F489063
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1050 | 333 | 1050 | 251 |
Family's Representative Sequence
| Representative Sequence | 3300053077|Ga0495601_0025172|Ga0495601_0025172_177_1010 |
| Length | 277 |
| Sequence | VLRVRAIALTAMSIAIHDLVKTYGQFTAVNGVSLDVQPGEIHGFLGPNGAGKTTTLRMIAGLLKPTAGRIEVNGHDLAKDPESAKASLGFIPDRPYIYEKLTAGEFLRFHGGLFGMNGSGQNPIGNRVKEMLELFELGRWENELVESFSHGMKQRLVMSAAFLHRPRAVVVDEPMVGLDPRGARLIKDVFRKMSERGVAILMSTHTLEVAEEMCDCISIILKGRIIARGTVDELRALAAGDDASGVLPGDEVDEVELTSVFLKLTGGSGLQEIDEIV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 2 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 73 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 78 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 166 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 169 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 171 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 172 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 174 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 175 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 176 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 177 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 178 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 179 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 180 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 181 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 182 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 183 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 184 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 185 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 186 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 187 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 188 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 190 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 191 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 192 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 194 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 195 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 197 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 198 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 199 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 202 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 203 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 204 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 207 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 208 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 210 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 212 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 213 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 214 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 215 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 216 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 217 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 218 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 219 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 220 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 221 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 222 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 223 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 224 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 225 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 226 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 227 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 271 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 272 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 273 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 274 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 275 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 278 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 279 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 280 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 281 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 282 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 283 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 310 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 311 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 312 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 313 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 314 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 315 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 316 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 326 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 330 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 331 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.71 |
| Nodule | 0 |
| Rhizoplane | 2.1 |
| Rhizosphere | 94.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25405J52794_10003721 | 3300003911 | Unclassified | 2691 |
| 2 | Ga0065704_10170200 | 3300005289 | Unclassified | 1296 |
| 3 | Ga0065712_10005714 | 3300005290 | Bacteria | 3303 |
| 4 | Ga0065712_10088511 | 3300005290 | Archaea | 2516 |
| 5 | Ga0065712_10105799 | 3300005290 | Bacteria | 1902 |
| 6 | Ga0065715_10007369 | 3300005293 | Bacteria | 5543 |
| 7 | Ga0065715_10051194 | 3300005293 | Bacteria | 985 |
| 8 | Ga0065715_10096409 | 3300005293 | Bacteria | 3813 |
| 9 | Ga0065707_10002251 | 3300005295 | Bacteria | 8627 |
| 10 | Ga0065707_10005235 | 3300005295 | Bacteria | 4356 |
| 11 | Ga0065707_10085509 | 3300005295 | Bacteria | 6100 |
| 12 | Ga0065707_10165513 | 3300005295 | Bacteria | 1526 |
| 13 | Ga0070676_10006806 | 3300005328 | Bacteria | 6126 |
| 14 | Ga0070676_10321649 | 3300005328 | Bacteria | 1055 |
| 15 | Ga0070683_100006082 | 3300005329 | Bacteria | 10117 |
| 16 | Ga0070683_100121001 | 3300005329 | Bacteria | 2473 |
| 17 | Ga0070683_100165983 | 3300005329 | Archaea | 2095 |
| 18 | Ga0070690_100029154 | 3300005330 | Bacteria | 3421 |
| 19 | Ga0070690_100109929 | 3300005330 | Bacteria | 1838 |
| 20 | Ga0070670_100003674 | 3300005331 | Bacteria | 12789 |
| 21 | Ga0070670_100056795 | 3300005331 | Bacteria | 3360 |
| 22 | Ga0070670_100178229 | 3300005331 | Archaea | 1845 |
| 23 | Ga0070677_10031350 | 3300005333 | Bacteria | 2032 |
| 24 | Ga0068869_100164778 | 3300005334 | Bacteria | 1728 |
| 25 | Ga0068869_100186928 | 3300005334 | Bacteria | 1627 |
| 26 | Ga0068869_100280438 | 3300005334 | Bacteria | 1340 |
| 27 | Ga0068869_100375534 | 3300005334 | Bacteria | 1164 |
| 28 | Ga0070666_10022440 | 3300005335 | Bacteria | 4098 |
| 29 | Ga0070666_10039046 | 3300005335 | Unclassified | 3162 |
| 30 | Ga0070666_10087282 | 3300005335 | Archaea | 2138 |
| 31 | Ga0068868_100025873 | 3300005338 | Bacteria | 4468 |
| 32 | Ga0068868_100028023 | 3300005338 | Bacteria | 4302 |
| 33 | Ga0068868_100079273 | 3300005338 | Bacteria | 2631 |
| 34 | Ga0068868_100241239 | 3300005338 | Bacteria | 1519 |
| 35 | Ga0070689_100005737 | 3300005340 | Bacteria | 8512 |
| 36 | Ga0070689_100008806 | 3300005340 | Bacteria | 7126 |
| 37 | Ga0070689_100009227 | 3300005340 | Bacteria | 6985 |
| 38 | Ga0070689_100011887 | 3300005340 | Bacteria | 6249 |
| 39 | Ga0070691_10044437 | 3300005341 | Bacteria | 2107 |
| 40 | Ga0070687_100062482 | 3300005343 | Bacteria | 1972 |
| 41 | Ga0070687_100161004 | 3300005343 | Bacteria | 1326 |
| 42 | Ga0070661_100016292 | 3300005344 | Bacteria | 5254 |
| 43 | Ga0070661_100499300 | 3300005344 | Bacteria | 974 |
| 44 | Ga0070692_10027343 | 3300005345 | Bacteria | 2826 |
| 45 | Ga0070668_100295055 | 3300005347 | Bacteria | 1358 |
| 46 | Ga0070668_100312884 | 3300005347 | Bacteria | 1320 |
| 47 | Ga0070669_100002795 | 3300005353 | Bacteria | 12595 |
| 48 | Ga0070669_100009439 | 3300005353 | Bacteria | 6948 |
| 49 | Ga0070669_100131441 | 3300005353 | Bacteria | 1921 |
| 50 | Ga0070669_100216352 | 3300005353 | Bacteria | 1513 |
| 51 | Ga0070675_100001411 | 3300005354 | Bacteria | 17650 |
| 52 | Ga0070675_100014315 | 3300005354 | Bacteria | 6253 |
| 53 | Ga0070675_100038263 | 3300005354 | Bacteria | 3909 |
| 54 | Ga0070675_100144890 | 3300005354 | Bacteria | 2033 |
| 55 | Ga0070675_100166641 | 3300005354 | Archaea | 1898 |
| 56 | Ga0070675_100204877 | 3300005354 | Bacteria | 1713 |
| 57 | Ga0070675_100339176 | 3300005354 | Bacteria | 1331 |
| 58 | Ga0070671_100061284 | 3300005355 | Bacteria | 3133 |
| 59 | Ga0070671_100150212 | 3300005355 | Archaea | 1967 |
| 60 | Ga0070671_100280269 | 3300005355 | Bacteria | 1418 |
| 61 | Ga0070674_100014917 | 3300005356 | Bacteria | 4839 |
| 62 | Ga0070674_100020861 | 3300005356 | Bacteria | 4196 |
| 63 | Ga0070674_100026357 | 3300005356 | Bacteria | 3795 |
| 64 | Ga0070674_100035571 | 3300005356 | Bacteria | 3336 |
| 65 | Ga0070674_100138361 | 3300005356 | Bacteria | 1824 |
| 66 | Ga0070674_100139424 | 3300005356 | Bacteria | 1818 |
| 67 | Ga0070673_100006996 | 3300005364 | Bacteria | 7393 |
| 68 | Ga0070673_100011588 | 3300005364 | Bacteria | 6022 |
| 69 | Ga0070673_100012813 | 3300005364 | Bacteria | 5771 |
| 70 | Ga0070673_100069369 | 3300005364 | Bacteria | 2825 |
| 71 | Ga0070673_100090119 | 3300005364 | Bacteria | 2505 |
| 72 | Ga0070673_100389527 | 3300005364 | Bacteria | 1244 |
| 73 | Ga0070688_100068697 | 3300005365 | Bacteria | 2260 |
| 74 | Ga0070659_100074165 | 3300005366 | Bacteria | 2710 |
| 75 | Ga0070667_100042719 | 3300005367 | Bacteria | 3804 |
| 76 | Ga0070667_100138545 | 3300005367 | Archaea | 2129 |
| 77 | Ga0070667_100167371 | 3300005367 | Unclassified | 1939 |
| 78 | Ga0070667_100466462 | 3300005367 | Bacteria | 1155 |
| 79 | Ga0070709_10093260 | 3300005434 | Bacteria | 1990 |
| 80 | Ga0070709_10156519 | 3300005434 | Bacteria | 1580 |
| 81 | Ga0070713_100010981 | 3300005436 | Bacteria | 6570 |
| 82 | Ga0070701_10007454 | 3300005438 | Bacteria | 4676 |
| 83 | Ga0070701_10038327 | 3300005438 | Bacteria | 2425 |
| 84 | Ga0070701_10310978 | 3300005438 | Bacteria | 972 |
| 85 | Ga0070705_100000016 | 3300005440 | Bacteria | 90163 |
| 86 | Ga0070705_100007054 | 3300005440 | Bacteria | 5522 |
| 87 | Ga0070705_100012183 | 3300005440 | Bacteria | 4364 |
| 88 | Ga0070705_100022448 | 3300005440 | Bacteria | 3372 |
| 89 | Ga0070705_100162140 | 3300005440 | Bacteria | 1496 |
| 90 | Ga0070705_100240775 | 3300005440 | Bacteria | 1264 |
| 91 | Ga0070705_100284793 | 3300005440 | Bacteria | 1177 |
| 92 | Ga0070700_100014023 | 3300005441 | Bacteria | 4518 |
| 93 | Ga0070700_100020027 | 3300005441 | Bacteria | 3870 |
| 94 | Ga0070700_100025789 | 3300005441 | Bacteria | 3464 |
| 95 | Ga0070700_100143020 | 3300005441 | Bacteria | 1628 |
| 96 | Ga0070700_100282727 | 3300005441 | Bacteria | 1204 |
| 97 | Ga0070700_100501744 | 3300005441 | Bacteria | 933 |
| 98 | Ga0070694_100000279 | 3300005444 | Bacteria | 27271 |
| 99 | Ga0070694_100051631 | 3300005444 | Bacteria | 2777 |
| 100 | Ga0070694_100054815 | 3300005444 | Bacteria | 2702 |
| 101 | Ga0070694_100080930 | 3300005444 | Unclassified | 2258 |
| 102 | Ga0070694_100112572 | 3300005444 | Bacteria | 1941 |
| 103 | Ga0070708_100255719 | 3300005445 | Bacteria | 1646 |
| 104 | Ga0070708_100267398 | 3300005445 | Bacteria | 1608 |
| 105 | Ga0070708_100317841 | 3300005445 | Bacteria | 1467 |
| 106 | Ga0070708_100467772 | 3300005445 | Bacteria | 1189 |
| 107 | Ga0070678_100022491 | 3300005456 | Bacteria | 4180 |
| 108 | Ga0070678_100252298 | 3300005456 | Bacteria | 1480 |
| 109 | Ga0070662_100040364 | 3300005457 | Bacteria | 3322 |
| 110 | Ga0070662_100152569 | 3300005457 | Unclassified | 1800 |
| 111 | Ga0070681_10138723 | 3300005458 | Bacteria | 2361 |
| 112 | Ga0068867_100002379 | 3300005459 | Bacteria | 13223 |
| 113 | Ga0068867_100024363 | 3300005459 | Bacteria | 4335 |
| 114 | Ga0068867_100050212 | 3300005459 | Bacteria | 3073 |
| 115 | Ga0068867_100080672 | 3300005459 | Bacteria | 2451 |
| 116 | Ga0068867_100860136 | 3300005459 | Bacteria | 813 |
| 117 | Ga0070685_10010288 | 3300005466 | Bacteria | 4856 |
| 118 | Ga0070706_100005121 | 3300005467 | Bacteria | 12507 |
| 119 | Ga0070706_100095894 | 3300005467 | Bacteria | 2754 |
| 120 | Ga0070706_100342967 | 3300005467 | Bacteria | 1393 |
| 121 | Ga0070706_100364722 | 3300005467 | Unclassified | 1346 |
| 122 | Ga0070706_100700205 | 3300005467 | Bacteria | 939 |
| 123 | Ga0070707_100048133 | 3300005468 | Bacteria | 4084 |
| 124 | Ga0070707_100075269 | 3300005468 | Bacteria | 3256 |
| 125 | Ga0070707_100087606 | 3300005468 | Bacteria | 3011 |
| 126 | Ga0070707_100158438 | 3300005468 | Bacteria | 2205 |
| 127 | Ga0070707_100184718 | 3300005468 | Bacteria | 2033 |
| 128 | Ga0070707_100199012 | 3300005468 | Bacteria | 1953 |
| 129 | Ga0070707_100300530 | 3300005468 | Bacteria | 1560 |
| 130 | Ga0070707_100388790 | 3300005468 | Bacteria | 1355 |
| 131 | Ga0070698_100004889 | 3300005471 | Bacteria | 14710 |
| 132 | Ga0070698_100015072 | 3300005471 | Bacteria | 8172 |
| 133 | Ga0070698_100024325 | 3300005471 | Bacteria | 6319 |
| 134 | Ga0070698_100028123 | 3300005471 | Bacteria | 5843 |
| 135 | Ga0070698_100083790 | 3300005471 | Bacteria | 3177 |
| 136 | Ga0070698_100247228 | 3300005471 | Bacteria | 1716 |
| 137 | Ga0070698_100385143 | 3300005471 | Bacteria | 1335 |
| 138 | Ga0070698_100671570 | 3300005471 | Bacteria | 978 |
| 139 | Ga0070699_100000388 | 3300005518 | Bacteria | 42659 |
| 140 | Ga0070699_100001370 | 3300005518 | Bacteria | 22398 |
| 141 | Ga0070699_100001651 | 3300005518 | Bacteria | 20364 |
| 142 | Ga0070699_100014128 | 3300005518 | Bacteria | 6869 |
| 143 | Ga0070699_100025124 | 3300005518 | Bacteria | 5136 |
| 144 | Ga0070699_100027914 | 3300005518 | Bacteria | 4868 |
| 145 | Ga0070699_100061496 | 3300005518 | Bacteria | 3254 |
| 146 | Ga0070699_100081764 | 3300005518 | Bacteria | 2816 |
| 147 | Ga0070699_100108356 | 3300005518 | Bacteria | 2438 |
| 148 | Ga0070699_100195297 | 3300005518 | Bacteria | 1799 |
| 149 | Ga0070699_100379626 | 3300005518 | Bacteria | 1276 |
| 150 | Ga0070679_100028536 | 3300005530 | Bacteria | 5503 |
| 151 | Ga0070684_100001607 | 3300005535 | Bacteria | 16329 |
| 152 | Ga0070684_100005752 | 3300005535 | Bacteria | 9531 |
| 153 | Ga0070684_100163975 | 3300005535 | Bacteria | 2017 |
| 154 | Ga0070697_100006069 | 3300005536 | Bacteria | 9349 |
| 155 | Ga0070697_100028711 | 3300005536 | Bacteria | 4456 |
| 156 | Ga0070697_100104650 | 3300005536 | Bacteria | 2353 |
| 157 | Ga0070697_100213299 | 3300005536 | Bacteria | 1644 |
| 158 | Ga0068853_100295519 | 3300005539 | Bacteria | 1496 |
| 159 | Ga0070672_100005758 | 3300005543 | Bacteria | 8261 |
| 160 | Ga0070672_100059416 | 3300005543 | Bacteria | 3008 |
| 161 | Ga0070672_100084165 | 3300005543 | Bacteria | 2554 |
| 162 | Ga0070686_100024077 | 3300005544 | Bacteria | 3647 |
| 163 | Ga0070686_100167871 | 3300005544 | Bacteria | 1550 |
| 164 | Ga0070686_100389065 | 3300005544 | Bacteria | 1058 |
| 165 | Ga0070686_100465093 | 3300005544 | Bacteria | 975 |
| 166 | Ga0070695_100000061 | 3300005545 | Bacteria | 44298 |
| 167 | Ga0070695_100003902 | 3300005545 | Bacteria | 8706 |
| 168 | Ga0070695_100041240 | 3300005545 | Bacteria | 2925 |
| 169 | Ga0070695_100109023 | 3300005545 | Bacteria | 1876 |
| 170 | Ga0070695_100112542 | 3300005545 | Bacteria | 1849 |
| 171 | Ga0070696_100000571 | 3300005546 | Bacteria | 23529 |
| 172 | Ga0070696_100005465 | 3300005546 | Bacteria | 8477 |
| 173 | Ga0070696_100040027 | 3300005546 | Bacteria | 3236 |
| 174 | Ga0070696_100086982 | 3300005546 | Bacteria | 2220 |
| 175 | Ga0070696_100547662 | 3300005546 | Bacteria | 926 |
| 176 | Ga0070693_100066041 | 3300005547 | Bacteria | 2116 |
| 177 | Ga0070665_100016328 | 3300005548 | Bacteria | 7445 |
| 178 | Ga0070665_100065573 | 3300005548 | Bacteria | 3642 |
| 179 | Ga0070704_100000718 | 3300005549 | Bacteria | 16171 |
| 180 | Ga0070704_100009228 | 3300005549 | Bacteria | 5951 |
| 181 | Ga0070704_100025085 | 3300005549 | Bacteria | 3921 |
| 182 | Ga0070704_100044405 | 3300005549 | Bacteria | 3088 |
| 183 | Ga0070704_100430955 | 3300005549 | Bacteria | 1131 |
| 184 | Ga0070704_100624956 | 3300005549 | Bacteria | 949 |
| 185 | Ga0070664_100002520 | 3300005564 | Bacteria | 14761 |
| 186 | Ga0070664_100016849 | 3300005564 | Bacteria | 5998 |
| 187 | Ga0068857_100042312 | 3300005577 | Bacteria | 4041 |
| 188 | Ga0068857_100138987 | 3300005577 | Archaea | 2195 |
| 189 | Ga0068857_100160805 | 3300005577 | Bacteria | 2038 |
| 190 | Ga0068854_100019045 | 3300005578 | Bacteria | 4618 |
| 191 | Ga0068854_100042743 | 3300005578 | Bacteria | 3209 |
| 192 | Ga0070702_100203421 | 3300005615 | Bacteria | 1313 |
| 193 | Ga0068859_100000940 | 3300005617 | Bacteria | 29798 |
| 194 | Ga0068859_100003972 | 3300005617 | Bacteria | 15091 |
| 195 | Ga0068859_100038713 | 3300005617 | Bacteria | 4783 |
| 196 | Ga0068859_100060701 | 3300005617 | Unclassified | 3810 |
| 197 | Ga0068859_100248282 | 3300005617 | Bacteria | 1870 |
| 198 | Ga0068859_100505346 | 3300005617 | Bacteria | 1304 |
| 199 | Ga0068864_100028303 | 3300005618 | Bacteria | 4736 |
| 200 | Ga0068864_100186160 | 3300005618 | Bacteria | 1901 |
| 201 | Ga0068864_100425635 | 3300005618 | Bacteria | 1266 |
| 202 | Ga0068861_100000753 | 3300005719 | Bacteria | 19414 |
| 203 | Ga0068861_100027954 | 3300005719 | Bacteria | 4112 |
| 204 | Ga0068861_100126847 | 3300005719 | Bacteria | 2066 |
| 205 | Ga0068861_100128155 | 3300005719 | Bacteria | 2056 |
| 206 | Ga0068861_100167648 | 3300005719 | Bacteria | 1817 |
| 207 | Ga0068861_100190742 | 3300005719 | Bacteria | 1713 |
| 208 | Ga0068861_100405535 | 3300005719 | Bacteria | 1211 |
| 209 | Ga0068851_10111766 | 3300005834 | Unclassified | 1459 |
| 210 | Ga0068870_10014038 | 3300005840 | Bacteria | 3775 |
| 211 | Ga0068863_100009319 | 3300005841 | Bacteria | 9580 |
| 212 | Ga0068863_100102559 | 3300005841 | Unclassified | 2720 |
| 213 | Ga0068863_100169327 | 3300005841 | Bacteria | 2095 |
| 214 | Ga0068863_100217153 | 3300005841 | Bacteria | 1841 |
| 215 | Ga0068858_100009204 | 3300005842 | Bacteria | 9438 |
| 216 | Ga0068858_100019683 | 3300005842 | Bacteria | 6311 |
| 217 | Ga0068858_100158144 | 3300005842 | Archaea | 2133 |
| 218 | Ga0068858_100274625 | 3300005842 | Bacteria | 1604 |
| 219 | Ga0068858_100457983 | 3300005842 | Unclassified | 1230 |
| 220 | Ga0068860_100024357 | 3300005843 | Bacteria | 5849 |
| 221 | Ga0068860_100024428 | 3300005843 | Bacteria | 5839 |
| 222 | Ga0068860_100084499 | 3300005843 | Bacteria | 3020 |
| 223 | Ga0068860_100141468 | 3300005843 | Bacteria | 2313 |
| 224 | Ga0068862_100000612 | 3300005844 | Bacteria | 37096 |
