0395905_0812414
1955 Ga0395905_0894131
1956 Ga0395905_0939843
1957 Ga0395905_0963294
1958 Ga0395905_1116376
1959 Ga0436364_0175729
1960 Ga0395901_0000030
1961 Ga0395901_0002677
1962 Ga0395901_0042121
1963 Ga0395901_0054951
1964 Ga0395901_0055144
1965 Ga0395901_0055540
1966 Ga0395901_0065331
1967 Ga0395901_0077217
1968 Ga0395901_0094907
1969 Ga0395901_0100699
1970 Ga0395901_0126257
1971 Ga0395901_0128807
1972 Ga0395901_0144878
1973 Ga0395901_0172602
1974 Ga0395901_0193105
1975 Ga0395901_0250470
1976 Ga0395901_0307525
1977 Ga0395901_0451725
1978 Ga0395901_1092528
1979 Ga0395901_1384078
1980 Ga0395901_1556931
1981 Ga0395901_1644779
1982 Ga0439432_048711
1983 Ga0439432_090395
1984 Ga0439452_057664
1985 Ga0450920_029769
1986 Ga0439458_0000003
1987 Ga0439458_0000100
1988 Ga0439464_0001273
1989 Ga0439460_0086825
1990 Ga0466969_0046863
1991 Ga0466969_0077966
1992 Ga0466972_0031573
1993 Ga0466972_0032078
1994 Ga0466966_0000040
1995 Ga0466966_0003997
1996 Ga0466966_0023733
1997 Ga0466966_0035641
1998 Ga0466966_0114363
1999 Ga0466966_0161218
2000 Ga0466961_0020081
2001 Ga0466961_0040967
2002 Ga0466961_0054346
2003 Ga0466961_0061493
2004 Ga0466961_0265237
2005 Ga0466963_0009039
2006 Ga0466963_0054644
2007 Ga0466963_0058373
2008 Ga0466963_0203082
2009 Ga0466963_0247828
2010 Ga0466963_0711786
2011 Ga0466964_0007055
2012 Ga0453684_2468266
2013 Ga0466971_0039340
2014 Ga0466971_0094072
2015 Ga0466970_0006716
2016 Ga0466970_0023232
2017 Ga0466957_0009860
2018 Ga0466957_0013721
2019 Ga0466957_0027323
2020 Ga0466957_0059908
2021 Ga0466957_0395786
2022 Ga0466960_0042280
2023 Ga0466960_0179575
2024 Ga0466959_0009381
2025 Ga0466959_0084305
2026 Ga0466959_0094129
2027 Ga0466959_0174691
2028 Ga0466959_0974316
2029 Ga0466958_0010790
2030 Ga0466958_0024787
2031 Ga0466958_0050383
2032 Ga0466958_0290351
2033 Ga0466958_0638767
2034 Ga0466967_0140202
2035 Ga0466967_0181116
2036 Ga0466967_0216114
2037 Ga0466967_1492801
2038 Ga0495643_0421655
2039 Ga0495663_0102764
2040 Ga0495668_0062198
2041 Ga0495625_0372400
2042 Ga0495669_0024216
2043 Ga0495670_0290512
2044 Ga0495677_0224392
2045 Ga0496100_0151100
2046 Ga0496100_0971693
2047 Ga0496101_0063491
2048 Ga0496101_0141676
2049 Ga0496101_0424353
2050 Ga0496102_0020707
2051 Ga0496102_0291559
2052 Ga0496102_0439840
2053 Ga0496102_0608293
2054 Ga0496102_0806358
2055 Ga0496103_0007362
2056 Ga0496104_0166249
2057 Ga0496104_0596402
2058 Ga0496105_0133648
2059 Ga0496106_0016894
2060 Ga0496106_0524506
2061 Ga0496107_0036931
2062 Ga0496107_0081166
2063 Ga0496107_0106943
2064 Ga0496107_0271040
2065 Ga0496107_0674672
2066 Ga0496108_0069017
2067 Ga0496108_0071546
2068 Ga0496108_0086998
2069 Ga0496109_0050692
2070 Ga0496109_0075801
2071 Ga0496109_0098041
2072 Ga0496109_0438934
2073 Ga0496109_1758415
2074 Ga0496110_0002515
2075 Ga0496110_0023537
2076 Ga0496110_0068362
2077 Ga0496111_0000518
2078 Ga0496111_0003916
2079 Ga0496111_0091805
2080 Ga0496111_0604806
2081 Ga0496112_0003787
2082 Ga0496112_0023834
2083 Ga0496112_0053964
2084 Ga0496112_0179700
2085 Ga0496112_0202928
2086 Ga0496112_1391113
2087 Ga0496113_0016888
2088 Ga0496113_0067863
2089 Ga0496113_0092522
2090 Ga0496114_0048078
2091 Ga0496115_0000488
2092 Ga0496115_0409644
2093 Ga0501067_0010970
2094 Ga0501067_0419157
2095 Ga0501069_0770106
2096 Ga0501070_0141925
2097 Ga0501074_0191303
2098 Ga0501209_274112
2099 nmdc:mga03683_186908_c1
2100 nmdc:mga06r32_548503_c1
2101 nmdc:mga08y16_1445317_c1
2102 nmdc:mga0n895_1392335_c1
2103 nmdc:mga0n895_577200_c1
2104 nmdc:mga0a205_11550_c1
2105 Ga0590077_044713
2106 Ga0466962_0004600
2107 Ga0466962_0184642
2108 Ga0466962_0211639

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00571

CBS

CBS domain

3

56

0.96

PF00571

CBS

CBS domain

67

123

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5g5r-assembly1.cif.gz_A cbs domain tandem of site-2 protease from archaeoglobus fulgidus in complex with llama nanobody - apo form 0.9409 5 120
1xkf-assembly2.cif.gz_A crystal structure of hypoxic response protein i (hrpi) with two coordinated zinc ions 0.9384 1 119
2p9m-assembly2.cif.gz_C crystal structure of conserved hypothetical protein mj0922 from methanocaldococcus jannaschii dsm 2661 0.9244 1 120
2p9m-assembly1.cif.gz_B crystal structure of conserved hypothetical protein mj0922 from methanocaldococcus jannaschii dsm 2661 0.9194 1 120
2p9m-assembly1.cif.gz_A crystal structure of conserved hypothetical protein mj0922 from methanocaldococcus jannaschii dsm 2661 0.9185 1 120
ID Description Score Start End Superfamily
3kpbA00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.945 1 120 3.10.580.10
af_P17115_194_318_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9344 1 119 3.10.580.10
af_Q58332_1_138_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9312 1 120 3.10.580.10
af_Q58629_165_294_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9304 1 120 3.10.580.10
3kpbA00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9222 1 120 3.10.580.10
ID Description Score Start End GO Terms
AF-A0A536ZA27-F1-model_v4 CBS domain-containing protein 0.979 1 119
AF-A0A7V8XMP6-F1-model_v4 CBS domain-containing protein 0.9747 1 113
AF-A0A536ZA27-F1-model_v4 CBS domain-containing protein 0.9709 1 119
AF-A0A1B1S1Y4-F1-model_v4 CBS domain-containing protein 0.9674 1 120
AF-A0A543DS25-F1-model_v4 CBS domain protein 0.9656 1 113

Map