| 225 | Ga0068862_100028702 | 3300005844 | Bacteria | 4685 |
| 226 | Ga0068862_100039204 | 3300005844 | Bacteria | 4023 |
| 227 | Ga0068862_100052619 | 3300005844 | Bacteria | 3484 |
| 228 | Ga0068862_100139194 | 3300005844 | Bacteria | 2153 |
| 229 | Ga0068862_100200359 | 3300005844 | Bacteria | 1800 |
| 230 | Ga0068862_100210502 | 3300005844 | Bacteria | 1757 |
| 231 | Ga0068862_100248914 | 3300005844 | Bacteria | 1619 |
| 232 | Ga0081455_10002517 | 3300005937 | Bacteria | 21758 |
| 233 | Ga0081538_10007747 | 3300005981 | Bacteria | 9235 |
| 234 | Ga0081540_1015496 | 3300005983 | Bacteria | 4825 |
| 235 | Ga0081539_10027639 | 3300005985 | Bacteria | 3588 |
| 236 | Ga0081539_10052810 | 3300005985 | Bacteria | 2279 |
| 237 | Ga0075368_10007051 | 3300006042 | Bacteria | 3955 |
| 238 | Ga0075368_10009337 | 3300006042 | Bacteria | 3527 |
| 239 | Ga0075363_100020050 | 3300006048 | Bacteria | 3350 |
| 240 | Ga0075364_10011053 | 3300006051 | Bacteria | 5478 |
| 241 | Ga0075364_10047832 | 3300006051 | Bacteria | 2787 |
| 242 | Ga0075364_10048544 | 3300006051 | Bacteria | 2766 |
| 243 | Ga0075364_10132308 | 3300006051 | Bacteria | 1675 |
| 244 | Ga0075364_10189464 | 3300006051 | Bacteria | 1393 |
| 245 | Ga0075432_10074504 | 3300006058 | Bacteria | 1223 |
| 246 | Ga0070716_100170006 | 3300006173 | Bacteria | 1421 |
| 247 | Ga0075362_10000342 | 3300006177 | Bacteria | 13343 |
| 248 | Ga0075362_10009532 | 3300006177 | Bacteria | 3758 |
| 249 | Ga0075367_10002146 | 3300006178 | Bacteria | 8874 |
| 250 | Ga0075367_10008454 | 3300006178 | Bacteria | 5333 |
| 251 | Ga0075367_10014597 | 3300006178 | Bacteria | 4253 |
| 252 | Ga0075367_10047450 | 3300006178 | Bacteria | 2527 |
| 253 | Ga0075366_10001977 | 3300006195 | Bacteria | 10373 |
| 254 | Ga0075366_10004267 | 3300006195 | Bacteria | 7668 |
| 255 | Ga0097621_100044020 | 3300006237 | Bacteria | 3600 |
| 256 | Ga0097621_100050875 | 3300006237 | Bacteria | 3370 |
| 257 | Ga0097621_100268169 | 3300006237 | Unclassified | 1499 |
| 258 | Ga0097621_100361067 | 3300006237 | Bacteria | 1294 |
| 259 | Ga0097621_100507716 | 3300006237 | Bacteria | 1093 |
| 260 | Ga0075370_10008821 | 3300006353 | Bacteria | 5206 |
| 261 | Ga0075370_10126123 | 3300006353 | Bacteria | 1492 |
| 262 | Ga0068871_100008186 | 3300006358 | Bacteria | 7510 |
| 263 | Ga0068871_100010044 | 3300006358 | Bacteria | 6883 |
| 264 | Ga0068871_100012078 | 3300006358 | Bacteria | 6357 |
| 265 | Ga0068871_100090873 | 3300006358 | Bacteria | 2543 |
| 266 | Ga0068871_100093277 | 3300006358 | Bacteria | 2511 |
| 267 | Ga0068871_100246910 | 3300006358 | Bacteria | 1554 |
| 268 | Ga0075428_100000037 | 3300006844 | Bacteria | 105391 |
| 269 | Ga0075428_100000862 | 3300006844 | Bacteria | 31924 |
| 270 | Ga0075428_100004677 | 3300006844 | Bacteria | 15154 |
| 271 | Ga0075428_100011075 | 3300006844 | Bacteria | 10033 |
| 272 | Ga0075428_100013797 | 3300006844 | Bacteria | 8998 |
| 273 | Ga0075428_100022252 | 3300006844 | Bacteria | 7019 |
| 274 | Ga0075428_100028725 | 3300006844 | Bacteria | 6153 |
| 275 | Ga0075428_100053234 | 3300006844 | Bacteria | 4434 |
| 276 | Ga0075428_100079714 | 3300006844 | Bacteria | 3573 |
| 277 | Ga0075428_100081214 | 3300006844 | Bacteria | 3538 |
| 278 | Ga0075428_100084143 | 3300006844 | Bacteria | 3471 |
| 279 | Ga0075428_100135988 | 3300006844 | Bacteria | 2672 |
| 280 | Ga0075428_100180128 | 3300006844 | Bacteria | 2288 |
| 281 | Ga0075428_100316600 | 3300006844 | Bacteria | 1677 |
| 282 | Ga0075428_100333260 | 3300006844 | Bacteria | 1630 |
| 283 | Ga0075428_100599064 | 3300006844 | Bacteria | 1177 |
| 284 | Ga0075430_100000655 | 3300006846 | Bacteria | 26398 |
| 285 | Ga0075430_100095248 | 3300006846 | Bacteria | 2488 |
| 286 | Ga0075430_100099053 | 3300006846 | Bacteria | 2435 |
| 287 | Ga0075430_100131855 | 3300006846 | Bacteria | 2083 |
| 288 | Ga0075430_100155649 | 3300006846 | Bacteria | 1903 |
| 289 | Ga0075430_100220864 | 3300006846 | Bacteria | 1572 |
| 290 | Ga0075430_100229698 | 3300006846 | Bacteria | 1539 |
| 291 | Ga0075431_100012414 | 3300006847 | Bacteria | 8597 |
| 292 | Ga0075431_100046991 | 3300006847 | Bacteria | 4451 |
| 293 | Ga0075431_100073064 | 3300006847 | Bacteria | 3539 |
| 294 | Ga0075431_100082230 | 3300006847 | Bacteria | 3324 |
| 295 | Ga0075431_100096915 | 3300006847 | Bacteria | 3045 |
| 296 | Ga0075431_100110730 | 3300006847 | Bacteria | 2834 |
| 297 | Ga0075433_10007731 | 3300006852 | Bacteria | 8540 |
| 298 | Ga0075433_10039242 | 3300006852 | Bacteria | 4093 |
| 299 | Ga0075433_10052832 | 3300006852 | Bacteria | 3541 |
| 300 | Ga0075433_10054439 | 3300006852 | Bacteria | 3491 |
| 301 | Ga0075433_10057366 | 3300006852 | Bacteria | 3403 |
| 302 | Ga0075433_10081956 | 3300006852 | Bacteria | 2845 |
| 303 | Ga0075433_10155475 | 3300006852 | Bacteria | 2035 |
| 304 | Ga0075433_10184022 | 3300006852 | Bacteria | 1859 |
| 305 | Ga0075433_10260765 | 3300006852 | Bacteria | 1536 |
| 306 | Ga0075433_10404294 | 3300006852 | Bacteria | 1205 |
| 307 | Ga0075433_10412631 | 3300006852 | Bacteria | 1191 |
| 308 | Ga0075434_100000019 | 3300006871 | Bacteria | 73391 |
| 309 | Ga0075434_100001168 | 3300006871 | Bacteria | 21752 |
| 310 | Ga0075434_100009596 | 3300006871 | Bacteria | 9035 |
| 311 | Ga0075434_100081191 | 3300006871 | Bacteria | 3240 |
| 312 | Ga0075434_100084276 | 3300006871 | Bacteria | 3177 |
| 313 | Ga0075434_100179364 | 3300006871 | Bacteria | 2138 |
| 314 | Ga0075434_100247819 | 3300006871 | Bacteria | 1801 |
| 315 | Ga0075434_100356718 | 3300006871 | Bacteria | 1483 |
| 316 | Ga0075429_100005390 | 3300006880 | Bacteria | 11006 |
| 317 | Ga0075429_100007476 | 3300006880 | Bacteria | 9484 |
| 318 | Ga0075429_100058680 | 3300006880 | Bacteria | 3352 |
| 319 | Ga0075429_100111123 | 3300006880 | Bacteria | 2395 |
| 320 | Ga0068865_100010101 | 3300006881 | Bacteria | 5874 |
| 321 | Ga0068865_100014003 | 3300006881 | Bacteria | 5089 |
| 322 | Ga0068865_100023794 | 3300006881 | Bacteria | 4015 |
| 323 | Ga0068865_100193892 | 3300006881 | Bacteria | 1573 |
| 324 | Ga0075436_100000160 | 3300006914 | Bacteria | 41885 |
| 325 | Ga0075436_100019245 | 3300006914 | Bacteria | 4678 |
| 326 | Ga0075436_100035724 | 3300006914 | Bacteria | 3427 |
| 327 | Ga0075436_100324167 | 3300006914 | Bacteria | 1107 |
| 328 | Ga0097620_100000940 | 3300006931 | Bacteria | 29798 |
| 329 | Ga0097620_100003972 | 3300006931 | Bacteria | 15091 |
| 330 | Ga0097620_100038715 | 3300006931 | Bacteria | 4783 |
| 331 | Ga0097620_100060700 | 3300006931 | Unclassified | 3810 |
| 332 | Ga0097620_100248275 | 3300006931 | Bacteria | 1870 |
| 333 | Ga0097620_100505408 | 3300006931 | Bacteria | 1304 |
| 334 | Ga0075435_100000041 | 3300007076 | Bacteria | 66202 |
| 335 | Ga0075435_100009005 | 3300007076 | Bacteria | 7202 |
| 336 | Ga0075435_100009374 | 3300007076 | Bacteria | 7083 |
| 337 | Ga0075435_100012805 | 3300007076 | Bacteria | 6215 |
| 338 | Ga0075435_100015015 | 3300007076 | Bacteria | 5811 |
| 339 | Ga0075435_100023820 | 3300007076 | Bacteria | 4741 |
| 340 | Ga0075435_100027371 | 3300007076 | Bacteria | 4459 |
| 341 | Ga0075435_100122061 | 3300007076 | Bacteria | 2175 |
| 342 | Ga0075435_100369723 | 3300007076 | Bacteria | 1231 |
| 343 | Ga0099795_10044070 | 3300007788 | Bacteria | 1599 |
| 344 | Ga0105240_10312044 | 3300009093 | Bacteria | 1795 |
| 345 | Ga0105240_10376406 | 3300009093 | Bacteria | 1604 |
| 346 | Ga0111539_10000009 | 3300009094 | Bacteria | 375223 |
| 347 | Ga0111539_10001537 | 3300009094 | Bacteria | 30729 |
| 348 | Ga0111539_10006768 | 3300009094 | Bacteria | 14750 |
| 349 | Ga0111539_10008826 | 3300009094 | Bacteria | 12776 |
| 350 | Ga0111539_10022355 | 3300009094 | Bacteria | 7772 |
| 351 | Ga0111539_10080387 | 3300009094 | Bacteria | 3834 |
| 352 | Ga0111539_10155020 | 3300009094 | Bacteria | 2680 |
| 353 | Ga0111539_10204953 | 3300009094 | Unclassified | 2299 |
| 354 | Ga0111539_10318443 | 3300009094 | Bacteria | 1810 |
| 355 | Ga0111539_10390908 | 3300009094 | Bacteria | 1620 |
| 356 | Ga0111539_10683220 | 3300009094 | Unclassified | 1195 |
| 357 | Ga0111539_10813561 | 3300009094 | Bacteria | 1087 |
| 358 | Ga0105245_10037421 | 3300009098 | Unclassified | 4314 |
| 359 | Ga0105245_10419112 | 3300009098 | Bacteria | 1342 |
| 360 | Ga0105245_10478930 | 3300009098 | Bacteria | 1258 |
| 361 | Ga0105245_10588771 | 3300009098 | Bacteria | 1138 |
| 362 | Ga0105247_10062558 | 3300009101 | Unclassified | 2309 |
| 363 | Ga0114129_10001294 | 3300009147 | Bacteria | 33348 |
| 364 | Ga0114129_10002457 | 3300009147 | Bacteria | 25726 |
| 365 | Ga0114129_10006209 | 3300009147 | Bacteria | 16950 |
| 366 | Ga0114129_10008621 | 3300009147 | Bacteria | 14537 |
| 367 | Ga0114129_10013305 | 3300009147 | Bacteria | 11729 |
| 368 | Ga0114129_10022844 | 3300009147 | Bacteria | 8869 |
| 369 | Ga0114129_10027092 | 3300009147 | Bacteria | 8115 |
| 370 | Ga0114129_10028182 | 3300009147 | Bacteria | 7957 |
| 371 | Ga0114129_10055196 | 3300009147 | Bacteria | 5569 |
| 372 | Ga0114129_10062679 | 3300009147 | Bacteria | 5193 |
| 373 | Ga0114129_10096224 | 3300009147 | Bacteria | 4099 |
| 374 | Ga0114129_10101489 | 3300009147 | Bacteria | 3981 |
| 375 | Ga0114129_10116915 | 3300009147 | Unclassified | 3675 |
| 376 | Ga0114129_10121320 | 3300009147 | Bacteria | 3597 |
| 377 | Ga0114129_10129796 | 3300009147 | Bacteria | 3463 |
| 378 | Ga0114129_10221239 | 3300009147 | Bacteria | 2554 |
| 379 | Ga0114129_10240049 | 3300009147 | Bacteria | 2436 |
| 380 | Ga0114129_10329959 | 3300009147 | Bacteria | 2026 |
| 381 | Ga0114129_10412042 | 3300009147 | Bacteria | 1779 |
| 382 | Ga0114129_10415252 | 3300009147 | Bacteria | 1771 |
| 383 | Ga0114129_10629028 | 3300009147 | Bacteria | 1387 |
| 384 | Ga0114129_10712688 | 3300009147 | Bacteria | 1288 |
| 385 | Ga0114129_10863037 | 3300009147 | Bacteria | 1150 |
| 386 | Ga0114129_11227867 | 3300009147 | Bacteria | 932 |
| 387 | Ga0105243_10255676 | 3300009148 | Bacteria | 1566 |
| 388 | Ga0105243_10781472 | 3300009148 | Bacteria | 939 |
| 389 | Ga0105241_10038324 | 3300009174 | Bacteria | 3613 |
| 390 | Ga0105241_10053004 | 3300009174 | Bacteria | 3100 |
| 391 | Ga0105241_10628713 | 3300009174 | Bacteria | 973 |
| 392 | Ga0105242_10016080 | 3300009176 | Bacteria | 5812 |
| 393 | Ga0105242_10016312 | 3300009176 | Bacteria | 5776 |
| 394 | Ga0105242_10018000 | 3300009176 | Bacteria | 5519 |
| 395 | Ga0105242_10460910 | 3300009176 | Bacteria | 1200 |
| 396 | Ga0105242_10585001 | 3300009176 | Bacteria | 1076 |
| 397 | Ga0105242_10645287 | 3300009176 | Bacteria | 1029 |
| 398 | Ga0105248_10031306 | 3300009177 | Bacteria | 5945 |
| 399 | Ga0105248_10093562 | 3300009177 | Unclassified | 3385 |
| 400 | Ga0105248_10139977 | 3300009177 | Bacteria | 2729 |
| 401 | Ga0105248_10148033 | 3300009177 | Bacteria | 2649 |
| 402 | Ga0105248_10243788 | 3300009177 | Bacteria | 2023 |
| 403 | Ga0105248_10398371 | 3300009177 | Unclassified | 1550 |
| 404 | Ga0105248_10412292 | 3300009177 | Bacteria | 1521 |
| 405 | Ga0105248_10548766 | 3300009177 | Bacteria | 1304 |
| 406 | Ga0105238_10736138 | 3300009551 | Bacteria | 999 |
| 407 | Ga0105249_10003036 | 3300009553 | Bacteria | 14480 |
| 408 | Ga0105249_10022901 | 3300009553 | Bacteria | 5600 |
| 409 | Ga0105249_10049361 | 3300009553 | Bacteria | 3838 |
| 410 | Ga0105249_10131718 | 3300009553 | Bacteria | 2388 |
| 411 | Ga0105249_10222121 | 3300009553 | Bacteria | 1859 |
| 412 | Ga0105249_10314628 | 3300009553 | Bacteria | 1575 |
| 413 | Ga0105249_10321939 | 3300009553 | Unclassified | 1558 |
| 414 | Ga0105249_10524618 | 3300009553 | Bacteria | 1232 |
| 415 | Ga0157374_10030945 | 3300013296 | Bacteria | 4861 |
| 416 | Ga0157374_10225484 | 3300013296 | Archaea | 1840 |
| 417 | Ga0157374_10324324 | 3300013296 | Bacteria | 1527 |
| 418 | Ga0157378_10058289 | 3300013297 | Bacteria | 3444 |
| 419 | Ga0157378_10080042 | 3300013297 | Bacteria | 2951 |
| 420 | Ga0157378_10411257 | 3300013297 | Bacteria | 1335 |
| 421 | Ga0163162_10133984 | 3300013306 | Bacteria | 2588 |
| 422 | Ga0163162_10152375 | 3300013306 | Unclassified | 2430 |
| 423 | Ga0163162_10225525 | 3300013306 | Bacteria | 2004 |
| 424 | Ga0157375_10084503 | 3300013308 | Bacteria | 3223 |
| 425 | Ga0157375_10394347 | 3300013308 | Unclassified | 1551 |
| 426 | Ga0157375_10404597 | 3300013308 | Bacteria | 1531 |
| 427 | Ga0157375_10490619 | 3300013308 | Bacteria | 1393 |
| 428 | Ga0157375_10551188 | 3300013308 | Bacteria | 1315 |
| 429 | Ga0157375_10907241 | 3300013308 | Bacteria | 1025 |
| 430 | Ga0163163_10004353 | 3300014325 | Bacteria | 12060 |
| 431 | Ga0163163_10149794 | 3300014325 | Bacteria | 2377 |
| 432 | Ga0157380_10008295 | 3300014326 | Bacteria | 7403 |
| 433 | Ga0157380_10019709 | 3300014326 | Bacteria | 5030 |
| 434 | Ga0157380_10071434 | 3300014326 | Bacteria | 2807 |
| 435 | Ga0157380_10076260 | 3300014326 | Bacteria | 2728 |
| 436 | Ga0157380_10241933 | 3300014326 | Bacteria | 1627 |
| 437 | Ga0157379_10026173 | 3300014968 | Bacteria | 5191 |
| 438 | Ga0157376_10048399 | 3300014969 | Bacteria | 3515 |
| 439 | Ga0157376_10420505 | 3300014969 | Bacteria | 1297 |
| 440 | Ga0157376_10521425 | 3300014969 | Bacteria | 1171 |
| 441 | Ga0207697_10102455 | 3300025315 | Bacteria | 1221 |
| 442 | Ga0207656_10077204 | 3300025321 | Unclassified | 1491 |
| 443 | Ga0207682_10039732 | 3300025893 | Bacteria | 1914 |
| 444 | Ga0207682_10136217 | 3300025893 | Bacteria | 1099 |
| 445 | Ga0207642_10040535 | 3300025899 | Bacteria | 2032 |
| 446 | Ga0207680_10126590 | 3300025903 | Bacteria | 1678 |
| 447 | Ga0207699_10141209 | 3300025906 | Bacteria | 1583 |
| 448 | Ga0207699_10175738 | 3300025906 | Bacteria | 1436 |
| 449 | Ga0207645_10032234 | 3300025907 | Bacteria | 3368 |
| 450 | Ga0207645_10049279 | 3300025907 | Bacteria | 2689 |
| 451 | Ga0207645_10087849 | 3300025907 | Unclassified | 1998 |
| 452 | Ga0207645_10155466 | 3300025907 | Bacteria | 1494 |
| 453 | Ga0207645_10215451 | 3300025907 | Bacteria | 1265 |
| 454 | Ga0207645_10289435 | 3300025907 | Bacteria | 1089 |
| 455 | Ga0207643_10021437 | 3300025908 | Bacteria | 3550 |
| 456 | Ga0207643_10059667 | 3300025908 | Bacteria | 2177 |
| 457 | Ga0207684_10002898 | 3300025910 | Bacteria | 17004 |
| 458 | Ga0207684_10018006 | 3300025910 | Bacteria | 6054 |
| 459 | Ga0207684_10107159 | 3300025910 | Bacteria | 2391 |
| 460 | Ga0207684_10192771 | 3300025910 | Bacteria | 1758 |
| 461 | Ga0207684_10293250 | 3300025910 | Bacteria | 1402 |
| 462 | Ga0207684_10646670 | 3300025910 | Bacteria | 901 |
| 463 | Ga0207654_10041097 | 3300025911 | Bacteria | 2609 |
| 464 | Ga0207695_10235075 | 3300025913 | Bacteria | 1735 |
| 465 | Ga0207660_10117351 | 3300025917 | Bacteria | 2011 |
| 466 | Ga0207660_10178651 | 3300025917 | Bacteria | 1647 |
| 467 | Ga0207660_10351067 | 3300025917 | Bacteria | 1182 |
| 468 | Ga0207662_10034224 | 3300025918 | Bacteria | 2965 |
| 469 | Ga0207662_10080037 | 3300025918 | Bacteria | 1992 |
| 470 | Ga0207662_10168725 | 3300025918 | Bacteria | 1402 |
| 471 | Ga0207649_10017165 | 3300025920 | Archaea | 4100 |
| 472 | Ga0207646_10004695 | 3300025922 | Bacteria | 14724 |
| 473 | Ga0207646_10017592 | 3300025922 | Bacteria | 6680 |
| 474 | Ga0207646_10090244 | 3300025922 | Bacteria | 2743 |
| 475 | Ga0207646_10112625 | 3300025922 | Unclassified | 2442 |
| 476 | Ga0207646_10126651 | 3300025922 | Bacteria | 2297 |
| 477 | Ga0207646_10229372 | 3300025922 | Bacteria | 1678 |
| 478 | Ga0207646_10306821 | 3300025922 | Bacteria | 1434 |
| 479 | Ga0207646_10327475 | 3300025922 | Bacteria | 1384 |
| 480 | Ga0207681_10005037 | 3300025923 | Bacteria | 8123 |
| 481 | Ga0207681_10017604 | 3300025923 | Bacteria | 4489 |
| 482 | Ga0207681_10104669 | 3300025923 | Bacteria | 2048 |
| 483 | Ga0207681_10201533 | 3300025923 | Bacteria | 1528 |
| 484 | Ga0207650_10036705 | 3300025925 | Bacteria | 3567 |
| 485 | Ga0207650_10110255 | 3300025925 | Bacteria | 2129 |
| 486 | Ga0207650_10218717 | 3300025925 | Archaea | 1532 |
| 487 | Ga0207659_10000188 | 3300025926 | Bacteria | 36927 |
| 488 | Ga0207659_10014321 | 3300025926 | Bacteria | 5110 |
| 489 | Ga0207659_10018680 | 3300025926 | Bacteria | 4548 |
| 490 | Ga0207659_10134331 | 3300025926 | Bacteria | 1914 |
| 491 | Ga0207659_10269349 | 3300025926 | Bacteria | 1389 |
| 492 | Ga0207659_10355032 | 3300025926 | Bacteria | 1217 |
| 493 | Ga0207659_10464624 | 3300025926 | Bacteria | 1067 |
| 494 | Ga0207687_10022568 | 3300025927 | Bacteria | 4190 |
| 495 | Ga0207687_10367888 | 3300025927 | Bacteria | 1175 |
| 496 | Ga0207700_10008063 | 3300025928 | Bacteria | 6496 |
| 497 | Ga0207700_10034985 | 3300025928 | Bacteria | 3613 |
| 498 | Ga0207644_10106522 | 3300025931 | Archaea | 2114 |
| 499 | Ga0207690_10027586 | 3300025932 | Bacteria | 3590 |
| 500 | Ga0207706_10045956 | 3300025933 | Bacteria | 3867 |
| 501 | Ga0207706_10087817 | 3300025933 | Bacteria | 2734 |
| 502 | Ga0207706_10100969 | 3300025933 | Bacteria | 2538 |
| 503 | Ga0207706_10203135 | 3300025933 | Bacteria | 1738 |
| 504 | Ga0207686_10006180 | 3300025934 | Bacteria | 6436 |
| 505 | Ga0207686_10091048 | 3300025934 | Bacteria | 2014 |
| 506 | Ga0207686_10376889 | 3300025934 | Bacteria | 1075 |
| 507 | Ga0207709_10130829 | 3300025935 | Bacteria | 1710 |
| 508 | Ga0207709_10313972 | 3300025935 | Bacteria | 1170 |
| 509 | Ga0207670_10003997 | 3300025936 | Bacteria | 7874 |
| 510 | Ga0207670_10009084 | 3300025936 | Bacteria | 5647 |
| 511 | Ga0207670_10201744 | 3300025936 | Bacteria | 1511 |
| 512 | Ga0207669_10006704 | 3300025937 | Bacteria | 5281 |
| 513 | Ga0207669_10010515 | 3300025937 | Bacteria | 4458 |
| 514 | Ga0207669_10013007 | 3300025937 | Bacteria | 4116 |
| 515 | Ga0207669_10024631 | 3300025937 | Bacteria | 3238 |
| 516 | Ga0207704_10135832 | 3300025938 | Bacteria | 1711 |
| 517 | Ga0207704_10143235 | 3300025938 | Bacteria | 1675 |
| 518 | Ga0207691_10006107 | 3300025940 | Bacteria | 11642 |
| 519 | Ga0207691_10022906 | 3300025940 | Bacteria | 5886 |
| 520 | Ga0207691_10063906 | 3300025940 | Bacteria | 3336 |
| 521 | Ga0207691_10092316 | 3300025940 | Bacteria | 2711 |
| 522 | Ga0207691_10113871 | 3300025940 | Bacteria | 2403 |
| 523 | Ga0207711_10051889 | 3300025941 | Bacteria | 3514 |
| 524 | Ga0207711_10188431 | 3300025941 | Bacteria | 1879 |
| 525 | Ga0207711_10255968 | 3300025941 | Bacteria | 1608 |
| 526 | Ga0207711_10576602 | 3300025941 | Bacteria | 1049 |
| 527 | Ga0207689_10017760 | 3300025942 | Bacteria | 6011 |
| 528 | Ga0207689_10079510 | 3300025942 | Bacteria | 2694 |
| 529 | Ga0207689_10083757 | 3300025942 | Bacteria | 2622 |
| 530 | Ga0207689_10115149 | 3300025942 | Bacteria | 2210 |
| 531 | Ga0207661_10011215 | 3300025944 | Bacteria | 6484 |
| 532 | Ga0207661_10156657 | 3300025944 | Archaea | 1973 |
| 533 | Ga0207679_10002659 | 3300025945 | Bacteria | 11028 |
| 534 | Ga0207679_10124202 | 3300025945 | Bacteria | 2060 |
| 535 | Ga0207679_10126194 | 3300025945 | Bacteria | 2045 |
| 536 | Ga0207679_10363460 | 3300025945 | Unclassified | 1264 |
| 537 | Ga0207667_10278442 | 3300025949 | Bacteria | 1709 |
| 538 | Ga0207651_10023379 | 3300025960 | Bacteria | 3800 |
| 539 | Ga0207651_10025902 | 3300025960 | Unclassified | 3653 |
| 540 | Ga0207651_10052833 | 3300025960 | Bacteria | 2773 |
| 541 | Ga0207651_10111975 | 3300025960 | Bacteria | 2051 |
| 542 | Ga0207651_10195355 | 3300025960 | Bacteria | 1617 |
| 543 | Ga0207651_10204382 | 3300025960 | Bacteria | 1585 |
| 544 | Ga0207651_10268256 | 3300025960 | Bacteria | 1405 |
| 545 | Ga0207712_10018953 | 3300025961 | Bacteria | 4489 |
| 546 | Ga0207712_10088448 | 3300025961 | Bacteria | 2274 |
| 547 | Ga0207712_10155321 | 3300025961 | Bacteria | 1772 |
| 548 | Ga0207712_10453719 | 3300025961 | Bacteria | 1088 |
| 549 | Ga0207712_10474054 | 3300025961 | Unclassified | 1066 |
| 550 | Ga0207668_10063637 | 3300025972 | Bacteria | 2603 |
| 551 | Ga0207668_10150746 | 3300025972 | Bacteria | 1800 |
| 552 | Ga0207668_10185652 | 3300025972 | Bacteria | 1644 |
| 553 | Ga0207640_10030010 | 3300025981 | Bacteria | 3345 |
| 554 | Ga0207640_10037127 | 3300025981 | Bacteria | 3063 |
| 555 | Ga0207658_10181141 | 3300025986 | Bacteria | 1744 |
| 556 | Ga0207658_10226951 | 3300025986 | Archaea | 1574 |
| 557 | Ga0207658_10530718 | 3300025986 | Bacteria | 1051 |
| 558 | Ga0207677_10017072 | 3300026023 | Bacteria | 4317 |
| 559 | Ga0207677_10017810 | 3300026023 | Bacteria | 4247 |
| 560 | Ga0207677_10249195 | 3300026023 | Bacteria | 1441 |
| 561 | Ga0207703_10004262 | 3300026035 | Bacteria | 11766 |
| 562 | Ga0207703_10138768 | 3300026035 | Archaea | 2108 |
| 563 | Ga0207703_10230660 | 3300026035 | Unclassified | 1660 |
| 564 | Ga0207703_10351998 | 3300026035 | Unclassified | 1356 |
| 565 | Ga0207678_10015984 | 3300026067 | Bacteria | 6591 |
| 566 | Ga0207708_10011404 | 3300026075 | Bacteria | 6621 |
| 567 | Ga0207708_10016816 | 3300026075 | Bacteria | 5508 |
| 568 | Ga0207708_10026800 | 3300026075 | Bacteria | 4363 |
| 569 | Ga0207708_10033011 | 3300026075 | Bacteria | 3931 |
| 570 | Ga0207708_10033034 | 3300026075 | Bacteria | 3930 |
| 571 | Ga0207708_10050529 | 3300026075 | Bacteria | 3165 |
| 572 | Ga0207708_10067724 | 3300026075 | Bacteria | 2732 |
| 573 | Ga0207708_10091051 | 3300026075 | Bacteria | 2351 |
| 574 | Ga0207708_10149787 | 3300026075 | Bacteria | 1836 |
| 575 | Ga0207641_10207438 | 3300026088 | Bacteria | 1810 |
| 576 | Ga0207641_10493090 | 3300026088 | Bacteria | 1189 |
| 577 | Ga0207648_10001860 | 3300026089 | Bacteria | 23055 |
| 578 | Ga0207648_10031489 | 3300026089 | Bacteria | 4690 |
| 579 | Ga0207648_10050958 | 3300026089 | Bacteria | 3619 |
| 580 | Ga0207648_10102995 | 3300026089 | Bacteria | 2503 |
| 581 | Ga0207676_10024049 | 3300026095 | Bacteria | 4504 |
| 582 | Ga0207676_10027327 | 3300026095 | Bacteria | 4249 |
| 583 | Ga0207676_10042656 | 3300026095 | Bacteria | 3490 |
| 584 | Ga0207676_10069868 | 3300026095 | Bacteria | 2814 |
| 585 | Ga0207676_10223604 | 3300026095 | Bacteria | 1678 |
| 586 | Ga0207674_10023655 | 3300026116 | Bacteria | 6577 |
| 587 | Ga0207674_10044046 | 3300026116 | Bacteria | 4599 |
| 588 | Ga0207674_10052540 | 3300026116 | Bacteria | 4156 |
| 589 | Ga0207674_10122262 | 3300026116 | Bacteria | 2569 |
| 590 | Ga0207674_10161279 | 3300026116 | Archaea | 2196 |
| 591 | Ga0207675_100006022 | 3300026118 | Bacteria | 11541 |
| 592 | Ga0207675_100022659 | 3300026118 | Bacteria | 5845 |
| 593 | Ga0207675_100048529 | 3300026118 | Bacteria | 3963 |
| 594 | Ga0207675_100050645 | 3300026118 | Bacteria | 3875 |
| 595 | Ga0207675_100051051 | 3300026118 | Unclassified | 3859 |
| 596 | Ga0207675_100061364 | 3300026118 | Bacteria | 3509 |
| 597 | Ga0207675_100339845 | 3300026118 | Bacteria | 1469 |
| 598 | Ga0207675_100427718 | 3300026118 | Bacteria | 1308 |
| 599 | Ga0207683_10039938 | 3300026121 | Bacteria | 4093 |
| 600 | Ga0207683_10053529 | 3300026121 | Bacteria | 3539 |
| 601 | Ga0207683_10078856 | 3300026121 | Bacteria | 2919 |
| 602 | Ga0207683_10461497 | 3300026121 | Bacteria | 1171 |
| 603 | Ga0207698_10360865 | 3300026142 | Bacteria | 1376 |
| 604 | Ga0209813_10007956 | 3300027866 | Bacteria | 2660 |
| 605 | Ga0209974_10086695 | 3300027876 | Bacteria | 1082 |
| 606 | Ga0207428_10000005 | 3300027907 | Bacteria | 520045 |
| 607 | Ga0207428_10000963 | 3300027907 | Bacteria | 31936 |
| 608 | Ga0207428_10001556 | 3300027907 | Bacteria | 23960 |
| 609 | Ga0207428_10001740 | 3300027907 | Bacteria | 22291 |
| 610 | Ga0207428_10019076 | 3300027907 | Bacteria | 5849 |
| 611 | Ga0207428_10061765 | 3300027907 | Unclassified | 2965 |
| 612 | Ga0207428_10217213 | 3300027907 | Bacteria | 1434 |
| 613 | Ga0207428_10428309 | 3300027907 | Unclassified | 966 |
| 614 | Ga0268265_10000183 | 3300028380 | Bacteria | 74487 |
| 615 | Ga0268265_10038688 | 3300028380 | Bacteria | 3510 |
| 616 | Ga0268265_10095582 | 3300028380 | Bacteria | 2386 |
| 617 | Ga0268265_10223540 | 3300028380 | Bacteria | 1649 |
| 618 | Ga0268265_10399988 | 3300028380 | Bacteria | 1269 |
| 619 | Ga0268265_10712833 | 3300028380 | Bacteria | 970 |
| 620 | Ga0268264_10006097 | 3300028381 | Bacteria | 10186 |
| 621 | Ga0268264_10309429 | 3300028381 | Bacteria | 1490 |
| 622 | Ga0265323_10004413 | 3300028653 | Bacteria | 6067 |
| 623 | Ga0265338_10021154 | 3300028800 | Bacteria | 6798 |
| 624 | Ga0265324_10012498 | 3300029957 | Bacteria | 3198 |
| 625 | Ga0316579_10027907 | 3300031691 | Bacteria | 2567 |
| 626 | Ga0316579_10037408 | 3300031691 | Unclassified | 2242 |
| 627 | Ga0265314_10037448 | 3300031711 | Bacteria | 3515 |
| 628 | Ga0316576_10002816 | 3300031727 | Bacteria | 10008 |
| 629 | Ga0316576_10276245 | 3300031727 | Bacteria | 1259 |
| 630 | Ga0316576_10358649 | 3300031727 | Bacteria | 1084 |
| 631 | Ga0307410_10304204 | 3300031852 | Bacteria | 1259 |
| 632 | Ga0307406_10133876 | 3300031901 | Bacteria | 1744 |
| 633 | Ga0307407_10215608 | 3300031903 | Bacteria | 1295 |
| 634 | Ga0307412_10497176 | 3300031911 | Bacteria | 1014 |
| 635 | Ga0307409_100056429 | 3300031995 | Bacteria | 3037 |
| 636 | Ga0307409_100142266 | 3300031995 | Bacteria | 2069 |
| 637 | Ga0307409_100149029 | 3300031995 | Bacteria | 2028 |
| 638 | Ga0307416_100025487 | 3300032002 | Bacteria | 4335 |
| 639 | Ga0307416_100102786 | 3300032002 | Bacteria | 2493 |
| 640 | Ga0307411_10110595 | 3300032005 | Bacteria | 1965 |
| 641 | Ga0307411_10325373 | 3300032005 | Bacteria | 1243 |
| 642 | Ga0307415_100222295 | 3300032126 | Bacteria | 1515 |
| 643 | Ga0373930_0011111 | 3300034816 | Bacteria | 1621 |
| 644 | Ga0373958_0012953 | 3300034819 | Bacteria | 1435 |
| 645 | Ga0373958_0021785 | 3300034819 | Bacteria | 1192 |
| 646 | Ga0373929_0001104 | 3300035085 | Bacteria | 5244 |
| 647 | Ga0373940_0000039 | 3300035088 | Bacteria | 14131 |
| 648 | Ga0373940_0069588 | 3300035088 | Bacteria | 1022 |
| 649 | Ga0373949_0001162 | 3300035090 | Bacteria | 7856 |
| 650 | Ga0373951_0002100 | 3300035091 | Bacteria | 5107 |
| 651 | Ga0373932_0002751 | 3300035112 | Bacteria | 4374 |
| 652 | Ga0373932_0061243 | 3300035112 | Bacteria | 1144 |
| 653 | Ga0373936_0118575 | 3300035113 | Bacteria | 1129 |
| 654 | Ga0373939_0000940 | 3300035114 | Bacteria | 7249 |
| 655 | Ga0373941_0001349 | 3300035115 | Bacteria | 5162 |
| 656 | Ga0373945_0037248 | 3300035116 | Bacteria | 1745 |
| 657 | Ga0373954_0088662 | 3300035118 | Bacteria | 1484 |
| 658 | Ga0373956_0084511 | 3300035119 | Bacteria | 1459 |
| 659 | Ga0373960_0001226 | 3300035121 | Bacteria | 5615 |
| 660 | Ga0373943_0003982 | 3300035170 | Bacteria | 6721 |
| 661 | Ga0373943_0186533 | 3300035170 | Bacteria | 1142 |
| 662 | Ga0373943_0220576 | 3300035170 | Unclassified | 1056 |
| 663 | Ga0373946_0008520 | 3300035171 | Bacteria | 3764 |
| 664 | Ga0373946_0251858 | 3300035171 | Bacteria | 862 |
| 665 | Ga0373955_0074212 | 3300035172 | Bacteria | 1908 |
| 666 | Ga0373955_0075377 | 3300035172 | Bacteria | 1896 |
| 667 | Ga0373942_0000750 | 3300035207 | Bacteria | 8943 |
| 668 | Ga0373961_0002991 | 3300035241 | Bacteria | 4263 |
| 669 | Ga0373961_0064211 | 3300035241 | Bacteria | 1122 |
| 670 | Ga0373962_0000766 | 3300035242 | Bacteria | 7324 |
| 671 | Ga0316574_0049704 | 3300035398 | Bacteria | 2608 |
| 672 | Ga0316574_0165455 | 3300035398 | Bacteria | 1424 |
| 673 | Ga0316574_0267273 | 3300035398 | Bacteria | 1091 |
| 674 | Ga0373924_0010419 | 3300035410 | Bacteria | 3425 |
| 675 | Ga0373924_0121792 | 3300035410 | Bacteria | 1132 |
| 676 | Ga0373931_0001453 | 3300035691 | Bacteria | 10179 |
| 677 | Ga0373931_0065359 | 3300035691 | Bacteria | 1971 |
| 678 | Ga0373935_0026673 | 3300035692 | Bacteria | 3569 |
| 679 | Ga0373935_0261811 | 3300035692 | Bacteria | 1213 |
| 680 | Ga0373927_0031710 | 3300035695 | Bacteria | 3444 |
| 681 | Ga0373933_0024873 | 3300035724 | Bacteria | 3431 |
| 682 | Ga0373933_0132775 | 3300035724 | Bacteria | 1566 |
| 683 | Ga0373937_0003122 | 3300036401 | Bacteria | 13861 |
| 684 | Ga0373937_0031300 | 3300036401 | Bacteria | 4820 |
| 685 | Ga0373937_0279887 | 3300036401 | Bacteria | 1575 |
| 686 | Ga0373937_0300272 | 3300036401 | Bacteria | 1518 |
| 687 | Ga0373937_0361320 | 3300036401 | Bacteria | 1376 |
| 688 | Ga0316582_0033596 | 3300036647 | Bacteria | 3152 |
| 689 | Ga0316582_0094238 | 3300036647 | Bacteria | 1975 |
| 690 | Ga0373925_0005452 | 3300037068 | Bacteria | 9475 |
| 691 | Ga0373925_0196828 | 3300037068 | Bacteria | 1601 |
| 692 | Ga0373925_0455971 | 3300037068 | Bacteria | 1047 |
| 693 | Ga0436365_0993952 | 3300039437 | Bacteria | 1004 |
| 694 | Ga0439461_0008604 | 3300041410 | Bacteria | 1833 |
| 695 | Ga0439433_0007182 | 3300041999 | Bacteria | 2404 |
| 696 | Ga0439441_048546 | 3300042001 | Bacteria | 869 |
| 697 | Ga0439445_0041035 | 3300042004 | Bacteria | 1229 |
| 698 | Ga0439457_107273 | 3300042014 | Bacteria | 654 |
| 699 | Ga0450920_041037 | 3300042122 | Bacteria | 923 |
| 700 | Ga0450923_003766 | 3300042125 | Bacteria | 2323 |
| 701 | Ga0450896_027603 | 3300042133 | Bacteria | 850 |
| 702 | Ga0439446_0006628 | 3300042156 | Bacteria | 3028 |
| 703 | Ga0439446_0009351 | 3300042156 | Bacteria | 2624 |
| 704 | Ga0439434_0020742 | 3300042435 | Bacteria | 1974 |
| 705 | Ga0439434_0024883 | 3300042435 | Bacteria | 1807 |
| 706 | Ga0439435_0005134 | 3300042436 | Bacteria | 2865 |
| 707 | Ga0451577_0001014 | 3300042876 | Bacteria | 40843 |
| 708 | Ga0451577_0028596 | 3300042876 | Bacteria | 5039 |
| 709 | Ga0451577_0092147 | 3300042876 | Bacteria | 2706 |
| 710 | Ga0439440_0100124 | 3300042993 | Bacteria | 788 |
| 711 | Ga0453684_0000004 | 3300044712 | Bacteria | 1469893 |
| 712 | Ga0453684_0066994 | 3300044712 | Bacteria | 4569 |
| 713 | Ga0453684_0168852 | 3300044712 | Bacteria | 2580 |
| 714 | Ga0453684_0547163 | 3300044712 | Bacteria | 1276 |
| 715 | Ga0451576_0002751 | 3300045051 | Bacteria | 25497 |
| 716 | Ga0451576_0004039 | 3300045051 | Bacteria | 19473 |
| 717 | Ga0451576_0011011 | 3300045051 | Bacteria | 10327 |
| 718 | Ga0451576_0035312 | 3300045051 | Bacteria | 5305 |
| 719 | Ga0451576_0093800 | 3300045051 | Bacteria | 3121 |
| 720 | Ga0451576_0289303 | 3300045051 | Bacteria | 1713 |
| 721 | Ga0451576_0388698 | 3300045051 | Bacteria | 1462 |
| 722 | Ga0495592_0147312 | 3300046454 | Bacteria | 1631 |
| 723 | Ga0495603_0006665 | 3300046455 | Bacteria | 6930 |
| 724 | Ga0495629_0001864 | 3300046459 | Bacteria | 16488 |
| 725 | Ga0495638_0020091 | 3300046460 | Bacteria | 4414 |
| 726 | Ga0495651_0124323 | 3300046462 | Bacteria | 1891 |
| 727 | Ga0495651_0188806 | 3300046462 | Bacteria | 1452 |
| 728 | Ga0495580_0154759 | 3300046472 | Bacteria | 1588 |
| 729 | Ga0495639_0095330 | 3300046475 | Bacteria | 1400 |
| 730 | Ga0495639_0232697 | 3300046475 | Bacteria | 908 |
| 731 | Ga0495664_0129466 | 3300046477 | Bacteria | 1528 |
| 732 | Ga0495664_0206431 | 3300046477 | Bacteria | 1190 |
| 733 | Ga0495584_0029632 | 3300046491 | Bacteria | 2775 |
| 734 | Ga0495584_0164844 | 3300046491 | Unclassified | 1126 |
| 735 | Ga0495594_0050120 | 3300046499 | Bacteria | 2296 |
| 736 | Ga0495608_0001856 | 3300046511 | Bacteria | 15079 |
| 737 | Ga0495628_0053229 | 3300046516 | Bacteria | 3195 |
| 738 | Ga0495630_0003013 | 3300046517 | Bacteria | 11686 |
| 739 | Ga0495644_0039341 | 3300046523 | Bacteria | 1783 |
| 740 | Ga0495663_0090808 | 3300046525 | Unclassified | 995 |
| 741 | Ga0495642_0004422 | 3300046528 | Bacteria | 5456 |
| 742 | Ga0495642_0098933 | 3300046528 | Bacteria | 1240 |
| 743 | Ga0495652_0354473 | 3300046529 | Bacteria | 1050 |
| 744 | Ga0495586_0265383 | 3300046535 | Bacteria | 981 |
| 745 | Ga0495587_0085683 | 3300046536 | Bacteria | 1824 |
| 746 | Ga0495598_0003522 | 3300046537 | Bacteria | 3337 |
| 747 | Ga0495598_0012767 | 3300046537 | Bacteria | 2070 |
| 748 | Ga0495609_0049776 | 3300046538 | Bacteria | 1869 |
| 749 | Ga0495609_0196663 | 3300046538 | Bacteria | 844 |
| 750 | Ga0495621_0067618 | 3300046539 | Bacteria | 1310 |
| 751 | Ga0495621_0136917 | 3300046539 | Bacteria | 956 |
| 752 | Ga0495621_0162226 | 3300046539 | Bacteria | 884 |
| 753 | Ga0495645_0003630 | 3300046543 | Bacteria | 10481 |
| 754 | Ga0495645_0011692 | 3300046543 | Bacteria | 6179 |
| 755 | Ga0495645_0206925 | 3300046543 | Bacteria | 1327 |
| 756 | Ga0495633_0018672 | 3300046558 | Bacteria | 3519 |
| 757 | Ga0495667_0023699 | 3300046559 | Bacteria | 4134 |
| 758 | Ga0495656_0017840 | 3300046615 | Bacteria | 2715 |
| 759 | Ga0495656_0058075 | 3300046615 | Bacteria | 1678 |
| 760 | Ga0495635_0062022 | 3300046663 | Bacteria | 2567 |
| 761 | Ga0495635_0150703 | 3300046663 | Bacteria | 1583 |
| 762 | Ga0495659_0010701 | 3300046664 | Bacteria | 2950 |
| 763 | Ga0495659_0013333 | 3300046664 | Bacteria | 2677 |
| 764 | Ga0495659_0042079 | 3300046664 | Bacteria | 1634 |
| 765 | Ga0495659_0049722 | 3300046664 | Bacteria | 1523 |
| 766 | Ga0495659_0104522 | 3300046664 | Bacteria | 1100 |
| 767 | Ga0495588_0024900 | 3300046674 | Bacteria | 2977 |
| 768 | Ga0495599_0039434 | 3300046678 | Bacteria | 2968 |
| 769 | Ga0495599_0100107 | 3300046678 | Bacteria | 1807 |
| 770 | Ga0495658_0015799 | 3300046683 | Bacteria | 3878 |
| 771 | Ga0495658_0150951 | 3300046683 | Bacteria | 1427 |
| 772 | Ga0495658_0151640 | 3300046683 | Bacteria | 1424 |
| 773 | Ga0495669_0013753 | 3300046684 | Bacteria | 3454 |
| 774 | Ga0495669_0019300 | 3300046684 | Bacteria | 2941 |
| 775 | Ga0495669_0037536 | 3300046684 | Bacteria | 2144 |
| 776 | Ga0495669_0096286 | 3300046684 | Unclassified | 1371 |
| 777 | Ga0495613_0000599 | 3300046689 | Bacteria | 29031 |
| 778 | Ga0495613_0161684 | 3300046689 | Bacteria | 1593 |
| 779 | Ga0495613_0267061 | 3300046689 | Bacteria | 1191 |
| 780 | Ga0495600_0003980 | 3300046809 | Bacteria | 8780 |
| 781 | Ga0495600_0063933 | 3300046809 | Bacteria | 2405 |
| 782 | Ga0495604_0014504 | 3300047317 | Bacteria | 6284 |
| 783 | Ga0495636_0100582 | 3300047318 | Bacteria | 1264 |
| 784 | Ga0495674_0050049 | 3300047319 | Bacteria | 3688 |
| 785 | Ga0495674_0074426 | 3300047319 | Bacteria | 2925 |
| 786 | Ga0495672_0001565 | 3300047320 | Bacteria | 22401 |
| 787 | Ga0495677_0026679 | 3300047445 | Bacteria | 2095 |
| 788 | Ga0495685_018711 | 3300047447 | Unclassified | 2378 |
| 789 | Ga0495684_0000310 | 3300047471 | Bacteria | 39859 |
| 790 | Ga0495684_0112833 | 3300047471 | Bacteria | 2050 |
| 791 | Ga0495684_0146073 | 3300047471 | Bacteria | 1771 |
| 792 | Ga0495684_0352374 | 3300047471 | Bacteria | 1045 |
| 793 | Ga0496100_0214982 | 3300048903 | Archaea | 1408 |
| 794 | Ga0496101_0001671 | 3300048904 | Bacteria | 13309 |
| 795 | Ga0496102_0032144 | 3300048905 | Bacteria | 4714 |
| 796 | Ga0496104_0003276 | 3300048907 | Bacteria | 13967 |
| 797 | Ga0496104_0088057 | 3300048907 | Unclassified | 2966 |
| 798 | Ga0496104_0179311 | 3300048907 | Unclassified | 2029 |
| 799 | Ga0496105_0045285 | 3300048908 | Bacteria | 3630 |
| 800 | Ga0496105_0124553 | 3300048908 | Unclassified | 2125 |
| 801 | Ga0496105_0156700 | 3300048908 | Bacteria | 1870 |
| 802 | Ga0496106_0037860 | 3300048909 | Bacteria | 3609 |
| 803 | Ga0496106_0157814 | 3300048909 | Bacteria | 1793 |
| 804 | Ga0496107_0258932 | 3300048910 | Bacteria | 1295 |
| 805 | Ga0496108_0004502 | 3300048911 | Bacteria | 11225 |
| 806 | Ga0496109_0001333 | 3300048912 | Bacteria | 20382 |
| 807 | Ga0496109_0304142 | 3300048912 | Bacteria | 1504 |
| 808 | Ga0496110_0001226 | 3300048913 | Bacteria | 18281 |
| 809 | Ga0496112_0033138 | 3300048915 | Bacteria | 5019 |
| 810 | Ga0496112_0414005 | 3300048915 | Bacteria | 1287 |
| 811 | Ga0496113_0133691 | 3300048916 | Archaea | 1948 |
| 812 | Ga0496114_0001180 | 3300048917 | Bacteria | 19796 |
| 813 | Ga0496114_0233106 | 3300048917 | Bacteria | 1618 |
| 814 | Ga0496115_0228113 | 3300048918 | Unclassified | 1536 |
| 815 | Ga0501298_006448 | 3300049521 | Bacteria | 1919 |
| 816 | Ga0501031_0128708 | 3300049568 | Bacteria | 1654 |
| 817 | Ga0501031_0335599 | 3300049568 | Bacteria | 979 |
| 818 | Ga0501032_0395640 | 3300049569 | Bacteria | 888 |
| 819 | Ga0501033_0060564 | 3300049570 | Bacteria | 2792 |
| 820 | Ga0501034_0004031 | 3300049571 | Bacteria | 16482 |
| 821 | Ga0501036_0013404 | 3300049572 | Bacteria | 6812 |
| 822 | Ga0501036_0063161 | 3300049572 | Bacteria | 3136 |
| 823 | Ga0501036_0075501 | 3300049572 | Bacteria | 2850 |
| 824 | Ga0501036_0096531 | 3300049572 | Bacteria | 2499 |
| 825 | Ga0501036_0205940 | 3300049572 | Bacteria | 1654 |
| 826 | Ga0501037_0075725 | 3300049573 | Bacteria | 2444 |
| 827 | Ga0501038_0043999 | 3300049574 | Bacteria | 3881 |
| 828 | Ga0501038_0063821 | 3300049574 | Bacteria | 3143 |
| 829 | Ga0501038_0160861 | 3300049574 | Bacteria | 1825 |
| 830 | Ga0501039_0111878 | 3300049575 | Bacteria | 2135 |
| 831 | Ga0501039_0158973 | 3300049575 | Bacteria | 1776 |
| 832 | Ga0501039_0170020 | 3300049575 | Bacteria | 1714 |
| 833 | Ga0501040_0004377 | 3300049576 | Bacteria | 9182 |
| 834 | Ga0501040_0006548 | 3300049576 | Bacteria | 7562 |
| 835 | Ga0501040_0033622 | 3300049576 | Bacteria | 3475 |
| 836 | Ga0501040_0111652 | 3300049576 | Bacteria | 1912 |
| 837 | Ga0501040_0130769 | 3300049576 | Bacteria | 1765 |
| 838 | Ga0501041_0047271 | 3300049577 | Bacteria | 2619 |
| 839 | Ga0501041_0162432 | 3300049577 | Bacteria | 1397 |
| 840 | Ga0501041_0196082 | 3300049577 | Bacteria | 1265 |
| 841 | Ga0501041_0218489 | 3300049577 | Bacteria | 1196 |
| 842 | Ga0501042_0022598 | 3300049578 | Bacteria | 4395 |
| 843 | Ga0501042_0315804 | 3300049578 | Bacteria | 1129 |
| 844 | Ga0501042_0469976 | 3300049578 | Bacteria | 912 |
| 845 | Ga0501042_0481416 | 3300049578 | Bacteria | 901 |
| 846 | Ga0501043_0112868 | 3300049579 | Bacteria | 2134 |
| 847 | Ga0501048_0021740 | 3300049582 | Bacteria | 4695 |
| 848 | Ga0501048_0025224 | 3300049582 | Bacteria | 4333 |
| 849 | Ga0501048_0031371 | 3300049582 | Bacteria | 3844 |
| 850 | Ga0501048_0071723 | 3300049582 | Bacteria | 2445 |
| 851 | Ga0501048_0212123 | 3300049582 | Bacteria | 1373 |
| 852 | Ga0501048_0401835 | 3300049582 | Bacteria | 979 |
| 853 | Ga0501067_0285894 | 3300049583 | Bacteria | 918 |
| 854 | Ga0501068_0149337 | 3300049584 | Bacteria | 1468 |
| 855 | Ga0501071_0022159 | 3300049587 | Bacteria | 4427 |
| 856 | Ga0501071_0026347 | 3300049587 | Bacteria | 4080 |
| 857 | Ga0501071_0037102 | 3300049587 | Bacteria | 3479 |
| 858 | Ga0501071_0037251 | 3300049587 | Bacteria | 3472 |
| 859 | Ga0501071_0192236 | 3300049587 | Bacteria | 1531 |
| 860 | Ga0501071_0361244 | 3300049587 | Bacteria | 1106 |
| 861 | Ga0501071_0521535 | 3300049587 | Bacteria | 912 |
| 862 | Ga0501071_0632167 | 3300049587 | Bacteria | 823 |
| 863 | Ga0501072_0007310 | 3300049588 | Bacteria | 8376 |
| 864 | Ga0501072_0022930 | 3300049588 | Bacteria | 4846 |
| 865 | Ga0501072_0025475 | 3300049588 | Bacteria | 4608 |
| 866 | Ga0501072_0264862 | 3300049588 | Bacteria | 1368 |
| 867 | Ga0501072_0270104 | 3300049588 | Bacteria | 1353 |
| 868 | Ga0501073_0004289 | 3300049589 | Bacteria | 10697 |
| 869 | Ga0501073_0045987 | 3300049589 | Bacteria | 3072 |
| 870 | Ga0501074_0061265 | 3300049590 | Bacteria | 2711 |
| 871 | Ga0501074_0061528 | 3300049590 | Bacteria | 2705 |
| 872 | Ga0501074_0149674 | 3300049590 | Bacteria | 1669 |
| 873 | Ga0501074_0178990 | 3300049590 | Bacteria | 1513 |
| 874 | Ga0501075_0010372 | 3300049591 | Bacteria | 6546 |
| 875 | Ga0501075_0014416 | 3300049591 | Bacteria | 5663 |
| 876 | Ga0501075_0015936 | 3300049591 | Bacteria | 5405 |
| 877 | Ga0501075_0026624 | 3300049591 | Bacteria | 4259 |
| 878 | Ga0501075_0027486 | 3300049591 | Bacteria | 4193 |
| 879 | Ga0501075_0339000 | 3300049591 | Bacteria | 1146 |
| 880 | Ga0501075_0430463 | 3300049591 | Bacteria | 1006 |
| 881 | Ga0501076_0008303 | 3300049592 | Bacteria | 7609 |
| 882 | Ga0501076_0014435 | 3300049592 | Bacteria | 5950 |
| 883 | Ga0501076_0018379 | 3300049592 | Bacteria | 5329 |
| 884 | Ga0501076_0024644 | 3300049592 | Bacteria | 4653 |
| 885 | Ga0501076_0033580 | 3300049592 | Bacteria | 4006 |
| 886 | Ga0501076_0112103 | 3300049592 | Bacteria | 2206 |
| 887 | Ga0501076_0277677 | 3300049592 | Bacteria | 1372 |
| 888 | Ga0501076_0558450 | 3300049592 | Bacteria | 944 |
| 889 | Ga0501077_0114031 | 3300049593 | Bacteria | 1714 |
| 890 | Ga0501077_0120443 | 3300049593 | Bacteria | 1663 |
| 891 | Ga0501077_0304536 | 3300049593 | Bacteria | 1015 |
| 892 | Ga0501077_0484655 | 3300049593 | Bacteria | 793 |
| 893 | Ga0501079_0039777 | 3300049741 | Bacteria | 3627 |
| 894 | Ga0501079_0041256 | 3300049741 | Bacteria | 3562 |
| 895 | Ga0501079_0080999 | 3300049741 | Bacteria | 2510 |
| 896 | Ga0501079_0117863 | 3300049741 | Bacteria | 2064 |
| 897 | Ga0501079_0309187 | 3300049741 | Bacteria | 1237 |
| 898 | Ga0501079_0401812 | 3300049741 | Bacteria | 1074 |
| 899 | Ga0501080_0047614 | 3300049742 | Bacteria | 3992 |
| 900 | Ga0501080_0568157 | 3300049742 | Bacteria | 1009 |
| 901 | Ga0501080_0753648 | 3300049742 | Bacteria | 856 |
| 902 | Ga0501081_0008536 | 3300049743 | Bacteria | 6659 |
| 903 | Ga0501081_0009062 | 3300049743 | Bacteria | 6469 |
| 904 | Ga0501081_0038621 | 3300049743 | Bacteria | 3263 |
| 905 | Ga0501081_0059835 | 3300049743 | Bacteria | 2638 |
| 906 | Ga0501081_0062692 | 3300049743 | Bacteria | 2579 |
| 907 | Ga0501081_0223625 | 3300049743 | Bacteria | 1369 |
| 908 | Ga0501081_0415026 | 3300049743 | Bacteria | 997 |
| 909 | Ga0501081_0554685 | 3300049743 | Bacteria | 858 |
| 910 | Ga0501045_0011826 | 3300049824 | Bacteria | 6131 |
| 911 | Ga0501045_0018556 | 3300049824 | Bacteria | 4949 |
| 912 | Ga0501045_0065071 | 3300049824 | Bacteria | 2677 |
| 913 | Ga0501045_0164990 | 3300049824 | Bacteria | 1650 |
| 914 | Ga0501045_0430481 | 3300049824 | Bacteria | 981 |
| 915 | Ga0501045_0477941 | 3300049824 | Bacteria | 926 |
| 916 | nmdc:mga03683_3241_c1 | 3300050489 | Bacteria | 5213 |
| 917 | nmdc:mga03683_66316_c1 | 3300050489 | Bacteria | 1535 |
| 918 | nmdc:mga03n38_220435_c1 | 3300050490 | Bacteria | 990 |
| 919 | nmdc:mga00v17_16883_c1 | 3300050491 | Bacteria | 4121 |
| 920 | nmdc:mga00v17_171208_c1 | 3300050491 | Bacteria | 1400 |
| 921 | nmdc:mga00v17_34078_c1 | 3300050491 | Bacteria | 3022 |
| 922 | nmdc:mga0yw44_2299_c1 | 3300050492 | Bacteria | 8079 |
| 923 | nmdc:mga0yw44_497700_c1 | 3300050492 | Bacteria | 827 |
| 924 | nmdc:mga0k408_28290_c2 | 3300050493 | Bacteria | 2777 |
| 925 | nmdc:mga0k408_4177_c1 | 3300050493 | Bacteria | 7666 |
| 926 | nmdc:mga06z11_17737_c1 | 3300050494 | Bacteria | 3238 |
| 927 | nmdc:mga06z11_3555_c1 | 3300050494 | Bacteria | 6037 |
| 928 | nmdc:mga06z11_50315_c1 | 3300050494 | Bacteria | 2129 |
| 929 | nmdc:mga06z11_5154_c1 | 3300050494 | Bacteria | 5214 |
| 930 | nmdc:mga06z11_9088_c1 | 3300050494 | Bacteria | 4174 |
| 931 | nmdc:mga04h51_126451_c1 | 3300050495 | Bacteria | 957 |
| 932 | nmdc:mga04h51_9279_c1 | 3300050495 | Bacteria | 2660 |
| 933 | nmdc:mga05p37_100630_c1 | 3300050507 | Unclassified | 3560 |
| 934 | nmdc:mga05p37_130274_c1 | 3300050507 | Bacteria | 3086 |
| 935 | nmdc:mga05p37_134259_c1 | 3300050507 | Bacteria | 3036 |
| 936 | nmdc:mga05p37_135291_c1 | 3300050507 | Bacteria | 3023 |
| 937 | nmdc:mga05p37_145751_c1 | 3300050507 | Bacteria | 2900 |
| 938 | nmdc:mga05p37_165753_c1 | 3300050507 | Bacteria | 2697 |
| 939 | nmdc:mga05p37_1682_c1 | 3300050507 | Bacteria | 25731 |
| 940 | nmdc:mga05p37_188854_c1 | 3300050507 | Bacteria | 2503 |
| 941 | nmdc:mga05p37_200646_c1 | 3300050507 | Bacteria | 2416 |
| 942 | nmdc:mga05p37_228487_c1 | 3300050507 | Bacteria | 2243 |
| 943 | nmdc:mga05p37_22858_c1 | 3300050507 | Bacteria | 7583 |
| 944 | nmdc:mga05p37_240985_c1 | 3300050507 | Bacteria | 2174 |
| 945 | nmdc:mga05p37_28735_c1 | 3300050507 | Bacteria | 6784 |
| 946 | nmdc:mga05p37_367296_c1 | 3300050507 | Bacteria | 1690 |
| 947 | nmdc:mga05p37_40463_c1 | 3300050507 | Bacteria | 5725 |
| 948 | nmdc:mga05p37_423797_c1 | 3300050507 | Bacteria | 1548 |
| 949 | nmdc:mga05p37_478081_c1 | 3300050507 | Bacteria | 1436 |
| 950 | nmdc:mga05p37_566944_c1 | 3300050507 | Bacteria | 1289 |
| 951 | nmdc:mga05p37_567032_c1 | 3300050507 | Bacteria | 1289 |
| 952 | nmdc:mga05p37_644_c1 | 3300050507 | Bacteria | 38645 |
| 953 | nmdc:mga05p37_69333_c1 | 3300050507 | Bacteria | 4337 |
| 954 | nmdc:mga05p37_78073_c1 | 3300050507 | Bacteria | 4076 |
| 955 | nmdc:mga05p37_81281_c1 | 3300050507 | Bacteria | 3992 |
| 956 | nmdc:mga05p37_855548_c1 | 3300050507 | Bacteria | 987 |
| 957 | nmdc:mga05p37_86311_c1 | 3300050507 | Bacteria | 3868 |
| 958 | nmdc:mga09592_113139_c1 | 3300050508 | Bacteria | 2329 |
| 959 | nmdc:mga09592_304352_c1 | 3300050508 | Bacteria | 1382 |
| 960 | nmdc:mga09592_314878_c1 | 3300050508 | Bacteria | 1356 |
| 961 | nmdc:mga09592_40921_c1 | 3300050508 | Bacteria | 3895 |
| 962 | nmdc:mga09592_423364_c1 | 3300050508 | Bacteria | 1150 |
| 963 | nmdc:mga09592_4298_c1 | 3300050508 | Bacteria | 11503 |
| 964 | nmdc:mga09592_547400_c1 | 3300050508 | Bacteria | 994 |
| 965 | nmdc:mga09592_7328_c1 | 3300050508 | Bacteria | 8967 |
| 966 | nmdc:mga09592_99751_c1 | 3300050508 | Bacteria | 2486 |
| 967 | nmdc:mga0qj67_144750_c1 | 3300050509 | Bacteria | 1927 |
| 968 | nmdc:mga0qj67_165467_c1 | 3300050509 | Unclassified | 1795 |
| 969 | nmdc:mga0qj67_3318_c1 | 3300050509 | Bacteria | 11603 |
| 970 | nmdc:mga06r32_107564_c1 | 3300050510 | Bacteria | 2741 |
| 971 | nmdc:mga06r32_15924_c1 | 3300050510 | Bacteria | 6842 |
| 972 | nmdc:mga06r32_49931_c1 | 3300050510 | Bacteria | 4002 |
| 973 | nmdc:mga06r32_603924_c1 | 3300050510 | Bacteria | 1068 |
| 974 | nmdc:mga06r32_63212_c1 | 3300050510 | Bacteria | 3567 |
| 975 | nmdc:mga06r32_8083_c1 | 3300050510 | Bacteria | 9465 |
| 976 | nmdc:mga06r32_95924_c1 | 3300050510 | Bacteria | 2903 |
| 977 | nmdc:mga08y16_10460_c1 | 3300050511 | Bacteria | 9735 |
| 978 | nmdc:mga08y16_104809_c1 | 3300050511 | Bacteria | 2944 |
| 979 | nmdc:mga08y16_10929_c1 | 3300050511 | Bacteria | 9533 |
| 980 | nmdc:mga08y16_155249_c1 | 3300050511 | Bacteria | 2378 |
| 981 | nmdc:mga08y16_198729_c1 | 3300050511 | Bacteria | 2078 |
| 982 | nmdc:mga08y16_243215_c1 | 3300050511 | Unclassified | 1860 |
| 983 | nmdc:mga08y16_244777_c1 | 3300050511 | Bacteria | 1853 |
| 984 | nmdc:mga08y16_373840_c1 | 3300050511 | Bacteria | 1462 |
| 985 | nmdc:mga08y16_39988_c1 | 3300050511 | Bacteria | 4918 |
| 986 | nmdc:mga08y16_48405_c1 | 3300050511 | Bacteria | 4449 |
| 987 | nmdc:mga08y16_6292_c1 | 3300050511 | Bacteria | 12450 |
| 988 | nmdc:mga08y16_86790_c1 | 3300050511 | Bacteria | 3261 |
| 989 | nmdc:mga08y16_932_c1 | 3300050511 | Bacteria | 28369 |
| 990 | nmdc:mga08y16_9_c1 | 3300050511 | Bacteria | 566088 |
| 991 | nmdc:mga0n895_102951_c1 | 3300050512 | Bacteria | 2866 |
| 992 | nmdc:mga0n895_112926_c1 | 3300050512 | Bacteria | 2734 |
| 993 | nmdc:mga0n895_138646_c1 | 3300050512 | Bacteria | 2460 |
| 994 | nmdc:mga0n895_139651_c1 | 3300050512 | Bacteria | 2450 |
| 995 | nmdc:mga0n895_151826_c1 | 3300050512 | Bacteria | 2347 |
| 996 | nmdc:mga0n895_168218_c1 | 3300050512 | Bacteria | 2224 |
| 997 | nmdc:mga0n895_182632_c1 | 3300050512 | Bacteria | 2129 |
| 998 | nmdc:mga0n895_20798_c1 | 3300050512 | Bacteria | 6128 |
| 999 | nmdc:mga0n895_4406_c1 | 3300050512 | Bacteria | 11564 |
| 1000 | nmdc:mga0n895_52553_c1 | 3300050512 | Bacteria | 4000 |
| 1001 | nmdc:mga0n895_691527_c1 | 3300050512 | Bacteria | 1016 |
| 1002 | nmdc:mga0n895_700432_c1 | 3300050512 | Bacteria | 1009 |
| 1003 | nmdc:mga0n895_81_c1 | 3300050512 | Bacteria | 54736 |
| 1004 | nmdc:mga0rr50_1_c1 | 3300050513 | Bacteria | 558123 |
| 1005 | nmdc:mga0rr50_28641_c1 | 3300050513 | Bacteria | 3918 |
| 1006 | nmdc:mga0rr50_4248_c1 | 3300050513 | Bacteria | 8383 |
| 1007 | nmdc:mga0rr50_557328_c1 | 3300050513 | Unclassified | 976 |
| 1008 | nmdc:mga0rr50_83187_c1 | 3300050513 | Bacteria | 2474 |
| 1009 | nmdc:mga0rr50_8895_c1 | 3300050513 | Bacteria | 6273 |
| 1010 | nmdc:mga08x19_181099_c1 | 3300050514 | Bacteria | 1439 |
| 1011 | nmdc:mga08x19_265_c1 | 3300050514 | Bacteria | 39740 |
| 1012 | nmdc:mga08x19_310417_c1 | 3300050514 | Bacteria | 1096 |
| 1013 | nmdc:mga08x19_59349_c1 | 3300050514 | Bacteria | 2476 |
| 1014 | nmdc:mga08x19_96849_c1 | 3300050514 | Bacteria | 1953 |
| 1015 | nmdc:mga0a205_115510_c1 | 3300050515 | Bacteria | 2583 |
| 1016 | nmdc:mga0a205_116830_c1 | 3300050515 | Bacteria | 2566 |
| 1017 | nmdc:mga0a205_179962_c1 | 3300050515 | Bacteria | 2009 |
| 1018 | nmdc:mga0a205_3136_c1 | 3300050515 | Bacteria | 14660 |
| 1019 | nmdc:mga0a205_326970_c1 | 3300050515 | Bacteria | 1403 |
| 1020 | nmdc:mga0a205_391940_c1 | 3300050515 | Bacteria | 1253 |
| 1021 | nmdc:mga0a205_456663_c1 | 3300050515 | Bacteria | 1137 |
| 1022 | nmdc:mga0a205_45943_c1 | 3300050515 | Bacteria | 4211 |
| 1023 | nmdc:mga0a205_46215_c1 | 3300050515 | Bacteria | 4199 |
| 1024 | nmdc:mga0a205_47513_c2 | 3300050515 | Bacteria | 1872 |
| 1025 | nmdc:mga0a205_49528_c1 | 3300050515 | Bacteria | 4055 |
| 1026 | nmdc:mga0a205_61542_c1 | 3300050515 | Bacteria | 2785 |
| 1027 | nmdc:mga0sz30_68326_c1 | 3300050516 | Bacteria | 1526 |
| 1028 | Ga0495601_0025172 | 3300053077 | Bacteria | 3668 |
| 1029 | Ga0495601_0058386 | 3300053077 | Bacteria | 2445 |
| 1030 | Ga0495595_0043128 | 3300053084 | Bacteria | 2068 |
| 1031 | Ga0495619_0008204 | 3300053085 | Bacteria | 6604 |
| 1032 | Ga0495619_0071124 | 3300053085 | Bacteria | 2328 |
| 1033 | Ga0500646_0081212 | 3300053090 | Bacteria | 989 |
| 1034 | Ga0500555_006197 | 3300053103 | Bacteria | 3395 |
| 1035 | Ga0501084_0008116 | 3300054114 | Bacteria | 8651 |
| 1036 | Ga0501084_0130496 | 3300054114 | Bacteria | 2116 |
| 1037 | Ga0501084_0161438 | 3300054114 | Bacteria | 1891 |
| 1038 | Ga0501084_0216963 | 3300054114 | Bacteria | 1614 |
| 1039 | Ga0501084_0383980 | 3300054114 | Bacteria | 1187 |
| 1040 | Ga0501082_0015946 | 3300060353 | Bacteria | 6463 |
| 1041 | Ga0501082_0024231 | 3300060353 | Bacteria | 5233 |
| 1042 | Ga0501082_0030564 | 3300060353 | Bacteria | 4642 |
| 1043 | Ga0501082_0089298 | 3300060353 | Bacteria | 2661 |
| 1044 | Ga0501082_0291148 | 3300060353 | Bacteria | 1422 |
| 1045 | Ga0501082_0317908 | 3300060353 | Bacteria | 1356 |
| 1046 | Ga0501082_0538040 | 3300060353 | Bacteria | 1022 |
| 1047 | Ga0530510_0006006 | 3300061734 | Bacteria | 8426 |
| 1048 | Ga0530510_0011471 | 3300061734 | Bacteria | 6215 |
| 1049 | Ga0530510_0092624 | 3300061734 | Bacteria | 2206 |
| 1050 | Ga0530510_0157749 | 3300061734 | Bacteria | 1678 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046475 | Ga0495639_0232697 | Ga0495639_0232697_265_882 | 191 |
| 2 | 3300035398 | Ga0316574_0165455 | Ga0316574_0165455_14_625 | 192 |
| 3 | 3300035398 | Ga0316574_0267273 | Ga0316574_0267273_64_675 | 192 |
| 4 | 3300042993 | Ga0439440_0100124 | Ga0439440_0100124_71_685 | 192 |
| 5 | 3300049593 | Ga0501077_0484655 | Ga0501077_0484655_17_628 | 192 |
| 6 | 3300035113 | Ga0373936_0118575 | Ga0373936_0118575_18_635 | 193 |
| 7 | 3300042014 | Ga0439457_107273 | Ga0439457_107273_19_636 | 193 |
| 8 | 3300049572 | Ga0501036_0205940 | Ga0501036_0205940_17_634 | 193 |
| 9 | 3300049590 | Ga0501074_0061528 | Ga0501074_0061528_1743_2360 | 193 |
| 10 | 3300049742 | Ga0501080_0568157 | Ga0501080_0568157_306_923 | 193 |
| 11 | 3300050513 | nmdc:mga0rr50_557328_c1 | nmdc:mga0rr50_557328_c1_11_628 | 193 |
| 12 | 3300005545 | Ga0070695_100109023 | Ga0070695_1001090232 | 210 |
| 13 | 3300049587 | Ga0501071_0361244 | Ga0501071_0361244_14_697 | 215 |
| 14 | 3300049578 | Ga0501042_0469976 | Ga0501042_0469976_206_901 | 219 |
| 15 | 3300028800 | Ga0265338_10021154 | Ga0265338_100211544 | 226 |
| 16 | 3300029957 | Ga0265324_10012498 | Ga0265324_100124982 | 226 |
| 17 | 3300042876 | Ga0451577_0028596 | Ga0451577_0028596_425_1144 | 226 |
| 18 | 3300042876 | Ga0451577_0092147 | Ga0451577_0092147_361_1080 | 226 |
| 19 | 3300044712 | Ga0453684_0168852 | Ga0453684_0168852_1223_1942 | 226 |
| 20 | 3300045051 | Ga0451576_0004039 | Ga0451576_0004039_15329_16048 | 226 |
| 21 | 3300005549 | Ga0070704_100430955 | Ga0070704_1004309552 | 227 |
| 22 | 3300005844 | Ga0068862_100028702 | Ga0068862_1000287023 | 227 |
| 23 | 3300028380 | Ga0268265_10712833 | Ga0268265_107128331 | 227 |
| 24 | 3300028653 | Ga0265323_10004413 | Ga0265323_100044132 | 227 |
| 25 | 3300009147 | Ga0114129_10121320 | Ga0114129_101213202 | 228 |
| 26 | 3300042876 | Ga0451577_0001014 | Ga0451577_0001014_35374_36108 | 231 |
| 27 | 3300044712 | Ga0453684_0000004 | Ga0453684_0000004_1300126_1300860 | 231 |
| 28 | 3300050495 | nmdc:mga04h51_126451_c1 | nmdc:mga04h51_126451_c1_216_947 | 231 |
| 29 | 3300025928 | Ga0207700_10034985 | Ga0207700_100349853 | 233 |
| 30 | 3300006844 | Ga0075428_100004677 | Ga0075428_1000046775 | 234 |
| 31 | 3300009094 | Ga0111539_10204953 | Ga0111539_102049533 | 234 |
| 32 | 3300027907 | Ga0207428_10061765 | Ga0207428_100617654 | 234 |
| 33 | 3300050509 | nmdc:mga0qj67_165467_c1 | nmdc:mga0qj67_165467_c1_947_1696 | 234 |
| 34 | 3300050511 | nmdc:mga08y16_373840_c1 | nmdc:mga08y16_373840_c1_292_1041 | 234 |
| 35 | 3300005338 | Ga0068868_100079273 | Ga0068868_1000792732 | 235 |
| 36 | 3300005347 | Ga0070668_100312884 | Ga0070668_1003128842 | 235 |
| 37 | 3300005356 | Ga0070674_100139424 | Ga0070674_1001394242 | 235 |
| 38 | 3300005444 | Ga0070694_100051631 | Ga0070694_1000516312 | 235 |
| 39 | 3300005459 | Ga0068867_100080672 | Ga0068867_1000806722 | 235 |
| 40 | 3300005548 | Ga0070665_100016328 | Ga0070665_1000163286 | 235 |
| 41 | 3300005844 | Ga0068862_100248914 | Ga0068862_1002489142 | 235 |
| 42 | 3300006358 | Ga0068871_100010044 | Ga0068871_1000100448 | 235 |
| 43 | 3300006847 | Ga0075431_100082230 | Ga0075431_1000822302 | 235 |
| 44 | 3300006881 | Ga0068865_100023794 | Ga0068865_1000237945 | 235 |
| 45 | 3300006881 | Ga0068865_100193892 | Ga0068865_1001938922 | 235 |
| 46 | 3300009094 | Ga0111539_10022355 | Ga0111539_100223553 | 235 |
| 47 | 3300009098 | Ga0105245_10419112 | Ga0105245_104191122 | 235 |
| 48 | 3300013297 | Ga0157378_10411257 | Ga0157378_104112572 | 235 |
| 49 | 3300025899 | Ga0207642_10040535 | Ga0207642_100405352 | 235 |
| 50 | 3300025934 | Ga0207686_10091048 | Ga0207686_100910482 | 235 |
| 51 | 3300025941 | Ga0207711_10576602 | Ga0207711_105766021 | 235 |
| 52 | 3300025942 | Ga0207689_10115149 | Ga0207689_101151492 | 235 |
| 53 | 3300026089 | Ga0207648_10102995 | Ga0207648_101029952 | 235 |
| 54 | 3300026121 | Ga0207683_10078856 | Ga0207683_100788562 | 235 |
| 55 | 3300028380 | Ga0268265_10038688 | Ga0268265_100386883 | 235 |
| 56 | 3300035170 | Ga0373943_0220576 | Ga0373943_0220576_74_817 | 235 |
| 57 | 3300046684 | Ga0495669_0013753 | Ga0495669_0013753_835_1599 | 235 |
| 58 | 3300048907 | Ga0496104_0179311 | Ga0496104_0179311_212_967 | 235 |
| 59 | 3300048912 | Ga0496109_0304142 | Ga0496109_0304142_394_1149 | 235 |
| 60 | 3300050510 | nmdc:mga06r32_63212_c1 | nmdc:mga06r32_63212_c1_1407_2147 | 235 |
| 61 | 3300050511 | nmdc:mga08y16_10460_c1 | nmdc:mga08y16_10460_c1_2265_3005 | 235 |
| 62 | 3300006358 | Ga0068871_100008186 | Ga0068871_1000081862 | 236 |
| 63 | 3300006358 | Ga0068871_100090873 | Ga0068871_1000908732 | 236 |
| 64 | 3300007788 | Ga0099795_10044070 | Ga0099795_100440702 | 236 |
| 65 | 3300013297 | Ga0157378_10058289 | Ga0157378_100582893 | 236 |
| 66 | 3300014969 | Ga0157376_10521425 | Ga0157376_105214252 | 236 |
| 67 | 3300031691 | Ga0316579_10037408 | Ga0316579_100374082 | 236 |
| 68 | 3300031711 | Ga0265314_10037448 | Ga0265314_100374482 | 236 |
| 69 | 3300031995 | Ga0307409_100142266 | Ga0307409_1001422661 | 236 |
| 70 | 3300035398 | Ga0316574_0049704 | Ga0316574_0049704_1388_2146 | 236 |
| 71 | 3300046472 | Ga0495580_0154759 | Ga0495580_0154759_598_1350 | 236 |
| 72 | 3300049577 | Ga0501041_0218489 | Ga0501041_0218489_325_1071 | 236 |
| 73 | 3300049591 | Ga0501075_0339000 | Ga0501075_0339000_359_1105 | 236 |
| 74 | 3300049741 | Ga0501079_0041256 | Ga0501079_0041256_2777_3523 | 236 |
| 75 | 3300049743 | Ga0501081_0554685 | Ga0501081_0554685_29_775 | 236 |
| 76 | 3300050507 | nmdc:mga05p37_78073_c1 | nmdc:mga05p37_78073_c1_2066_2881 | 236 |
| 77 | 3300005293 | Ga0065715_10051194 | Ga0065715_100511941 | 237 |
| 78 | 3300005341 | Ga0070691_10044437 | Ga0070691_100444372 | 237 |
| 79 | 3300005345 | Ga0070692_10027343 | Ga0070692_100273432 | 237 |
| 80 | 3300005438 | Ga0070701_10038327 | Ga0070701_100383272 | 237 |
| 81 | 3300005440 | Ga0070705_100000016 | Ga0070705_10000001661 | 237 |
| 82 | 3300005440 | Ga0070705_100007054 | Ga0070705_1000070543 | 237 |
| 83 | 3300005444 | Ga0070694_100000279 | Ga0070694_1000002796 | 237 |
| 84 | 3300005445 | Ga0070708_100267398 | Ga0070708_1002673982 | 237 |
| 85 | 3300005458 | Ga0070681_10138723 | Ga0070681_101387232 | 237 |
| 86 | 3300005471 | Ga0070698_100015072 | Ga0070698_1000150728 | 237 |
| 87 | 3300005518 | Ga0070699_100001370 | Ga0070699_10000137013 | 237 |
| 88 | 3300005545 | Ga0070695_100000061 | Ga0070695_1000000618 | 237 |
| 89 | 3300005546 | Ga0070696_100000571 | Ga0070696_1000005716 | 237 |
| 90 | 3300005719 | Ga0068861_100126847 | Ga0068861_1001268472 | 237 |
| 91 | 3300006058 | Ga0075432_10074504 | Ga0075432_100745042 | 237 |
| 92 | 3300006844 | Ga0075428_100022252 | Ga0075428_1000222526 | 237 |
| 93 | 3300006844 | Ga0075428_100053234 | Ga0075428_1000532344 | 237 |
| 94 | 3300006846 | Ga0075430_100000655 | Ga0075430_1000006553 | 237 |
| 95 | 3300007076 | Ga0075435_100369723 | Ga0075435_1003697232 | 237 |
| 96 | 3300009094 | Ga0111539_10683220 | Ga0111539_106832202 | 237 |
| 97 | 3300009147 | Ga0114129_10008621 | Ga0114129_100086217 | 237 |
| 98 | 3300009147 | Ga0114129_10116915 | Ga0114129_101169153 | 237 |
| 99 | 3300009147 | Ga0114129_10129796 | Ga0114129_101297962 | 237 |
| 100 | 3300009148 | Ga0105243_10781472 | Ga0105243_107814721 | 237 |
| 101 | 3300009176 | Ga0105242_10585001 | Ga0105242_105850012 | 237 |
| 102 | 3300009176 | Ga0105242_10645287 | Ga0105242_106452871 | 237 |
| 103 | 3300013308 | Ga0157375_10551188 | Ga0157375_105511882 | 237 |
| 104 | 3300025934 | Ga0207686_10376889 | Ga0207686_103768891 | 237 |
| 105 | 3300025935 | Ga0207709_10130829 | Ga0207709_101308292 | 237 |
| 106 | 3300026118 | Ga0207675_100061364 | Ga0207675_1000613643 | 237 |
| 107 | 3300027907 | Ga0207428_10428309 | Ga0207428_104283092 | 237 |
| 108 | 3300031691 | Ga0316579_10027907 | Ga0316579_100279072 | 237 |
| 109 | 3300031727 | Ga0316576_10002816 | Ga0316576_100028166 | 237 |
| 110 | 3300035118 | Ga0373954_0088662 | Ga0373954_0088662_458_1240 | 237 |
| 111 | 3300035170 | Ga0373943_0186533 | Ga0373943_0186533_111_893 | 237 |
| 112 | 3300036647 | Ga0316582_0033596 | Ga0316582_0033596_1844_2590 | 237 |
| 113 | 3300036647 | Ga0316582_0094238 | Ga0316582_0094238_255_1001 | 237 |
| 114 | 3300042133 | Ga0450896_027603 | Ga0450896_027603_85_837 | 237 |
| 115 | 3300046454 | Ga0495592_0147312 | Ga0495592_0147312_757_1539 | 237 |
| 116 | 3300046477 | Ga0495664_0206431 | Ga0495664_0206431_385_1167 | 237 |
| 117 | 3300046491 | Ga0495584_0164844 | Ga0495584_0164844_38_787 | 237 |
| 118 | 3300046511 | Ga0495608_0001856 | Ga0495608_0001856_8162_8944 | 237 |
| 119 | 3300046517 | Ga0495630_0003013 | Ga0495630_0003013_6296_7078 | 237 |
| 120 | 3300046525 | Ga0495663_0090808 | Ga0495663_0090808_11_760 | 237 |
| 121 | 3300046528 | Ga0495642_0004422 | Ga0495642_0004422_1896_2645 | 237 |
| 122 | 3300046536 | Ga0495587_0085683 | Ga0495587_0085683_41_823 | 237 |
| 123 | 3300046539 | Ga0495621_0162226 | Ga0495621_0162226_19_768 | 237 |
| 124 | 3300046543 | Ga0495645_0003630 | Ga0495645_0003630_9559_10374 | 237 |
| 125 | 3300046559 | Ga0495667_0023699 | Ga0495667_0023699_262_1044 | 237 |
| 126 | 3300046678 | Ga0495599_0100107 | Ga0495599_0100107_224_1006 | 237 |
| 127 | 3300046684 | Ga0495669_0096286 | Ga0495669_0096286_80_829 | 237 |
| 128 | 3300046689 | Ga0495613_0000599 | Ga0495613_0000599_6114_6896 | 237 |
| 129 | 3300046809 | Ga0495600_0003980 | Ga0495600_0003980_613_1428 | 237 |
| 130 | 3300047317 | Ga0495604_0014504 | Ga0495604_0014504_3539_4354 | 237 |
| 131 | 3300047319 | Ga0495674_0050049 | Ga0495674_0050049_27_806 | 237 |
| 132 | 3300047447 | Ga0495685_018711 | Ga0495685_018711_999_1748 | 237 |
| 133 | 3300047471 | Ga0495684_0000310 | Ga0495684_0000310_21783_22598 | 237 |
| 134 | 3300049568 | Ga0501031_0128708 | Ga0501031_0128708_175_921 | 237 |
| 135 | 3300049572 | Ga0501036_0096531 | Ga0501036_0096531_176_925 | 237 |
| 136 | 3300049573 | Ga0501037_0075725 | Ga0501037_0075725_525_1274 | 237 |
| 137 | 3300049576 | Ga0501040_0006548 | Ga0501040_0006548_6587_7336 | 237 |
| 138 | 3300049578 | Ga0501042_0022598 | Ga0501042_0022598_1185_1934 | 237 |
| 139 | 3300049582 | Ga0501048_0025224 | Ga0501048_0025224_1909_2658 | 237 |
| 140 | 3300049587 | Ga0501071_0026347 | Ga0501071_0026347_1984_2730 | 237 |
| 141 | 3300049587 | Ga0501071_0192236 | Ga0501071_0192236_38_787 | 237 |
| 142 | 3300049588 | Ga0501072_0022930 | Ga0501072_0022930_1831_2580 | 237 |
| 143 | 3300049591 | Ga0501075_0015936 | Ga0501075_0015936_789_1538 | 237 |
| 144 | 3300049592 | Ga0501076_0018379 | Ga0501076_0018379_2169_2918 | 237 |
| 145 | 3300049593 | Ga0501077_0120443 | Ga0501077_0120443_126_875 | 237 |
| 146 | 3300049743 | Ga0501081_0062692 | Ga0501081_0062692_823_1572 | 237 |
| 147 | 3300049824 | Ga0501045_0065071 | Ga0501045_0065071_584_1333 | 237 |
| 148 | 3300049824 | Ga0501045_0430481 | Ga0501045_0430481_169_915 | 237 |
| 149 | 3300050507 | nmdc:mga05p37_100630_c1 | nmdc:mga05p37_100630_c1_2656_3405 | 237 |
| 150 | 3300050507 | nmdc:mga05p37_135291_c1 | nmdc:mga05p37_135291_c1_1334_2080 | 237 |
| 151 | 3300050507 | nmdc:mga05p37_423797_c1 | nmdc:mga05p37_423797_c1_246_992 | 237 |
| 152 | 3300050507 | nmdc:mga05p37_478081_c1 | nmdc:mga05p37_478081_c1_511_1260 | 237 |
| 153 | 3300050508 | nmdc:mga09592_7328_c1 | nmdc:mga09592_7328_c1_3383_4132 | 237 |
| 154 | 3300050508 | nmdc:mga09592_99751_c1 | nmdc:mga09592_99751_c1_385_1134 | 237 |
| 155 | 3300050509 | nmdc:mga0qj67_3318_c1 | nmdc:mga0qj67_3318_c1_430_1179 | 237 |
| 156 | 3300050511 | nmdc:mga08y16_243215_c1 | nmdc:mga08y16_243215_c1_255_1004 | 237 |
| 157 | 3300050515 | nmdc:mga0a205_179962_c1 | nmdc:mga0a205_179962_c1_1089_1838 | 237 |
| 158 | 3300053084 | Ga0495595_0043128 | Ga0495595_0043128_1049_1831 | 237 |
| 159 | 3300053085 | Ga0495619_0008204 | Ga0495619_0008204_468_1250 | 237 |
| 160 | 3300061734 | Ga0530510_0006006 | Ga0530510_0006006_3485_4234 | 237 |
| 161 | 3300003911 | JGI25405J52794_10003721 | JGI25405J52794_100037212 | 238 |
| 162 | 3300005289 | Ga0065704_10170200 | Ga0065704_101702001 | 238 |
| 163 | 3300005290 | Ga0065712_10005714 | Ga0065712_100057143 | 238 |
| 164 | 3300005290 | Ga0065712_10088511 | Ga0065712_100885112 | 238 |
| 165 | 3300005290 | Ga0065712_10105799 | Ga0065712_101057992 | 238 |
| 166 | 3300005293 | Ga0065715_10007369 | Ga0065715_100073692 | 238 |
| 167 | 3300005293 | Ga0065715_10096409 | Ga0065715_100964092 | 238 |
| 168 | 3300005295 | Ga0065707_10002251 | Ga0065707_100022512 | 238 |
| 169 | 3300005295 | Ga0065707_10005235 | Ga0065707_100052351 | 238 |
| 170 | 3300005295 | Ga0065707_10085509 | Ga0065707_100855095 | 238 |
| 171 | 3300005295 | Ga0065707_10165513 | Ga0065707_101655132 | 238 |
| 172 | 3300005328 | Ga0070676_10006806 | Ga0070676_100068063 | 238 |
| 173 | 3300005328 | Ga0070676_10321649 | Ga0070676_103216492 | 238 |
| 174 | 3300005329 | Ga0070683_100006082 | Ga0070683_1000060826 | 238 |
| 175 | 3300005329 | Ga0070683_100121001 | Ga0070683_1001210012 | 238 |
| 176 | 3300005329 | Ga0070683_100165983 | Ga0070683_1001659832 | 238 |
| 177 | 3300005330 | Ga0070690_100029154 | Ga0070690_1000291542 | 238 |
| 178 | 3300005330 | Ga0070690_100109929 | Ga0070690_1001099292 | 238 |
| 179 | 3300005331 | Ga0070670_100003674 | Ga0070670_1000036746 | 238 |
| 180 | 3300005331 | Ga0070670_100056795 | Ga0070670_1000567952 | 238 |
| 181 | 3300005331 | Ga0070670_100178229 | Ga0070670_1001782292 | 238 |
| 182 | 3300005333 | Ga0070677_10031350 | Ga0070677_100313502 | 238 |
| 183 | 3300005334 | Ga0068869_100164778 | Ga0068869_1001647782 | 238 |
| 184 | 3300005334 | Ga0068869_100186928 | Ga0068869_1001869282 | 238 |
| 185 | 3300005334 | Ga0068869_100280438 | Ga0068869_1002804382 | 238 |
| 186 | 3300005334 | Ga0068869_100375534 | Ga0068869_1003755342 | 238 |
| 187 | 3300005335 | Ga0070666_10022440 | Ga0070666_100224404 | 238 |
| 188 | 3300005335 | Ga0070666_10039046 | Ga0070666_100390462 | 238 |
| 189 | 3300005335 | Ga0070666_10087282 | Ga0070666_100872822 | 238 |
| 190 | 3300005338 | Ga0068868_100025873 | Ga0068868_1000258732 | 238 |
| 191 | 3300005338 | Ga0068868_100028023 | Ga0068868_1000280232 | 238 |
| 192 | 3300005338 | Ga0068868_100241239 | Ga0068868_1002412392 | 238 |
| 193 | 3300005340 | Ga0070689_100005737 | Ga0070689_1000057377 | 238 |
| 194 | 3300005340 | Ga0070689_100008806 | Ga0070689_1000088066 | 238 |
| 195 | 3300005340 | Ga0070689_100009227 | Ga0070689_1000092276 | 238 |
| 196 | 3300005340 | Ga0070689_100011887 | Ga0070689_1000118876 | 238 |
| 197 | 3300005343 | Ga0070687_100062482 | Ga0070687_1000624822 | 238 |
| 198 | 3300005343 | Ga0070687_100161004 | Ga0070687_1001610042 | 238 |
| 199 | 3300005344 | Ga0070661_100016292 | Ga0070661_1000162923 | 238 |
| 200 | 3300005344 | Ga0070661_100499300 | Ga0070661_1004993002 | 238 |
| 201 | 3300005347 | Ga0070668_100295055 | Ga0070668_1002950552 | 238 |
| 202 | 3300005353 | Ga0070669_100002795 | Ga0070669_1000027954 | 238 |
| 203 | 3300005353 | Ga0070669_100009439 | Ga0070669_1000094397 | 238 |
| 204 | 3300005353 | Ga0070669_100131441 | Ga0070669_1001314412 | 238 |
| 205 | 3300005353 | Ga0070669_100216352 | Ga0070669_1002163521 | 238 |
| 206 | 3300005354 | Ga0070675_100001411 | Ga0070675_10000141114 | 238 |
| 207 | 3300005354 | Ga0070675_100014315 | Ga0070675_1000143154 | 238 |
| 208 | 3300005354 | Ga0070675_100038263 | Ga0070675_1000382632 | 238 |
| 209 | 3300005354 | Ga0070675_100144890 | Ga0070675_1001448901 | 238 |
| 210 | 3300005354 | Ga0070675_100166641 | Ga0070675_1001666412 | 238 |
| 211 | 3300005354 | Ga0070675_100204877 | Ga0070675_1002048772 | 238 |
| 212 | 3300005354 | Ga0070675_100339176 | Ga0070675_1003391762 | 238 |
| 213 | 3300005355 | Ga0070671_100061284 | Ga0070671_1000612842 | 238 |
| 214 | 3300005355 | Ga0070671_100150212 | Ga0070671_1001502122 | 238 |
| 215 | 3300005355 | Ga0070671_100280269 | Ga0070671_1002802692 | 238 |
| 216 | 3300005356 | Ga0070674_100014917 | Ga0070674_1000149172 | 238 |
| 217 | 3300005356 | Ga0070674_100020861 | Ga0070674_1000208614 | 238 |
| 218 | 3300005356 | Ga0070674_100026357 | Ga0070674_1000263572 | 238 |
| 219 | 3300005356 | Ga0070674_100035571 | Ga0070674_1000355712 | 238 |
| 220 | 3300005356 | Ga0070674_100138361 | Ga0070674_1001383612 | 238 |
| 221 | 3300005364 | Ga0070673_100006996 | Ga0070673_1000069962 | 238 |
| 222 | 3300005364 | Ga0070673_100011588 | Ga0070673_1000115882 | 238 |
| 223 | 3300005364 | Ga0070673_100012813 | Ga0070673_1000128133 | 238 |
| 224 | 3300005364 | Ga0070673_100069369 | Ga0070673_1000693692 | 238 |
| 225 | 3300005364 | Ga0070673_100090119 | Ga0070673_1000901192 | 238 |
| 226 | 3300005364 | Ga0070673_100389527 | Ga0070673_1003895272 | 238 |
| 227 | 3300005365 | Ga0070688_100068697 | Ga0070688_1000686972 | 238 |
| 228 | 3300005366 | Ga0070659_100074165 | Ga0070659_1000741652 | 238 |
| 229 | 3300005367 | Ga0070667_100042719 | Ga0070667_1000427192 | 238 |
| 230 | 3300005367 | Ga0070667_100138545 | Ga0070667_1001385452 | 238 |
| 231 | 3300005367 | Ga0070667_100167371 | Ga0070667_1001673712 | 238 |
| 232 | 3300005367 | Ga0070667_100466462 | Ga0070667_1004664622 | 238 |
| 233 | 3300005434 | Ga0070709_10093260 | Ga0070709_100932602 | 238 |
| 234 | 3300005434 | Ga0070709_10156519 | Ga0070709_101565192 | 238 |
| 235 | 3300005436 | Ga0070713_100010981 | Ga0070713_1000109812 | 238 |
| 236 | 3300005438 | Ga0070701_10007454 | Ga0070701_100074544 | 238 |
| 237 | 3300005438 | Ga0070701_10310978 | Ga0070701_103109781 | 238 |
| 238 | 3300005440 | Ga0070705_100012183 | Ga0070705_1000121832 | 238 |
| 239 | 3300005440 | Ga0070705_100022448 | Ga0070705_1000224483 | 238 |
| 240 | 3300005440 | Ga0070705_100162140 | Ga0070705_1001621402 | 238 |
| 241 | 3300005440 | Ga0070705_100240775 | Ga0070705_1002407752 | 238 |
| 242 | 3300005440 | Ga0070705_100284793 | Ga0070705_1002847932 | 238 |
| 243 | 3300005441 | Ga0070700_100014023 | Ga0070700_1000140233 | 238 |
| 244 | 3300005441 | Ga0070700_100020027 | Ga0070700_1000200274 | 238 |
| 245 | 3300005441 | Ga0070700_100025789 | Ga0070700_1000257894 | 238 |
| 246 | 3300005441 | Ga0070700_100143020 | Ga0070700_1001430202 | 238 |
| 247 | 3300005441 | Ga0070700_100282727 | Ga0070700_1002827272 | 238 |
| 248 | 3300005441 | Ga0070700_100501744 | Ga0070700_1005017442 | 238 |
| 249 | 3300005444 | Ga0070694_100054815 | Ga0070694_1000548152 | 238 |
| 250 | 3300005444 | Ga0070694_100080930 | Ga0070694_1000809302 | 238 |
| 251 | 3300005444 | Ga0070694_100112572 | Ga0070694_1001125722 | 238 |
| 252 | 3300005445 | Ga0070708_100255719 | Ga0070708_1002557192 | 238 |
| 253 | 3300005445 | Ga0070708_100317841 | Ga0070708_1003178412 | 238 |
| 254 | 3300005445 | Ga0070708_100467772 | Ga0070708_1004677722 | 238 |
| 255 | 3300005456 | Ga0070678_100022491 | Ga0070678_1000224912 | 238 |
| 256 | 3300005456 | Ga0070678_100252298 | Ga0070678_1002522982 | 238 |
| 257 | 3300005457 | Ga0070662_100040364 | Ga0070662_1000403643 | 238 |
| 258 | 3300005457 | Ga0070662_100152569 | Ga0070662_1001525692 | 238 |
| 259 | 3300005459 | Ga0068867_100002379 | Ga0068867_10000237912 | 238 |
| 260 | 3300005459 | Ga0068867_100024363 | Ga0068867_1000243633 | 238 |
| 261 | 3300005459 | Ga0068867_100050212 | Ga0068867_1000502121 | 238 |
| 262 | 3300005459 | Ga0068867_100860136 | Ga0068867_1008601361 | 238 |
| 263 | 3300005466 | Ga0070685_10010288 | Ga0070685_100102882 | 238 |
| 264 | 3300005467 | Ga0070706_100005121 | Ga0070706_1000051218 | 238 |
| 265 | 3300005467 | Ga0070706_100095894 | Ga0070706_1000958942 | 238 |
| 266 | 3300005467 | Ga0070706_100342967 | Ga0070706_1003429672 | 238 |
| 267 | 3300005467 | Ga0070706_100364722 | Ga0070706_1003647222 | 238 |
| 268 | 3300005467 | Ga0070706_100700205 | Ga0070706_1007002051 | 238 |
| 269 | 3300005468 | Ga0070707_100048133 | Ga0070707_1000481332 | 238 |
| 270 | 3300005468 | Ga0070707_100075269 | Ga0070707_1000752693 | 238 |
| 271 | 3300005468 | Ga0070707_100087606 | Ga0070707_1000876061 | 238 |
| 272 | 3300005468 | Ga0070707_100158438 | Ga0070707_1001584382 | 238 |
| 273 | 3300005468 | Ga0070707_100184718 | Ga0070707_1001847182 | 238 |
| 274 | 3300005468 | Ga0070707_100199012 | Ga0070707_1001990121 | 238 |
| 275 | 3300005468 | Ga0070707_100300530 | Ga0070707_1003005302 | 238 |
| 276 | 3300005468 | Ga0070707_100388790 | Ga0070707_1003887902 | 238 |
| 277 | 3300005471 | Ga0070698_100004889 | Ga0070698_10000488910 | 238 |
| 278 | 3300005471 | Ga0070698_100024325 | Ga0070698_1000243252 | 238 |
| 279 | 3300005471 | Ga0070698_100028123 | Ga0070698_1000281234 | 238 |
| 280 | 3300005471 | Ga0070698_100083790 | Ga0070698_1000837902 | 238 |
| 281 | 3300005471 | Ga0070698_100247228 | Ga0070698_1002472282 | 238 |
| 282 | 3300005471 | Ga0070698_100385143 | Ga0070698_1003851432 | 238 |
| 283 | 3300005471 | Ga0070698_100671570 | Ga0070698_1006715702 | 238 |
| 284 | 3300005518 | Ga0070699_100000388 | Ga0070699_10000038839 | 238 |
| 285 | 3300005518 | Ga0070699_100001651 | Ga0070699_10000165112 | 238 |
| 286 | 3300005518 | Ga0070699_100014128 | Ga0070699_1000141283 | 238 |
| 287 | 3300005518 | Ga0070699_100025124 | Ga0070699_1000251244 | 238 |
| 288 | 3300005518 | Ga0070699_100027914 | Ga0070699_1000279142 | 238 |
| 289 | 3300005518 | Ga0070699_100061496 | Ga0070699_1000614962 | 238 |
| 290 | 3300005518 | Ga0070699_100081764 | Ga0070699_1000817642 | 238 |
| 291 | 3300005518 | Ga0070699_100108356 | Ga0070699_1001083562 | 238 |
| 292 | 3300005518 | Ga0070699_100195297 | Ga0070699_1001952972 | 238 |
| 293 | 3300005518 | Ga0070699_100379626 | Ga0070699_1003796262 | 238 |
| 294 | 3300005530 | Ga0070679_100028536 | Ga0070679_1000285366 | 238 |
| 295 | 3300005535 | Ga0070684_100001607 | Ga0070684_1000016076 | 238 |
| 296 | 3300005535 | Ga0070684_100005752 | Ga0070684_1000057527 | 238 |
| 297 | 3300005535 | Ga0070684_100163975 | Ga0070684_1001639752 | 238 |
| 298 | 3300005536 | Ga0070697_100006069 | Ga0070697_1000060693 | 238 |
| 299 | 3300005536 | Ga0070697_100028711 | Ga0070697_1000287113 | 238 |
| 300 | 3300005536 | Ga0070697_100104650 | Ga0070697_1001046502 | 238 |
| 301 | 3300005536 | Ga0070697_100213299 | Ga0070697_1002132992 | 238 |
| 302 | 3300005539 | Ga0068853_100295519 | Ga0068853_1002955192 | 238 |
| 303 | 3300005543 | Ga0070672_100005758 | Ga0070672_1000057587 | 238 |
| 304 | 3300005543 | Ga0070672_100059416 | Ga0070672_1000594162 | 238 |
| 305 | 3300005543 | Ga0070672_100084165 | Ga0070672_1000841652 | 238 |
| 306 | 3300005544 | Ga0070686_100024077 | Ga0070686_1000240772 | 238 |
| 307 | 3300005544 | Ga0070686_100167871 | Ga0070686_1001678712 | 238 |
| 308 | 3300005544 | Ga0070686_100389065 | Ga0070686_1003890652 | 238 |
| 309 | 3300005544 | Ga0070686_100465093 | Ga0070686_1004650932 | 238 |
| 310 | 3300005545 | Ga0070695_100003902 | Ga0070695_1000039027 | 238 |
| 311 | 3300005545 | Ga0070695_100041240 | Ga0070695_1000412402 | 238 |
| 312 | 3300005545 | Ga0070695_100112542 | Ga0070695_1001125422 | 238 |
| 313 | 3300005546 | Ga0070696_100005465 | Ga0070696_1000054653 | 238 |
| 314 | 3300005546 | Ga0070696_100040027 | Ga0070696_1000400273 | 238 |
| 315 | 3300005546 | Ga0070696_100086982 | Ga0070696_1000869822 | 238 |
| 316 | 3300005546 | Ga0070696_100547662 | Ga0070696_1005476621 | 238 |
| 317 | 3300005547 | Ga0070693_100066041 | Ga0070693_1000660412 | 238 |
| 318 | 3300005548 | Ga0070665_100065573 | Ga0070665_1000655732 | 238 |
| 319 | 3300005549 | Ga0070704_100000718 | Ga0070704_10000071814 | 238 |
| 320 | 3300005549 | Ga0070704_100009228 | Ga0070704_1000092284 | 238 |
| 321 | 3300005549 | Ga0070704_100025085 | Ga0070704_1000250851 | 238 |
| 322 | 3300005549 | Ga0070704_100044405 | Ga0070704_1000444052 | 238 |
| 323 | 3300005549 | Ga0070704_100624956 | Ga0070704_1006249562 | 238 |
| 324 | 3300005564 | Ga0070664_100002520 | Ga0070664_1000025209 | 238 |
| 325 | 3300005564 | Ga0070664_100016849 | Ga0070664_1000168494 | 238 |
| 326 | 3300005577 | Ga0068857_100042312 | Ga0068857_1000423122 | 238 |
| 327 | 3300005577 | Ga0068857_100138987 | Ga0068857_1001389872 | 238 |
| 328 | 3300005577 | Ga0068857_100160805 | Ga0068857_1001608052 | 238 |
| 329 | 3300005578 | Ga0068854_100019045 | Ga0068854_1000190452 | 238 |
| 330 | 3300005578 | Ga0068854_100042743 | Ga0068854_1000427432 | 238 |
| 331 | 3300005615 | Ga0070702_100203421 | Ga0070702_1002034212 | 238 |
| 332 | 3300005617 | Ga0068859_100000940 | Ga0068859_10000094011 | 238 |
| 333 | 3300005617 | Ga0068859_100003972 | Ga0068859_1000039729 | 238 |
| 334 | 3300005617 | Ga0068859_100038713 | Ga0068859_1000387132 | 238 |
| 335 | 3300005617 | Ga0068859_100060701 | Ga0068859_1000607012 | 238 |
| 336 | 3300005617 | Ga0068859_100248282 | Ga0068859_1002482822 | 238 |
| 337 | 3300005617 | Ga0068859_100505346 | Ga0068859_1005053462 | 238 |
| 338 | 3300005618 | Ga0068864_100028303 | Ga0068864_1000283032 | 238 |
| 339 | 3300005618 | Ga0068864_100186160 | Ga0068864_1001861602 | 238 |
| 340 | 3300005618 | Ga0068864_100425635 | Ga0068864_1004256352 | 238 |
| 341 | 3300005719 | Ga0068861_100000753 | Ga0068861_10000075317 | 238 |
| 342 | 3300005719 | Ga0068861_100027954 | Ga0068861_1000279542 | 238 |
| 343 | 3300005719 | Ga0068861_100128155 | Ga0068861_1001281552 | 238 |
| 344 | 3300005719 | Ga0068861_100167648 | Ga0068861_1001676482 | 238 |
| 345 | 3300005719 | Ga0068861_100190742 | Ga0068861_1001907422 | 238 |
| 346 | 3300005719 | Ga0068861_100405535 | Ga0068861_1004055352 | 238 |
| 347 | 3300005834 | Ga0068851_10111766 | Ga0068851_101117662 | 238 |
| 348 | 3300005840 | Ga0068870_10014038 | Ga0068870_100140382 | 238 |
| 349 | 3300005841 | Ga0068863_100009319 | Ga0068863_1000093192 | 238 |
| 350 | 3300005841 | Ga0068863_100102559 | Ga0068863_1001025592 | 238 |
| 351 | 3300005841 | Ga0068863_100169327 | Ga0068863_1001693272 | 238 |
| 352 | 3300005841 | Ga0068863_100217153 | Ga0068863_1002171532 | 238 |
| 353 | 3300005842 | Ga0068858_100009204 | Ga0068858_1000092046 | 238 |
| 354 | 3300005842 | Ga0068858_100019683 | Ga0068858_1000196837 | 238 |
| 355 | 3300005842 | Ga0068858_100158144 | Ga0068858_1001581442 | 238 |
| 356 | 3300005842 | Ga0068858_100274625 | Ga0068858_1002746252 | 238 |
| 357 | 3300005842 | Ga0068858_100457983 | Ga0068858_1004579832 | 238 |
| 358 | 3300005843 | Ga0068860_100024357 | Ga0068860_1000243575 | 238 |
| 359 | 3300005843 | Ga0068860_100024428 | Ga0068860_1000244282 | 238 |
| 360 | 3300005843 | Ga0068860_100084499 | Ga0068860_1000844992 | 238 |
| 361 | 3300005843 | Ga0068860_100141468 | Ga0068860_1001414682 | 238 |
| 362 | 3300005844 | Ga0068862_100000612 | Ga0068862_10000061211 | 238 |
| 363 | 3300005844 | Ga0068862_100039204 | Ga0068862_1000392042 | 238 |
| 364 | 3300005844 | Ga0068862_100052619 | Ga0068862_1000526193 | 238 |
| 365 | 3300005844 | Ga0068862_100139194 | Ga0068862_1001391942 | 238 |
| 366 | 3300005844 | Ga0068862_100200359 | Ga0068862_1002003592 | 238 |
| 367 | 3300005844 | Ga0068862_100210502 | Ga0068862_1002105021 | 238 |
| 368 | 3300005937 | Ga0081455_10002517 | Ga0081455_1000251712 | 238 |
| 369 | 3300005981 | Ga0081538_10007747 | Ga0081538_100077472 | 238 |
| 370 | 3300005983 | Ga0081540_1015496 | Ga0081540_10154962 | 238 |
| 371 | 3300005985 | Ga0081539_10027639 | Ga0081539_100276393 | 238 |
| 372 | 3300005985 | Ga0081539_10052810 | Ga0081539_100528103 | 238 |
| 373 | 3300006042 | Ga0075368_10007051 | Ga0075368_100070512 | 238 |
| 374 | 3300006042 | Ga0075368_10009337 | Ga0075368_100093372 | 238 |
| 375 | 3300006048 | Ga0075363_100020050 | Ga0075363_1000200502 | 238 |
| 376 | 3300006051 | Ga0075364_10011053 | Ga0075364_100110533 | 238 |
| 377 | 3300006051 | Ga0075364_10047832 | Ga0075364_100478322 | 238 |
| 378 | 3300006051 | Ga0075364_10048544 | Ga0075364_100485443 | 238 |
| 379 | 3300006051 | Ga0075364_10132308 | Ga0075364_101323082 | 238 |
| 380 | 3300006051 | Ga0075364_10189464 | Ga0075364_101894642 | 238 |
| 381 | 3300006173 | Ga0070716_100170006 | Ga0070716_1001700062 | 238 |
| 382 | 3300006177 | Ga0075362_10000342 | Ga0075362_100003423 | 238 |
| 383 | 3300006177 | Ga0075362_10009532 | Ga0075362_100095324 | 238 |
| 384 | 3300006178 | Ga0075367_10002146 | Ga0075367_100021464 | 238 |
| 385 | 3300006178 | Ga0075367_10008454 | Ga0075367_100084545 | 238 |
| 386 | 3300006178 | Ga0075367_10014597 | Ga0075367_100145974 | 238 |
| 387 | 3300006178 | Ga0075367_10047450 | Ga0075367_100474502 | 238 |
| 388 | 3300006195 | Ga0075366_10001977 | Ga0075366_100019777 | 238 |
| 389 | 3300006195 | Ga0075366_10004267 | Ga0075366_100042673 | 238 |
| 390 | 3300006237 | Ga0097621_100044020 | Ga0097621_1000440202 | 238 |
| 391 | 3300006237 | Ga0097621_100050875 | Ga0097621_1000508752 | 238 |
| 392 | 3300006237 | Ga0097621_100268169 | Ga0097621_1002681691 | 238 |
| 393 | 3300006237 | Ga0097621_100361067 | Ga0097621_1003610672 | 238 |
| 394 | 3300006237 | Ga0097621_100507716 | Ga0097621_1005077162 | 238 |
| 395 | 3300006353 | Ga0075370_10008821 | Ga0075370_100088212 | 238 |
| 396 | 3300006353 | Ga0075370_10126123 | Ga0075370_101261232 | 238 |
| 397 | 3300006358 | Ga0068871_100012078 | Ga0068871_1000120786 | 238 |
| 398 | 3300006358 | Ga0068871_100093277 | Ga0068871_1000932772 | 238 |
| 399 | 3300006358 | Ga0068871_100246910 | Ga0068871_1002469102 | 238 |
| 400 | 3300006844 | Ga0075428_100000037 | Ga0075428_10000003772 | 238 |
| 401 | 3300006844 | Ga0075428_100000862 | Ga0075428_10000086223 | 238 |
| 402 | 3300006844 | Ga0075428_100011075 | Ga0075428_10001107512 | 238 |
| 403 | 3300006844 | Ga0075428_100013797 | Ga0075428_1000137973 | 238 |
| 404 | 3300006844 | Ga0075428_100028725 | Ga0075428_1000287256 | 238 |
| 405 | 3300006844 | Ga0075428_100079714 | Ga0075428_1000797143 | 238 |
| 406 | 3300006844 | Ga0075428_100081214 | Ga0075428_1000812142 | 238 |
| 407 | 3300006844 | Ga0075428_100084143 | Ga0075428_1000841433 | 238 |
| 408 | 3300006844 | Ga0075428_100135988 | Ga0075428_1001359882 | 238 |
| 409 | 3300006844 | Ga0075428_100180128 | Ga0075428_1001801282 | 238 |
| 410 | 3300006844 | Ga0075428_100316600 | Ga0075428_1003166002 | 238 |
| 411 | 3300006844 | Ga0075428_100333260 | Ga0075428_1003332602 | 238 |
| 412 | 3300006844 | Ga0075428_100599064 | Ga0075428_1005990642 | 238 |
| 413 | 3300006846 | Ga0075430_100095248 | Ga0075430_1000952482 | 238 |
| 414 | 3300006846 | Ga0075430_100099053 | Ga0075430_1000990532 | 238 |
| 415 | 3300006846 | Ga0075430_100131855 | Ga0075430_1001318552 | 238 |
| 416 | 3300006846 | Ga0075430_100155649 | Ga0075430_1001556492 | 238 |
| 417 | 3300006846 | Ga0075430_100220864 | Ga0075430_1002208642 | 238 |
| 418 | 3300006846 | Ga0075430_100229698 | Ga0075430_1002296982 | 238 |
| 419 | 3300006847 | Ga0075431_100012414 | Ga0075431_1000124145 | 238 |
| 420 | 3300006847 | Ga0075431_100046991 | Ga0075431_1000469913 | 238 |
| 421 | 3300006847 | Ga0075431_100073064 | Ga0075431_1000730642 | 238 |
| 422 | 3300006847 | Ga0075431_100096915 | Ga0075431_1000969152 | 238 |
| 423 | 3300006847 | Ga0075431_100110730 | Ga0075431_1001107301 | 238 |
| 424 | 3300006852 | Ga0075433_10007731 | Ga0075433_100077317 | 238 |
| 425 | 3300006852 | Ga0075433_10039242 | Ga0075433_100392423 | 238 |
| 426 | 3300006852 | Ga0075433_10052832 | Ga0075433_100528323 | 238 |
| 427 | 3300006852 | Ga0075433_10054439 | Ga0075433_100544393 | 238 |
| 428 | 3300006852 | Ga0075433_10057366 | Ga0075433_100573662 | 238 |
| 429 | 3300006852 | Ga0075433_10081956 | Ga0075433_100819563 | 238 |
| 430 | 3300006852 | Ga0075433_10155475 | Ga0075433_101554752 | 238 |
| 431 | 3300006852 | Ga0075433_10184022 | Ga0075433_101840222 | 238 |
| 432 | 3300006852 | Ga0075433_10260765 | Ga0075433_102607652 | 238 |
| 433 | 3300006852 | Ga0075433_10404294 | Ga0075433_104042942 | 238 |
| 434 | 3300006852 | Ga0075433_10412631 | Ga0075433_104126312 | 238 |
| 435 | 3300006871 | Ga0075434_100000019 | Ga0075434_10000001940 | 238 |
| 436 | 3300006871 | Ga0075434_100001168 | Ga0075434_10000116812 | 238 |
| 437 | 3300006871 | Ga0075434_100009596 | Ga0075434_1000095967 | 238 |
| 438 | 3300006871 | Ga0075434_100081191 | Ga0075434_1000811912 | 238 |
| 439 | 3300006871 | Ga0075434_100084276 | Ga0075434_1000842763 | 238 |
| 440 | 3300006871 | Ga0075434_100179364 | Ga0075434_1001793642 | 238 |
| 441 | 3300006871 | Ga0075434_100247819 | Ga0075434_1002478192 | 238 |
| 442 | 3300006871 | Ga0075434_100356718 | Ga0075434_1003567182 | 238 |
| 443 | 3300006880 | Ga0075429_100005390 | Ga0075429_1000053905 | 238 |
| 444 | 3300006880 | Ga0075429_100007476 | Ga0075429_1000074761 | 238 |
| 445 | 3300006880 | Ga0075429_100058680 | Ga0075429_1000586803 | 238 |
| 446 | 3300006880 | Ga0075429_100111123 | Ga0075429_1001111232 | 238 |
| 447 | 3300006881 | Ga0068865_100010101 | Ga0068865_1000101014 | 238 |
| 448 | 3300006881 | Ga0068865_100014003 | Ga0068865_1000140035 | 238 |
| 449 | 3300006914 | Ga0075436_100000160 | Ga0075436_10000016015 | 238 |
| 450 | 3300006914 | Ga0075436_100019245 | Ga0075436_1000192454 | 238 |
| 451 | 3300006914 | Ga0075436_100035724 | Ga0075436_1000357242 | 238 |
| 452 | 3300006914 | Ga0075436_100324167 | Ga0075436_1003241671 | 238 |
| 453 | 3300006931 | Ga0097620_100000940 | Ga0097620_10000094011 | 238 |
| 454 | 3300006931 | Ga0097620_100003972 | Ga0097620_1000039729 | 238 |
| 455 | 3300006931 | Ga0097620_100038715 | Ga0097620_1000387153 | 238 |
| 456 | 3300006931 | Ga0097620_100060700 | Ga0097620_1000607002 | 238 |
| 457 | 3300006931 | Ga0097620_100248275 | Ga0097620_1002482751 | 238 |
| 458 | 3300006931 | Ga0097620_100505408 | Ga0097620_1005054082 | 238 |
| 459 | 3300007076 | Ga0075435_100000041 | Ga0075435_10000004118 | 238 |
| 460 | 3300007076 | Ga0075435_100009005 | Ga0075435_1000090053 | 238 |
| 461 | 3300007076 | Ga0075435_100009374 | Ga0075435_1000093747 | 238 |
| 462 | 3300007076 | Ga0075435_100012805 | Ga0075435_1000128052 | 238 |
| 463 | 3300007076 | Ga0075435_100015015 | Ga0075435_1000150153 | 238 |
| 464 | 3300007076 | Ga0075435_100023820 | Ga0075435_1000238204 | 238 |
| 465 | 3300007076 | Ga0075435_100027371 | Ga0075435_1000273712 | 238 |
| 466 | 3300007076 | Ga0075435_100122061 | Ga0075435_1001220612 | 238 |
| 467 | 3300009093 | Ga0105240_10312044 | Ga0105240_103120442 | 238 |
| 468 | 3300009093 | Ga0105240_10376406 | Ga0105240_103764062 | 238 |
| 469 | 3300009094 | Ga0111539_10000009 | Ga0111539_10000009212 | 238 |
| 470 | 3300009094 | Ga0111539_10001537 | Ga0111539_1000153715 | 238 |
| 471 | 3300009094 | Ga0111539_10006768 | Ga0111539_100067683 | 238 |
| 472 | 3300009094 | Ga0111539_10008826 | Ga0111539_100088269 | 238 |
| 473 | 3300009094 | Ga0111539_10080387 | Ga0111539_100803872 | 238 |
| 474 | 3300009094 | Ga0111539_10155020 | Ga0111539_101550202 | 238 |
| 475 | 3300009094 | Ga0111539_10318443 | Ga0111539_103184432 | 238 |
| 476 | 3300009094 | Ga0111539_10390908 | Ga0111539_103909082 | 238 |
| 477 | 3300009094 | Ga0111539_10813561 | Ga0111539_108135611 | 238 |
| 478 | 3300009098 | Ga0105245_10037421 | Ga0105245_100374212 | 238 |
| 479 | 3300009098 | Ga0105245_10478930 | Ga0105245_104789301 | 238 |
| 480 | 3300009098 | Ga0105245_10588771 | Ga0105245_105887712 | 238 |
| 481 | 3300009101 | Ga0105247_10062558 | Ga0105247_100625582 | 238 |
| 482 | 3300009147 | Ga0114129_10001294 | Ga0114129_100012942 | 238 |
| 483 | 3300009147 | Ga0114129_10002457 | Ga0114129_100024578 | 238 |
| 484 | 3300009147 | Ga0114129_10006209 | Ga0114129_100062096 | 238 |
| 485 | 3300009147 | Ga0114129_10013305 | Ga0114129_100133053 | 238 |
| 486 | 3300009147 | Ga0114129_10022844 | Ga0114129_100228445 | 238 |
| 487 | 3300009147 | Ga0114129_10027092 | Ga0114129_100270922 | 238 |
| 488 | 3300009147 | Ga0114129_10028182 | Ga0114129_100281822 | 238 |
| 489 | 3300009147 | Ga0114129_10055196 | Ga0114129_100551964 | 238 |
| 490 | 3300009147 | Ga0114129_10062679 | Ga0114129_100626792 | 238 |
| 491 | 3300009147 | Ga0114129_10096224 | Ga0114129_100962242 | 238 |
| 492 | 3300009147 | Ga0114129_10101489 | Ga0114129_101014892 | 238 |
| 493 | 3300009147 | Ga0114129_10221239 | Ga0114129_102212391 | 238 |
| 494 | 3300009147 | Ga0114129_10240049 | Ga0114129_102400492 | 238 |
| 495 | 3300009147 | Ga0114129_10329959 | Ga0114129_103299591 | 238 |
| 496 | 3300009147 | Ga0114129_10412042 | Ga0114129_104120422 | 238 |
| 497 | 3300009147 | Ga0114129_10415252 | Ga0114129_104152522 | 238 |
| 498 | 3300009147 | Ga0114129_10629028 | Ga0114129_106290282 | 238 |
| 499 | 3300009147 | Ga0114129_10712688 | Ga0114129_107126882 | 238 |
| 500 | 3300009147 | Ga0114129_10863037 | Ga0114129_108630372 | 238 |
| 501 | 3300009147 | Ga0114129_11227867 | Ga0114129_112278672 | 238 |
| 502 | 3300009148 | Ga0105243_10255676 | Ga0105243_102556762 | 238 |
| 503 | 3300009174 | Ga0105241_10038324 | Ga0105241_100383243 | 238 |
| 504 | 3300009174 | Ga0105241_10053004 | Ga0105241_100530044 | 238 |
| 505 | 3300009174 | Ga0105241_10628713 | Ga0105241_106287131 | 238 |
| 506 | 3300009176 | Ga0105242_10016080 | Ga0105242_100160804 | 238 |
| 507 | 3300009176 | Ga0105242_10016312 | Ga0105242_100163125 | 238 |
| 508 | 3300009176 | Ga0105242_10018000 | Ga0105242_100180005 | 238 |
| 509 | 3300009176 | Ga0105242_10460910 | Ga0105242_104609102 | 238 |
| 510 | 3300009177 | Ga0105248_10031306 | Ga0105248_100313065 | 238 |
| 511 | 3300009177 | Ga0105248_10093562 | Ga0105248_100935623 | 238 |
| 512 | 3300009177 | Ga0105248_10139977 | Ga0105248_101399772 | 238 |
| 513 | 3300009177 | Ga0105248_10148033 | Ga0105248_101480332 | 238 |
| 514 | 3300009177 | Ga0105248_10243788 | Ga0105248_102437882 | 238 |
| 515 | 3300009177 | Ga0105248_10398371 | Ga0105248_103983712 | 238 |
| 516 | 3300009177 | Ga0105248_10412292 | Ga0105248_104122922 | 238 |
| 517 | 3300009177 | Ga0105248_10548766 | Ga0105248_105487662 | 238 |
| 518 | 3300009551 | Ga0105238_10736138 | Ga0105238_107361382 | 238 |
| 519 | 3300009553 | Ga0105249_10003036 | Ga0105249_100030362 | 238 |
| 520 | 3300009553 | Ga0105249_10022901 | Ga0105249_100229012 | 238 |
| 521 | 3300009553 | Ga0105249_10049361 | Ga0105249_100493613 | 238 |
| 522 | 3300009553 | Ga0105249_10131718 | Ga0105249_101317182 | 238 |
| 523 | 3300009553 | Ga0105249_10222121 | Ga0105249_102221212 | 238 |
| 524 | 3300009553 | Ga0105249_10314628 | Ga0105249_103146282 | 238 |
| 525 | 3300009553 | Ga0105249_10321939 | Ga0105249_103219392 | 238 |
| 526 | 3300009553 | Ga0105249_10524618 | Ga0105249_105246182 | 238 |
| 527 | 3300013296 | Ga0157374_10030945 | Ga0157374_100309453 | 238 |
| 528 | 3300013296 | Ga0157374_10225484 | Ga0157374_102254842 | 238 |
| 529 | 3300013296 | Ga0157374_10324324 | Ga0157374_103243242 | 238 |
| 530 | 3300013297 | Ga0157378_10080042 | Ga0157378_100800422 | 238 |
| 531 | 3300013306 | Ga0163162_10133984 | Ga0163162_101339841 | 238 |
| 532 | 3300013306 | Ga0163162_10152375 | Ga0163162_101523752 | 238 |
| 533 | 3300013306 | Ga0163162_10225525 | Ga0163162_102255252 | 238 |
| 534 | 3300013308 | Ga0157375_10084503 | Ga0157375_100845033 | 238 |
| 535 | 3300013308 | Ga0157375_10394347 | Ga0157375_103943472 | 238 |
| 536 | 3300013308 | Ga0157375_10404597 | Ga0157375_104045971 | 238 |
| 537 | 3300013308 | Ga0157375_10490619 | Ga0157375_104906192 | 238 |
| 538 | 3300013308 | Ga0157375_10907241 | Ga0157375_109072412 | 238 |
| 539 | 3300014325 | Ga0163163_10004353 | Ga0163163_100043533 | 238 |
| 540 | 3300014325 | Ga0163163_10149794 | Ga0163163_101497942 | 238 |
| 541 | 3300014326 | Ga0157380_10008295 | Ga0157380_100082956 | 238 |
| 542 | 3300014326 | Ga0157380_10019709 | Ga0157380_100197093 | 238 |
| 543 | 3300014326 | Ga0157380_10071434 | Ga0157380_100714342 | 238 |
| 544 | 3300014326 | Ga0157380_10076260 | Ga0157380_100762602 | 238 |
| 545 | 3300014326 | Ga0157380_10241933 | Ga0157380_102419332 | 238 |
| 546 | 3300014968 | Ga0157379_10026173 | Ga0157379_100261732 | 238 |
| 547 | 3300014969 | Ga0157376_10048399 | Ga0157376_100483992 | 238 |
| 548 | 3300014969 | Ga0157376_10420505 | Ga0157376_104205052 | 238 |
| 549 | 3300025315 | Ga0207697_10102455 | Ga0207697_101024552 | 238 |
| 550 | 3300025321 | Ga0207656_10077204 | Ga0207656_100772042 | 238 |
| 551 | 3300025893 | Ga0207682_10039732 | Ga0207682_100397323 | 238 |
| 552 | 3300025893 | Ga0207682_10136217 | Ga0207682_101362172 | 238 |
| 553 | 3300025903 | Ga0207680_10126590 | Ga0207680_101265902 | 238 |
| 554 | 3300025906 | Ga0207699_10141209 | Ga0207699_101412092 | 238 |
| 555 | 3300025906 | Ga0207699_10175738 | Ga0207699_101757382 | 238 |
| 556 | 3300025907 | Ga0207645_10032234 | Ga0207645_100322342 | 238 |
| 557 | 3300025907 | Ga0207645_10049279 | Ga0207645_100492792 | 238 |
| 558 | 3300025907 | Ga0207645_10087849 | Ga0207645_100878492 | 238 |
| 559 | 3300025907 | Ga0207645_10155466 | Ga0207645_101554662 | 238 |
| 560 | 3300025907 | Ga0207645_10215451 | Ga0207645_102154512 | 238 |
| 561 | 3300025907 | Ga0207645_10289435 | Ga0207645_102894352 | 238 |
| 562 | 3300025908 | Ga0207643_10021437 | Ga0207643_100214372 | 238 |
| 563 | 3300025908 | Ga0207643_10059667 | Ga0207643_100596672 | 238 |
| 564 | 3300025910 | Ga0207684_10002898 | Ga0207684_100028989 | 238 |
| 565 | 3300025910 | Ga0207684_10018006 | Ga0207684_100180067 | 238 |
| 566 | 3300025910 | Ga0207684_10107159 | Ga0207684_101071592 | 238 |
| 567 | 3300025910 | Ga0207684_10192771 | Ga0207684_101927712 | 238 |
| 568 | 3300025910 | Ga0207684_10293250 | Ga0207684_102932502 | 238 |
| 569 | 3300025910 | Ga0207684_10646670 | Ga0207684_106466702 | 238 |
| 570 | 3300025911 | Ga0207654_10041097 | Ga0207654_100410972 | 238 |
| 571 | 3300025913 | Ga0207695_10235075 | Ga0207695_102350752 | 238 |
| 572 | 3300025917 | Ga0207660_10117351 | Ga0207660_101173512 | 238 |
| 573 | 3300025917 | Ga0207660_10178651 | Ga0207660_101786512 | 238 |
| 574 | 3300025917 | Ga0207660_10351067 | Ga0207660_103510672 | 238 |
| 575 | 3300025918 | Ga0207662_10034224 | Ga0207662_100342242 | 238 |
| 576 | 3300025918 | Ga0207662_10080037 | Ga0207662_100800372 | 238 |
| 577 | 3300025918 | Ga0207662_10168725 | Ga0207662_101687252 | 238 |
| 578 | 3300025920 | Ga0207649_10017165 | Ga0207649_100171652 | 238 |
| 579 | 3300025922 | Ga0207646_10004695 | Ga0207646_100046956 | 238 |
| 580 | 3300025922 | Ga0207646_10017592 | Ga0207646_100175926 | 238 |
| 581 | 3300025922 | Ga0207646_10090244 | Ga0207646_100902442 | 238 |
| 582 | 3300025922 | Ga0207646_10112625 | Ga0207646_101126252 | 238 |
| 583 | 3300025922 | Ga0207646_10126651 | Ga0207646_101266511 | 238 |
| 584 | 3300025922 | Ga0207646_10229372 | Ga0207646_102293722 | 238 |
| 585 | 3300025922 | Ga0207646_10306821 | Ga0207646_103068212 | 238 |
| 586 | 3300025922 | Ga0207646_10327475 | Ga0207646_103274751 | 238 |
| 587 | 3300025923 | Ga0207681_10005037 | Ga0207681_100050377 | 238 |
| 588 | 3300025923 | Ga0207681_10017604 | Ga0207681_100176042 | 238 |
| 589 | 3300025923 | Ga0207681_10104669 | Ga0207681_101046692 | 238 |
| 590 | 3300025923 | Ga0207681_10201533 | Ga0207681_102015332 | 238 |
| 591 | 3300025925 | Ga0207650_10036705 | Ga0207650_100367053 | 238 |
| 592 | 3300025925 | Ga0207650_10110255 | Ga0207650_101102551 | 238 |
| 593 | 3300025925 | Ga0207650_10218717 | Ga0207650_102187172 | 238 |
| 594 | 3300025926 | Ga0207659_10000188 | Ga0207659_1000018823 | 238 |
| 595 | 3300025926 | Ga0207659_10014321 | Ga0207659_100143212 | 238 |
| 596 | 3300025926 | Ga0207659_10018680 | Ga0207659_100186803 | 238 |
| 597 | 3300025926 | Ga0207659_10134331 | Ga0207659_101343312 | 238 |
| 598 | 3300025926 | Ga0207659_10269349 | Ga0207659_102693492 | 238 |
| 599 | 3300025926 | Ga0207659_10355032 | Ga0207659_103550322 | 238 |
| 600 | 3300025926 | Ga0207659_10464624 | Ga0207659_104646241 | 238 |
| 601 | 3300025927 | Ga0207687_10022568 | Ga0207687_100225683 | 238 |
| 602 | 3300025927 | Ga0207687_10367888 | Ga0207687_103678881 | 238 |
| 603 | 3300025928 | Ga0207700_10008063 | Ga0207700_100080634 | 238 |
| 604 | 3300025931 | Ga0207644_10106522 | Ga0207644_101065222 | 238 |
| 605 | 3300025932 | Ga0207690_10027586 | Ga0207690_100275863 | 238 |
| 606 | 3300025933 | Ga0207706_10045956 | Ga0207706_100459562 | 238 |
| 607 | 3300025933 | Ga0207706_10087817 | Ga0207706_100878172 | 238 |
| 608 | 3300025933 | Ga0207706_10100969 | Ga0207706_101009692 | 238 |
| 609 | 3300025933 | Ga0207706_10203135 | Ga0207706_102031352 | 238 |
| 610 | 3300025934 | Ga0207686_10006180 | Ga0207686_100061805 | 238 |
| 611 | 3300025935 | Ga0207709_10313972 | Ga0207709_103139721 | 238 |
| 612 | 3300025936 | Ga0207670_10003997 | Ga0207670_100039976 | 238 |
| 613 | 3300025936 | Ga0207670_10009084 | Ga0207670_100090842 | 238 |
| 614 | 3300025936 | Ga0207670_10201744 | Ga0207670_102017441 | 238 |
| 615 | 3300025937 | Ga0207669_10006704 | Ga0207669_100067042 | 238 |
| 616 | 3300025937 | Ga0207669_10010515 | Ga0207669_100105152 | 238 |
| 617 | 3300025937 | Ga0207669_10013007 | Ga0207669_100130074 | 238 |
| 618 | 3300025937 | Ga0207669_10024631 | Ga0207669_100246312 | 238 |
| 619 | 3300025938 | Ga0207704_10135832 | Ga0207704_101358322 | 238 |
| 620 | 3300025938 | Ga0207704_10143235 | Ga0207704_101432352 | 238 |
| 621 | 3300025940 | Ga0207691_10006107 | Ga0207691_100061075 | 238 |
| 622 | 3300025940 | Ga0207691_10022906 | Ga0207691_100229063 | 238 |
| 623 | 3300025940 | Ga0207691_10063906 | Ga0207691_100639063 | 238 |
| 624 | 3300025940 | Ga0207691_10092316 | Ga0207691_100923162 | 238 |
| 625 | 3300025940 | Ga0207691_10113871 | Ga0207691_101138712 | 238 |
| 626 | 3300025941 | Ga0207711_10051889 | Ga0207711_100518892 | 238 |
| 627 | 3300025941 | Ga0207711_10188431 | Ga0207711_101884312 | 238 |
| 628 | 3300025941 | Ga0207711_10255968 | Ga0207711_102559682 | 238 |
| 629 | 3300025942 | Ga0207689_10017760 | Ga0207689_100177602 | 238 |
| 630 | 3300025942 | Ga0207689_10079510 | Ga0207689_100795102 | 238 |
| 631 | 3300025942 | Ga0207689_10083757 | Ga0207689_100837572 | 238 |
| 632 | 3300025944 | Ga0207661_10011215 | Ga0207661_100112155 | 238 |
| 633 | 3300025944 | Ga0207661_10156657 | Ga0207661_101566572 | 238 |
| 634 | 3300025945 | Ga0207679_10002659 | Ga0207679_100026595 | 238 |
| 635 | 3300025945 | Ga0207679_10124202 | Ga0207679_101242022 | 238 |
| 636 | 3300025945 | Ga0207679_10126194 | Ga0207679_101261942 | 238 |
| 637 | 3300025945 | Ga0207679_10363460 | Ga0207679_103634602 | 238 |
| 638 | 3300025949 | Ga0207667_10278442 | Ga0207667_102784422 | 238 |
| 639 | 3300025960 | Ga0207651_10023379 | Ga0207651_100233792 | 238 |
| 640 | 3300025960 | Ga0207651_10025902 | Ga0207651_100259023 | 238 |
| 641 | 3300025960 | Ga0207651_10052833 | Ga0207651_100528332 | 238 |
| 642 | 3300025960 | Ga0207651_10111975 | Ga0207651_101119752 | 238 |
| 643 | 3300025960 | Ga0207651_10195355 | Ga0207651_101953552 | 238 |
| 644 | 3300025960 | Ga0207651_10204382 | Ga0207651_102043821 | 238 |
| 645 | 3300025960 | Ga0207651_10268256 | Ga0207651_102682562 | 238 |
| 646 | 3300025961 | Ga0207712_10018953 | Ga0207712_100189532 | 238 |
| 647 | 3300025961 | Ga0207712_10088448 | Ga0207712_100884482 | 238 |
| 648 | 3300025961 | Ga0207712_10155321 | Ga0207712_101553212 | 238 |
| 649 | 3300025961 | Ga0207712_10453719 | Ga0207712_104537192 | 238 |
| 650 | 3300025961 | Ga0207712_10474054 | Ga0207712_104740541 | 238 |
| 651 | 3300025972 | Ga0207668_10063637 | Ga0207668_100636371 | 238 |
| 652 | 3300025972 | Ga0207668_10150746 | Ga0207668_101507462 | 238 |
| 653 | 3300025972 | Ga0207668_10185652 | Ga0207668_101856522 | 238 |
| 654 | 3300025981 | Ga0207640_10030010 | Ga0207640_100300102 | 238 |
| 655 | 3300025981 | Ga0207640_10037127 | Ga0207640_100371273 | 238 |
| 656 | 3300025986 | Ga0207658_10181141 | Ga0207658_101811412 | 238 |
| 657 | 3300025986 | Ga0207658_10226951 | Ga0207658_102269512 | 238 |
| 658 | 3300025986 | Ga0207658_10530718 | Ga0207658_105307182 | 238 |
| 659 | 3300026023 | Ga0207677_10017072 | Ga0207677_100170722 | 238 |
| 660 | 3300026023 | Ga0207677_10017810 | Ga0207677_100178104 | 238 |
| 661 | 3300026023 | Ga0207677_10249195 | Ga0207677_102491952 | 238 |
| 662 | 3300026035 | Ga0207703_10004262 | Ga0207703_1000426211 | 238 |
| 663 | 3300026035 | Ga0207703_10138768 | Ga0207703_101387682 | 238 |
| 664 | 3300026035 | Ga0207703_10230660 | Ga0207703_102306602 | 238 |
| 665 | 3300026035 | Ga0207703_10351998 | Ga0207703_103519982 | 238 |
| 666 | 3300026067 | Ga0207678_10015984 | Ga0207678_100159846 | 238 |
| 667 | 3300026075 | Ga0207708_10011404 | Ga0207708_100114047 | 238 |
| 668 | 3300026075 | Ga0207708_10016816 | Ga0207708_100168165 | 238 |
| 669 | 3300026075 | Ga0207708_10026800 | Ga0207708_100268003 | 238 |
| 670 | 3300026075 | Ga0207708_10033011 | Ga0207708_100330115 | 238 |
| 671 | 3300026075 | Ga0207708_10033034 | Ga0207708_100330342 | 238 |
| 672 | 3300026075 | Ga0207708_10050529 | Ga0207708_100505292 | 238 |
| 673 | 3300026075 | Ga0207708_10067724 | Ga0207708_100677242 | 238 |
| 674 | 3300026075 | Ga0207708_10091051 | Ga0207708_100910512 | 238 |
| 675 | 3300026075 | Ga0207708_10149787 | Ga0207708_101497872 | 238 |
| 676 | 3300026088 | Ga0207641_10207438 | Ga0207641_102074381 | 238 |
| 677 | 3300026088 | Ga0207641_10493090 | Ga0207641_104930902 | 238 |
| 678 | 3300026089 | Ga0207648_10001860 | Ga0207648_100018607 | 238 |
| 679 | 3300026089 | Ga0207648_10031489 | Ga0207648_100314893 | 238 |
| 680 | 3300026089 | Ga0207648_10050958 | Ga0207648_100509583 | 238 |
| 681 | 3300026095 | Ga0207676_10024049 | Ga0207676_100240494 | 238 |
| 682 | 3300026095 | Ga0207676_10027327 | Ga0207676_100273272 | 238 |
| 683 | 3300026095 | Ga0207676_10042656 | Ga0207676_100426562 | 238 |
| 684 | 3300026095 | Ga0207676_10069868 | Ga0207676_100698682 | 238 |
| 685 | 3300026095 | Ga0207676_10223604 | Ga0207676_102236042 | 238 |
| 686 | 3300026116 | Ga0207674_10023655 | Ga0207674_100236552 | 238 |
| 687 | 3300026116 | Ga0207674_10044046 | Ga0207674_100440462 | 238 |
| 688 | 3300026116 | Ga0207674_10052540 | Ga0207674_100525402 | 238 |
| 689 | 3300026116 | Ga0207674_10122262 | Ga0207674_101222622 | 238 |
| 690 | 3300026116 | Ga0207674_10161279 | Ga0207674_101612792 | 238 |
| 691 | 3300026118 | Ga0207675_100006022 | Ga0207675_1000060224 | 238 |
| 692 | 3300026118 | Ga0207675_100022659 | Ga0207675_1000226594 | 238 |
| 693 | 3300026118 | Ga0207675_100048529 | Ga0207675_1000485292 | 238 |
| 694 | 3300026118 | Ga0207675_100050645 | Ga0207675_1000506452 | 238 |
| 695 | 3300026118 | Ga0207675_100051051 | Ga0207675_1000510513 | 238 |
| 696 | 3300026118 | Ga0207675_100339845 | Ga0207675_1003398452 | 238 |
| 697 | 3300026118 | Ga0207675_100427718 | Ga0207675_1004277182 | 238 |
| 698 | 3300026121 | Ga0207683_10039938 | Ga0207683_100399382 | 238 |
| 699 | 3300026121 | Ga0207683_10053529 | Ga0207683_100535292 | 238 |
| 700 | 3300026121 | Ga0207683_10461497 | Ga0207683_104614972 | 238 |
| 701 | 3300026142 | Ga0207698_10360865 | Ga0207698_103608652 | 238 |
| 702 | 3300027866 | Ga0209813_10007956 | Ga0209813_100079562 | 238 |
| 703 | 3300027876 | Ga0209974_10086695 | Ga0209974_100866952 | 238 |
| 704 | 3300027907 | Ga0207428_10000005 | Ga0207428_10000005414 | 238 |
| 705 | 3300027907 | Ga0207428_10000963 | Ga0207428_1000096330 | 238 |
| 706 | 3300027907 | Ga0207428_10001556 | Ga0207428_1000155612 | 238 |
| 707 | 3300027907 | Ga0207428_10001740 | Ga0207428_1000174019 | 238 |
| 708 | 3300027907 | Ga0207428_10019076 | Ga0207428_100190764 | 238 |
| 709 | 3300027907 | Ga0207428_10217213 | Ga0207428_102172132 | 238 |
| 710 | 3300028380 | Ga0268265_10000183 | Ga0268265_1000018364 | 238 |
| 711 | 3300028380 | Ga0268265_10095582 | Ga0268265_100955822 | 238 |
| 712 | 3300028380 | Ga0268265_10223540 | Ga0268265_102235402 | 238 |
| 713 | 3300028380 | Ga0268265_10399988 | Ga0268265_103999881 | 238 |
| 714 | 3300028381 | Ga0268264_10006097 | Ga0268264_100060976 | 238 |
| 715 | 3300028381 | Ga0268264_10309429 | Ga0268264_103094292 | 238 |
| 716 | 3300031727 | Ga0316576_10276245 | Ga0316576_102762451 | 238 |
| 717 | 3300031727 | Ga0316576_10358649 | Ga0316576_103586492 | 238 |
| 718 | 3300031852 | Ga0307410_10304204 | Ga0307410_103042042 | 238 |
| 719 | 3300031901 | Ga0307406_10133876 | Ga0307406_101338762 | 238 |
| 720 | 3300031903 | Ga0307407_10215608 | Ga0307407_102156081 | 238 |
| 721 | 3300031911 | Ga0307412_10497176 | Ga0307412_104971762 | 238 |
| 722 | 3300031995 | Ga0307409_100056429 | Ga0307409_1000564292 | 238 |
| 723 | 3300031995 | Ga0307409_100149029 | Ga0307409_1001490292 | 238 |
| 724 | 3300032002 | Ga0307416_100025487 | Ga0307416_1000254872 | 238 |
| 725 | 3300032002 | Ga0307416_100102786 | Ga0307416_1001027862 | 238 |
| 726 | 3300032005 | Ga0307411_10110595 | Ga0307411_101105952 | 238 |
| 727 | 3300032005 | Ga0307411_10325373 | Ga0307411_103253732 | 238 |
| 728 | 3300032126 | Ga0307415_100222295 | Ga0307415_1002222952 | 238 |
| 729 | 3300034816 | Ga0373930_0011111 | Ga0373930_0011111_433_1185 | 238 |
| 730 | 3300034819 | Ga0373958_0012953 | Ga0373958_0012953_23_775 | 238 |
| 731 | 3300034819 | Ga0373958_0021785 | Ga0373958_0021785_212_1024 | 238 |
| 732 | 3300035085 | Ga0373929_0001104 | Ga0373929_0001104_2853_3605 | 238 |
| 733 | 3300035088 | Ga0373940_0000039 | Ga0373940_0000039_2242_2994 | 238 |
| 734 | 3300035088 | Ga0373940_0069588 | Ga0373940_0069588_114_926 | 238 |
| 735 | 3300035090 | Ga0373949_0001162 | Ga0373949_0001162_2014_2766 | 238 |
| 736 | 3300035091 | Ga0373951_0002100 | Ga0373951_0002100_174_926 | 238 |
| 737 | 3300035112 | Ga0373932_0002751 | Ga0373932_0002751_1877_2629 | 238 |
| 738 | 3300035112 | Ga0373932_0061243 | Ga0373932_0061243_103_852 | 238 |
| 739 | 3300035114 | Ga0373939_0000940 | Ga0373939_0000940_2850_3602 | 238 |
| 740 | 3300035115 | Ga0373941_0001349 | Ga0373941_0001349_2291_3043 | 238 |
| 741 | 3300035116 | Ga0373945_0037248 | Ga0373945_0037248_651_1475 | 238 |
| 742 | 3300035119 | Ga0373956_0084511 | Ga0373956_0084511_340_1110 | 238 |
| 743 | 3300035121 | Ga0373960_0001226 | Ga0373960_0001226_2745_3497 | 238 |
| 744 | 3300035170 | Ga0373943_0003982 | Ga0373943_0003982_3750_4574 | 238 |
| 745 | 3300035171 | Ga0373946_0008520 | Ga0373946_0008520_2855_3679 | 238 |
| 746 | 3300035171 | Ga0373946_0251858 | Ga0373946_0251858_76_846 | 238 |
| 747 | 3300035172 | Ga0373955_0074212 | Ga0373955_0074212_924_1715 | 238 |
| 748 | 3300035172 | Ga0373955_0075377 | Ga0373955_0075377_717_1496 | 238 |
| 749 | 3300035207 | Ga0373942_0000750 | Ga0373942_0000750_2152_2904 | 238 |
| 750 | 3300035241 | Ga0373961_0002991 | Ga0373961_0002991_270_1022 | 238 |
| 751 | 3300035241 | Ga0373961_0064211 | Ga0373961_0064211_77_826 | 238 |
| 752 | 3300035242 | Ga0373962_0000766 | Ga0373962_0000766_1704_2456 | 238 |
| 753 | 3300035410 | Ga0373924_0010419 | Ga0373924_0010419_1504_2328 | 238 |
| 754 | 3300035410 | Ga0373924_0121792 | Ga0373924_0121792_83_853 | 238 |
| 755 | 3300035691 | Ga0373931_0001453 | Ga0373931_0001453_7451_8203 | 238 |
| 756 | 3300035691 | Ga0373931_0065359 | Ga0373931_0065359_226_975 | 238 |
| 757 | 3300035692 | Ga0373935_0026673 | Ga0373935_0026673_2655_3446 | 238 |
| 758 | 3300035692 | Ga0373935_0261811 | Ga0373935_0261811_332_1084 | 238 |
| 759 | 3300035695 | Ga0373927_0031710 | Ga0373927_0031710_271_1062 | 238 |
| 760 | 3300035724 | Ga0373933_0024873 | Ga0373933_0024873_1732_2511 | 238 |
| 761 | 3300035724 | Ga0373933_0132775 | Ga0373933_0132775_337_1089 | 238 |
| 762 | 3300036401 | Ga0373937_0003122 | Ga0373937_0003122_4633_5412 | 238 |
| 763 | 3300036401 | Ga0373937_0031300 | Ga0373937_0031300_213_965 | 238 |
| 764 | 3300036401 | Ga0373937_0279887 | Ga0373937_0279887_489_1259 | 238 |
| 765 | 3300036401 | Ga0373937_0300272 | Ga0373937_0300272_465_1217 | 238 |
| 766 | 3300036401 | Ga0373937_0361320 | Ga0373937_0361320_397_1194 | 238 |
| 767 | 3300037068 | Ga0373925_0005452 | Ga0373925_0005452_3634_4386 | 238 |
| 768 | 3300037068 | Ga0373925_0196828 | Ga0373925_0196828_508_1278 | 238 |
| 769 | 3300037068 | Ga0373925_0455971 | Ga0373925_0455971_115_867 | 238 |
| 770 | 3300039437 | Ga0436365_0993952 | Ga0436365_0993952_216_965 | 238 |
| 771 | 3300041410 | Ga0439461_0008604 | Ga0439461_0008604_924_1676 | 238 |
| 772 | 3300041999 | Ga0439433_0007182 | Ga0439433_0007182_1343_2095 | 238 |
| 773 | 3300042001 | Ga0439441_048546 | Ga0439441_048546_19_771 | 238 |
| 774 | 3300042004 | Ga0439445_0041035 | Ga0439445_0041035_396_1148 | 238 |
| 775 | 3300042122 | Ga0450920_041037 | Ga0450920_041037_48_833 | 238 |
| 776 | 3300042125 | Ga0450923_003766 | Ga0450923_003766_477_1229 | 238 |
| 777 | 3300042156 | Ga0439446_0006628 | Ga0439446_0006628_1250_2020 | 238 |
| 778 | 3300042156 | Ga0439446_0009351 | Ga0439446_0009351_155_907 | 238 |
| 779 | 3300042435 | Ga0439434_0020742 | Ga0439434_0020742_1200_1952 | 238 |
| 780 | 3300042435 | Ga0439434_0024883 | Ga0439434_0024883_38_802 | 238 |
| 781 | 3300042436 | Ga0439435_0005134 | Ga0439435_0005134_1717_2469 | 238 |
| 782 | 3300044712 | Ga0453684_0066994 | Ga0453684_0066994_2746_3498 | 238 |
| 783 | 3300044712 | Ga0453684_0547163 | Ga0453684_0547163_202_954 | 238 |
| 784 | 3300045051 | Ga0451576_0002751 | Ga0451576_0002751_22286_23038 | 238 |
| 785 | 3300045051 | Ga0451576_0011011 | Ga0451576_0011011_5393_6181 | 238 |
| 786 | 3300045051 | Ga0451576_0035312 | Ga0451576_0035312_101_913 | 238 |
| 787 | 3300045051 | Ga0451576_0093800 | Ga0451576_0093800_1577_2329 | 238 |
| 788 | 3300045051 | Ga0451576_0289303 | Ga0451576_0289303_183_935 | 238 |
| 789 | 3300045051 | Ga0451576_0388698 | Ga0451576_0388698_612_1400 | 238 |
| 790 | 3300046455 | Ga0495603_0006665 | Ga0495603_0006665_4547_5299 | 238 |
| 791 | 3300046459 | Ga0495629_0001864 | Ga0495629_0001864_7789_8541 | 238 |
| 792 | 3300046460 | Ga0495638_0020091 | Ga0495638_0020091_160_912 | 238 |
| 793 | 3300046462 | Ga0495651_0124323 | Ga0495651_0124323_817_1641 | 238 |
| 794 | 3300046462 | Ga0495651_0188806 | Ga0495651_0188806_153_905 | 238 |
| 795 | 3300046475 | Ga0495639_0095330 | Ga0495639_0095330_477_1229 | 238 |
| 796 | 3300046477 | Ga0495664_0129466 | Ga0495664_0129466_287_1057 | 238 |
| 797 | 3300046491 | Ga0495584_0029632 | Ga0495584_0029632_1865_2617 | 238 |
| 798 | 3300046499 | Ga0495594_0050120 | Ga0495594_0050120_554_1306 | 238 |
| 799 | 3300046516 | Ga0495628_0053229 | Ga0495628_0053229_682_1452 | 238 |
| 800 | 3300046523 | Ga0495644_0039341 | Ga0495644_0039341_559_1464 | 238 |
| 801 | 3300046528 | Ga0495642_0098933 | Ga0495642_0098933_393_1145 | 238 |
| 802 | 3300046529 | Ga0495652_0354473 | Ga0495652_0354473_36_827 | 238 |
| 803 | 3300046535 | Ga0495586_0265383 | Ga0495586_0265383_17_769 | 238 |
| 804 | 3300046537 | Ga0495598_0003522 | Ga0495598_0003522_492_1262 | 238 |
| 805 | 3300046537 | Ga0495598_0012767 | Ga0495598_0012767_534_1286 | 238 |
| 806 | 3300046538 | Ga0495609_0049776 | Ga0495609_0049776_456_1208 | 238 |
| 807 | 3300046538 | Ga0495609_0196663 | Ga0495609_0196663_19_771 | 238 |
| 808 | 3300046539 | Ga0495621_0067618 | Ga0495621_0067618_294_1046 | 238 |
| 809 | 3300046539 | Ga0495621_0136917 | Ga0495621_0136917_20_772 | 238 |
| 810 | 3300046543 | Ga0495645_0011692 | Ga0495645_0011692_602_1372 | 238 |
| 811 | 3300046543 | Ga0495645_0206925 | Ga0495645_0206925_152_904 | 238 |
| 812 | 3300046558 | Ga0495633_0018672 | Ga0495633_0018672_1586_2338 | 238 |
| 813 | 3300046615 | Ga0495656_0017840 | Ga0495656_0017840_723_1475 | 238 |
| 814 | 3300046615 | Ga0495656_0058075 | Ga0495656_0058075_70_864 | 238 |
| 815 | 3300046663 | Ga0495635_0062022 | Ga0495635_0062022_1446_2198 | 238 |
| 816 | 3300046663 | Ga0495635_0150703 | Ga0495635_0150703_710_1480 | 238 |
| 817 | 3300046664 | Ga0495659_0010701 | Ga0495659_0010701_583_1335 | 238 |
| 818 | 3300046664 | Ga0495659_0013333 | Ga0495659_0013333_1020_1832 | 238 |
| 819 | 3300046664 | Ga0495659_0042079 | Ga0495659_0042079_250_1020 | 238 |
| 820 | 3300046664 | Ga0495659_0049722 | Ga0495659_0049722_450_1202 | 238 |
| 821 | 3300046664 | Ga0495659_0104522 | Ga0495659_0104522_80_832 | 238 |
| 822 | 3300046674 | Ga0495588_0024900 | Ga0495588_0024900_487_1239 | 238 |
| 823 | 3300046678 | Ga0495599_0039434 | Ga0495599_0039434_1712_2482 | 238 |
| 824 | 3300046683 | Ga0495658_0015799 | Ga0495658_0015799_760_1512 | 238 |
| 825 | 3300046683 | Ga0495658_0150951 | Ga0495658_0150951_354_1124 | 238 |
| 826 | 3300046683 | Ga0495658_0151640 | Ga0495658_0151640_394_1218 | 238 |
| 827 | 3300046684 | Ga0495669_0019300 | Ga0495669_0019300_349_1101 | 238 |
| 828 | 3300046684 | Ga0495669_0037536 | Ga0495669_0037536_707_1459 | 238 |
| 829 | 3300046689 | Ga0495613_0161684 | Ga0495613_0161684_28_798 | 238 |
| 830 | 3300046689 | Ga0495613_0267061 | Ga0495613_0267061_303_1055 | 238 |
| 831 | 3300046809 | Ga0495600_0063933 | Ga0495600_0063933_1035_1805 | 238 |
| 832 | 3300047318 | Ga0495636_0100582 | Ga0495636_0100582_226_996 | 238 |
| 833 | 3300047319 | Ga0495674_0074426 | Ga0495674_0074426_588_1358 | 238 |
| 834 | 3300047320 | Ga0495672_0001565 | Ga0495672_0001565_18907_19668 | 238 |
| 835 | 3300047445 | Ga0495677_0026679 | Ga0495677_0026679_264_1016 | 238 |
| 836 | 3300047471 | Ga0495684_0112833 | Ga0495684_0112833_1179_1949 | 238 |
| 837 | 3300047471 | Ga0495684_0146073 | Ga0495684_0146073_639_1409 | 238 |
| 838 | 3300047471 | Ga0495684_0352374 | Ga0495684_0352374_13_810 | 238 |
| 839 | 3300048903 | Ga0496100_0214982 | Ga0496100_0214982_262_1014 | 238 |
| 840 | 3300048904 | Ga0496101_0001671 | Ga0496101_0001671_6170_6967 | 238 |
| 841 | 3300048905 | Ga0496102_0032144 | Ga0496102_0032144_2162_2914 | 238 |
| 842 | 3300048907 | Ga0496104_0003276 | Ga0496104_0003276_8988_9740 | 238 |
| 843 | 3300048907 | Ga0496104_0088057 | Ga0496104_0088057_809_1579 | 238 |
| 844 | 3300048908 | Ga0496105_0045285 | Ga0496105_0045285_2588_3340 | 238 |
| 845 | 3300048908 | Ga0496105_0124553 | Ga0496105_0124553_780_1550 | 238 |
| 846 | 3300048908 | Ga0496105_0156700 | Ga0496105_0156700_552_1349 | 238 |
| 847 | 3300048909 | Ga0496106_0037860 | Ga0496106_0037860_421_1173 | 238 |
| 848 | 3300048909 | Ga0496106_0157814 | Ga0496106_0157814_555_1352 | 238 |
| 849 | 3300048910 | Ga0496107_0258932 | Ga0496107_0258932_510_1262 | 238 |
| 850 | 3300048911 | Ga0496108_0004502 | Ga0496108_0004502_566_1318 | 238 |
| 851 | 3300048912 | Ga0496109_0001333 | Ga0496109_0001333_5713_6465 | 238 |
| 852 | 3300048913 | Ga0496110_0001226 | Ga0496110_0001226_112_864 | 238 |
| 853 | 3300048915 | Ga0496112_0033138 | Ga0496112_0033138_62_814 | 238 |
| 854 | 3300048915 | Ga0496112_0414005 | Ga0496112_0414005_47_838 | 238 |
| 855 | 3300048916 | Ga0496113_0133691 | Ga0496113_0133691_1155_1907 | 238 |
| 856 | 3300048917 | Ga0496114_0001180 | Ga0496114_0001180_17251_18048 | 238 |
| 857 | 3300048917 | Ga0496114_0233106 | Ga0496114_0233106_688_1440 | 238 |
| 858 | 3300048918 | Ga0496115_0228113 | Ga0496115_0228113_600_1370 | 238 |
| 859 | 3300049521 | Ga0501298_006448 | Ga0501298_006448_478_1233 | 238 |
| 860 | 3300049568 | Ga0501031_0335599 | Ga0501031_0335599_158_910 | 238 |
| 861 | 3300049569 | Ga0501032_0395640 | Ga0501032_0395640_70_822 | 238 |
| 862 | 3300049570 | Ga0501033_0060564 | Ga0501033_0060564_1584_2336 | 238 |
| 863 | 3300049571 | Ga0501034_0004031 | Ga0501034_0004031_5057_5809 | 238 |
| 864 | 3300049572 | Ga0501036_0013404 | Ga0501036_0013404_4292_5044 | 238 |
| 865 | 3300049572 | Ga0501036_0063161 | Ga0501036_0063161_147_899 | 238 |
| 866 | 3300049572 | Ga0501036_0075501 | Ga0501036_0075501_1582_2334 | 238 |
| 867 | 3300049574 | Ga0501038_0043999 | Ga0501038_0043999_55_849 | 238 |
| 868 | 3300049574 | Ga0501038_0063821 | Ga0501038_0063821_2093_2845 | 238 |
| 869 | 3300049574 | Ga0501038_0160861 | Ga0501038_0160861_499_1251 | 238 |
| 870 | 3300049575 | Ga0501039_0111878 | Ga0501039_0111878_256_1050 | 238 |
| 871 | 3300049575 | Ga0501039_0158973 | Ga0501039_0158973_705_1454 | 238 |
| 872 | 3300049575 | Ga0501039_0170020 | Ga0501039_0170020_118_870 | 238 |
| 873 | 3300049576 | Ga0501040_0004377 | Ga0501040_0004377_3850_4644 | 238 |
| 874 | 3300049576 | Ga0501040_0033622 | Ga0501040_0033622_2012_2764 | 238 |
| 875 | 3300049576 | Ga0501040_0111652 | Ga0501040_0111652_25_777 | 238 |
| 876 | 3300049576 | Ga0501040_0130769 | Ga0501040_0130769_412_1164 | 238 |
| 877 | 3300049577 | Ga0501041_0047271 | Ga0501041_0047271_964_1716 | 238 |
| 878 | 3300049577 | Ga0501041_0162432 | Ga0501041_0162432_245_994 | 238 |
| 879 | 3300049577 | Ga0501041_0196082 | Ga0501041_0196082_121_873 | 238 |
| 880 | 3300049578 | Ga0501042_0315804 | Ga0501042_0315804_63_815 | 238 |
| 881 | 3300049578 | Ga0501042_0481416 | Ga0501042_0481416_93_845 | 238 |
| 882 | 3300049579 | Ga0501043_0112868 | Ga0501043_0112868_198_992 | 238 |
| 883 | 3300049582 | Ga0501048_0021740 | Ga0501048_0021740_55_849 | 238 |
| 884 | 3300049582 | Ga0501048_0031371 | Ga0501048_0031371_1706_2458 | 238 |
| 885 | 3300049582 | Ga0501048_0071723 | Ga0501048_0071723_212_964 | 238 |
| 886 | 3300049582 | Ga0501048_0212123 | Ga0501048_0212123_156_908 | 238 |
| 887 | 3300049582 | Ga0501048_0401835 | Ga0501048_0401835_168_920 | 238 |
| 888 | 3300049583 | Ga0501067_0285894 | Ga0501067_0285894_67_858 | 238 |
| 889 | 3300049584 | Ga0501068_0149337 | Ga0501068_0149337_295_1089 | 238 |
| 890 | 3300049587 | Ga0501071_0022159 | Ga0501071_0022159_1756_2550 | 238 |
| 891 | 3300049587 | Ga0501071_0037102 | Ga0501071_0037102_1058_1810 | 238 |
| 892 | 3300049587 | Ga0501071_0037251 | Ga0501071_0037251_1777_2529 | 238 |
| 893 | 3300049587 | Ga0501071_0521535 | Ga0501071_0521535_39_788 | 238 |
| 894 | 3300049587 | Ga0501071_0632167 | Ga0501071_0632167_46_798 | 238 |
| 895 | 3300049588 | Ga0501072_0007310 | Ga0501072_0007310_4748_5500 | 238 |
| 896 | 3300049588 | Ga0501072_0025475 | Ga0501072_0025475_2312_3064 | 238 |
| 897 | 3300049588 | Ga0501072_0264862 | Ga0501072_0264862_66_818 | 238 |
| 898 | 3300049588 | Ga0501072_0270104 | Ga0501072_0270104_543_1295 | 238 |
| 899 | 3300049589 | Ga0501073_0004289 | Ga0501073_0004289_7724_8515 | 238 |
| 900 | 3300049589 | Ga0501073_0045987 | Ga0501073_0045987_1666_2418 | 238 |
| 901 | 3300049590 | Ga0501074_0061265 | Ga0501074_0061265_1480_2271 | 238 |
| 902 | 3300049590 | Ga0501074_0149674 | Ga0501074_0149674_495_1247 | 238 |
| 903 | 3300049590 | Ga0501074_0178990 | Ga0501074_0178990_677_1429 | 238 |
| 904 | 3300049591 | Ga0501075_0010372 | Ga0501075_0010372_1621_2415 | 238 |
| 905 | 3300049591 | Ga0501075_0014416 | Ga0501075_0014416_977_1777 | 238 |
| 906 | 3300049591 | Ga0501075_0026624 | Ga0501075_0026624_1773_2525 | 238 |
| 907 | 3300049591 | Ga0501075_0027486 | Ga0501075_0027486_3421_4173 | 238 |
| 908 | 3300049591 | Ga0501075_0430463 | Ga0501075_0430463_213_965 | 238 |
| 909 | 3300049592 | Ga0501076_0008303 | Ga0501076_0008303_4554_5306 | 238 |
| 910 | 3300049592 | Ga0501076_0014435 | Ga0501076_0014435_682_1476 | 238 |
| 911 | 3300049592 | Ga0501076_0024644 | Ga0501076_0024644_3081_3833 | 238 |
| 912 | 3300049592 | Ga0501076_0033580 | Ga0501076_0033580_1383_2135 | 238 |
| 913 | 3300049592 | Ga0501076_0112103 | Ga0501076_0112103_700_1452 | 238 |
| 914 | 3300049592 | Ga0501076_0277677 | Ga0501076_0277677_204_956 | 238 |
| 915 | 3300049592 | Ga0501076_0558450 | Ga0501076_0558450_39_791 | 238 |
| 916 | 3300049593 | Ga0501077_0114031 | Ga0501077_0114031_358_1107 | 238 |
| 917 | 3300049593 | Ga0501077_0304536 | Ga0501077_0304536_231_983 | 238 |
| 918 | 3300049741 | Ga0501079_0039777 | Ga0501079_0039777_70_864 | 238 |
| 919 | 3300049741 | Ga0501079_0080999 | Ga0501079_0080999_1112_1864 | 238 |
| 920 | 3300049741 | Ga0501079_0117863 | Ga0501079_0117863_468_1220 | 238 |
| 921 | 3300049741 | Ga0501079_0309187 | Ga0501079_0309187_449_1198 | 238 |
| 922 | 3300049741 | Ga0501079_0401812 | Ga0501079_0401812_152_904 | 238 |
| 923 | 3300049742 | Ga0501080_0047614 | Ga0501080_0047614_3159_3911 | 238 |
| 924 | 3300049742 | Ga0501080_0753648 | Ga0501080_0753648_74_823 | 238 |
| 925 | 3300049743 | Ga0501081_0008536 | Ga0501081_0008536_3281_4033 | 238 |
| 926 | 3300049743 | Ga0501081_0009062 | Ga0501081_0009062_3955_4749 | 238 |
| 927 | 3300049743 | Ga0501081_0038621 | Ga0501081_0038621_1951_2703 | 238 |
| 928 | 3300049743 | Ga0501081_0059835 | Ga0501081_0059835_792_1577 | 238 |
| 929 | 3300049743 | Ga0501081_0223625 | Ga0501081_0223625_424_1176 | 238 |
| 930 | 3300049743 | Ga0501081_0415026 | Ga0501081_0415026_18_770 | 238 |
| 931 | 3300049824 | Ga0501045_0011826 | Ga0501045_0011826_3094_3846 | 238 |
| 932 | 3300049824 | Ga0501045_0018556 | Ga0501045_0018556_3385_4137 | 238 |
| 933 | 3300049824 | Ga0501045_0164990 | Ga0501045_0164990_673_1467 | 238 |
| 934 | 3300049824 | Ga0501045_0477941 | Ga0501045_0477941_95_847 | 238 |
| 935 | 3300050489 | nmdc:mga03683_3241_c1 | nmdc:mga03683_3241_c1_2702_3484 | 238 |
| 936 | 3300050489 | nmdc:mga03683_66316_c1 | nmdc:mga03683_66316_c1_731_1483 | 238 |
| 937 | 3300050490 | nmdc:mga03n38_220435_c1 | nmdc:mga03n38_220435_c1_77_829 | 238 |
| 938 | 3300050491 | nmdc:mga00v17_16883_c1 | nmdc:mga00v17_16883_c1_2334_3116 | 238 |
| 939 | 3300050491 | nmdc:mga00v17_171208_c1 | nmdc:mga00v17_171208_c1_193_948 | 238 |
| 940 | 3300050491 | nmdc:mga00v17_34078_c1 | nmdc:mga00v17_34078_c1_1939_2691 | 238 |
| 941 | 3300050492 | nmdc:mga0yw44_2299_c1 | nmdc:mga0yw44_2299_c1_3145_3921 | 238 |
| 942 | 3300050492 | nmdc:mga0yw44_497700_c1 | nmdc:mga0yw44_497700_c1_18_800 | 238 |
| 943 | 3300050493 | nmdc:mga0k408_28290_c2 | nmdc:mga0k408_28290_c2_677_1429 | 238 |
| 944 | 3300050493 | nmdc:mga0k408_4177_c1 | nmdc:mga0k408_4177_c1_2127_2879 | 238 |
| 945 | 3300050494 | nmdc:mga06z11_17737_c1 | nmdc:mga06z11_17737_c1_1614_2366 | 238 |
| 946 | 3300050494 | nmdc:mga06z11_3555_c1 | nmdc:mga06z11_3555_c1_2351_3133 | 238 |
| 947 | 3300050494 | nmdc:mga06z11_50315_c1 | nmdc:mga06z11_50315_c1_1033_1785 | 238 |
| 948 | 3300050494 | nmdc:mga06z11_5154_c1 | nmdc:mga06z11_5154_c1_1112_1864 | 238 |
| 949 | 3300050494 | nmdc:mga06z11_9088_c1 | nmdc:mga06z11_9088_c1_2973_3725 | 238 |
| 950 | 3300050495 | nmdc:mga04h51_9279_c1 | nmdc:mga04h51_9279_c1_318_1100 | 238 |
| 951 | 3300050507 | nmdc:mga05p37_130274_c1 | nmdc:mga05p37_130274_c1_666_1418 | 238 |
| 952 | 3300050507 | nmdc:mga05p37_134259_c1 | nmdc:mga05p37_134259_c1_1401_2153 | 238 |
| 953 | 3300050507 | nmdc:mga05p37_145751_c1 | nmdc:mga05p37_145751_c1_1457_2206 | 238 |
| 954 | 3300050507 | nmdc:mga05p37_165753_c1 | nmdc:mga05p37_165753_c1_361_1110 | 238 |
| 955 | 3300050507 | nmdc:mga05p37_1682_c1 | nmdc:mga05p37_1682_c1_17515_18267 | 238 |
| 956 | 3300050507 | nmdc:mga05p37_188854_c1 | nmdc:mga05p37_188854_c1_321_1091 | 238 |
| 957 | 3300050507 | nmdc:mga05p37_200646_c1 | nmdc:mga05p37_200646_c1_646_1398 | 238 |
| 958 | 3300050507 | nmdc:mga05p37_228487_c1 | nmdc:mga05p37_228487_c1_1222_1974 | 238 |
| 959 | 3300050507 | nmdc:mga05p37_22858_c1 | nmdc:mga05p37_22858_c1_5452_6225 | 238 |
| 960 | 3300050507 | nmdc:mga05p37_240985_c1 | nmdc:mga05p37_240985_c1_829_1581 | 238 |
| 961 | 3300050507 | nmdc:mga05p37_28735_c1 | nmdc:mga05p37_28735_c1_1578_2327 | 238 |
| 962 | 3300050507 | nmdc:mga05p37_367296_c1 | nmdc:mga05p37_367296_c1_352_1104 | 238 |
| 963 | 3300050507 | nmdc:mga05p37_40463_c1 | nmdc:mga05p37_40463_c1_2984_3736 | 238 |
| 964 | 3300050507 | nmdc:mga05p37_566944_c1 | nmdc:mga05p37_566944_c1_303_1055 | 238 |
| 965 | 3300050507 | nmdc:mga05p37_567032_c1 | nmdc:mga05p37_567032_c1_289_1041 | 238 |
| 966 | 3300050507 | nmdc:mga05p37_644_c1 | nmdc:mga05p37_644_c1_358_1110 | 238 |
| 967 | 3300050507 | nmdc:mga05p37_69333_c1 | nmdc:mga05p37_69333_c1_3474_4226 | 238 |
| 968 | 3300050507 | nmdc:mga05p37_81281_c1 | nmdc:mga05p37_81281_c1_1774_2526 | 238 |
| 969 | 3300050507 | nmdc:mga05p37_855548_c1 | nmdc:mga05p37_855548_c1_205_957 | 238 |
| 970 | 3300050507 | nmdc:mga05p37_86311_c1 | nmdc:mga05p37_86311_c1_2615_3370 | 238 |
| 971 | 3300050508 | nmdc:mga09592_113139_c1 | nmdc:mga09592_113139_c1_404_1156 | 238 |
| 972 | 3300050508 | nmdc:mga09592_304352_c1 | nmdc:mga09592_304352_c1_571_1323 | 238 |
| 973 | 3300050508 | nmdc:mga09592_314878_c1 | nmdc:mga09592_314878_c1_488_1291 | 238 |
| 974 | 3300050508 | nmdc:mga09592_40921_c1 | nmdc:mga09592_40921_c1_1909_2658 | 238 |
| 975 | 3300050508 | nmdc:mga09592_423364_c1 | nmdc:mga09592_423364_c1_33_785 | 238 |
| 976 | 3300050508 | nmdc:mga09592_4298_c1 | nmdc:mga09592_4298_c1_1260_2012 | 238 |
| 977 | 3300050508 | nmdc:mga09592_547400_c1 | nmdc:mga09592_547400_c1_10_762 | 238 |
| 978 | 3300050509 | nmdc:mga0qj67_144750_c1 | nmdc:mga0qj67_144750_c1_58_807 | 238 |
| 979 | 3300050510 | nmdc:mga06r32_107564_c1 | nmdc:mga06r32_107564_c1_395_1147 | 238 |
| 980 | 3300050510 | nmdc:mga06r32_15924_c1 | nmdc:mga06r32_15924_c1_3659_4411 | 238 |
| 981 | 3300050510 | nmdc:mga06r32_49931_c1 | nmdc:mga06r32_49931_c1_3093_3845 | 238 |
| 982 | 3300050510 | nmdc:mga06r32_603924_c1 | nmdc:mga06r32_603924_c1_231_983 | 238 |
| 983 | 3300050510 | nmdc:mga06r32_8083_c1 | nmdc:mga06r32_8083_c1_2749_3501 | 238 |
| 984 | 3300050510 | nmdc:mga06r32_95924_c1 | nmdc:mga06r32_95924_c1_628_1380 | 238 |
| 985 | 3300050511 | nmdc:mga08y16_104809_c1 | nmdc:mga08y16_104809_c1_1242_1994 | 238 |
| 986 | 3300050511 | nmdc:mga08y16_10929_c1 | nmdc:mga08y16_10929_c1_13_801 | 238 |
| 987 | 3300050511 | nmdc:mga08y16_155249_c1 | nmdc:mga08y16_155249_c1_1531_2283 | 238 |
| 988 | 3300050511 | nmdc:mga08y16_198729_c1 | nmdc:mga08y16_198729_c1_115_909 | 238 |
| 989 | 3300050511 | nmdc:mga08y16_244777_c1 | nmdc:mga08y16_244777_c1_447_1196 | 238 |
| 990 | 3300050511 | nmdc:mga08y16_39988_c1 | nmdc:mga08y16_39988_c1_1474_2277 | 238 |
| 991 | 3300050511 | nmdc:mga08y16_48405_c1 | nmdc:mga08y16_48405_c1_2669_3421 | 238 |
| 992 | 3300050511 | nmdc:mga08y16_6292_c1 | nmdc:mga08y16_6292_c1_3459_4214 | 238 |
| 993 | 3300050511 | nmdc:mga08y16_86790_c1 | nmdc:mga08y16_86790_c1_1356_2147 | 238 |
| 994 | 3300050511 | nmdc:mga08y16_932_c1 | nmdc:mga08y16_932_c1_11444_12235 | 238 |
| 995 | 3300050511 | nmdc:mga08y16_9_c1 | nmdc:mga08y16_9_c1_41203_41955 | 238 |
| 996 | 3300050512 | nmdc:mga0n895_102951_c1 | nmdc:mga0n895_102951_c1_1589_2341 | 238 |
| 997 | 3300050512 | nmdc:mga0n895_112926_c1 | nmdc:mga0n895_112926_c1_1154_1906 | 238 |
| 998 | 3300050512 | nmdc:mga0n895_138646_c1 | nmdc:mga0n895_138646_c1_1420_2172 | 238 |
| 999 | 3300050512 | nmdc:mga0n895_139651_c1 | nmdc:mga0n895_139651_c1_688_1437 | 238 |
| 1000 | 3300050512 | nmdc:mga0n895_151826_c1 | nmdc:mga0n895_151826_c1_584_1354 | 238 |
| 1001 | 3300050512 | nmdc:mga0n895_168218_c1 | nmdc:mga0n895_168218_c1_1122_1880 | 238 |
| 1002 | 3300050512 | nmdc:mga0n895_182632_c1 | nmdc:mga0n895_182632_c1_81_833 | 238 |
| 1003 | 3300050512 | nmdc:mga0n895_20798_c1 | nmdc:mga0n895_20798_c1_1245_2033 | 238 |
| 1004 | 3300050512 | nmdc:mga0n895_4406_c1 | nmdc:mga0n895_4406_c1_284_1072 | 238 |
| 1005 | 3300050512 | nmdc:mga0n895_52553_c1 | nmdc:mga0n895_52553_c1_2768_3556 | 238 |
| 1006 | 3300050512 | nmdc:mga0n895_691527_c1 | nmdc:mga0n895_691527_c1_220_972 | 238 |
| 1007 | 3300050512 | nmdc:mga0n895_700432_c1 | nmdc:mga0n895_700432_c1_213_965 | 238 |
| 1008 | 3300050512 | nmdc:mga0n895_81_c1 | nmdc:mga0n895_81_c1_20918_21688 | 238 |
| 1009 | 3300050513 | nmdc:mga0rr50_1_c1 | nmdc:mga0rr50_1_c1_136053_136823 | 238 |
| 1010 | 3300050513 | nmdc:mga0rr50_28641_c1 | nmdc:mga0rr50_28641_c1_2685_3437 | 238 |
| 1011 | 3300050513 | nmdc:mga0rr50_4248_c1 | nmdc:mga0rr50_4248_c1_4294_5064 | 238 |
| 1012 | 3300050513 | nmdc:mga0rr50_83187_c1 | nmdc:mga0rr50_83187_c1_1594_2352 | 238 |
| 1013 | 3300050513 | nmdc:mga0rr50_8895_c1 | nmdc:mga0rr50_8895_c1_4186_4938 | 238 |
| 1014 | 3300050514 | nmdc:mga08x19_181099_c1 | nmdc:mga08x19_181099_c1_308_1078 | 238 |
| 1015 | 3300050514 | nmdc:mga08x19_265_c1 | nmdc:mga08x19_265_c1_19356_20126 | 238 |
| 1016 | 3300050514 | nmdc:mga08x19_310417_c1 | nmdc:mga08x19_310417_c1_116_868 | 238 |
| 1017 | 3300050514 | nmdc:mga08x19_59349_c1 | nmdc:mga08x19_59349_c1_1681_2451 | 238 |
| 1018 | 3300050514 | nmdc:mga08x19_96849_c1 | nmdc:mga08x19_96849_c1_650_1426 | 238 |
| 1019 | 3300050515 | nmdc:mga0a205_115510_c1 | nmdc:mga0a205_115510_c1_779_1531 | 238 |
| 1020 | 3300050515 | nmdc:mga0a205_116830_c1 | nmdc:mga0a205_116830_c1_1544_2293 | 238 |
| 1021 | 3300050515 | nmdc:mga0a205_3136_c1 | nmdc:mga0a205_3136_c1_3197_3949 | 238 |
| 1022 | 3300050515 | nmdc:mga0a205_326970_c1 | nmdc:mga0a205_326970_c1_178_930 | 238 |
| 1023 | 3300050515 | nmdc:mga0a205_391940_c1 | nmdc:mga0a205_391940_c1_480_1232 | 238 |
| 1024 | 3300050515 | nmdc:mga0a205_456663_c1 | nmdc:mga0a205_456663_c1_318_1118 | 238 |
| 1025 | 3300050515 | nmdc:mga0a205_45943_c1 | nmdc:mga0a205_45943_c1_1132_1920 | 238 |
| 1026 | 3300050515 | nmdc:mga0a205_46215_c1 | nmdc:mga0a205_46215_c1_3186_3938 | 238 |
| 1027 | 3300050515 | nmdc:mga0a205_47513_c2 | nmdc:mga0a205_47513_c2_186_974 | 238 |
| 1028 | 3300050515 | nmdc:mga0a205_49528_c1 | nmdc:mga0a205_49528_c1_1725_2504 | 238 |
| 1029 | 3300050515 | nmdc:mga0a205_61542_c1 | nmdc:mga0a205_61542_c1_189_941 | 238 |
| 1030 | 3300050516 | nmdc:mga0sz30_68326_c1 | nmdc:mga0sz30_68326_c1_513_1265 | 238 |
| 1031 | 3300053077 | Ga0495601_0025172 | Ga0495601_0025172_177_1010 | 238 |
| 1032 | 3300053077 | Ga0495601_0058386 | Ga0495601_0058386_284_1063 | 238 |
| 1033 | 3300053085 | Ga0495619_0071124 | Ga0495619_0071124_724_1494 | 238 |
| 1034 | 3300053090 | Ga0500646_0081212 | Ga0500646_0081212_19_771 | 238 |
| 1035 | 3300053103 | Ga0500555_006197 | Ga0500555_006197_635_1387 | 238 |
| 1036 | 3300054114 | Ga0501084_0008116 | Ga0501084_0008116_6489_7283 | 238 |
| 1037 | 3300054114 | Ga0501084_0130496 | Ga0501084_0130496_286_1038 | 238 |
| 1038 | 3300054114 | Ga0501084_0161438 | Ga0501084_0161438_69_821 | 238 |
| 1039 | 3300054114 | Ga0501084_0216963 | Ga0501084_0216963_837_1589 | 238 |
| 1040 | 3300054114 | Ga0501084_0383980 | Ga0501084_0383980_283_1032 | 238 |
| 1041 | 3300060353 | Ga0501082_0015946 | Ga0501082_0015946_5490_6284 | 238 |
| 1042 | 3300060353 | Ga0501082_0024231 | Ga0501082_0024231_3679_4431 | 238 |
| 1043 | 3300060353 | Ga0501082_0030564 | Ga0501082_0030564_3547_4299 | 238 |
| 1044 | 3300060353 | Ga0501082_0089298 | Ga0501082_0089298_1633_2385 | 238 |
| 1045 | 3300060353 | Ga0501082_0291148 | Ga0501082_0291148_137_886 | 238 |
| 1046 | 3300060353 | Ga0501082_0317908 | Ga0501082_0317908_340_1092 | 238 |
| 1047 | 3300060353 | Ga0501082_0538040 | Ga0501082_0538040_69_824 | 238 |
| 1048 | 3300061734 | Ga0530510_0011471 | Ga0530510_0011471_3495_4247 | 238 |
| 1049 | 3300061734 | Ga0530510_0092624 | Ga0530510_0092624_531_1283 | 238 |
| 1050 | 3300061734 | Ga0530510_0157749 | Ga0530510_0157749_472_1221 | 238 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4rvc-assembly1.cif.gz_A | structure of atp binding subunit of abc transporter | 0.9368 | 1 | 226 |
| 7lkp-assembly1.cif.gz_A | structure of atp-free human abca4 | 0.9353 | 2 | 211 |
| 7tbw-assembly1.cif.gz_A | the structure of atp-bound abca1 | 0.9334 | 2 | 210 |
| 6cvl-assembly1.cif.gz_D | crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein | 0.9281 | 1 | 204 |
| 8edw-assembly1.cif.gz_A | cryo-em structure of human abca7 in bpl/ch nanodiscs | 0.927 | 2 | 210 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P36879_1_236_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9434 | 2 | 216 | 3.40.50.300 |
| 4rvcA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9368 | 1 | 226 | 3.40.50.300 |
| af_Q9VRG3_1356_1574_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9357 | 2 | 199 | 3.40.50.300 |
| af_P0A9U1_321_563_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9348 | 2 | 215 | 3.40.50.300 |
| af_P78363_1926_2175_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9344 | 2 | 216 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A523UXE7-F1-model_v4 | ABC transporter ATP-binding protein | 0.9743 | 1 | 229 |
GO:0005524
GO:0016887 |
| AF-A0A351RT97-F1-model_v4 | ABC transporter | 0.9721 | 1 | 228 |
GO:0005524
GO:0016887 |
| AF-Q2YZP3-F1-model_v4 | Cytochrome c biogenesis ATP-binding export protein ccmA | 0.9716 | 1 | 228 |
GO:0005524
GO:0016887 |
| AF-A0A3E0NKL7-F1-model_v4 | ABC transporter ATP-binding protein | 0.9685 | 2 | 226 |
GO:0005524
GO:0016887 |
| AF-A0A5C5YM13-F1-model_v4 | Putative ABC transporter ATP-binding protein YbhF | 0.9662 | 1 | 226 |
GO:0005524
GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar