F489063

General Info

Members Datasets Scaffolds Average Seq Length
1050 333 1050 251

Family's Representative Sequence

Representative Sequence 3300053077|Ga0495601_0025172|Ga0495601_0025172_177_1010
Length 277
Sequence VLRVRAIALTAMSIAIHDLVKTYGQFTAVNGVSLDVQPGEIHGFLGPNGAGKTTTLRMIAGLLKPTAGRIEVNGHDLAKDPESAKASLGFIPDRPYIYEKLTAGEFLRFHGGLFGMNGSGQNPIGNRVKEMLELFELGRWENELVESFSHGMKQRLVMSAAFLHRPRAVVVDEPMVGLDPRGARLIKDVFRKMSERGVAILMSTHTLEVAEEMCDCISIILKGRIIARGTVDELRALAAGDDASGVLPGDEVDEVELTSVFLKLTGGSGLQEIDEIV

Samples

Sample ID Description Type Environment
1 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
164 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
169 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
170 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
171 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
172 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
173 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
183 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
184 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
185 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
186 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
187 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
188 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
189 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
191 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
192 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
193 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
194 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
195 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
200 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
201 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
202 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
203 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
205 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
207 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
208 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
209 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
213 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
214 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
215 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
216 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
217 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
218 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
219 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
220 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
221 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
222 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
223 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
224 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
225 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
226 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
227 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
228 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
229 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
230 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
231 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
232 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
233 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
234 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
235 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
236 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
237 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
238 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
239 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
240 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
241 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
242 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
243 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
244 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
245 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
246 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
247 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
248 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
249 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
250 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
251 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
252 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
253 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
254 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
255 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
256 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
257 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
258 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
259 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
260 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
261 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
262 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
263 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
264 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
265 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
266 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
267 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
268 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
269 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
270 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
271 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
272 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
273 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
274 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
275 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
276 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
277 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
278 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
279 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
280 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
281 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
282 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
283 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
297 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
298 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
299 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
300 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
301 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
302 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
303 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
304 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
305 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
306 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
307 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
308 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
309 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
310 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
311 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
312 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
313 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
314 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
315 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
316 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
317 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
318 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
319 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
320 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
321 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
322 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
323 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
324 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
325 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
326 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
327 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
328 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
329 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
330 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
331 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
332 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
333 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.71
Nodule 0
Rhizoplane 2.1
Rhizosphere 94.1
Stem 0
Stem Tuber 0
Unclassified 0.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10003721 3300003911 Unclassified 2691
2 Ga0065704_10170200 3300005289 Unclassified 1296
3 Ga0065712_10005714 3300005290 Bacteria 3303
4 Ga0065712_10088511 3300005290 Archaea 2516
5 Ga0065712_10105799 3300005290 Bacteria 1902
6 Ga0065715_10007369 3300005293 Bacteria 5543
7 Ga0065715_10051194 3300005293 Bacteria 985
8 Ga0065715_10096409 3300005293 Bacteria 3813
9 Ga0065707_10002251 3300005295 Bacteria 8627
10 Ga0065707_10005235 3300005295 Bacteria 4356
11 Ga0065707_10085509 3300005295 Bacteria 6100
12 Ga0065707_10165513 3300005295 Bacteria 1526
13 Ga0070676_10006806 3300005328 Bacteria 6126
14 Ga0070676_10321649 3300005328 Bacteria 1055
15 Ga0070683_100006082 3300005329 Bacteria 10117
16 Ga0070683_100121001 3300005329 Bacteria 2473
17 Ga0070683_100165983 3300005329 Archaea 2095
18 Ga0070690_100029154 3300005330 Bacteria 3421
19 Ga0070690_100109929 3300005330 Bacteria 1838
20 Ga0070670_100003674 3300005331 Bacteria 12789
21 Ga0070670_100056795 3300005331 Bacteria 3360
22 Ga0070670_100178229 3300005331 Archaea 1845
23 Ga0070677_10031350 3300005333 Bacteria 2032
24 Ga0068869_100164778 3300005334 Bacteria 1728
25 Ga0068869_100186928 3300005334 Bacteria 1627
26 Ga0068869_100280438 3300005334 Bacteria 1340
27 Ga0068869_100375534 3300005334 Bacteria 1164
28 Ga0070666_10022440 3300005335 Bacteria 4098
29 Ga0070666_10039046 3300005335 Unclassified 3162
30 Ga0070666_10087282 3300005335 Archaea 2138
31 Ga0068868_100025873 3300005338 Bacteria 4468
32 Ga0068868_100028023 3300005338 Bacteria 4302
33 Ga0068868_100079273 3300005338 Bacteria 2631
34 Ga0068868_100241239 3300005338 Bacteria 1519
35 Ga0070689_100005737 3300005340 Bacteria 8512
36 Ga0070689_100008806 3300005340 Bacteria 7126
37 Ga0070689_100009227 3300005340 Bacteria 6985
38 Ga0070689_100011887 3300005340 Bacteria 6249
39 Ga0070691_10044437 3300005341 Bacteria 2107
40 Ga0070687_100062482 3300005343 Bacteria 1972
41 Ga0070687_100161004 3300005343 Bacteria 1326
42 Ga0070661_100016292 3300005344 Bacteria 5254
43 Ga0070661_100499300 3300005344 Bacteria 974
44 Ga0070692_10027343 3300005345 Bacteria 2826
45 Ga0070668_100295055 3300005347 Bacteria 1358
46 Ga0070668_100312884 3300005347 Bacteria 1320
47 Ga0070669_100002795 3300005353 Bacteria 12595
48 Ga0070669_100009439 3300005353 Bacteria 6948
49 Ga0070669_100131441 3300005353 Bacteria 1921
50 Ga0070669_100216352 3300005353 Bacteria 1513
51 Ga0070675_100001411 3300005354 Bacteria 17650
52 Ga0070675_100014315 3300005354 Bacteria 6253
53 Ga0070675_100038263 3300005354 Bacteria 3909
54 Ga0070675_100144890 3300005354 Bacteria 2033
55 Ga0070675_100166641 3300005354 Archaea 1898
56 Ga0070675_100204877 3300005354 Bacteria 1713
57 Ga0070675_100339176 3300005354 Bacteria 1331
58 Ga0070671_100061284 3300005355 Bacteria 3133
59 Ga0070671_100150212 3300005355 Archaea 1967
60 Ga0070671_100280269 3300005355 Bacteria 1418
61 Ga0070674_100014917 3300005356 Bacteria 4839
62 Ga0070674_100020861 3300005356 Bacteria 4196
63 Ga0070674_100026357 3300005356 Bacteria 3795
64 Ga0070674_100035571 3300005356 Bacteria 3336
65 Ga0070674_100138361 3300005356 Bacteria 1824
66 Ga0070674_100139424 3300005356 Bacteria 1818
67 Ga0070673_100006996 3300005364 Bacteria 7393
68 Ga0070673_100011588 3300005364 Bacteria 6022
69 Ga0070673_100012813 3300005364 Bacteria 5771
70 Ga0070673_100069369 3300005364 Bacteria 2825
71 Ga0070673_100090119 3300005364 Bacteria 2505
72 Ga0070673_100389527 3300005364 Bacteria 1244
73 Ga0070688_100068697 3300005365 Bacteria 2260
74 Ga0070659_100074165 3300005366 Bacteria 2710
75 Ga0070667_100042719 3300005367 Bacteria 3804
76 Ga0070667_100138545 3300005367 Archaea 2129
77 Ga0070667_100167371 3300005367 Unclassified 1939
78 Ga0070667_100466462 3300005367 Bacteria 1155
79 Ga0070709_10093260 3300005434 Bacteria 1990
80 Ga0070709_10156519 3300005434 Bacteria 1580
81 Ga0070713_100010981 3300005436 Bacteria 6570
82 Ga0070701_10007454 3300005438 Bacteria 4676
83 Ga0070701_10038327 3300005438 Bacteria 2425
84 Ga0070701_10310978 3300005438 Bacteria 972
85 Ga0070705_100000016 3300005440 Bacteria 90163
86 Ga0070705_100007054 3300005440 Bacteria 5522
87 Ga0070705_100012183 3300005440 Bacteria 4364
88 Ga0070705_100022448 3300005440 Bacteria 3372
89 Ga0070705_100162140 3300005440 Bacteria 1496
90 Ga0070705_100240775 3300005440 Bacteria 1264
91 Ga0070705_100284793 3300005440 Bacteria 1177
92 Ga0070700_100014023 3300005441 Bacteria 4518
93 Ga0070700_100020027 3300005441 Bacteria 3870
94 Ga0070700_100025789 3300005441 Bacteria 3464
95 Ga0070700_100143020 3300005441 Bacteria 1628
96 Ga0070700_100282727 3300005441 Bacteria 1204
97 Ga0070700_100501744 3300005441 Bacteria 933
98 Ga0070694_100000279 3300005444 Bacteria 27271
99 Ga0070694_100051631 3300005444 Bacteria 2777
100 Ga0070694_100054815 3300005444 Bacteria 2702
101 Ga0070694_100080930 3300005444 Unclassified 2258
102 Ga0070694_100112572 3300005444 Bacteria 1941
103 Ga0070708_100255719 3300005445 Bacteria 1646
104 Ga0070708_100267398 3300005445 Bacteria 1608
105 Ga0070708_100317841 3300005445 Bacteria 1467
106 Ga0070708_100467772 3300005445 Bacteria 1189
107 Ga0070678_100022491 3300005456 Bacteria 4180
108 Ga0070678_100252298 3300005456 Bacteria 1480
109 Ga0070662_100040364 3300005457 Bacteria 3322
110 Ga0070662_100152569 3300005457 Unclassified 1800
111 Ga0070681_10138723 3300005458 Bacteria 2361
112 Ga0068867_100002379 3300005459 Bacteria 13223
113 Ga0068867_100024363 3300005459 Bacteria 4335
114 Ga0068867_100050212 3300005459 Bacteria 3073
115 Ga0068867_100080672 3300005459 Bacteria 2451
116 Ga0068867_100860136 3300005459 Bacteria 813
117 Ga0070685_10010288 3300005466 Bacteria 4856
118 Ga0070706_100005121 3300005467 Bacteria 12507
119 Ga0070706_100095894 3300005467 Bacteria 2754
120 Ga0070706_100342967 3300005467 Bacteria 1393
121 Ga0070706_100364722 3300005467 Unclassified 1346
122 Ga0070706_100700205 3300005467 Bacteria 939
123 Ga0070707_100048133 3300005468 Bacteria 4084
124 Ga0070707_100075269 3300005468 Bacteria 3256
125 Ga0070707_100087606 3300005468 Bacteria 3011
126 Ga0070707_100158438 3300005468 Bacteria 2205
127 Ga0070707_100184718 3300005468 Bacteria 2033
128 Ga0070707_100199012 3300005468 Bacteria 1953
129 Ga0070707_100300530 3300005468 Bacteria 1560
130 Ga0070707_100388790 3300005468 Bacteria 1355
131 Ga0070698_100004889 3300005471 Bacteria 14710
132 Ga0070698_100015072 3300005471 Bacteria 8172
133 Ga0070698_100024325 3300005471 Bacteria 6319
134 Ga0070698_100028123 3300005471 Bacteria 5843
135 Ga0070698_100083790 3300005471 Bacteria 3177
136 Ga0070698_100247228 3300005471 Bacteria 1716
137 Ga0070698_100385143 3300005471 Bacteria 1335
138 Ga0070698_100671570 3300005471 Bacteria 978
139 Ga0070699_100000388 3300005518 Bacteria 42659
140 Ga0070699_100001370 3300005518 Bacteria 22398
141 Ga0070699_100001651 3300005518 Bacteria 20364
142 Ga0070699_100014128 3300005518 Bacteria 6869
143 Ga0070699_100025124 3300005518 Bacteria 5136
144 Ga0070699_100027914 3300005518 Bacteria 4868
145 Ga0070699_100061496 3300005518 Bacteria 3254
146 Ga0070699_100081764 3300005518 Bacteria 2816
147 Ga0070699_100108356 3300005518 Bacteria 2438
148 Ga0070699_100195297 3300005518 Bacteria 1799
149 Ga0070699_100379626 3300005518 Bacteria 1276
150 Ga0070679_100028536 3300005530 Bacteria 5503
151 Ga0070684_100001607 3300005535 Bacteria 16329
152 Ga0070684_100005752 3300005535 Bacteria 9531
153 Ga0070684_100163975 3300005535 Bacteria 2017
154 Ga0070697_100006069 3300005536 Bacteria 9349
155 Ga0070697_100028711 3300005536 Bacteria 4456
156 Ga0070697_100104650 3300005536 Bacteria 2353
157 Ga0070697_100213299 3300005536 Bacteria 1644
158 Ga0068853_100295519 3300005539 Bacteria 1496
159 Ga0070672_100005758 3300005543 Bacteria 8261
160 Ga0070672_100059416 3300005543 Bacteria 3008
161 Ga0070672_100084165 3300005543 Bacteria 2554
162 Ga0070686_100024077 3300005544 Bacteria 3647
163 Ga0070686_100167871 3300005544 Bacteria 1550
164 Ga0070686_100389065 3300005544 Bacteria 1058
165 Ga0070686_100465093 3300005544 Bacteria 975
166 Ga0070695_100000061 3300005545 Bacteria 44298
167 Ga0070695_100003902 3300005545 Bacteria 8706
168 Ga0070695_100041240 3300005545 Bacteria 2925
169 Ga0070695_100109023 3300005545 Bacteria 1876
170 Ga0070695_100112542 3300005545 Bacteria 1849
171 Ga0070696_100000571 3300005546 Bacteria 23529
172 Ga0070696_100005465 3300005546 Bacteria 8477
173 Ga0070696_100040027 3300005546 Bacteria 3236
174 Ga0070696_100086982 3300005546 Bacteria 2220
175 Ga0070696_100547662 3300005546 Bacteria 926
176 Ga0070693_100066041 3300005547 Bacteria 2116
177 Ga0070665_100016328 3300005548 Bacteria 7445
178 Ga0070665_100065573 3300005548 Bacteria 3642
179 Ga0070704_100000718 3300005549 Bacteria 16171
180 Ga0070704_100009228 3300005549 Bacteria 5951
181 Ga0070704_100025085 3300005549 Bacteria 3921
182 Ga0070704_100044405 3300005549 Bacteria 3088
183 Ga0070704_100430955 3300005549 Bacteria 1131
184 Ga0070704_100624956 3300005549 Bacteria 949
185 Ga0070664_100002520 3300005564 Bacteria 14761
186 Ga0070664_100016849 3300005564 Bacteria 5998
187 Ga0068857_100042312 3300005577 Bacteria 4041
188 Ga0068857_100138987 3300005577 Archaea 2195
189 Ga0068857_100160805 3300005577 Bacteria 2038
190 Ga0068854_100019045 3300005578 Bacteria 4618
191 Ga0068854_100042743 3300005578 Bacteria 3209
192 Ga0070702_100203421 3300005615 Bacteria 1313
193 Ga0068859_100000940 3300005617 Bacteria 29798
194 Ga0068859_100003972 3300005617 Bacteria 15091
195 Ga0068859_100038713 3300005617 Bacteria 4783
196 Ga0068859_100060701 3300005617 Unclassified 3810
197 Ga0068859_100248282 3300005617 Bacteria 1870
198 Ga0068859_100505346 3300005617 Bacteria 1304
199 Ga0068864_100028303 3300005618 Bacteria 4736
200 Ga0068864_100186160 3300005618 Bacteria 1901
201 Ga0068864_100425635 3300005618 Bacteria 1266
202 Ga0068861_100000753 3300005719 Bacteria 19414
203 Ga0068861_100027954 3300005719 Bacteria 4112
204 Ga0068861_100126847 3300005719 Bacteria 2066
205 Ga0068861_100128155 3300005719 Bacteria 2056
206 Ga0068861_100167648 3300005719 Bacteria 1817
207 Ga0068861_100190742 3300005719 Bacteria 1713
208 Ga0068861_100405535 3300005719 Bacteria 1211
209 Ga0068851_10111766 3300005834 Unclassified 1459
210 Ga0068870_10014038 3300005840 Bacteria 3775
211 Ga0068863_100009319 3300005841 Bacteria 9580
212 Ga0068863_100102559 3300005841 Unclassified 2720
213 Ga0068863_100169327 3300005841 Bacteria 2095
214 Ga0068863_100217153 3300005841 Bacteria 1841
215 Ga0068858_100009204 3300005842 Bacteria 9438
216 Ga0068858_100019683 3300005842 Bacteria 6311
217 Ga0068858_100158144 3300005842 Archaea 2133
218 Ga0068858_100274625 3300005842 Bacteria 1604
219 Ga0068858_100457983 3300005842 Unclassified 1230
220 Ga0068860_100024357 3300005843 Bacteria 5849
221 Ga0068860_100024428 3300005843 Bacteria 5839
222 Ga0068860_100084499 3300005843 Bacteria 3020
223 Ga0068860_100141468 3300005843 Bacteria 2313
224 Ga0068862_100000612 3300005844 Bacteria 37096
225 Ga0068862_100028702 3300005844 Bacteria 4685
226 Ga0068862_100039204 3300005844 Bacteria 4023
227 Ga0068862_100052619 3300005844 Bacteria 3484
228 Ga0068862_100139194 3300005844 Bacteria 2153
229 Ga0068862_100200359 3300005844 Bacteria 1800
230 Ga0068862_100210502 3300005844 Bacteria 1757
231 Ga0068862_100248914 3300005844 Bacteria 1619
232 Ga0081455_10002517 3300005937 Bacteria 21758
233 Ga0081538_10007747 3300005981 Bacteria 9235
234 Ga0081540_1015496 3300005983 Bacteria 4825
235 Ga0081539_10027639 3300005985 Bacteria 3588
236 Ga0081539_10052810 3300005985 Bacteria 2279
237 Ga0075368_10007051 3300006042 Bacteria 3955
238 Ga0075368_10009337 3300006042 Bacteria 3527
239 Ga0075363_100020050 3300006048 Bacteria 3350
240 Ga0075364_10011053 3300006051 Bacteria 5478
241 Ga0075364_10047832 3300006051 Bacteria 2787
242 Ga0075364_10048544 3300006051 Bacteria 2766
243 Ga0075364_10132308 3300006051 Bacteria 1675
244 Ga0075364_10189464 3300006051 Bacteria 1393
245 Ga0075432_10074504 3300006058 Bacteria 1223
246 Ga0070716_100170006 3300006173 Bacteria 1421
247 Ga0075362_10000342 3300006177 Bacteria 13343
248 Ga0075362_10009532 3300006177 Bacteria 3758
249 Ga0075367_10002146 3300006178 Bacteria 8874
250 Ga0075367_10008454 3300006178 Bacteria 5333
251 Ga0075367_10014597 3300006178 Bacteria 4253
252 Ga0075367_10047450 3300006178 Bacteria 2527
253 Ga0075366_10001977 3300006195 Bacteria 10373
254 Ga0075366_10004267 3300006195 Bacteria 7668
255 Ga0097621_100044020 3300006237 Bacteria 3600
256 Ga0097621_100050875 3300006237 Bacteria 3370
257 Ga0097621_100268169 3300006237 Unclassified 1499
258 Ga0097621_100361067 3300006237 Bacteria 1294
259 Ga0097621_100507716 3300006237 Bacteria 1093
260 Ga0075370_10008821 3300006353 Bacteria 5206
261 Ga0075370_10126123 3300006353 Bacteria 1492
262 Ga0068871_100008186 3300006358 Bacteria 7510
263 Ga0068871_100010044 3300006358 Bacteria 6883
264 Ga0068871_100012078 3300006358 Bacteria 6357
265 Ga0068871_100090873 3300006358 Bacteria 2543
266 Ga0068871_100093277 3300006358 Bacteria 2511
267 Ga0068871_100246910 3300006358 Bacteria 1554
268 Ga0075428_100000037 3300006844 Bacteria 105391
269 Ga0075428_100000862 3300006844 Bacteria 31924
270 Ga0075428_100004677 3300006844 Bacteria 15154
271 Ga0075428_100011075 3300006844 Bacteria 10033
272 Ga0075428_100013797 3300006844 Bacteria 8998
273 Ga0075428_100022252 3300006844 Bacteria 7019
274 Ga0075428_100028725 3300006844 Bacteria 6153
275 Ga0075428_100053234 3300006844 Bacteria 4434
276 Ga0075428_100079714 3300006844 Bacteria 3573
277 Ga0075428_100081214 3300006844 Bacteria 3538
278 Ga0075428_100084143 3300006844 Bacteria 3471
279 Ga0075428_100135988 3300006844 Bacteria 2672
280 Ga0075428_100180128 3300006844 Bacteria 2288
281 Ga0075428_100316600 3300006844 Bacteria 1677
282 Ga0075428_100333260 3300006844 Bacteria 1630
283 Ga0075428_100599064 3300006844 Bacteria 1177
284 Ga0075430_100000655 3300006846 Bacteria 26398
285 Ga0075430_100095248 3300006846 Bacteria 2488
286 Ga0075430_100099053 3300006846 Bacteria 2435
287 Ga0075430_100131855 3300006846 Bacteria 2083
288 Ga0075430_100155649 3300006846 Bacteria 1903
289 Ga0075430_100220864 3300006846 Bacteria 1572
290 Ga0075430_100229698 3300006846 Bacteria 1539
291 Ga0075431_100012414 3300006847 Bacteria 8597
292 Ga0075431_100046991 3300006847 Bacteria 4451
293 Ga0075431_100073064 3300006847 Bacteria 3539
294 Ga0075431_100082230 3300006847 Bacteria 3324
295 Ga0075431_100096915 3300006847 Bacteria 3045
296 Ga0075431_100110730 3300006847 Bacteria 2834
297 Ga0075433_10007731 3300006852 Bacteria 8540
298 Ga0075433_10039242 3300006852 Bacteria 4093
299 Ga0075433_10052832 3300006852 Bacteria 3541
300 Ga0075433_10054439 3300006852 Bacteria 3491
301 Ga0075433_10057366 3300006852 Bacteria 3403
302 Ga0075433_10081956 3300006852 Bacteria 2845
303 Ga0075433_10155475 3300006852 Bacteria 2035
304 Ga0075433_10184022 3300006852 Bacteria 1859
305 Ga0075433_10260765 3300006852 Bacteria 1536
306 Ga0075433_10404294 3300006852 Bacteria 1205
307 Ga0075433_10412631 3300006852 Bacteria 1191
308 Ga0075434_100000019 3300006871 Bacteria 73391
309 Ga0075434_100001168 3300006871 Bacteria 21752
310 Ga0075434_100009596 3300006871 Bacteria 9035
311 Ga0075434_100081191 3300006871 Bacteria 3240
312 Ga0075434_100084276 3300006871 Bacteria 3177
313 Ga0075434_100179364 3300006871 Bacteria 2138
314 Ga0075434_100247819 3300006871 Bacteria 1801
315 Ga0075434_100356718 3300006871 Bacteria 1483
316 Ga0075429_100005390 3300006880 Bacteria 11006
317 Ga0075429_100007476 3300006880 Bacteria 9484
318 Ga0075429_100058680 3300006880 Bacteria 3352
319 Ga0075429_100111123 3300006880 Bacteria 2395
320 Ga0068865_100010101 3300006881 Bacteria 5874
321 Ga0068865_100014003 3300006881 Bacteria 5089
322 Ga0068865_100023794 3300006881 Bacteria 4015
323 Ga0068865_100193892 3300006881 Bacteria 1573
324 Ga0075436_100000160 3300006914 Bacteria 41885
325 Ga0075436_100019245 3300006914 Bacteria 4678
326 Ga0075436_100035724 3300006914 Bacteria 3427
327 Ga0075436_100324167 3300006914 Bacteria 1107
328 Ga0097620_100000940 3300006931 Bacteria 29798
329 Ga0097620_100003972 3300006931 Bacteria 15091
330 Ga0097620_100038715 3300006931 Bacteria 4783
331 Ga0097620_100060700 3300006931 Unclassified 3810
332 Ga0097620_100248275 3300006931 Bacteria 1870
333 Ga0097620_100505408 3300006931 Bacteria 1304
334 Ga0075435_100000041 3300007076 Bacteria 66202
335 Ga0075435_100009005 3300007076 Bacteria 7202
336 Ga0075435_100009374 3300007076 Bacteria 7083
337 Ga0075435_100012805 3300007076 Bacteria 6215
338 Ga0075435_100015015 3300007076 Bacteria 5811
339 Ga0075435_100023820 3300007076 Bacteria 4741
340 Ga0075435_100027371 3300007076 Bacteria 4459
341 Ga0075435_100122061 3300007076 Bacteria 2175
342 Ga0075435_100369723 3300007076 Bacteria 1231
343 Ga0099795_10044070 3300007788 Bacteria 1599
344 Ga0105240_10312044 3300009093 Bacteria 1795
345 Ga0105240_10376406 3300009093 Bacteria 1604
346 Ga0111539_10000009 3300009094 Bacteria 375223
347 Ga0111539_10001537 3300009094 Bacteria 30729
348 Ga0111539_10006768 3300009094 Bacteria 14750
349 Ga0111539_10008826 3300009094 Bacteria 12776
350 Ga0111539_10022355 3300009094 Bacteria 7772
351 Ga0111539_10080387 3300009094 Bacteria 3834
352 Ga0111539_10155020 3300009094 Bacteria 2680
353 Ga0111539_10204953 3300009094 Unclassified 2299
354 Ga0111539_10318443 3300009094 Bacteria 1810
355 Ga0111539_10390908 3300009094 Bacteria 1620
356 Ga0111539_10683220 3300009094 Unclassified 1195
357 Ga0111539_10813561 3300009094 Bacteria 1087
358 Ga0105245_10037421 3300009098 Unclassified 4314
359 Ga0105245_10419112 3300009098 Bacteria 1342
360 Ga0105245_10478930 3300009098 Bacteria 1258
361 Ga0105245_10588771 3300009098 Bacteria 1138
362 Ga0105247_10062558 3300009101 Unclassified 2309
363 Ga0114129_10001294 3300009147 Bacteria 33348
364 Ga0114129_10002457 3300009147 Bacteria 25726
365 Ga0114129_10006209 3300009147 Bacteria 16950
366 Ga0114129_10008621 3300009147 Bacteria 14537
367 Ga0114129_10013305 3300009147 Bacteria 11729
368 Ga0114129_10022844 3300009147 Bacteria 8869
369 Ga0114129_10027092 3300009147 Bacteria 8115
370 Ga0114129_10028182 3300009147 Bacteria 7957
371 Ga0114129_10055196 3300009147 Bacteria 5569
372 Ga0114129_10062679 3300009147 Bacteria 5193
373 Ga0114129_10096224 3300009147 Bacteria 4099
374 Ga0114129_10101489 3300009147 Bacteria 3981
375 Ga0114129_10116915 3300009147 Unclassified 3675
376 Ga0114129_10121320 3300009147 Bacteria 3597
377 Ga0114129_10129796 3300009147 Bacteria 3463
378 Ga0114129_10221239 3300009147 Bacteria 2554
379 Ga0114129_10240049 3300009147 Bacteria 2436
380 Ga0114129_10329959 3300009147 Bacteria 2026
381 Ga0114129_10412042 3300009147 Bacteria 1779
382 Ga0114129_10415252 3300009147 Bacteria 1771
383 Ga0114129_10629028 3300009147 Bacteria 1387
384 Ga0114129_10712688 3300009147 Bacteria 1288
385 Ga0114129_10863037 3300009147 Bacteria 1150
386 Ga0114129_11227867 3300009147 Bacteria 932
387 Ga0105243_10255676 3300009148 Bacteria 1566
388 Ga0105243_10781472 3300009148 Bacteria 939
389 Ga0105241_10038324 3300009174 Bacteria 3613
390 Ga0105241_10053004 3300009174 Bacteria 3100
391 Ga0105241_10628713 3300009174 Bacteria 973
392 Ga0105242_10016080 3300009176 Bacteria 5812
393 Ga0105242_10016312 3300009176 Bacteria 5776
394 Ga0105242_10018000 3300009176 Bacteria 5519
395 Ga0105242_10460910 3300009176 Bacteria 1200
396 Ga0105242_10585001 3300009176 Bacteria 1076
397 Ga0105242_10645287 3300009176 Bacteria 1029
398 Ga0105248_10031306 3300009177 Bacteria 5945
399 Ga0105248_10093562 3300009177 Unclassified 3385
400 Ga0105248_10139977 3300009177 Bacteria 2729
401 Ga0105248_10148033 3300009177 Bacteria 2649
402 Ga0105248_10243788 3300009177 Bacteria 2023
403 Ga0105248_10398371 3300009177 Unclassified 1550
404 Ga0105248_10412292 3300009177 Bacteria 1521
405 Ga0105248_10548766 3300009177 Bacteria 1304
406 Ga0105238_10736138 3300009551 Bacteria 999
407 Ga0105249_10003036 3300009553 Bacteria 14480
408 Ga0105249_10022901 3300009553 Bacteria 5600
409 Ga0105249_10049361 3300009553 Bacteria 3838
410 Ga0105249_10131718 3300009553 Bacteria 2388
411 Ga0105249_10222121 3300009553 Bacteria 1859
412 Ga0105249_10314628 3300009553 Bacteria 1575
413 Ga0105249_10321939 3300009553 Unclassified 1558
414 Ga0105249_10524618 3300009553 Bacteria 1232
415 Ga0157374_10030945 3300013296 Bacteria 4861
416 Ga0157374_10225484 3300013296 Archaea 1840
417 Ga0157374_10324324 3300013296 Bacteria 1527
418 Ga0157378_10058289 3300013297 Bacteria 3444
419 Ga0157378_10080042 3300013297 Bacteria 2951
420 Ga0157378_10411257 3300013297 Bacteria 1335
421 Ga0163162_10133984 3300013306 Bacteria 2588
422 Ga0163162_10152375 3300013306 Unclassified 2430
423 Ga0163162_10225525 3300013306 Bacteria 2004
424 Ga0157375_10084503 3300013308 Bacteria 3223
425 Ga0157375_10394347 3300013308 Unclassified 1551
426 Ga0157375_10404597 3300013308 Bacteria 1531
427 Ga0157375_10490619 3300013308 Bacteria 1393
428 Ga0157375_10551188 3300013308 Bacteria 1315
429 Ga0157375_10907241 3300013308 Bacteria 1025
430 Ga0163163_10004353 3300014325 Bacteria 12060
431 Ga0163163_10149794 3300014325 Bacteria 2377
432 Ga0157380_10008295 3300014326 Bacteria 7403
433 Ga0157380_10019709 3300014326 Bacteria 5030
434 Ga0157380_10071434 3300014326 Bacteria 2807
435 Ga0157380_10076260 3300014326 Bacteria 2728
436 Ga0157380_10241933 3300014326 Bacteria 1627
437 Ga0157379_10026173 3300014968 Bacteria 5191
438 Ga0157376_10048399 3300014969 Bacteria 3515
439 Ga0157376_10420505 3300014969 Bacteria 1297
440 Ga0157376_10521425 3300014969 Bacteria 1171
441 Ga0207697_10102455 3300025315 Bacteria 1221
442 Ga0207656_10077204 3300025321 Unclassified 1491
443 Ga0207682_10039732 3300025893 Bacteria 1914
444 Ga0207682_10136217 3300025893 Bacteria 1099
445 Ga0207642_10040535 3300025899 Bacteria 2032
446 Ga0207680_10126590 3300025903 Bacteria 1678
447 Ga0207699_10141209 3300025906 Bacteria 1583
448 Ga0207699_10175738 3300025906 Bacteria 1436
449 Ga0207645_10032234 3300025907 Bacteria 3368
450 Ga0207645_10049279 3300025907 Bacteria 2689
451 Ga0207645_10087849 3300025907 Unclassified 1998
452 Ga0207645_10155466 3300025907 Bacteria 1494
453 Ga0207645_10215451 3300025907 Bacteria 1265
454 Ga0207645_10289435 3300025907 Bacteria 1089
455 Ga0207643_10021437 3300025908 Bacteria 3550
456 Ga0207643_10059667 3300025908 Bacteria 2177
457 Ga0207684_10002898 3300025910 Bacteria 17004
458 Ga0207684_10018006 3300025910 Bacteria 6054
459 Ga0207684_10107159 3300025910 Bacteria 2391
460 Ga0207684_10192771 3300025910 Bacteria 1758
461 Ga0207684_10293250 3300025910 Bacteria 1402
462 Ga0207684_10646670 3300025910 Bacteria 901
463 Ga0207654_10041097 3300025911 Bacteria 2609
464 Ga0207695_10235075 3300025913 Bacteria 1735
465 Ga0207660_10117351 3300025917 Bacteria 2011
466 Ga0207660_10178651 3300025917 Bacteria 1647
467 Ga0207660_10351067 3300025917 Bacteria 1182
468 Ga0207662_10034224 3300025918 Bacteria 2965
469 Ga0207662_10080037 3300025918 Bacteria 1992
470 Ga0207662_10168725 3300025918 Bacteria 1402
471 Ga0207649_10017165 3300025920 Archaea 4100
472 Ga0207646_10004695 3300025922 Bacteria 14724
473 Ga0207646_10017592 3300025922 Bacteria 6680
474 Ga0207646_10090244 3300025922 Bacteria 2743
475 Ga0207646_10112625 3300025922 Unclassified 2442
476 Ga0207646_10126651 3300025922 Bacteria 2297
477 Ga0207646_10229372 3300025922 Bacteria 1678
478 Ga0207646_10306821 3300025922 Bacteria 1434
479 Ga0207646_10327475 3300025922 Bacteria 1384
480 Ga0207681_10005037 3300025923 Bacteria 8123
481 Ga0207681_10017604 3300025923 Bacteria 4489
482 Ga0207681_10104669 3300025923 Bacteria 2048
483 Ga0207681_10201533 3300025923 Bacteria 1528
484 Ga0207650_10036705 3300025925 Bacteria 3567
485 Ga0207650_10110255 3300025925 Bacteria 2129
486 Ga0207650_10218717 3300025925 Archaea 1532
487 Ga0207659_10000188 3300025926 Bacteria 36927
488 Ga0207659_10014321 3300025926 Bacteria 5110
489 Ga0207659_10018680 3300025926 Bacteria 4548
490 Ga0207659_10134331 3300025926 Bacteria 1914
491 Ga0207659_10269349 3300025926 Bacteria 1389
492 Ga0207659_10355032 3300025926 Bacteria 1217
493 Ga0207659_10464624 3300025926 Bacteria 1067
494 Ga0207687_10022568 3300025927 Bacteria 4190
495 Ga0207687_10367888 3300025927 Bacteria 1175
496 Ga0207700_10008063 3300025928 Bacteria 6496
497 Ga0207700_10034985 3300025928 Bacteria 3613
498 Ga0207644_10106522 3300025931 Archaea 2114
499 Ga0207690_10027586 3300025932 Bacteria 3590
500 Ga0207706_10045956 3300025933 Bacteria 3867
501 Ga0207706_10087817 3300025933 Bacteria 2734
502 Ga0207706_10100969 3300025933 Bacteria 2538
503 Ga0207706_10203135 3300025933 Bacteria 1738
504 Ga0207686_10006180 3300025934 Bacteria 6436
505 Ga0207686_10091048 3300025934 Bacteria 2014
506 Ga0207686_10376889 3300025934 Bacteria 1075
507 Ga0207709_10130829 3300025935 Bacteria 1710
508 Ga0207709_10313972 3300025935 Bacteria 1170
509 Ga0207670_10003997 3300025936 Bacteria 7874
510 Ga0207670_10009084 3300025936 Bacteria 5647
511 Ga0207670_10201744 3300025936 Bacteria 1511
512 Ga0207669_10006704 3300025937 Bacteria 5281
513 Ga0207669_10010515 3300025937 Bacteria 4458
514 Ga0207669_10013007 3300025937 Bacteria 4116
515 Ga0207669_10024631 3300025937 Bacteria 3238
516 Ga0207704_10135832 3300025938 Bacteria 1711
517 Ga0207704_10143235 3300025938 Bacteria 1675
518 Ga0207691_10006107 3300025940 Bacteria 11642
519 Ga0207691_10022906 3300025940 Bacteria 5886
520 Ga0207691_10063906 3300025940 Bacteria 3336
521 Ga0207691_10092316 3300025940 Bacteria 2711
522 Ga0207691_10113871 3300025940 Bacteria 2403
523 Ga0207711_10051889 3300025941 Bacteria 3514
524 Ga0207711_10188431 3300025941 Bacteria 1879
525 Ga0207711_10255968 3300025941 Bacteria 1608
526 Ga0207711_10576602 3300025941 Bacteria 1049
527 Ga0207689_10017760 3300025942 Bacteria 6011
528 Ga0207689_10079510 3300025942 Bacteria 2694
529 Ga0207689_10083757 3300025942 Bacteria 2622
530 Ga0207689_10115149 3300025942 Bacteria 2210
531 Ga0207661_10011215 3300025944 Bacteria 6484
532 Ga0207661_10156657 3300025944 Archaea 1973
533 Ga0207679_10002659 3300025945 Bacteria 11028
534 Ga0207679_10124202 3300025945 Bacteria 2060
535 Ga0207679_10126194 3300025945 Bacteria 2045
536 Ga0207679_10363460 3300025945 Unclassified 1264
537 Ga0207667_10278442 3300025949 Bacteria 1709
538 Ga0207651_10023379 3300025960 Bacteria 3800
539 Ga0207651_10025902 3300025960 Unclassified 3653
540 Ga0207651_10052833 3300025960 Bacteria 2773
541 Ga0207651_10111975 3300025960 Bacteria 2051
542 Ga0207651_10195355 3300025960 Bacteria 1617
543 Ga0207651_10204382 3300025960 Bacteria 1585
544 Ga0207651_10268256 3300025960 Bacteria 1405
545 Ga0207712_10018953 3300025961 Bacteria 4489
546 Ga0207712_10088448 3300025961 Bacteria 2274
547 Ga0207712_10155321 3300025961 Bacteria 1772
548 Ga0207712_10453719 3300025961 Bacteria 1088
549 Ga0207712_10474054 3300025961 Unclassified 1066
550 Ga0207668_10063637 3300025972 Bacteria 2603
551 Ga0207668_10150746 3300025972 Bacteria 1800
552 Ga0207668_10185652 3300025972 Bacteria 1644
553 Ga0207640_10030010 3300025981 Bacteria 3345
554 Ga0207640_10037127 3300025981 Bacteria 3063
555 Ga0207658_10181141 3300025986 Bacteria 1744
556 Ga0207658_10226951 3300025986 Archaea 1574
557 Ga0207658_10530718 3300025986 Bacteria 1051
558 Ga0207677_10017072 3300026023 Bacteria 4317
559 Ga0207677_10017810 3300026023 Bacteria 4247
560 Ga0207677_10249195 3300026023 Bacteria 1441
561 Ga0207703_10004262 3300026035 Bacteria 11766
562 Ga0207703_10138768 3300026035 Archaea 2108
563 Ga0207703_10230660 3300026035 Unclassified 1660
564 Ga0207703_10351998 3300026035 Unclassified 1356
565 Ga0207678_10015984 3300026067 Bacteria 6591
566 Ga0207708_10011404 3300026075 Bacteria 6621
567 Ga0207708_10016816 3300026075 Bacteria 5508
568 Ga0207708_10026800 3300026075 Bacteria 4363
569 Ga0207708_10033011 3300026075 Bacteria 3931
570 Ga0207708_10033034 3300026075 Bacteria 3930
571 Ga0207708_10050529 3300026075 Bacteria 3165
572 Ga0207708_10067724 3300026075 Bacteria 2732
573 Ga0207708_10091051 3300026075 Bacteria 2351
574 Ga0207708_10149787 3300026075 Bacteria 1836
575 Ga0207641_10207438 3300026088 Bacteria 1810
576 Ga0207641_10493090 3300026088 Bacteria 1189
577 Ga0207648_10001860 3300026089 Bacteria 23055
578 Ga0207648_10031489 3300026089 Bacteria 4690
579 Ga0207648_10050958 3300026089 Bacteria 3619
580 Ga0207648_10102995 3300026089 Bacteria 2503
581 Ga0207676_10024049 3300026095 Bacteria 4504
582 Ga0207676_10027327 3300026095 Bacteria 4249
583 Ga0207676_10042656 3300026095 Bacteria 3490
584 Ga0207676_10069868 3300026095 Bacteria 2814
585 Ga0207676_10223604 3300026095 Bacteria 1678
586 Ga0207674_10023655 3300026116 Bacteria 6577
587 Ga0207674_10044046 3300026116 Bacteria 4599
588 Ga0207674_10052540 3300026116 Bacteria 4156
589 Ga0207674_10122262 3300026116 Bacteria 2569
590 Ga0207674_10161279 3300026116 Archaea 2196
591 Ga0207675_100006022 3300026118 Bacteria 11541
592 Ga0207675_100022659 3300026118 Bacteria 5845
593 Ga0207675_100048529 3300026118 Bacteria 3963
594 Ga0207675_100050645 3300026118 Bacteria 3875
595 Ga0207675_100051051 3300026118 Unclassified 3859
596 Ga0207675_100061364 3300026118 Bacteria 3509
597 Ga0207675_100339845 3300026118 Bacteria 1469
598 Ga0207675_100427718 3300026118 Bacteria 1308
599 Ga0207683_10039938 3300026121 Bacteria 4093
600 Ga0207683_10053529 3300026121 Bacteria 3539
601 Ga0207683_10078856 3300026121 Bacteria 2919
602 Ga0207683_10461497 3300026121 Bacteria 1171
603 Ga0207698_10360865 3300026142 Bacteria 1376
604 Ga0209813_10007956 3300027866 Bacteria 2660
605 Ga0209974_10086695 3300027876 Bacteria 1082
606 Ga0207428_10000005 3300027907 Bacteria 520045
607 Ga0207428_10000963 3300027907 Bacteria 31936
608 Ga0207428_10001556 3300027907 Bacteria 23960
609 Ga0207428_10001740 3300027907 Bacteria 22291
610 Ga0207428_10019076 3300027907 Bacteria 5849
611 Ga0207428_10061765 3300027907 Unclassified 2965
612 Ga0207428_10217213 3300027907 Bacteria 1434
613 Ga0207428_10428309 3300027907 Unclassified 966
614 Ga0268265_10000183 3300028380 Bacteria 74487
615 Ga0268265_10038688 3300028380 Bacteria 3510
616 Ga0268265_10095582 3300028380 Bacteria 2386
617 Ga0268265_10223540 3300028380 Bacteria 1649
618 Ga0268265_10399988 3300028380 Bacteria 1269
619 Ga0268265_10712833 3300028380 Bacteria 970
620 Ga0268264_10006097 3300028381 Bacteria 10186
621 Ga0268264_10309429 3300028381 Bacteria 1490
622 Ga0265323_10004413 3300028653 Bacteria 6067
623 Ga0265338_10021154 3300028800 Bacteria 6798
624 Ga0265324_10012498 3300029957 Bacteria 3198
625 Ga0316579_10027907 3300031691 Bacteria 2567
626 Ga0316579_10037408 3300031691 Unclassified 2242
627 Ga0265314_10037448 3300031711 Bacteria 3515
628 Ga0316576_10002816 3300031727 Bacteria 10008
629 Ga0316576_10276245 3300031727 Bacteria 1259
630 Ga0316576_10358649 3300031727 Bacteria 1084
631 Ga0307410_10304204 3300031852 Bacteria 1259
632 Ga0307406_10133876 3300031901 Bacteria 1744
633 Ga0307407_10215608 3300031903 Bacteria 1295
634 Ga0307412_10497176 3300031911 Bacteria 1014
635 Ga0307409_100056429 3300031995 Bacteria 3037
636 Ga0307409_100142266 3300031995 Bacteria 2069
637 Ga0307409_100149029 3300031995 Bacteria 2028
638 Ga0307416_100025487 3300032002 Bacteria 4335
639 Ga0307416_100102786 3300032002 Bacteria 2493
640 Ga0307411_10110595 3300032005 Bacteria 1965
641 Ga0307411_10325373 3300032005 Bacteria 1243
642 Ga0307415_100222295 3300032126 Bacteria 1515
643 Ga0373930_0011111 3300034816 Bacteria 1621
644 Ga0373958_0012953 3300034819 Bacteria 1435
645 Ga0373958_0021785 3300034819 Bacteria 1192
646 Ga0373929_0001104 3300035085 Bacteria 5244
647 Ga0373940_0000039 3300035088 Bacteria 14131
648 Ga0373940_0069588 3300035088 Bacteria 1022
649 Ga0373949_0001162 3300035090 Bacteria 7856
650 Ga0373951_0002100 3300035091 Bacteria 5107
651 Ga0373932_0002751 3300035112 Bacteria 4374
652 Ga0373932_0061243 3300035112 Bacteria 1144
653 Ga0373936_0118575 3300035113 Bacteria 1129
654 Ga0373939_0000940 3300035114 Bacteria 7249
655 Ga0373941_0001349 3300035115 Bacteria 5162
656 Ga0373945_0037248 3300035116 Bacteria 1745
657 Ga0373954_0088662 3300035118 Bacteria 1484
658 Ga0373956_0084511 3300035119 Bacteria 1459
659 Ga0373960_0001226 3300035121 Bacteria 5615
660 Ga0373943_0003982 3300035170 Bacteria 6721
661 Ga0373943_0186533 3300035170 Bacteria 1142
662 Ga0373943_0220576 3300035170 Unclassified 1056
663 Ga0373946_0008520 3300035171 Bacteria 3764
664 Ga0373946_0251858 3300035171 Bacteria 862
665 Ga0373955_0074212 3300035172 Bacteria 1908
666 Ga0373955_0075377 3300035172 Bacteria 1896
667 Ga0373942_0000750 3300035207 Bacteria 8943
668 Ga0373961_0002991 3300035241 Bacteria 4263
669 Ga0373961_0064211 3300035241 Bacteria 1122
670 Ga0373962_0000766 3300035242 Bacteria 7324
671 Ga0316574_0049704 3300035398 Bacteria 2608
672 Ga0316574_0165455 3300035398 Bacteria 1424
673 Ga0316574_0267273 3300035398 Bacteria 1091
674 Ga0373924_0010419 3300035410 Bacteria 3425
675 Ga0373924_0121792 3300035410 Bacteria 1132
676 Ga0373931_0001453 3300035691 Bacteria 10179
677 Ga0373931_0065359 3300035691 Bacteria 1971
678 Ga0373935_0026673 3300035692 Bacteria 3569
679 Ga0373935_0261811 3300035692 Bacteria 1213
680 Ga0373927_0031710 3300035695 Bacteria 3444
681 Ga0373933_0024873 3300035724 Bacteria 3431
682 Ga0373933_0132775 3300035724 Bacteria 1566
683 Ga0373937_0003122 3300036401 Bacteria 13861
684 Ga0373937_0031300 3300036401 Bacteria 4820
685 Ga0373937_0279887 3300036401 Bacteria 1575
686 Ga0373937_0300272 3300036401 Bacteria 1518
687 Ga0373937_0361320 3300036401 Bacteria 1376
688 Ga0316582_0033596 3300036647 Bacteria 3152
689 Ga0316582_0094238 3300036647 Bacteria 1975
690 Ga0373925_0005452 3300037068 Bacteria 9475
691 Ga0373925_0196828 3300037068 Bacteria 1601
692 Ga0373925_0455971 3300037068 Bacteria 1047
693 Ga0436365_0993952 3300039437 Bacteria 1004
694 Ga0439461_0008604 3300041410 Bacteria 1833
695 Ga0439433_0007182 3300041999 Bacteria 2404
696 Ga0439441_048546 3300042001 Bacteria 869
697 Ga0439445_0041035 3300042004 Bacteria 1229
698 Ga0439457_107273 3300042014 Bacteria 654
699 Ga0450920_041037 3300042122 Bacteria 923
700 Ga0450923_003766 3300042125 Bacteria 2323
701 Ga0450896_027603 3300042133 Bacteria 850
702 Ga0439446_0006628 3300042156 Bacteria 3028
703 Ga0439446_0009351 3300042156 Bacteria 2624
704 Ga0439434_0020742 3300042435 Bacteria 1974
705 Ga0439434_0024883 3300042435 Bacteria 1807
706 Ga0439435_0005134 3300042436 Bacteria 2865
707 Ga0451577_0001014 3300042876 Bacteria 40843
708 Ga0451577_0028596 3300042876 Bacteria 5039
709 Ga0451577_0092147 3300042876 Bacteria 2706
710 Ga0439440_0100124 3300042993 Bacteria 788
711 Ga0453684_0000004 3300044712 Bacteria 1469893
712 Ga0453684_0066994 3300044712 Bacteria 4569
713 Ga0453684_0168852 3300044712 Bacteria 2580
714 Ga0453684_0547163 3300044712 Bacteria 1276
715 Ga0451576_0002751 3300045051 Bacteria 25497
716 Ga0451576_0004039 3300045051 Bacteria 19473
717 Ga0451576_0011011 3300045051 Bacteria 10327
718 Ga0451576_0035312 3300045051 Bacteria 5305
719 Ga0451576_0093800 3300045051 Bacteria 3121
720 Ga0451576_0289303 3300045051 Bacteria 1713
721 Ga0451576_0388698 3300045051 Bacteria 1462
722 Ga0495592_0147312 3300046454 Bacteria 1631
723 Ga0495603_0006665 3300046455 Bacteria 6930
724 Ga0495629_0001864 3300046459 Bacteria 16488
725 Ga0495638_0020091 3300046460 Bacteria 4414
726 Ga0495651_0124323 3300046462 Bacteria 1891
727 Ga0495651_0188806 3300046462 Bacteria 1452
728 Ga0495580_0154759 3300046472 Bacteria 1588
729 Ga0495639_0095330 3300046475 Bacteria 1400
730 Ga0495639_0232697 3300046475 Bacteria 908
731 Ga0495664_0129466 3300046477 Bacteria 1528
732 Ga0495664_0206431 3300046477 Bacteria 1190
733 Ga0495584_0029632 3300046491 Bacteria 2775
734 Ga0495584_0164844 3300046491 Unclassified 1126
735 Ga0495594_0050120 3300046499 Bacteria 2296
736 Ga0495608_0001856 3300046511 Bacteria 15079
737 Ga0495628_0053229 3300046516 Bacteria 3195
738 Ga0495630_0003013 3300046517 Bacteria 11686
739 Ga0495644_0039341 3300046523 Bacteria 1783
740 Ga0495663_0090808 3300046525 Unclassified 995
741 Ga0495642_0004422 3300046528 Bacteria 5456
742 Ga0495642_0098933 3300046528 Bacteria 1240
743 Ga0495652_0354473 3300046529 Bacteria 1050
744 Ga0495586_0265383 3300046535 Bacteria 981
745 Ga0495587_0085683 3300046536 Bacteria 1824
746 Ga0495598_0003522 3300046537 Bacteria 3337
747 Ga0495598_0012767 3300046537 Bacteria 2070
748 Ga0495609_0049776 3300046538 Bacteria 1869
749 Ga0495609_0196663 3300046538 Bacteria 844
750 Ga0495621_0067618 3300046539 Bacteria 1310
751 Ga0495621_0136917 3300046539 Bacteria 956
752 Ga0495621_0162226 3300046539 Bacteria 884
753 Ga0495645_0003630 3300046543 Bacteria 10481
754 Ga0495645_0011692 3300046543 Bacteria 6179
755 Ga0495645_0206925 3300046543 Bacteria 1327
756 Ga0495633_0018672 3300046558 Bacteria 3519
757 Ga0495667_0023699 3300046559 Bacteria 4134
758 Ga0495656_0017840 3300046615 Bacteria 2715
759 Ga0495656_0058075 3300046615 Bacteria 1678
760 Ga0495635_0062022 3300046663 Bacteria 2567
761 Ga0495635_0150703 3300046663 Bacteria 1583
762 Ga0495659_0010701 3300046664 Bacteria 2950
763 Ga0495659_0013333 3300046664 Bacteria 2677
764 Ga0495659_0042079 3300046664 Bacteria 1634
765 Ga0495659_0049722 3300046664 Bacteria 1523
766 Ga0495659_0104522 3300046664 Bacteria 1100
767 Ga0495588_0024900 3300046674 Bacteria 2977
768 Ga0495599_0039434 3300046678 Bacteria 2968
769 Ga0495599_0100107 3300046678 Bacteria 1807
770 Ga0495658_0015799 3300046683 Bacteria 3878
771 Ga0495658_0150951 3300046683 Bacteria 1427
772 Ga0495658_0151640 3300046683 Bacteria 1424
773 Ga0495669_0013753 3300046684 Bacteria 3454
774 Ga0495669_0019300 3300046684 Bacteria 2941
775 Ga0495669_0037536 3300046684 Bacteria 2144
776 Ga0495669_0096286 3300046684 Unclassified 1371
777 Ga0495613_0000599 3300046689 Bacteria 29031
778 Ga0495613_0161684 3300046689 Bacteria 1593
779 Ga0495613_0267061 3300046689 Bacteria 1191
780 Ga0495600_0003980 3300046809 Bacteria 8780
781 Ga0495600_0063933 3300046809 Bacteria 2405
782 Ga0495604_0014504 3300047317 Bacteria 6284
783 Ga0495636_0100582 3300047318 Bacteria 1264
784 Ga0495674_0050049 3300047319 Bacteria 3688
785 Ga0495674_0074426 3300047319 Bacteria 2925
786 Ga0495672_0001565 3300047320 Bacteria 22401
787 Ga0495677_0026679 3300047445 Bacteria 2095
788 Ga0495685_018711 3300047447 Unclassified 2378
789 Ga0495684_0000310 3300047471 Bacteria 39859
790 Ga0495684_0112833 3300047471 Bacteria 2050
791 Ga0495684_0146073 3300047471 Bacteria 1771
792 Ga0495684_0352374 3300047471 Bacteria 1045
793 Ga0496100_0214982 3300048903 Archaea 1408
794 Ga0496101_0001671 3300048904 Bacteria 13309
795 Ga0496102_0032144 3300048905 Bacteria 4714
796 Ga0496104_0003276 3300048907 Bacteria 13967
797 Ga0496104_0088057 3300048907 Unclassified 2966
798 Ga0496104_0179311 3300048907 Unclassified 2029
799 Ga0496105_0045285 3300048908 Bacteria 3630
800 Ga0496105_0124553 3300048908 Unclassified 2125
801 Ga0496105_0156700 3300048908 Bacteria 1870
802 Ga0496106_0037860 3300048909 Bacteria 3609
803 Ga0496106_0157814 3300048909 Bacteria 1793
804 Ga0496107_0258932 3300048910 Bacteria 1295
805 Ga0496108_0004502 3300048911 Bacteria 11225
806 Ga0496109_0001333 3300048912 Bacteria 20382
807 Ga0496109_0304142 3300048912 Bacteria 1504
808 Ga0496110_0001226 3300048913 Bacteria 18281
809 Ga0496112_0033138 3300048915 Bacteria 5019
810 Ga0496112_0414005 3300048915 Bacteria 1287
811 Ga0496113_0133691 3300048916 Archaea 1948
812 Ga0496114_0001180 3300048917 Bacteria 19796
813 Ga0496114_0233106 3300048917 Bacteria 1618
814 Ga0496115_0228113 3300048918 Unclassified 1536
815 Ga0501298_006448 3300049521 Bacteria 1919
816 Ga0501031_0128708 3300049568 Bacteria 1654
817 Ga0501031_0335599 3300049568 Bacteria 979
818 Ga0501032_0395640 3300049569 Bacteria 888
819 Ga0501033_0060564 3300049570 Bacteria 2792
820 Ga0501034_0004031 3300049571 Bacteria 16482
821 Ga0501036_0013404 3300049572 Bacteria 6812
822 Ga0501036_0063161 3300049572 Bacteria 3136
823 Ga0501036_0075501 3300049572 Bacteria 2850
824 Ga0501036_0096531 3300049572 Bacteria 2499
825 Ga0501036_0205940 3300049572 Bacteria 1654
826 Ga0501037_0075725 3300049573 Bacteria 2444
827 Ga0501038_0043999 3300049574 Bacteria 3881
828 Ga0501038_0063821 3300049574 Bacteria 3143
829 Ga0501038_0160861 3300049574 Bacteria 1825
830 Ga0501039_0111878 3300049575 Bacteria 2135
831 Ga0501039_0158973 3300049575 Bacteria 1776
832 Ga0501039_0170020 3300049575 Bacteria 1714
833 Ga0501040_0004377 3300049576 Bacteria 9182
834 Ga0501040_0006548 3300049576 Bacteria 7562
835 Ga0501040_0033622 3300049576 Bacteria 3475
836 Ga0501040_0111652 3300049576 Bacteria 1912
837 Ga0501040_0130769 3300049576 Bacteria 1765
838 Ga0501041_0047271 3300049577 Bacteria 2619
839 Ga0501041_0162432 3300049577 Bacteria 1397
840 Ga0501041_0196082 3300049577 Bacteria 1265
841 Ga0501041_0218489 3300049577 Bacteria 1196
842 Ga0501042_0022598 3300049578 Bacteria 4395
843 Ga0501042_0315804 3300049578 Bacteria 1129
844 Ga0501042_0469976 3300049578 Bacteria 912
845 Ga0501042_0481416 3300049578 Bacteria 901
846 Ga0501043_0112868 3300049579 Bacteria 2134
847 Ga0501048_0021740 3300049582 Bacteria 4695
848 Ga0501048_0025224 3300049582 Bacteria 4333
849 Ga0501048_0031371 3300049582 Bacteria 3844
850 Ga0501048_0071723 3300049582 Bacteria 2445
851 Ga0501048_0212123 3300049582 Bacteria 1373
852 Ga0501048_0401835 3300049582 Bacteria 979
853 Ga0501067_0285894 3300049583 Bacteria 918
854 Ga0501068_0149337 3300049584 Bacteria 1468
855 Ga0501071_0022159 3300049587 Bacteria 4427
856 Ga0501071_0026347 3300049587 Bacteria 4080
857 Ga0501071_0037102 3300049587 Bacteria 3479
858 Ga0501071_0037251 3300049587 Bacteria 3472
859 Ga0501071_0192236 3300049587 Bacteria 1531
860 Ga0501071_0361244 3300049587 Bacteria 1106
861 Ga0501071_0521535 3300049587 Bacteria 912
862 Ga0501071_0632167 3300049587 Bacteria 823
863 Ga0501072_0007310 3300049588 Bacteria 8376
864 Ga0501072_0022930 3300049588 Bacteria 4846
865 Ga0501072_0025475 3300049588 Bacteria 4608
866 Ga0501072_0264862 3300049588 Bacteria 1368
867 Ga0501072_0270104 3300049588 Bacteria 1353
868 Ga0501073_0004289 3300049589 Bacteria 10697
869 Ga0501073_0045987 3300049589 Bacteria 3072
870 Ga0501074_0061265 3300049590 Bacteria 2711
871 Ga0501074_0061528 3300049590 Bacteria 2705
872 Ga0501074_0149674 3300049590 Bacteria 1669
873 Ga0501074_0178990 3300049590 Bacteria 1513
874 Ga0501075_0010372 3300049591 Bacteria 6546
875 Ga0501075_0014416 3300049591 Bacteria 5663
876 Ga0501075_0015936 3300049591 Bacteria 5405
877 Ga0501075_0026624 3300049591 Bacteria 4259
878 Ga0501075_0027486 3300049591 Bacteria 4193
879 Ga0501075_0339000 3300049591 Bacteria 1146
880 Ga0501075_0430463 3300049591 Bacteria 1006
881 Ga0501076_0008303 3300049592 Bacteria 7609
882 Ga0501076_0014435 3300049592 Bacteria 5950
883 Ga0501076_0018379 3300049592 Bacteria 5329
884 Ga0501076_0024644 3300049592 Bacteria 4653
885 Ga0501076_0033580 3300049592 Bacteria 4006
886 Ga0501076_0112103 3300049592 Bacteria 2206
887 Ga0501076_0277677 3300049592 Bacteria 1372
888 Ga0501076_0558450 3300049592 Bacteria 944
889 Ga0501077_0114031 3300049593 Bacteria 1714
890 Ga0501077_0120443 3300049593 Bacteria 1663
891 Ga0501077_0304536 3300049593 Bacteria 1015
892 Ga0501077_0484655 3300049593 Bacteria 793
893 Ga0501079_0039777 3300049741 Bacteria 3627
894 Ga0501079_0041256 3300049741 Bacteria 3562
895 Ga0501079_0080999 3300049741 Bacteria 2510
896 Ga0501079_0117863 3300049741 Bacteria 2064
897 Ga0501079_0309187 3300049741 Bacteria 1237
898 Ga0501079_0401812 3300049741 Bacteria 1074
899 Ga0501080_0047614 3300049742 Bacteria 3992
900 Ga0501080_0568157 3300049742 Bacteria 1009
901 Ga0501080_0753648 3300049742 Bacteria 856
902 Ga0501081_0008536 3300049743 Bacteria 6659
903 Ga0501081_0009062 3300049743 Bacteria 6469
904 Ga0501081_0038621 3300049743 Bacteria 3263
905 Ga0501081_0059835 3300049743 Bacteria 2638
906 Ga0501081_0062692 3300049743 Bacteria 2579
907 Ga0501081_0223625 3300049743 Bacteria 1369
908 Ga0501081_0415026 3300049743 Bacteria 997
909 Ga0501081_0554685 3300049743 Bacteria 858
910 Ga0501045_0011826 3300049824 Bacteria 6131
911 Ga0501045_0018556 3300049824 Bacteria 4949
912 Ga0501045_0065071 3300049824 Bacteria 2677
913 Ga0501045_0164990 3300049824 Bacteria 1650
914 Ga0501045_0430481 3300049824 Bacteria 981
915 Ga0501045_0477941 3300049824 Bacteria 926
916 nmdc:mga03683_3241_c1 3300050489 Bacteria 5213
917 nmdc:mga03683_66316_c1 3300050489 Bacteria 1535
918 nmdc:mga03n38_220435_c1 3300050490 Bacteria 990
919 nmdc:mga00v17_16883_c1 3300050491 Bacteria 4121
920 nmdc:mga00v17_171208_c1 3300050491 Bacteria 1400
921 nmdc:mga00v17_34078_c1 3300050491 Bacteria 3022
922 nmdc:mga0yw44_2299_c1 3300050492 Bacteria 8079
923 nmdc:mga0yw44_497700_c1 3300050492 Bacteria 827
924 nmdc:mga0k408_28290_c2 3300050493 Bacteria 2777
925 nmdc:mga0k408_4177_c1 3300050493 Bacteria 7666
926 nmdc:mga06z11_17737_c1 3300050494 Bacteria 3238
927 nmdc:mga06z11_3555_c1 3300050494 Bacteria 6037
928 nmdc:mga06z11_50315_c1 3300050494 Bacteria 2129
929 nmdc:mga06z11_5154_c1 3300050494 Bacteria 5214
930 nmdc:mga06z11_9088_c1 3300050494 Bacteria 4174
931 nmdc:mga04h51_126451_c1 3300050495 Bacteria 957
932 nmdc:mga04h51_9279_c1 3300050495 Bacteria 2660
933 nmdc:mga05p37_100630_c1 3300050507 Unclassified 3560
934 nmdc:mga05p37_130274_c1 3300050507 Bacteria 3086
935 nmdc:mga05p37_134259_c1 3300050507 Bacteria 3036
936 nmdc:mga05p37_135291_c1 3300050507 Bacteria 3023
937 nmdc:mga05p37_145751_c1 3300050507 Bacteria 2900
938 nmdc:mga05p37_165753_c1 3300050507 Bacteria 2697
939 nmdc:mga05p37_1682_c1 3300050507 Bacteria 25731
940 nmdc:mga05p37_188854_c1 3300050507 Bacteria 2503
941 nmdc:mga05p37_200646_c1 3300050507 Bacteria 2416
942 nmdc:mga05p37_228487_c1 3300050507 Bacteria 2243
943 nmdc:mga05p37_22858_c1 3300050507 Bacteria 7583
944 nmdc:mga05p37_240985_c1 3300050507 Bacteria 2174
945 nmdc:mga05p37_28735_c1 3300050507 Bacteria 6784
946 nmdc:mga05p37_367296_c1 3300050507 Bacteria 1690
947 nmdc:mga05p37_40463_c1 3300050507 Bacteria 5725
948 nmdc:mga05p37_423797_c1 3300050507 Bacteria 1548
949 nmdc:mga05p37_478081_c1 3300050507 Bacteria 1436
950 nmdc:mga05p37_566944_c1 3300050507 Bacteria 1289
951 nmdc:mga05p37_567032_c1 3300050507 Bacteria 1289
952 nmdc:mga05p37_644_c1 3300050507 Bacteria 38645
953 nmdc:mga05p37_69333_c1 3300050507 Bacteria 4337
954 nmdc:mga05p37_78073_c1 3300050507 Bacteria 4076
955 nmdc:mga05p37_81281_c1 3300050507 Bacteria 3992
956 nmdc:mga05p37_855548_c1 3300050507 Bacteria 987
957 nmdc:mga05p37_86311_c1 3300050507 Bacteria 3868
958 nmdc:mga09592_113139_c1 3300050508 Bacteria 2329
959 nmdc:mga09592_304352_c1 3300050508 Bacteria 1382
960 nmdc:mga09592_314878_c1 3300050508 Bacteria 1356
961 nmdc:mga09592_40921_c1 3300050508 Bacteria 3895
962 nmdc:mga09592_423364_c1 3300050508 Bacteria 1150
963 nmdc:mga09592_4298_c1 3300050508 Bacteria 11503
964 nmdc:mga09592_547400_c1 3300050508 Bacteria 994
965 nmdc:mga09592_7328_c1 3300050508 Bacteria 8967
966 nmdc:mga09592_99751_c1 3300050508 Bacteria 2486
967 nmdc:mga0qj67_144750_c1 3300050509 Bacteria 1927
968 nmdc:mga0qj67_165467_c1 3300050509 Unclassified 1795
969 nmdc:mga0qj67_3318_c1 3300050509 Bacteria 11603
970 nmdc:mga06r32_107564_c1 3300050510 Bacteria 2741
971 nmdc:mga06r32_15924_c1 3300050510 Bacteria 6842
972 nmdc:mga06r32_49931_c1 3300050510 Bacteria 4002
973 nmdc:mga06r32_603924_c1 3300050510 Bacteria 1068
974 nmdc:mga06r32_63212_c1 3300050510 Bacteria 3567
975 nmdc:mga06r32_8083_c1 3300050510 Bacteria 9465
976 nmdc:mga06r32_95924_c1 3300050510 Bacteria 2903
977 nmdc:mga08y16_10460_c1 3300050511 Bacteria 9735
978 nmdc:mga08y16_104809_c1 3300050511 Bacteria 2944
979 nmdc:mga08y16_10929_c1 3300050511 Bacteria 9533
980 nmdc:mga08y16_155249_c1 3300050511 Bacteria 2378
981 nmdc:mga08y16_198729_c1 3300050511 Bacteria 2078
982 nmdc:mga08y16_243215_c1 3300050511 Unclassified 1860
983 nmdc:mga08y16_244777_c1 3300050511 Bacteria 1853
984 nmdc:mga08y16_373840_c1 3300050511 Bacteria 1462
985 nmdc:mga08y16_39988_c1 3300050511 Bacteria 4918
986 nmdc:mga08y16_48405_c1 3300050511 Bacteria 4449
987 nmdc:mga08y16_6292_c1 3300050511 Bacteria 12450
988 nmdc:mga08y16_86790_c1 3300050511 Bacteria 3261
989 nmdc:mga08y16_932_c1 3300050511 Bacteria 28369
990 nmdc:mga08y16_9_c1 3300050511 Bacteria 566088
991 nmdc:mga0n895_102951_c1 3300050512 Bacteria 2866
992 nmdc:mga0n895_112926_c1 3300050512 Bacteria 2734
993 nmdc:mga0n895_138646_c1 3300050512 Bacteria 2460
994 nmdc:mga0n895_139651_c1 3300050512 Bacteria 2450
995 nmdc:mga0n895_151826_c1 3300050512 Bacteria 2347
996 nmdc:mga0n895_168218_c1 3300050512 Bacteria 2224
997 nmdc:mga0n895_182632_c1 3300050512 Bacteria 2129
998 nmdc:mga0n895_20798_c1 3300050512 Bacteria 6128
999 nmdc:mga0n895_4406_c1 3300050512 Bacteria 11564
1000 nmdc:mga0n895_52553_c1 3300050512 Bacteria 4000
1001 nmdc:mga0n895_691527_c1 3300050512 Bacteria 1016
1002 nmdc:mga0n895_700432_c1 3300050512 Bacteria 1009
1003 nmdc:mga0n895_81_c1 3300050512 Bacteria 54736
1004 nmdc:mga0rr50_1_c1 3300050513 Bacteria 558123
1005 nmdc:mga0rr50_28641_c1 3300050513 Bacteria 3918
1006 nmdc:mga0rr50_4248_c1 3300050513 Bacteria 8383
1007 nmdc:mga0rr50_557328_c1 3300050513 Unclassified 976
1008 nmdc:mga0rr50_83187_c1 3300050513 Bacteria 2474
1009 nmdc:mga0rr50_8895_c1 3300050513 Bacteria 6273
1010 nmdc:mga08x19_181099_c1 3300050514 Bacteria 1439
1011 nmdc:mga08x19_265_c1 3300050514 Bacteria 39740
1012 nmdc:mga08x19_310417_c1 3300050514 Bacteria 1096
1013 nmdc:mga08x19_59349_c1 3300050514 Bacteria 2476
1014 nmdc:mga08x19_96849_c1 3300050514 Bacteria 1953
1015 nmdc:mga0a205_115510_c1 3300050515 Bacteria 2583
1016 nmdc:mga0a205_116830_c1 3300050515 Bacteria 2566
1017 nmdc:mga0a205_179962_c1 3300050515 Bacteria 2009
1018 nmdc:mga0a205_3136_c1 3300050515 Bacteria 14660
1019 nmdc:mga0a205_326970_c1 3300050515 Bacteria 1403
1020 nmdc:mga0a205_391940_c1 3300050515 Bacteria 1253
1021 nmdc:mga0a205_456663_c1 3300050515 Bacteria 1137
1022 nmdc:mga0a205_45943_c1 3300050515 Bacteria 4211
1023 nmdc:mga0a205_46215_c1 3300050515 Bacteria 4199
1024 nmdc:mga0a205_47513_c2 3300050515 Bacteria 1872
1025 nmdc:mga0a205_49528_c1 3300050515 Bacteria 4055
1026 nmdc:mga0a205_61542_c1 3300050515 Bacteria 2785
1027 nmdc:mga0sz30_68326_c1 3300050516 Bacteria 1526
1028 Ga0495601_0025172 3300053077 Bacteria 3668
1029 Ga0495601_0058386 3300053077 Bacteria 2445
1030 Ga0495595_0043128 3300053084 Bacteria 2068
1031 Ga0495619_0008204 3300053085 Bacteria 6604
1032 Ga0495619_0071124 3300053085 Bacteria 2328
1033 Ga0500646_0081212 3300053090 Bacteria 989
1034 Ga0500555_006197 3300053103 Bacteria 3395
1035 Ga0501084_0008116 3300054114 Bacteria 8651
1036 Ga0501084_0130496 3300054114 Bacteria 2116
1037 Ga0501084_0161438 3300054114 Bacteria 1891
1038 Ga0501084_0216963 3300054114 Bacteria 1614
1039 Ga0501084_0383980 3300054114 Bacteria 1187
1040 Ga0501082_0015946 3300060353 Bacteria 6463
1041 Ga0501082_0024231 3300060353 Bacteria 5233
1042 Ga0501082_0030564 3300060353 Bacteria 4642
1043 Ga0501082_0089298 3300060353 Bacteria 2661
1044 Ga0501082_0291148 3300060353 Bacteria 1422
1045 Ga0501082_0317908 3300060353 Bacteria 1356
1046 Ga0501082_0538040 3300060353 Bacteria 1022
1047 Ga0530510_0006006 3300061734 Bacteria 8426
1048 Ga0530510_0011471 3300061734 Bacteria 6215
1049 Ga0530510_0092624 3300061734 Bacteria 2206
1050 Ga0530510_0157749 3300061734 Bacteria 1678

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046475 Ga0495639_0232697 Ga0495639_0232697_265_882 191
2 3300035398 Ga0316574_0165455 Ga0316574_0165455_14_625 192
3 3300035398 Ga0316574_0267273 Ga0316574_0267273_64_675 192
4 3300042993 Ga0439440_0100124 Ga0439440_0100124_71_685 192
5 3300049593 Ga0501077_0484655 Ga0501077_0484655_17_628 192
6 3300035113 Ga0373936_0118575 Ga0373936_0118575_18_635 193
7 3300042014 Ga0439457_107273 Ga0439457_107273_19_636 193
8 3300049572 Ga0501036_0205940 Ga0501036_0205940_17_634 193
9 3300049590 Ga0501074_0061528 Ga0501074_0061528_1743_2360 193
10 3300049742 Ga0501080_0568157 Ga0501080_0568157_306_923 193
11 3300050513 nmdc:mga0rr50_557328_c1 nmdc:mga0rr50_557328_c1_11_628 193
12 3300005545 Ga0070695_100109023 Ga0070695_1001090232 210
13 3300049587 Ga0501071_0361244 Ga0501071_0361244_14_697 215
14 3300049578 Ga0501042_0469976 Ga0501042_0469976_206_901 219
15 3300028800 Ga0265338_10021154 Ga0265338_100211544 226
16 3300029957 Ga0265324_10012498 Ga0265324_100124982 226
17 3300042876 Ga0451577_0028596 Ga0451577_0028596_425_1144 226
18 3300042876 Ga0451577_0092147 Ga0451577_0092147_361_1080 226
19 3300044712 Ga0453684_0168852 Ga0453684_0168852_1223_1942 226
20 3300045051 Ga0451576_0004039 Ga0451576_0004039_15329_16048 226
21 3300005549 Ga0070704_100430955 Ga0070704_1004309552 227
22 3300005844 Ga0068862_100028702 Ga0068862_1000287023 227
23 3300028380 Ga0268265_10712833 Ga0268265_107128331 227
24 3300028653 Ga0265323_10004413 Ga0265323_100044132 227
25 3300009147 Ga0114129_10121320 Ga0114129_101213202 228
26 3300042876 Ga0451577_0001014 Ga0451577_0001014_35374_36108 231
27 3300044712 Ga0453684_0000004 Ga0453684_0000004_1300126_1300860 231
28 3300050495 nmdc:mga04h51_126451_c1 nmdc:mga04h51_126451_c1_216_947 231
29 3300025928 Ga0207700_10034985 Ga0207700_100349853 233
30 3300006844 Ga0075428_100004677 Ga0075428_1000046775 234
31 3300009094 Ga0111539_10204953 Ga0111539_102049533 234
32 3300027907 Ga0207428_10061765 Ga0207428_100617654 234
33 3300050509 nmdc:mga0qj67_165467_c1 nmdc:mga0qj67_165467_c1_947_1696 234
34 3300050511 nmdc:mga08y16_373840_c1 nmdc:mga08y16_373840_c1_292_1041 234
35 3300005338 Ga0068868_100079273 Ga0068868_1000792732 235
36 3300005347 Ga0070668_100312884 Ga0070668_1003128842 235
37 3300005356 Ga0070674_100139424 Ga0070674_1001394242 235
38 3300005444 Ga0070694_100051631 Ga0070694_1000516312 235
39 3300005459 Ga0068867_100080672 Ga0068867_1000806722 235
40 3300005548 Ga0070665_100016328 Ga0070665_1000163286 235
41 3300005844 Ga0068862_100248914 Ga0068862_1002489142 235
42 3300006358 Ga0068871_100010044 Ga0068871_1000100448 235
43 3300006847 Ga0075431_100082230 Ga0075431_1000822302 235
44 3300006881 Ga0068865_100023794 Ga0068865_1000237945 235
45 3300006881 Ga0068865_100193892 Ga0068865_1001938922 235
46 3300009094 Ga0111539_10022355 Ga0111539_100223553 235
47 3300009098 Ga0105245_10419112 Ga0105245_104191122 235
48 3300013297 Ga0157378_10411257 Ga0157378_104112572 235
49 3300025899 Ga0207642_10040535 Ga0207642_100405352 235
50 3300025934 Ga0207686_10091048 Ga0207686_100910482 235
51 3300025941 Ga0207711_10576602 Ga0207711_105766021 235
52 3300025942 Ga0207689_10115149 Ga0207689_101151492 235
53 3300026089 Ga0207648_10102995 Ga0207648_101029952 235
54 3300026121 Ga0207683_10078856 Ga0207683_100788562 235
55 3300028380 Ga0268265_10038688 Ga0268265_100386883 235
56 3300035170 Ga0373943_0220576 Ga0373943_0220576_74_817 235
57 3300046684 Ga0495669_0013753 Ga0495669_0013753_835_1599 235
58 3300048907 Ga0496104_0179311 Ga0496104_0179311_212_967 235
59 3300048912 Ga0496109_0304142 Ga0496109_0304142_394_1149 235
60 3300050510 nmdc:mga06r32_63212_c1 nmdc:mga06r32_63212_c1_1407_2147 235
61 3300050511 nmdc:mga08y16_10460_c1 nmdc:mga08y16_10460_c1_2265_3005 235
62 3300006358 Ga0068871_100008186 Ga0068871_1000081862 236
63 3300006358 Ga0068871_100090873 Ga0068871_1000908732 236
64 3300007788 Ga0099795_10044070 Ga0099795_100440702 236
65 3300013297 Ga0157378_10058289 Ga0157378_100582893 236
66 3300014969 Ga0157376_10521425 Ga0157376_105214252 236
67 3300031691 Ga0316579_10037408 Ga0316579_100374082 236
68 3300031711 Ga0265314_10037448 Ga0265314_100374482 236
69 3300031995 Ga0307409_100142266 Ga0307409_1001422661 236
70 3300035398 Ga0316574_0049704 Ga0316574_0049704_1388_2146 236
71 3300046472 Ga0495580_0154759 Ga0495580_0154759_598_1350 236
72 3300049577 Ga0501041_0218489 Ga0501041_0218489_325_1071 236
73 3300049591 Ga0501075_0339000 Ga0501075_0339000_359_1105 236
74 3300049741 Ga0501079_0041256 Ga0501079_0041256_2777_3523 236
75 3300049743 Ga0501081_0554685 Ga0501081_0554685_29_775 236
76 3300050507 nmdc:mga05p37_78073_c1 nmdc:mga05p37_78073_c1_2066_2881 236
77 3300005293 Ga0065715_10051194 Ga0065715_100511941 237
78 3300005341 Ga0070691_10044437 Ga0070691_100444372 237
79 3300005345 Ga0070692_10027343 Ga0070692_100273432 237
80 3300005438 Ga0070701_10038327 Ga0070701_100383272 237
81 3300005440 Ga0070705_100000016 Ga0070705_10000001661 237
82 3300005440 Ga0070705_100007054 Ga0070705_1000070543 237
83 3300005444 Ga0070694_100000279 Ga0070694_1000002796 237
84 3300005445 Ga0070708_100267398 Ga0070708_1002673982 237
85 3300005458 Ga0070681_10138723 Ga0070681_101387232 237
86 3300005471 Ga0070698_100015072 Ga0070698_1000150728 237
87 3300005518 Ga0070699_100001370 Ga0070699_10000137013 237
88 3300005545 Ga0070695_100000061 Ga0070695_1000000618 237
89 3300005546 Ga0070696_100000571 Ga0070696_1000005716 237
90 3300005719 Ga0068861_100126847 Ga0068861_1001268472 237
91 3300006058 Ga0075432_10074504 Ga0075432_100745042 237
92 3300006844 Ga0075428_100022252 Ga0075428_1000222526 237
93 3300006844 Ga0075428_100053234 Ga0075428_1000532344 237
94 3300006846 Ga0075430_100000655 Ga0075430_1000006553 237
95 3300007076 Ga0075435_100369723 Ga0075435_1003697232 237
96 3300009094 Ga0111539_10683220 Ga0111539_106832202 237
97 3300009147 Ga0114129_10008621 Ga0114129_100086217 237
98 3300009147 Ga0114129_10116915 Ga0114129_101169153 237
99 3300009147 Ga0114129_10129796 Ga0114129_101297962 237
100 3300009148 Ga0105243_10781472 Ga0105243_107814721 237
101 3300009176 Ga0105242_10585001 Ga0105242_105850012 237
102 3300009176 Ga0105242_10645287 Ga0105242_106452871 237
103 3300013308 Ga0157375_10551188 Ga0157375_105511882 237
104 3300025934 Ga0207686_10376889 Ga0207686_103768891 237
105 3300025935 Ga0207709_10130829 Ga0207709_101308292 237
106 3300026118 Ga0207675_100061364 Ga0207675_1000613643 237
107 3300027907 Ga0207428_10428309 Ga0207428_104283092 237
108 3300031691 Ga0316579_10027907 Ga0316579_100279072 237
109 3300031727 Ga0316576_10002816 Ga0316576_100028166 237
110 3300035118 Ga0373954_0088662 Ga0373954_0088662_458_1240 237
111 3300035170 Ga0373943_0186533 Ga0373943_0186533_111_893 237
112 3300036647 Ga0316582_0033596 Ga0316582_0033596_1844_2590 237
113 3300036647 Ga0316582_0094238 Ga0316582_0094238_255_1001 237
114 3300042133 Ga0450896_027603 Ga0450896_027603_85_837 237
115 3300046454 Ga0495592_0147312 Ga0495592_0147312_757_1539 237
116 3300046477 Ga0495664_0206431 Ga0495664_0206431_385_1167 237
117 3300046491 Ga0495584_0164844 Ga0495584_0164844_38_787 237
118 3300046511 Ga0495608_0001856 Ga0495608_0001856_8162_8944 237
119 3300046517 Ga0495630_0003013 Ga0495630_0003013_6296_7078 237
120 3300046525 Ga0495663_0090808 Ga0495663_0090808_11_760 237
121 3300046528 Ga0495642_0004422 Ga0495642_0004422_1896_2645 237
122 3300046536 Ga0495587_0085683 Ga0495587_0085683_41_823 237
123 3300046539 Ga0495621_0162226 Ga0495621_0162226_19_768 237
124 3300046543 Ga0495645_0003630 Ga0495645_0003630_9559_10374 237
125 3300046559 Ga0495667_0023699 Ga0495667_0023699_262_1044 237
126 3300046678 Ga0495599_0100107 Ga0495599_0100107_224_1006 237
127 3300046684 Ga0495669_0096286 Ga0495669_0096286_80_829 237
128 3300046689 Ga0495613_0000599 Ga0495613_0000599_6114_6896 237
129 3300046809 Ga0495600_0003980 Ga0495600_0003980_613_1428 237
130 3300047317 Ga0495604_0014504 Ga0495604_0014504_3539_4354 237
131 3300047319 Ga0495674_0050049 Ga0495674_0050049_27_806 237
132 3300047447 Ga0495685_018711 Ga0495685_018711_999_1748 237
133 3300047471 Ga0495684_0000310 Ga0495684_0000310_21783_22598 237
134 3300049568 Ga0501031_0128708 Ga0501031_0128708_175_921 237
135 3300049572 Ga0501036_0096531 Ga0501036_0096531_176_925 237
136 3300049573 Ga0501037_0075725 Ga0501037_0075725_525_1274 237
137 3300049576 Ga0501040_0006548 Ga0501040_0006548_6587_7336 237
138 3300049578 Ga0501042_0022598 Ga0501042_0022598_1185_1934 237
139 3300049582 Ga0501048_0025224 Ga0501048_0025224_1909_2658 237
140 3300049587 Ga0501071_0026347 Ga0501071_0026347_1984_2730 237
141 3300049587 Ga0501071_0192236 Ga0501071_0192236_38_787 237
142 3300049588 Ga0501072_0022930 Ga0501072_0022930_1831_2580 237
143 3300049591 Ga0501075_0015936 Ga0501075_0015936_789_1538 237
144 3300049592 Ga0501076_0018379 Ga0501076_0018379_2169_2918 237
145 3300049593 Ga0501077_0120443 Ga0501077_0120443_126_875 237
146 3300049743 Ga0501081_0062692 Ga0501081_0062692_823_1572 237
147 3300049824 Ga0501045_0065071 Ga0501045_0065071_584_1333 237
148 3300049824 Ga0501045_0430481 Ga0501045_0430481_169_915 237
149 3300050507 nmdc:mga05p37_100630_c1 nmdc:mga05p37_100630_c1_2656_3405 237
150 3300050507 nmdc:mga05p37_135291_c1 nmdc:mga05p37_135291_c1_1334_2080 237
151 3300050507 nmdc:mga05p37_423797_c1 nmdc:mga05p37_423797_c1_246_992 237
152 3300050507 nmdc:mga05p37_478081_c1 nmdc:mga05p37_478081_c1_511_1260 237
153 3300050508 nmdc:mga09592_7328_c1 nmdc:mga09592_7328_c1_3383_4132 237
154 3300050508 nmdc:mga09592_99751_c1 nmdc:mga09592_99751_c1_385_1134 237
155 3300050509 nmdc:mga0qj67_3318_c1 nmdc:mga0qj67_3318_c1_430_1179 237
156 3300050511 nmdc:mga08y16_243215_c1 nmdc:mga08y16_243215_c1_255_1004 237
157 3300050515 nmdc:mga0a205_179962_c1 nmdc:mga0a205_179962_c1_1089_1838 237
158 3300053084 Ga0495595_0043128 Ga0495595_0043128_1049_1831 237
159 3300053085 Ga0495619_0008204 Ga0495619_0008204_468_1250 237
160 3300061734 Ga0530510_0006006 Ga0530510_0006006_3485_4234 237
161 3300003911 JGI25405J52794_10003721 JGI25405J52794_100037212 238
162 3300005289 Ga0065704_10170200 Ga0065704_101702001 238
163 3300005290 Ga0065712_10005714 Ga0065712_100057143 238
164 3300005290 Ga0065712_10088511 Ga0065712_100885112 238
165 3300005290 Ga0065712_10105799 Ga0065712_101057992 238
166 3300005293 Ga0065715_10007369 Ga0065715_100073692 238
167 3300005293 Ga0065715_10096409 Ga0065715_100964092 238
168 3300005295 Ga0065707_10002251 Ga0065707_100022512 238
169 3300005295 Ga0065707_10005235 Ga0065707_100052351 238
170 3300005295 Ga0065707_10085509 Ga0065707_100855095 238
171 3300005295 Ga0065707_10165513 Ga0065707_101655132 238
172 3300005328 Ga0070676_10006806 Ga0070676_100068063 238
173 3300005328 Ga0070676_10321649 Ga0070676_103216492 238
174 3300005329 Ga0070683_100006082 Ga0070683_1000060826 238
175 3300005329 Ga0070683_100121001 Ga0070683_1001210012 238
176 3300005329 Ga0070683_100165983 Ga0070683_1001659832 238
177 3300005330 Ga0070690_100029154 Ga0070690_1000291542 238
178 3300005330 Ga0070690_100109929 Ga0070690_1001099292 238
179 3300005331 Ga0070670_100003674 Ga0070670_1000036746 238
180 3300005331 Ga0070670_100056795 Ga0070670_1000567952 238
181 3300005331 Ga0070670_100178229 Ga0070670_1001782292 238
182 3300005333 Ga0070677_10031350 Ga0070677_100313502 238
183 3300005334 Ga0068869_100164778 Ga0068869_1001647782 238
184 3300005334 Ga0068869_100186928 Ga0068869_1001869282 238
185 3300005334 Ga0068869_100280438 Ga0068869_1002804382 238
186 3300005334 Ga0068869_100375534 Ga0068869_1003755342 238
187 3300005335 Ga0070666_10022440 Ga0070666_100224404 238
188 3300005335 Ga0070666_10039046 Ga0070666_100390462 238
189 3300005335 Ga0070666_10087282 Ga0070666_100872822 238
190 3300005338 Ga0068868_100025873 Ga0068868_1000258732 238
191 3300005338 Ga0068868_100028023 Ga0068868_1000280232 238
192 3300005338 Ga0068868_100241239 Ga0068868_1002412392 238
193 3300005340 Ga0070689_100005737 Ga0070689_1000057377 238
194 3300005340 Ga0070689_100008806 Ga0070689_1000088066 238
195 3300005340 Ga0070689_100009227 Ga0070689_1000092276 238
196 3300005340 Ga0070689_100011887 Ga0070689_1000118876 238
197 3300005343 Ga0070687_100062482 Ga0070687_1000624822 238
198 3300005343 Ga0070687_100161004 Ga0070687_1001610042 238
199 3300005344 Ga0070661_100016292 Ga0070661_1000162923 238
200 3300005344 Ga0070661_100499300 Ga0070661_1004993002 238
201 3300005347 Ga0070668_100295055 Ga0070668_1002950552 238
202 3300005353 Ga0070669_100002795 Ga0070669_1000027954 238
203 3300005353 Ga0070669_100009439 Ga0070669_1000094397 238
204 3300005353 Ga0070669_100131441 Ga0070669_1001314412 238
205 3300005353 Ga0070669_100216352 Ga0070669_1002163521 238
206 3300005354 Ga0070675_100001411 Ga0070675_10000141114 238
207 3300005354 Ga0070675_100014315 Ga0070675_1000143154 238
208 3300005354 Ga0070675_100038263 Ga0070675_1000382632 238
209 3300005354 Ga0070675_100144890 Ga0070675_1001448901 238
210 3300005354 Ga0070675_100166641 Ga0070675_1001666412 238
211 3300005354 Ga0070675_100204877 Ga0070675_1002048772 238
212 3300005354 Ga0070675_100339176 Ga0070675_1003391762 238
213 3300005355 Ga0070671_100061284 Ga0070671_1000612842 238
214 3300005355 Ga0070671_100150212 Ga0070671_1001502122 238
215 3300005355 Ga0070671_100280269 Ga0070671_1002802692 238
216 3300005356 Ga0070674_100014917 Ga0070674_1000149172 238
217 3300005356 Ga0070674_100020861 Ga0070674_1000208614 238
218 3300005356 Ga0070674_100026357 Ga0070674_1000263572 238
219 3300005356 Ga0070674_100035571 Ga0070674_1000355712 238
220 3300005356 Ga0070674_100138361 Ga0070674_1001383612 238
221 3300005364 Ga0070673_100006996 Ga0070673_1000069962 238
222 3300005364 Ga0070673_100011588 Ga0070673_1000115882 238
223 3300005364 Ga0070673_100012813 Ga0070673_1000128133 238
224 3300005364 Ga0070673_100069369 Ga0070673_1000693692 238
225 3300005364 Ga0070673_100090119 Ga0070673_1000901192 238
226 3300005364 Ga0070673_100389527 Ga0070673_1003895272 238
227 3300005365 Ga0070688_100068697 Ga0070688_1000686972 238
228 3300005366 Ga0070659_100074165 Ga0070659_1000741652 238
229 3300005367 Ga0070667_100042719 Ga0070667_1000427192 238
230 3300005367 Ga0070667_100138545 Ga0070667_1001385452 238
231 3300005367 Ga0070667_100167371 Ga0070667_1001673712 238
232 3300005367 Ga0070667_100466462 Ga0070667_1004664622 238
233 3300005434 Ga0070709_10093260 Ga0070709_100932602 238
234 3300005434 Ga0070709_10156519 Ga0070709_101565192 238
235 3300005436 Ga0070713_100010981 Ga0070713_1000109812 238
236 3300005438 Ga0070701_10007454 Ga0070701_100074544 238
237 3300005438 Ga0070701_10310978 Ga0070701_103109781 238
238 3300005440 Ga0070705_100012183 Ga0070705_1000121832 238
239 3300005440 Ga0070705_100022448 Ga0070705_1000224483 238
240 3300005440 Ga0070705_100162140 Ga0070705_1001621402 238
241 3300005440 Ga0070705_100240775 Ga0070705_1002407752 238
242 3300005440 Ga0070705_100284793 Ga0070705_1002847932 238
243 3300005441 Ga0070700_100014023 Ga0070700_1000140233 238
244 3300005441 Ga0070700_100020027 Ga0070700_1000200274 238
245 3300005441 Ga0070700_100025789 Ga0070700_1000257894 238
246 3300005441 Ga0070700_100143020 Ga0070700_1001430202 238
247 3300005441 Ga0070700_100282727 Ga0070700_1002827272 238
248 3300005441 Ga0070700_100501744 Ga0070700_1005017442 238
249 3300005444 Ga0070694_100054815 Ga0070694_1000548152 238
250 3300005444 Ga0070694_100080930 Ga0070694_1000809302 238
251 3300005444 Ga0070694_100112572 Ga0070694_1001125722 238
252 3300005445 Ga0070708_100255719 Ga0070708_1002557192 238
253 3300005445 Ga0070708_100317841 Ga0070708_1003178412 238
254 3300005445 Ga0070708_100467772 Ga0070708_1004677722 238
255 3300005456 Ga0070678_100022491 Ga0070678_1000224912 238
256 3300005456 Ga0070678_100252298 Ga0070678_1002522982 238
257 3300005457 Ga0070662_100040364 Ga0070662_1000403643 238
258 3300005457 Ga0070662_100152569 Ga0070662_1001525692 238
259 3300005459 Ga0068867_100002379 Ga0068867_10000237912 238
260 3300005459 Ga0068867_100024363 Ga0068867_1000243633 238
261 3300005459 Ga0068867_100050212 Ga0068867_1000502121 238
262 3300005459 Ga0068867_100860136 Ga0068867_1008601361 238
263 3300005466 Ga0070685_10010288 Ga0070685_100102882 238
264 3300005467 Ga0070706_100005121 Ga0070706_1000051218 238
265 3300005467 Ga0070706_100095894 Ga0070706_1000958942 238
266 3300005467 Ga0070706_100342967 Ga0070706_1003429672 238
267 3300005467 Ga0070706_100364722 Ga0070706_1003647222 238
268 3300005467 Ga0070706_100700205 Ga0070706_1007002051 238
269 3300005468 Ga0070707_100048133 Ga0070707_1000481332 238
270 3300005468 Ga0070707_100075269 Ga0070707_1000752693 238
271 3300005468 Ga0070707_100087606 Ga0070707_1000876061 238
272 3300005468 Ga0070707_100158438 Ga0070707_1001584382 238
273 3300005468 Ga0070707_100184718 Ga0070707_1001847182 238
274 3300005468 Ga0070707_100199012 Ga0070707_1001990121 238
275 3300005468 Ga0070707_100300530 Ga0070707_1003005302 238
276 3300005468 Ga0070707_100388790 Ga0070707_1003887902 238
277 3300005471 Ga0070698_100004889 Ga0070698_10000488910 238
278 3300005471 Ga0070698_100024325 Ga0070698_1000243252 238
279 3300005471 Ga0070698_100028123 Ga0070698_1000281234 238
280 3300005471 Ga0070698_100083790 Ga0070698_1000837902 238
281 3300005471 Ga0070698_100247228 Ga0070698_1002472282 238
282 3300005471 Ga0070698_100385143 Ga0070698_1003851432 238
283 3300005471 Ga0070698_100671570 Ga0070698_1006715702 238
284 3300005518 Ga0070699_100000388 Ga0070699_10000038839 238
285 3300005518 Ga0070699_100001651 Ga0070699_10000165112 238
286 3300005518 Ga0070699_100014128 Ga0070699_1000141283 238
287 3300005518 Ga0070699_100025124 Ga0070699_1000251244 238
288 3300005518 Ga0070699_100027914 Ga0070699_1000279142 238
289 3300005518 Ga0070699_100061496 Ga0070699_1000614962 238
290 3300005518 Ga0070699_100081764 Ga0070699_1000817642 238
291 3300005518 Ga0070699_100108356 Ga0070699_1001083562 238
292 3300005518 Ga0070699_100195297 Ga0070699_1001952972 238
293 3300005518 Ga0070699_100379626 Ga0070699_1003796262 238
294 3300005530 Ga0070679_100028536 Ga0070679_1000285366 238
295 3300005535 Ga0070684_100001607 Ga0070684_1000016076 238
296 3300005535 Ga0070684_100005752 Ga0070684_1000057527 238
297 3300005535 Ga0070684_100163975 Ga0070684_1001639752 238
298 3300005536 Ga0070697_100006069 Ga0070697_1000060693 238
299 3300005536 Ga0070697_100028711 Ga0070697_1000287113 238
300 3300005536 Ga0070697_100104650 Ga0070697_1001046502 238
301 3300005536 Ga0070697_100213299 Ga0070697_1002132992 238
302 3300005539 Ga0068853_100295519 Ga0068853_1002955192 238
303 3300005543 Ga0070672_100005758 Ga0070672_1000057587 238
304 3300005543 Ga0070672_100059416 Ga0070672_1000594162 238
305 3300005543 Ga0070672_100084165 Ga0070672_1000841652 238
306 3300005544 Ga0070686_100024077 Ga0070686_1000240772 238
307 3300005544 Ga0070686_100167871 Ga0070686_1001678712 238
308 3300005544 Ga0070686_100389065 Ga0070686_1003890652 238
309 3300005544 Ga0070686_100465093 Ga0070686_1004650932 238
310 3300005545 Ga0070695_100003902 Ga0070695_1000039027 238
311 3300005545 Ga0070695_100041240 Ga0070695_1000412402 238
312 3300005545 Ga0070695_100112542 Ga0070695_1001125422 238
313 3300005546 Ga0070696_100005465 Ga0070696_1000054653 238
314 3300005546 Ga0070696_100040027 Ga0070696_1000400273 238
315 3300005546 Ga0070696_100086982 Ga0070696_1000869822 238
316 3300005546 Ga0070696_100547662 Ga0070696_1005476621 238
317 3300005547 Ga0070693_100066041 Ga0070693_1000660412 238
318 3300005548 Ga0070665_100065573 Ga0070665_1000655732 238
319 3300005549 Ga0070704_100000718 Ga0070704_10000071814 238
320 3300005549 Ga0070704_100009228 Ga0070704_1000092284 238
321 3300005549 Ga0070704_100025085 Ga0070704_1000250851 238
322 3300005549 Ga0070704_100044405 Ga0070704_1000444052 238
323 3300005549 Ga0070704_100624956 Ga0070704_1006249562 238
324 3300005564 Ga0070664_100002520 Ga0070664_1000025209 238
325 3300005564 Ga0070664_100016849 Ga0070664_1000168494 238
326 3300005577 Ga0068857_100042312 Ga0068857_1000423122 238
327 3300005577 Ga0068857_100138987 Ga0068857_1001389872 238
328 3300005577 Ga0068857_100160805 Ga0068857_1001608052 238
329 3300005578 Ga0068854_100019045 Ga0068854_1000190452 238
330 3300005578 Ga0068854_100042743 Ga0068854_1000427432 238
331 3300005615 Ga0070702_100203421 Ga0070702_1002034212 238
332 3300005617 Ga0068859_100000940 Ga0068859_10000094011 238
333 3300005617 Ga0068859_100003972 Ga0068859_1000039729 238
334 3300005617 Ga0068859_100038713 Ga0068859_1000387132 238
335 3300005617 Ga0068859_100060701 Ga0068859_1000607012 238
336 3300005617 Ga0068859_100248282 Ga0068859_1002482822 238
337 3300005617 Ga0068859_100505346 Ga0068859_1005053462 238
338 3300005618 Ga0068864_100028303 Ga0068864_1000283032 238
339 3300005618 Ga0068864_100186160 Ga0068864_1001861602 238
340 3300005618 Ga0068864_100425635 Ga0068864_1004256352 238
341 3300005719 Ga0068861_100000753 Ga0068861_10000075317 238
342 3300005719 Ga0068861_100027954 Ga0068861_1000279542 238
343 3300005719 Ga0068861_100128155 Ga0068861_1001281552 238
344 3300005719 Ga0068861_100167648 Ga0068861_1001676482 238
345 3300005719 Ga0068861_100190742 Ga0068861_1001907422 238
346 3300005719 Ga0068861_100405535 Ga0068861_1004055352 238
347 3300005834 Ga0068851_10111766 Ga0068851_101117662 238
348 3300005840 Ga0068870_10014038 Ga0068870_100140382 238
349 3300005841 Ga0068863_100009319 Ga0068863_1000093192 238
350 3300005841 Ga0068863_100102559 Ga0068863_1001025592 238
351 3300005841 Ga0068863_100169327 Ga0068863_1001693272 238
352 3300005841 Ga0068863_100217153 Ga0068863_1002171532 238
353 3300005842 Ga0068858_100009204 Ga0068858_1000092046 238
354 3300005842 Ga0068858_100019683 Ga0068858_1000196837 238
355 3300005842 Ga0068858_100158144 Ga0068858_1001581442 238
356 3300005842 Ga0068858_100274625 Ga0068858_1002746252 238
357 3300005842 Ga0068858_100457983 Ga0068858_1004579832 238
358 3300005843 Ga0068860_100024357 Ga0068860_1000243575 238
359 3300005843 Ga0068860_100024428 Ga0068860_1000244282 238
360 3300005843 Ga0068860_100084499 Ga0068860_1000844992 238
361 3300005843 Ga0068860_100141468 Ga0068860_1001414682 238
362 3300005844 Ga0068862_100000612 Ga0068862_10000061211 238
363 3300005844 Ga0068862_100039204 Ga0068862_1000392042 238
364 3300005844 Ga0068862_100052619 Ga0068862_1000526193 238
365 3300005844 Ga0068862_100139194 Ga0068862_1001391942 238
366 3300005844 Ga0068862_100200359 Ga0068862_1002003592 238
367 3300005844 Ga0068862_100210502 Ga0068862_1002105021 238
368 3300005937 Ga0081455_10002517 Ga0081455_1000251712 238
369 3300005981 Ga0081538_10007747 Ga0081538_100077472 238
370 3300005983 Ga0081540_1015496 Ga0081540_10154962 238
371 3300005985 Ga0081539_10027639 Ga0081539_100276393 238
372 3300005985 Ga0081539_10052810 Ga0081539_100528103 238
373 3300006042 Ga0075368_10007051 Ga0075368_100070512 238
374 3300006042 Ga0075368_10009337 Ga0075368_100093372 238
375 3300006048 Ga0075363_100020050 Ga0075363_1000200502 238
376 3300006051 Ga0075364_10011053 Ga0075364_100110533 238
377 3300006051 Ga0075364_10047832 Ga0075364_100478322 238
378 3300006051 Ga0075364_10048544 Ga0075364_100485443 238
379 3300006051 Ga0075364_10132308 Ga0075364_101323082 238
380 3300006051 Ga0075364_10189464 Ga0075364_101894642 238
381 3300006173 Ga0070716_100170006 Ga0070716_1001700062 238
382 3300006177 Ga0075362_10000342 Ga0075362_100003423 238
383 3300006177 Ga0075362_10009532 Ga0075362_100095324 238
384 3300006178 Ga0075367_10002146 Ga0075367_100021464 238
385 3300006178 Ga0075367_10008454 Ga0075367_100084545 238
386 3300006178 Ga0075367_10014597 Ga0075367_100145974 238
387 3300006178 Ga0075367_10047450 Ga0075367_100474502 238
388 3300006195 Ga0075366_10001977 Ga0075366_100019777 238
389 3300006195 Ga0075366_10004267 Ga0075366_100042673 238
390 3300006237 Ga0097621_100044020 Ga0097621_1000440202 238
391 3300006237 Ga0097621_100050875 Ga0097621_1000508752 238
392 3300006237 Ga0097621_100268169 Ga0097621_1002681691 238
393 3300006237 Ga0097621_100361067 Ga0097621_1003610672 238
394 3300006237 Ga0097621_100507716 Ga0097621_1005077162 238
395 3300006353 Ga0075370_10008821 Ga0075370_100088212 238
396 3300006353 Ga0075370_10126123 Ga0075370_101261232 238
397 3300006358 Ga0068871_100012078 Ga0068871_1000120786 238
398 3300006358 Ga0068871_100093277 Ga0068871_1000932772 238
399 3300006358 Ga0068871_100246910 Ga0068871_1002469102 238
400 3300006844 Ga0075428_100000037 Ga0075428_10000003772 238
401 3300006844 Ga0075428_100000862 Ga0075428_10000086223 238
402 3300006844 Ga0075428_100011075 Ga0075428_10001107512 238
403 3300006844 Ga0075428_100013797 Ga0075428_1000137973 238
404 3300006844 Ga0075428_100028725 Ga0075428_1000287256 238
405 3300006844 Ga0075428_100079714 Ga0075428_1000797143 238
406 3300006844 Ga0075428_100081214 Ga0075428_1000812142 238
407 3300006844 Ga0075428_100084143 Ga0075428_1000841433 238
408 3300006844 Ga0075428_100135988 Ga0075428_1001359882 238
409 3300006844 Ga0075428_100180128 Ga0075428_1001801282 238
410 3300006844 Ga0075428_100316600 Ga0075428_1003166002 238
411 3300006844 Ga0075428_100333260 Ga0075428_1003332602 238
412 3300006844 Ga0075428_100599064 Ga0075428_1005990642 238
413 3300006846 Ga0075430_100095248 Ga0075430_1000952482 238
414 3300006846 Ga0075430_100099053 Ga0075430_1000990532 238
415 3300006846 Ga0075430_100131855 Ga0075430_1001318552 238
416 3300006846 Ga0075430_100155649 Ga0075430_1001556492 238
417 3300006846 Ga0075430_100220864 Ga0075430_1002208642 238
418 3300006846 Ga0075430_100229698 Ga0075430_1002296982 238
419 3300006847 Ga0075431_100012414 Ga0075431_1000124145 238
420 3300006847 Ga0075431_100046991 Ga0075431_1000469913 238
421 3300006847 Ga0075431_100073064 Ga0075431_1000730642 238
422 3300006847 Ga0075431_100096915 Ga0075431_1000969152 238
423 3300006847 Ga0075431_100110730 Ga0075431_1001107301 238
424 3300006852 Ga0075433_10007731 Ga0075433_100077317 238
425 3300006852 Ga0075433_10039242 Ga0075433_100392423 238
426 3300006852 Ga0075433_10052832 Ga0075433_100528323 238
427 3300006852 Ga0075433_10054439 Ga0075433_100544393 238
428 3300006852 Ga0075433_10057366 Ga0075433_100573662 238
429 3300006852 Ga0075433_10081956 Ga0075433_100819563 238
430 3300006852 Ga0075433_10155475 Ga0075433_101554752 238
431 3300006852 Ga0075433_10184022 Ga0075433_101840222 238
432 3300006852 Ga0075433_10260765 Ga0075433_102607652 238
433 3300006852 Ga0075433_10404294 Ga0075433_104042942 238
434 3300006852 Ga0075433_10412631 Ga0075433_104126312 238
435 3300006871 Ga0075434_100000019 Ga0075434_10000001940 238
436 3300006871 Ga0075434_100001168 Ga0075434_10000116812 238
437 3300006871 Ga0075434_100009596 Ga0075434_1000095967 238
438 3300006871 Ga0075434_100081191 Ga0075434_1000811912 238
439 3300006871 Ga0075434_100084276 Ga0075434_1000842763 238
440 3300006871 Ga0075434_100179364 Ga0075434_1001793642 238
441 3300006871 Ga0075434_100247819 Ga0075434_1002478192 238
442 3300006871 Ga0075434_100356718 Ga0075434_1003567182 238
443 3300006880 Ga0075429_100005390 Ga0075429_1000053905 238
444 3300006880 Ga0075429_100007476 Ga0075429_1000074761 238
445 3300006880 Ga0075429_100058680 Ga0075429_1000586803 238
446 3300006880 Ga0075429_100111123 Ga0075429_1001111232 238
447 3300006881 Ga0068865_100010101 Ga0068865_1000101014 238
448 3300006881 Ga0068865_100014003 Ga0068865_1000140035 238
449 3300006914 Ga0075436_100000160 Ga0075436_10000016015 238
450 3300006914 Ga0075436_100019245 Ga0075436_1000192454 238
451 3300006914 Ga0075436_100035724 Ga0075436_1000357242 238
452 3300006914 Ga0075436_100324167 Ga0075436_1003241671 238
453 3300006931 Ga0097620_100000940 Ga0097620_10000094011 238
454 3300006931 Ga0097620_100003972 Ga0097620_1000039729 238
455 3300006931 Ga0097620_100038715 Ga0097620_1000387153 238
456 3300006931 Ga0097620_100060700 Ga0097620_1000607002 238
457 3300006931 Ga0097620_100248275 Ga0097620_1002482751 238
458 3300006931 Ga0097620_100505408 Ga0097620_1005054082 238
459 3300007076 Ga0075435_100000041 Ga0075435_10000004118 238
460 3300007076 Ga0075435_100009005 Ga0075435_1000090053 238
461 3300007076 Ga0075435_100009374 Ga0075435_1000093747 238
462 3300007076 Ga0075435_100012805 Ga0075435_1000128052 238
463 3300007076 Ga0075435_100015015 Ga0075435_1000150153 238
464 3300007076 Ga0075435_100023820 Ga0075435_1000238204 238
465 3300007076 Ga0075435_100027371 Ga0075435_1000273712 238
466 3300007076 Ga0075435_100122061 Ga0075435_1001220612 238
467 3300009093 Ga0105240_10312044 Ga0105240_103120442 238
468 3300009093 Ga0105240_10376406 Ga0105240_103764062 238
469 3300009094 Ga0111539_10000009 Ga0111539_10000009212 238
470 3300009094 Ga0111539_10001537 Ga0111539_1000153715 238
471 3300009094 Ga0111539_10006768 Ga0111539_100067683 238
472 3300009094 Ga0111539_10008826 Ga0111539_100088269 238
473 3300009094 Ga0111539_10080387 Ga0111539_100803872 238
474 3300009094 Ga0111539_10155020 Ga0111539_101550202 238
475 3300009094 Ga0111539_10318443 Ga0111539_103184432 238
476 3300009094 Ga0111539_10390908 Ga0111539_103909082 238
477 3300009094 Ga0111539_10813561 Ga0111539_108135611 238
478 3300009098 Ga0105245_10037421 Ga0105245_100374212 238
479 3300009098 Ga0105245_10478930 Ga0105245_104789301 238
480 3300009098 Ga0105245_10588771 Ga0105245_105887712 238
481 3300009101 Ga0105247_10062558 Ga0105247_100625582 238
482 3300009147 Ga0114129_10001294 Ga0114129_100012942 238
483 3300009147 Ga0114129_10002457 Ga0114129_100024578 238
484 3300009147 Ga0114129_10006209 Ga0114129_100062096 238
485 3300009147 Ga0114129_10013305 Ga0114129_100133053 238
486 3300009147 Ga0114129_10022844 Ga0114129_100228445 238
487 3300009147 Ga0114129_10027092 Ga0114129_100270922 238
488 3300009147 Ga0114129_10028182 Ga0114129_100281822 238
489 3300009147 Ga0114129_10055196 Ga0114129_100551964 238
490 3300009147 Ga0114129_10062679 Ga0114129_100626792 238
491 3300009147 Ga0114129_10096224 Ga0114129_100962242 238
492 3300009147 Ga0114129_10101489 Ga0114129_101014892 238
493 3300009147 Ga0114129_10221239 Ga0114129_102212391 238
494 3300009147 Ga0114129_10240049 Ga0114129_102400492 238
495 3300009147 Ga0114129_10329959 Ga0114129_103299591 238
496 3300009147 Ga0114129_10412042 Ga0114129_104120422 238
497 3300009147 Ga0114129_10415252 Ga0114129_104152522 238
498 3300009147 Ga0114129_10629028 Ga0114129_106290282 238
499 3300009147 Ga0114129_10712688 Ga0114129_107126882 238
500 3300009147 Ga0114129_10863037 Ga0114129_108630372 238
501 3300009147 Ga0114129_11227867 Ga0114129_112278672 238
502 3300009148 Ga0105243_10255676 Ga0105243_102556762 238
503 3300009174 Ga0105241_10038324 Ga0105241_100383243 238
504 3300009174 Ga0105241_10053004 Ga0105241_100530044 238
505 3300009174 Ga0105241_10628713 Ga0105241_106287131 238
506 3300009176 Ga0105242_10016080 Ga0105242_100160804 238
507 3300009176 Ga0105242_10016312 Ga0105242_100163125 238
508 3300009176 Ga0105242_10018000 Ga0105242_100180005 238
509 3300009176 Ga0105242_10460910 Ga0105242_104609102 238
510 3300009177 Ga0105248_10031306 Ga0105248_100313065 238
511 3300009177 Ga0105248_10093562 Ga0105248_100935623 238
512 3300009177 Ga0105248_10139977 Ga0105248_101399772 238
513 3300009177 Ga0105248_10148033 Ga0105248_101480332 238
514 3300009177 Ga0105248_10243788 Ga0105248_102437882 238
515 3300009177 Ga0105248_10398371 Ga0105248_103983712 238
516 3300009177 Ga0105248_10412292 Ga0105248_104122922 238
517 3300009177 Ga0105248_10548766 Ga0105248_105487662 238
518 3300009551 Ga0105238_10736138 Ga0105238_107361382 238
519 3300009553 Ga0105249_10003036 Ga0105249_100030362 238
520 3300009553 Ga0105249_10022901 Ga0105249_100229012 238
521 3300009553 Ga0105249_10049361 Ga0105249_100493613 238
522 3300009553 Ga0105249_10131718 Ga0105249_101317182 238
523 3300009553 Ga0105249_10222121 Ga0105249_102221212 238
524 3300009553 Ga0105249_10314628 Ga0105249_103146282 238
525 3300009553 Ga0105249_10321939 Ga0105249_103219392 238
526 3300009553 Ga0105249_10524618 Ga0105249_105246182 238
527 3300013296 Ga0157374_10030945 Ga0157374_100309453 238
528 3300013296 Ga0157374_10225484 Ga0157374_102254842 238
529 3300013296 Ga0157374_10324324 Ga0157374_103243242 238
530 3300013297 Ga0157378_10080042 Ga0157378_100800422 238
531 3300013306 Ga0163162_10133984 Ga0163162_101339841 238
532 3300013306 Ga0163162_10152375 Ga0163162_101523752 238
533 3300013306 Ga0163162_10225525 Ga0163162_102255252 238
534 3300013308 Ga0157375_10084503 Ga0157375_100845033 238
535 3300013308 Ga0157375_10394347 Ga0157375_103943472 238
536 3300013308 Ga0157375_10404597 Ga0157375_104045971 238
537 3300013308 Ga0157375_10490619 Ga0157375_104906192 238
538 3300013308 Ga0157375_10907241 Ga0157375_109072412 238
539 3300014325 Ga0163163_10004353 Ga0163163_100043533 238
540 3300014325 Ga0163163_10149794 Ga0163163_101497942 238
541 3300014326 Ga0157380_10008295 Ga0157380_100082956 238
542 3300014326 Ga0157380_10019709 Ga0157380_100197093 238
543 3300014326 Ga0157380_10071434 Ga0157380_100714342 238
544 3300014326 Ga0157380_10076260 Ga0157380_100762602 238
545 3300014326 Ga0157380_10241933 Ga0157380_102419332 238
546 3300014968 Ga0157379_10026173 Ga0157379_100261732 238
547 3300014969 Ga0157376_10048399 Ga0157376_100483992 238
548 3300014969 Ga0157376_10420505 Ga0157376_104205052 238
549 3300025315 Ga0207697_10102455 Ga0207697_101024552 238
550 3300025321 Ga0207656_10077204 Ga0207656_100772042 238
551 3300025893 Ga0207682_10039732 Ga0207682_100397323 238
552 3300025893 Ga0207682_10136217 Ga0207682_101362172 238
553 3300025903 Ga0207680_10126590 Ga0207680_101265902 238
554 3300025906 Ga0207699_10141209 Ga0207699_101412092 238
555 3300025906 Ga0207699_10175738 Ga0207699_101757382 238
556 3300025907 Ga0207645_10032234 Ga0207645_100322342 238
557 3300025907 Ga0207645_10049279 Ga0207645_100492792 238
558 3300025907 Ga0207645_10087849 Ga0207645_100878492 238
559 3300025907 Ga0207645_10155466 Ga0207645_101554662 238
560 3300025907 Ga0207645_10215451 Ga0207645_102154512 238
561 3300025907 Ga0207645_10289435 Ga0207645_102894352 238
562 3300025908 Ga0207643_10021437 Ga0207643_100214372 238
563 3300025908 Ga0207643_10059667 Ga0207643_100596672 238
564 3300025910 Ga0207684_10002898 Ga0207684_100028989 238
565 3300025910 Ga0207684_10018006 Ga0207684_100180067 238
566 3300025910 Ga0207684_10107159 Ga0207684_101071592 238
567 3300025910 Ga0207684_10192771 Ga0207684_101927712 238
568 3300025910 Ga0207684_10293250 Ga0207684_102932502 238
569 3300025910 Ga0207684_10646670 Ga0207684_106466702 238
570 3300025911 Ga0207654_10041097 Ga0207654_100410972 238
571 3300025913 Ga0207695_10235075 Ga0207695_102350752 238
572 3300025917 Ga0207660_10117351 Ga0207660_101173512 238
573 3300025917 Ga0207660_10178651 Ga0207660_101786512 238
574 3300025917 Ga0207660_10351067 Ga0207660_103510672 238
575 3300025918 Ga0207662_10034224 Ga0207662_100342242 238
576 3300025918 Ga0207662_10080037 Ga0207662_100800372 238
577 3300025918 Ga0207662_10168725 Ga0207662_101687252 238
578 3300025920 Ga0207649_10017165 Ga0207649_100171652 238
579 3300025922 Ga0207646_10004695 Ga0207646_100046956 238
580 3300025922 Ga0207646_10017592 Ga0207646_100175926 238
581 3300025922 Ga0207646_10090244 Ga0207646_100902442 238
582 3300025922 Ga0207646_10112625 Ga0207646_101126252 238
583 3300025922 Ga0207646_10126651 Ga0207646_101266511 238
584 3300025922 Ga0207646_10229372 Ga0207646_102293722 238
585 3300025922 Ga0207646_10306821 Ga0207646_103068212 238
586 3300025922 Ga0207646_10327475 Ga0207646_103274751 238
587 3300025923 Ga0207681_10005037 Ga0207681_100050377 238
588 3300025923 Ga0207681_10017604 Ga0207681_100176042 238
589 3300025923 Ga0207681_10104669 Ga0207681_101046692 238
590 3300025923 Ga0207681_10201533 Ga0207681_102015332 238
591 3300025925 Ga0207650_10036705 Ga0207650_100367053 238
592 3300025925 Ga0207650_10110255 Ga0207650_101102551 238
593 3300025925 Ga0207650_10218717 Ga0207650_102187172 238
594 3300025926 Ga0207659_10000188 Ga0207659_1000018823 238
595 3300025926 Ga0207659_10014321 Ga0207659_100143212 238
596 3300025926 Ga0207659_10018680 Ga0207659_100186803 238
597 3300025926 Ga0207659_10134331 Ga0207659_101343312 238
598 3300025926 Ga0207659_10269349 Ga0207659_102693492 238
599 3300025926 Ga0207659_10355032 Ga0207659_103550322 238
600 3300025926 Ga0207659_10464624 Ga0207659_104646241 238
601 3300025927 Ga0207687_10022568 Ga0207687_100225683 238
602 3300025927 Ga0207687_10367888 Ga0207687_103678881 238
603 3300025928 Ga0207700_10008063 Ga0207700_100080634 238
604 3300025931 Ga0207644_10106522 Ga0207644_101065222 238
605 3300025932 Ga0207690_10027586 Ga0207690_100275863 238
606 3300025933 Ga0207706_10045956 Ga0207706_100459562 238
607 3300025933 Ga0207706_10087817 Ga0207706_100878172 238
608 3300025933 Ga0207706_10100969 Ga0207706_101009692 238
609 3300025933 Ga0207706_10203135 Ga0207706_102031352 238
610 3300025934 Ga0207686_10006180 Ga0207686_100061805 238
611 3300025935 Ga0207709_10313972 Ga0207709_103139721 238
612 3300025936 Ga0207670_10003997 Ga0207670_100039976 238
613 3300025936 Ga0207670_10009084 Ga0207670_100090842 238
614 3300025936 Ga0207670_10201744 Ga0207670_102017441 238
615 3300025937 Ga0207669_10006704 Ga0207669_100067042 238
616 3300025937 Ga0207669_10010515 Ga0207669_100105152 238
617 3300025937 Ga0207669_10013007 Ga0207669_100130074 238
618 3300025937 Ga0207669_10024631 Ga0207669_100246312 238
619 3300025938 Ga0207704_10135832 Ga0207704_101358322 238
620 3300025938 Ga0207704_10143235 Ga0207704_101432352 238
621 3300025940 Ga0207691_10006107 Ga0207691_100061075 238
622 3300025940 Ga0207691_10022906 Ga0207691_100229063 238
623 3300025940 Ga0207691_10063906 Ga0207691_100639063 238
624 3300025940 Ga0207691_10092316 Ga0207691_100923162 238
625 3300025940 Ga0207691_10113871 Ga0207691_101138712 238
626 3300025941 Ga0207711_10051889 Ga0207711_100518892 238
627 3300025941 Ga0207711_10188431 Ga0207711_101884312 238
628 3300025941 Ga0207711_10255968 Ga0207711_102559682 238
629 3300025942 Ga0207689_10017760 Ga0207689_100177602 238
630 3300025942 Ga0207689_10079510 Ga0207689_100795102 238
631 3300025942 Ga0207689_10083757 Ga0207689_100837572 238
632 3300025944 Ga0207661_10011215 Ga0207661_100112155 238
633 3300025944 Ga0207661_10156657 Ga0207661_101566572 238
634 3300025945 Ga0207679_10002659 Ga0207679_100026595 238
635 3300025945 Ga0207679_10124202 Ga0207679_101242022 238
636 3300025945 Ga0207679_10126194 Ga0207679_101261942 238
637 3300025945 Ga0207679_10363460 Ga0207679_103634602 238
638 3300025949 Ga0207667_10278442 Ga0207667_102784422 238
639 3300025960 Ga0207651_10023379 Ga0207651_100233792 238
640 3300025960 Ga0207651_10025902 Ga0207651_100259023 238
641 3300025960 Ga0207651_10052833 Ga0207651_100528332 238
642 3300025960 Ga0207651_10111975 Ga0207651_101119752 238
643 3300025960 Ga0207651_10195355 Ga0207651_101953552 238
644 3300025960 Ga0207651_10204382 Ga0207651_102043821 238
645 3300025960 Ga0207651_10268256 Ga0207651_102682562 238
646 3300025961 Ga0207712_10018953 Ga0207712_100189532 238
647 3300025961 Ga0207712_10088448 Ga0207712_100884482 238
648 3300025961 Ga0207712_10155321 Ga0207712_101553212 238
649 3300025961 Ga0207712_10453719 Ga0207712_104537192 238
650 3300025961 Ga0207712_10474054 Ga0207712_104740541 238
651 3300025972 Ga0207668_10063637 Ga0207668_100636371 238
652 3300025972 Ga0207668_10150746 Ga0207668_101507462 238
653 3300025972 Ga0207668_10185652 Ga0207668_101856522 238
654 3300025981 Ga0207640_10030010 Ga0207640_100300102 238
655 3300025981 Ga0207640_10037127 Ga0207640_100371273 238
656 3300025986 Ga0207658_10181141 Ga0207658_101811412 238
657 3300025986 Ga0207658_10226951 Ga0207658_102269512 238
658 3300025986 Ga0207658_10530718 Ga0207658_105307182 238
659 3300026023 Ga0207677_10017072 Ga0207677_100170722 238
660 3300026023 Ga0207677_10017810 Ga0207677_100178104 238
661 3300026023 Ga0207677_10249195 Ga0207677_102491952 238
662 3300026035 Ga0207703_10004262 Ga0207703_1000426211 238
663 3300026035 Ga0207703_10138768 Ga0207703_101387682 238
664 3300026035 Ga0207703_10230660 Ga0207703_102306602 238
665 3300026035 Ga0207703_10351998 Ga0207703_103519982 238
666 3300026067 Ga0207678_10015984 Ga0207678_100159846 238
667 3300026075 Ga0207708_10011404 Ga0207708_100114047 238
668 3300026075 Ga0207708_10016816 Ga0207708_100168165 238
669 3300026075 Ga0207708_10026800 Ga0207708_100268003 238
670 3300026075 Ga0207708_10033011 Ga0207708_100330115 238
671 3300026075 Ga0207708_10033034 Ga0207708_100330342 238
672 3300026075 Ga0207708_10050529 Ga0207708_100505292 238
673 3300026075 Ga0207708_10067724 Ga0207708_100677242 238
674 3300026075 Ga0207708_10091051 Ga0207708_100910512 238
675 3300026075 Ga0207708_10149787 Ga0207708_101497872 238
676 3300026088 Ga0207641_10207438 Ga0207641_102074381 238
677 3300026088 Ga0207641_10493090 Ga0207641_104930902 238
678 3300026089 Ga0207648_10001860 Ga0207648_100018607 238
679 3300026089 Ga0207648_10031489 Ga0207648_100314893 238
680 3300026089 Ga0207648_10050958 Ga0207648_100509583 238
681 3300026095 Ga0207676_10024049 Ga0207676_100240494 238
682 3300026095 Ga0207676_10027327 Ga0207676_100273272 238
683 3300026095 Ga0207676_10042656 Ga0207676_100426562 238
684 3300026095 Ga0207676_10069868 Ga0207676_100698682 238
685 3300026095 Ga0207676_10223604 Ga0207676_102236042 238
686 3300026116 Ga0207674_10023655 Ga0207674_100236552 238
687 3300026116 Ga0207674_10044046 Ga0207674_100440462 238
688 3300026116 Ga0207674_10052540 Ga0207674_100525402 238
689 3300026116 Ga0207674_10122262 Ga0207674_101222622 238
690 3300026116 Ga0207674_10161279 Ga0207674_101612792 238
691 3300026118 Ga0207675_100006022 Ga0207675_1000060224 238
692 3300026118 Ga0207675_100022659 Ga0207675_1000226594 238
693 3300026118 Ga0207675_100048529 Ga0207675_1000485292 238
694 3300026118 Ga0207675_100050645 Ga0207675_1000506452 238
695 3300026118 Ga0207675_100051051 Ga0207675_1000510513 238
696 3300026118 Ga0207675_100339845 Ga0207675_1003398452 238
697 3300026118 Ga0207675_100427718 Ga0207675_1004277182 238
698 3300026121 Ga0207683_10039938 Ga0207683_100399382 238
699 3300026121 Ga0207683_10053529 Ga0207683_100535292 238
700 3300026121 Ga0207683_10461497 Ga0207683_104614972 238
701 3300026142 Ga0207698_10360865 Ga0207698_103608652 238
702 3300027866 Ga0209813_10007956 Ga0209813_100079562 238
703 3300027876 Ga0209974_10086695 Ga0209974_100866952 238
704 3300027907 Ga0207428_10000005 Ga0207428_10000005414 238
705 3300027907 Ga0207428_10000963 Ga0207428_1000096330 238
706 3300027907 Ga0207428_10001556 Ga0207428_1000155612 238
707 3300027907 Ga0207428_10001740 Ga0207428_1000174019 238
708 3300027907 Ga0207428_10019076 Ga0207428_100190764 238
709 3300027907 Ga0207428_10217213 Ga0207428_102172132 238
710 3300028380 Ga0268265_10000183 Ga0268265_1000018364 238
711 3300028380 Ga0268265_10095582 Ga0268265_100955822 238
712 3300028380 Ga0268265_10223540 Ga0268265_102235402 238
713 3300028380 Ga0268265_10399988 Ga0268265_103999881 238
714 3300028381 Ga0268264_10006097 Ga0268264_100060976 238
715 3300028381 Ga0268264_10309429 Ga0268264_103094292 238
716 3300031727 Ga0316576_10276245 Ga0316576_102762451 238
717 3300031727 Ga0316576_10358649 Ga0316576_103586492 238
718 3300031852 Ga0307410_10304204 Ga0307410_103042042 238
719 3300031901 Ga0307406_10133876 Ga0307406_101338762 238
720 3300031903 Ga0307407_10215608 Ga0307407_102156081 238
721 3300031911 Ga0307412_10497176 Ga0307412_104971762 238
722 3300031995 Ga0307409_100056429 Ga0307409_1000564292 238
723 3300031995 Ga0307409_100149029 Ga0307409_1001490292 238
724 3300032002 Ga0307416_100025487 Ga0307416_1000254872 238
725 3300032002 Ga0307416_100102786 Ga0307416_1001027862 238
726 3300032005 Ga0307411_10110595 Ga0307411_101105952 238
727 3300032005 Ga0307411_10325373 Ga0307411_103253732 238
728 3300032126 Ga0307415_100222295 Ga0307415_1002222952 238
729 3300034816 Ga0373930_0011111 Ga0373930_0011111_433_1185 238
730 3300034819 Ga0373958_0012953 Ga0373958_0012953_23_775 238
731 3300034819 Ga0373958_0021785 Ga0373958_0021785_212_1024 238
732 3300035085 Ga0373929_0001104 Ga0373929_0001104_2853_3605 238
733 3300035088 Ga0373940_0000039 Ga0373940_0000039_2242_2994 238
734 3300035088 Ga0373940_0069588 Ga0373940_0069588_114_926 238
735 3300035090 Ga0373949_0001162 Ga0373949_0001162_2014_2766 238
736 3300035091 Ga0373951_0002100 Ga0373951_0002100_174_926 238
737 3300035112 Ga0373932_0002751 Ga0373932_0002751_1877_2629 238
738 3300035112 Ga0373932_0061243 Ga0373932_0061243_103_852 238
739 3300035114 Ga0373939_0000940 Ga0373939_0000940_2850_3602 238
740 3300035115 Ga0373941_0001349 Ga0373941_0001349_2291_3043 238
741 3300035116 Ga0373945_0037248 Ga0373945_0037248_651_1475 238
742 3300035119 Ga0373956_0084511 Ga0373956_0084511_340_1110 238
743 3300035121 Ga0373960_0001226 Ga0373960_0001226_2745_3497 238
744 3300035170 Ga0373943_0003982 Ga0373943_0003982_3750_4574 238
745 3300035171 Ga0373946_0008520 Ga0373946_0008520_2855_3679 238
746 3300035171 Ga0373946_0251858 Ga0373946_0251858_76_846 238
747 3300035172 Ga0373955_0074212 Ga0373955_0074212_924_1715 238
748 3300035172 Ga0373955_0075377 Ga0373955_0075377_717_1496 238
749 3300035207 Ga0373942_0000750 Ga0373942_0000750_2152_2904 238
750 3300035241 Ga0373961_0002991 Ga0373961_0002991_270_1022 238
751 3300035241 Ga0373961_0064211 Ga0373961_0064211_77_826 238
752 3300035242 Ga0373962_0000766 Ga0373962_0000766_1704_2456 238
753 3300035410 Ga0373924_0010419 Ga0373924_0010419_1504_2328 238
754 3300035410 Ga0373924_0121792 Ga0373924_0121792_83_853 238
755 3300035691 Ga0373931_0001453 Ga0373931_0001453_7451_8203 238
756 3300035691 Ga0373931_0065359 Ga0373931_0065359_226_975 238
757 3300035692 Ga0373935_0026673 Ga0373935_0026673_2655_3446 238
758 3300035692 Ga0373935_0261811 Ga0373935_0261811_332_1084 238
759 3300035695 Ga0373927_0031710 Ga0373927_0031710_271_1062 238
760 3300035724 Ga0373933_0024873 Ga0373933_0024873_1732_2511 238
761 3300035724 Ga0373933_0132775 Ga0373933_0132775_337_1089 238
762 3300036401 Ga0373937_0003122 Ga0373937_0003122_4633_5412 238
763 3300036401 Ga0373937_0031300 Ga0373937_0031300_213_965 238
764 3300036401 Ga0373937_0279887 Ga0373937_0279887_489_1259 238
765 3300036401 Ga0373937_0300272 Ga0373937_0300272_465_1217 238
766 3300036401 Ga0373937_0361320 Ga0373937_0361320_397_1194 238
767 3300037068 Ga0373925_0005452 Ga0373925_0005452_3634_4386 238
768 3300037068 Ga0373925_0196828 Ga0373925_0196828_508_1278 238
769 3300037068 Ga0373925_0455971 Ga0373925_0455971_115_867 238
770 3300039437 Ga0436365_0993952 Ga0436365_0993952_216_965 238
771 3300041410 Ga0439461_0008604 Ga0439461_0008604_924_1676 238
772 3300041999 Ga0439433_0007182 Ga0439433_0007182_1343_2095 238
773 3300042001 Ga0439441_048546 Ga0439441_048546_19_771 238
774 3300042004 Ga0439445_0041035 Ga0439445_0041035_396_1148 238
775 3300042122 Ga0450920_041037 Ga0450920_041037_48_833 238
776 3300042125 Ga0450923_003766 Ga0450923_003766_477_1229 238
777 3300042156 Ga0439446_0006628 Ga0439446_0006628_1250_2020 238
778 3300042156 Ga0439446_0009351 Ga0439446_0009351_155_907 238
779 3300042435 Ga0439434_0020742 Ga0439434_0020742_1200_1952 238
780 3300042435 Ga0439434_0024883 Ga0439434_0024883_38_802 238
781 3300042436 Ga0439435_0005134 Ga0439435_0005134_1717_2469 238
782 3300044712 Ga0453684_0066994 Ga0453684_0066994_2746_3498 238
783 3300044712 Ga0453684_0547163 Ga0453684_0547163_202_954 238
784 3300045051 Ga0451576_0002751 Ga0451576_0002751_22286_23038 238
785 3300045051 Ga0451576_0011011 Ga0451576_0011011_5393_6181 238
786 3300045051 Ga0451576_0035312 Ga0451576_0035312_101_913 238
787 3300045051 Ga0451576_0093800 Ga0451576_0093800_1577_2329 238
788 3300045051 Ga0451576_0289303 Ga0451576_0289303_183_935 238
789 3300045051 Ga0451576_0388698 Ga0451576_0388698_612_1400 238
790 3300046455 Ga0495603_0006665 Ga0495603_0006665_4547_5299 238
791 3300046459 Ga0495629_0001864 Ga0495629_0001864_7789_8541 238
792 3300046460 Ga0495638_0020091 Ga0495638_0020091_160_912 238
793 3300046462 Ga0495651_0124323 Ga0495651_0124323_817_1641 238
794 3300046462 Ga0495651_0188806 Ga0495651_0188806_153_905 238
795 3300046475 Ga0495639_0095330 Ga0495639_0095330_477_1229 238
796 3300046477 Ga0495664_0129466 Ga0495664_0129466_287_1057 238
797 3300046491 Ga0495584_0029632 Ga0495584_0029632_1865_2617 238
798 3300046499 Ga0495594_0050120 Ga0495594_0050120_554_1306 238
799 3300046516 Ga0495628_0053229 Ga0495628_0053229_682_1452 238
800 3300046523 Ga0495644_0039341 Ga0495644_0039341_559_1464 238
801 3300046528 Ga0495642_0098933 Ga0495642_0098933_393_1145 238
802 3300046529 Ga0495652_0354473 Ga0495652_0354473_36_827 238
803 3300046535 Ga0495586_0265383 Ga0495586_0265383_17_769 238
804 3300046537 Ga0495598_0003522 Ga0495598_0003522_492_1262 238
805 3300046537 Ga0495598_0012767 Ga0495598_0012767_534_1286 238
806 3300046538 Ga0495609_0049776 Ga0495609_0049776_456_1208 238
807 3300046538 Ga0495609_0196663 Ga0495609_0196663_19_771 238
808 3300046539 Ga0495621_0067618 Ga0495621_0067618_294_1046 238
809 3300046539 Ga0495621_0136917 Ga0495621_0136917_20_772 238
810 3300046543 Ga0495645_0011692 Ga0495645_0011692_602_1372 238
811 3300046543 Ga0495645_0206925 Ga0495645_0206925_152_904 238
812 3300046558 Ga0495633_0018672 Ga0495633_0018672_1586_2338 238
813 3300046615 Ga0495656_0017840 Ga0495656_0017840_723_1475 238
814 3300046615 Ga0495656_0058075 Ga0495656_0058075_70_864 238
815 3300046663 Ga0495635_0062022 Ga0495635_0062022_1446_2198 238
816 3300046663 Ga0495635_0150703 Ga0495635_0150703_710_1480 238
817 3300046664 Ga0495659_0010701 Ga0495659_0010701_583_1335 238
818 3300046664 Ga0495659_0013333 Ga0495659_0013333_1020_1832 238
819 3300046664 Ga0495659_0042079 Ga0495659_0042079_250_1020 238
820 3300046664 Ga0495659_0049722 Ga0495659_0049722_450_1202 238
821 3300046664 Ga0495659_0104522 Ga0495659_0104522_80_832 238
822 3300046674 Ga0495588_0024900 Ga0495588_0024900_487_1239 238
823 3300046678 Ga0495599_0039434 Ga0495599_0039434_1712_2482 238
824 3300046683 Ga0495658_0015799 Ga0495658_0015799_760_1512 238
825 3300046683 Ga0495658_0150951 Ga0495658_0150951_354_1124 238
826 3300046683 Ga0495658_0151640 Ga0495658_0151640_394_1218 238
827 3300046684 Ga0495669_0019300 Ga0495669_0019300_349_1101 238
828 3300046684 Ga0495669_0037536 Ga0495669_0037536_707_1459 238
829 3300046689 Ga0495613_0161684 Ga0495613_0161684_28_798 238
830 3300046689 Ga0495613_0267061 Ga0495613_0267061_303_1055 238
831 3300046809 Ga0495600_0063933 Ga0495600_0063933_1035_1805 238
832 3300047318 Ga0495636_0100582 Ga0495636_0100582_226_996 238
833 3300047319 Ga0495674_0074426 Ga0495674_0074426_588_1358 238
834 3300047320 Ga0495672_0001565 Ga0495672_0001565_18907_19668 238
835 3300047445 Ga0495677_0026679 Ga0495677_0026679_264_1016 238
836 3300047471 Ga0495684_0112833 Ga0495684_0112833_1179_1949 238
837 3300047471 Ga0495684_0146073 Ga0495684_0146073_639_1409 238
838 3300047471 Ga0495684_0352374 Ga0495684_0352374_13_810 238
839 3300048903 Ga0496100_0214982 Ga0496100_0214982_262_1014 238
840 3300048904 Ga0496101_0001671 Ga0496101_0001671_6170_6967 238
841 3300048905 Ga0496102_0032144 Ga0496102_0032144_2162_2914 238
842 3300048907 Ga0496104_0003276 Ga0496104_0003276_8988_9740 238
843 3300048907 Ga0496104_0088057 Ga0496104_0088057_809_1579 238
844 3300048908 Ga0496105_0045285 Ga0496105_0045285_2588_3340 238
845 3300048908 Ga0496105_0124553 Ga0496105_0124553_780_1550 238
846 3300048908 Ga0496105_0156700 Ga0496105_0156700_552_1349 238
847 3300048909 Ga0496106_0037860 Ga0496106_0037860_421_1173 238
848 3300048909 Ga0496106_0157814 Ga0496106_0157814_555_1352 238
849 3300048910 Ga0496107_0258932 Ga0496107_0258932_510_1262 238
850 3300048911 Ga0496108_0004502 Ga0496108_0004502_566_1318 238
851 3300048912 Ga0496109_0001333 Ga0496109_0001333_5713_6465 238
852 3300048913 Ga0496110_0001226 Ga0496110_0001226_112_864 238
853 3300048915 Ga0496112_0033138 Ga0496112_0033138_62_814 238
854 3300048915 Ga0496112_0414005 Ga0496112_0414005_47_838 238
855 3300048916 Ga0496113_0133691 Ga0496113_0133691_1155_1907 238
856 3300048917 Ga0496114_0001180 Ga0496114_0001180_17251_18048 238
857 3300048917 Ga0496114_0233106 Ga0496114_0233106_688_1440 238
858 3300048918 Ga0496115_0228113 Ga0496115_0228113_600_1370 238
859 3300049521 Ga0501298_006448 Ga0501298_006448_478_1233 238
860 3300049568 Ga0501031_0335599 Ga0501031_0335599_158_910 238
861 3300049569 Ga0501032_0395640 Ga0501032_0395640_70_822 238
862 3300049570 Ga0501033_0060564 Ga0501033_0060564_1584_2336 238
863 3300049571 Ga0501034_0004031 Ga0501034_0004031_5057_5809 238
864 3300049572 Ga0501036_0013404 Ga0501036_0013404_4292_5044 238
865 3300049572 Ga0501036_0063161 Ga0501036_0063161_147_899 238
866 3300049572 Ga0501036_0075501 Ga0501036_0075501_1582_2334 238
867 3300049574 Ga0501038_0043999 Ga0501038_0043999_55_849 238
868 3300049574 Ga0501038_0063821 Ga0501038_0063821_2093_2845 238
869 3300049574 Ga0501038_0160861 Ga0501038_0160861_499_1251 238
870 3300049575 Ga0501039_0111878 Ga0501039_0111878_256_1050 238
871 3300049575 Ga0501039_0158973 Ga0501039_0158973_705_1454 238
872 3300049575 Ga0501039_0170020 Ga0501039_0170020_118_870 238
873 3300049576 Ga0501040_0004377 Ga0501040_0004377_3850_4644 238
874 3300049576 Ga0501040_0033622 Ga0501040_0033622_2012_2764 238
875 3300049576 Ga0501040_0111652 Ga0501040_0111652_25_777 238
876 3300049576 Ga0501040_0130769 Ga0501040_0130769_412_1164 238
877 3300049577 Ga0501041_0047271 Ga0501041_0047271_964_1716 238
878 3300049577 Ga0501041_0162432 Ga0501041_0162432_245_994 238
879 3300049577 Ga0501041_0196082 Ga0501041_0196082_121_873 238
880 3300049578 Ga0501042_0315804 Ga0501042_0315804_63_815 238
881 3300049578 Ga0501042_0481416 Ga0501042_0481416_93_845 238
882 3300049579 Ga0501043_0112868 Ga0501043_0112868_198_992 238
883 3300049582 Ga0501048_0021740 Ga0501048_0021740_55_849 238
884 3300049582 Ga0501048_0031371 Ga0501048_0031371_1706_2458 238
885 3300049582 Ga0501048_0071723 Ga0501048_0071723_212_964 238
886 3300049582 Ga0501048_0212123 Ga0501048_0212123_156_908 238
887 3300049582 Ga0501048_0401835 Ga0501048_0401835_168_920 238
888 3300049583 Ga0501067_0285894 Ga0501067_0285894_67_858 238
889 3300049584 Ga0501068_0149337 Ga0501068_0149337_295_1089 238
890 3300049587 Ga0501071_0022159 Ga0501071_0022159_1756_2550 238
891 3300049587 Ga0501071_0037102 Ga0501071_0037102_1058_1810 238
892 3300049587 Ga0501071_0037251 Ga0501071_0037251_1777_2529 238
893 3300049587 Ga0501071_0521535 Ga0501071_0521535_39_788 238
894 3300049587 Ga0501071_0632167 Ga0501071_0632167_46_798 238
895 3300049588 Ga0501072_0007310 Ga0501072_0007310_4748_5500 238
896 3300049588 Ga0501072_0025475 Ga0501072_0025475_2312_3064 238
897 3300049588 Ga0501072_0264862 Ga0501072_0264862_66_818 238
898 3300049588 Ga0501072_0270104 Ga0501072_0270104_543_1295 238
899 3300049589 Ga0501073_0004289 Ga0501073_0004289_7724_8515 238
900 3300049589 Ga0501073_0045987 Ga0501073_0045987_1666_2418 238
901 3300049590 Ga0501074_0061265 Ga0501074_0061265_1480_2271 238
902 3300049590 Ga0501074_0149674 Ga0501074_0149674_495_1247 238
903 3300049590 Ga0501074_0178990 Ga0501074_0178990_677_1429 238
904 3300049591 Ga0501075_0010372 Ga0501075_0010372_1621_2415 238
905 3300049591 Ga0501075_0014416 Ga0501075_0014416_977_1777 238
906 3300049591 Ga0501075_0026624 Ga0501075_0026624_1773_2525 238
907 3300049591 Ga0501075_0027486 Ga0501075_0027486_3421_4173 238
908 3300049591 Ga0501075_0430463 Ga0501075_0430463_213_965 238
909 3300049592 Ga0501076_0008303 Ga0501076_0008303_4554_5306 238
910 3300049592 Ga0501076_0014435 Ga0501076_0014435_682_1476 238
911 3300049592 Ga0501076_0024644 Ga0501076_0024644_3081_3833 238
912 3300049592 Ga0501076_0033580 Ga0501076_0033580_1383_2135 238
913 3300049592 Ga0501076_0112103 Ga0501076_0112103_700_1452 238
914 3300049592 Ga0501076_0277677 Ga0501076_0277677_204_956 238
915 3300049592 Ga0501076_0558450 Ga0501076_0558450_39_791 238
916 3300049593 Ga0501077_0114031 Ga0501077_0114031_358_1107 238
917 3300049593 Ga0501077_0304536 Ga0501077_0304536_231_983 238
918 3300049741 Ga0501079_0039777 Ga0501079_0039777_70_864 238
919 3300049741 Ga0501079_0080999 Ga0501079_0080999_1112_1864 238
920 3300049741 Ga0501079_0117863 Ga0501079_0117863_468_1220 238
921 3300049741 Ga0501079_0309187 Ga0501079_0309187_449_1198 238
922 3300049741 Ga0501079_0401812 Ga0501079_0401812_152_904 238
923 3300049742 Ga0501080_0047614 Ga0501080_0047614_3159_3911 238
924 3300049742 Ga0501080_0753648 Ga0501080_0753648_74_823 238
925 3300049743 Ga0501081_0008536 Ga0501081_0008536_3281_4033 238
926 3300049743 Ga0501081_0009062 Ga0501081_0009062_3955_4749 238
927 3300049743 Ga0501081_0038621 Ga0501081_0038621_1951_2703 238
928 3300049743 Ga0501081_0059835 Ga0501081_0059835_792_1577 238
929 3300049743 Ga0501081_0223625 Ga0501081_0223625_424_1176 238
930 3300049743 Ga0501081_0415026 Ga0501081_0415026_18_770 238
931 3300049824 Ga0501045_0011826 Ga0501045_0011826_3094_3846 238
932 3300049824 Ga0501045_0018556 Ga0501045_0018556_3385_4137 238
933 3300049824 Ga0501045_0164990 Ga0501045_0164990_673_1467 238
934 3300049824 Ga0501045_0477941 Ga0501045_0477941_95_847 238
935 3300050489 nmdc:mga03683_3241_c1 nmdc:mga03683_3241_c1_2702_3484 238
936 3300050489 nmdc:mga03683_66316_c1 nmdc:mga03683_66316_c1_731_1483 238
937 3300050490 nmdc:mga03n38_220435_c1 nmdc:mga03n38_220435_c1_77_829 238
938 3300050491 nmdc:mga00v17_16883_c1 nmdc:mga00v17_16883_c1_2334_3116 238
939 3300050491 nmdc:mga00v17_171208_c1 nmdc:mga00v17_171208_c1_193_948 238
940 3300050491 nmdc:mga00v17_34078_c1 nmdc:mga00v17_34078_c1_1939_2691 238
941 3300050492 nmdc:mga0yw44_2299_c1 nmdc:mga0yw44_2299_c1_3145_3921 238
942 3300050492 nmdc:mga0yw44_497700_c1 nmdc:mga0yw44_497700_c1_18_800 238
943 3300050493 nmdc:mga0k408_28290_c2 nmdc:mga0k408_28290_c2_677_1429 238
944 3300050493 nmdc:mga0k408_4177_c1 nmdc:mga0k408_4177_c1_2127_2879 238
945 3300050494 nmdc:mga06z11_17737_c1 nmdc:mga06z11_17737_c1_1614_2366 238
946 3300050494 nmdc:mga06z11_3555_c1 nmdc:mga06z11_3555_c1_2351_3133 238
947 3300050494 nmdc:mga06z11_50315_c1 nmdc:mga06z11_50315_c1_1033_1785 238
948 3300050494 nmdc:mga06z11_5154_c1 nmdc:mga06z11_5154_c1_1112_1864 238
949 3300050494 nmdc:mga06z11_9088_c1 nmdc:mga06z11_9088_c1_2973_3725 238
950 3300050495 nmdc:mga04h51_9279_c1 nmdc:mga04h51_9279_c1_318_1100 238
951 3300050507 nmdc:mga05p37_130274_c1 nmdc:mga05p37_130274_c1_666_1418 238
952 3300050507 nmdc:mga05p37_134259_c1 nmdc:mga05p37_134259_c1_1401_2153 238
953 3300050507 nmdc:mga05p37_145751_c1 nmdc:mga05p37_145751_c1_1457_2206 238
954 3300050507 nmdc:mga05p37_165753_c1 nmdc:mga05p37_165753_c1_361_1110 238
955 3300050507 nmdc:mga05p37_1682_c1 nmdc:mga05p37_1682_c1_17515_18267 238
956 3300050507 nmdc:mga05p37_188854_c1 nmdc:mga05p37_188854_c1_321_1091 238
957 3300050507 nmdc:mga05p37_200646_c1 nmdc:mga05p37_200646_c1_646_1398 238
958 3300050507 nmdc:mga05p37_228487_c1 nmdc:mga05p37_228487_c1_1222_1974 238
959 3300050507 nmdc:mga05p37_22858_c1 nmdc:mga05p37_22858_c1_5452_6225 238
960 3300050507 nmdc:mga05p37_240985_c1 nmdc:mga05p37_240985_c1_829_1581 238
961 3300050507 nmdc:mga05p37_28735_c1 nmdc:mga05p37_28735_c1_1578_2327 238
962 3300050507 nmdc:mga05p37_367296_c1 nmdc:mga05p37_367296_c1_352_1104 238
963 3300050507 nmdc:mga05p37_40463_c1 nmdc:mga05p37_40463_c1_2984_3736 238
964 3300050507 nmdc:mga05p37_566944_c1 nmdc:mga05p37_566944_c1_303_1055 238
965 3300050507 nmdc:mga05p37_567032_c1 nmdc:mga05p37_567032_c1_289_1041 238
966 3300050507 nmdc:mga05p37_644_c1 nmdc:mga05p37_644_c1_358_1110 238
967 3300050507 nmdc:mga05p37_69333_c1 nmdc:mga05p37_69333_c1_3474_4226 238
968 3300050507 nmdc:mga05p37_81281_c1 nmdc:mga05p37_81281_c1_1774_2526 238
969 3300050507 nmdc:mga05p37_855548_c1 nmdc:mga05p37_855548_c1_205_957 238
970 3300050507 nmdc:mga05p37_86311_c1 nmdc:mga05p37_86311_c1_2615_3370 238
971 3300050508 nmdc:mga09592_113139_c1 nmdc:mga09592_113139_c1_404_1156 238
972 3300050508 nmdc:mga09592_304352_c1 nmdc:mga09592_304352_c1_571_1323 238
973 3300050508 nmdc:mga09592_314878_c1 nmdc:mga09592_314878_c1_488_1291 238
974 3300050508 nmdc:mga09592_40921_c1 nmdc:mga09592_40921_c1_1909_2658 238
975 3300050508 nmdc:mga09592_423364_c1 nmdc:mga09592_423364_c1_33_785 238
976 3300050508 nmdc:mga09592_4298_c1 nmdc:mga09592_4298_c1_1260_2012 238
977 3300050508 nmdc:mga09592_547400_c1 nmdc:mga09592_547400_c1_10_762 238
978 3300050509 nmdc:mga0qj67_144750_c1 nmdc:mga0qj67_144750_c1_58_807 238
979 3300050510 nmdc:mga06r32_107564_c1 nmdc:mga06r32_107564_c1_395_1147 238
980 3300050510 nmdc:mga06r32_15924_c1 nmdc:mga06r32_15924_c1_3659_4411 238
981 3300050510 nmdc:mga06r32_49931_c1 nmdc:mga06r32_49931_c1_3093_3845 238
982 3300050510 nmdc:mga06r32_603924_c1 nmdc:mga06r32_603924_c1_231_983 238
983 3300050510 nmdc:mga06r32_8083_c1 nmdc:mga06r32_8083_c1_2749_3501 238
984 3300050510 nmdc:mga06r32_95924_c1 nmdc:mga06r32_95924_c1_628_1380 238
985 3300050511 nmdc:mga08y16_104809_c1 nmdc:mga08y16_104809_c1_1242_1994 238
986 3300050511 nmdc:mga08y16_10929_c1 nmdc:mga08y16_10929_c1_13_801 238
987 3300050511 nmdc:mga08y16_155249_c1 nmdc:mga08y16_155249_c1_1531_2283 238
988 3300050511 nmdc:mga08y16_198729_c1 nmdc:mga08y16_198729_c1_115_909 238
989 3300050511 nmdc:mga08y16_244777_c1 nmdc:mga08y16_244777_c1_447_1196 238
990 3300050511 nmdc:mga08y16_39988_c1 nmdc:mga08y16_39988_c1_1474_2277 238
991 3300050511 nmdc:mga08y16_48405_c1 nmdc:mga08y16_48405_c1_2669_3421 238
992 3300050511 nmdc:mga08y16_6292_c1 nmdc:mga08y16_6292_c1_3459_4214 238
993 3300050511 nmdc:mga08y16_86790_c1 nmdc:mga08y16_86790_c1_1356_2147 238
994 3300050511 nmdc:mga08y16_932_c1 nmdc:mga08y16_932_c1_11444_12235 238
995 3300050511 nmdc:mga08y16_9_c1 nmdc:mga08y16_9_c1_41203_41955 238
996 3300050512 nmdc:mga0n895_102951_c1 nmdc:mga0n895_102951_c1_1589_2341 238
997 3300050512 nmdc:mga0n895_112926_c1 nmdc:mga0n895_112926_c1_1154_1906 238
998 3300050512 nmdc:mga0n895_138646_c1 nmdc:mga0n895_138646_c1_1420_2172 238
999 3300050512 nmdc:mga0n895_139651_c1 nmdc:mga0n895_139651_c1_688_1437 238
1000 3300050512 nmdc:mga0n895_151826_c1 nmdc:mga0n895_151826_c1_584_1354 238
1001 3300050512 nmdc:mga0n895_168218_c1 nmdc:mga0n895_168218_c1_1122_1880 238
1002 3300050512 nmdc:mga0n895_182632_c1 nmdc:mga0n895_182632_c1_81_833 238
1003 3300050512 nmdc:mga0n895_20798_c1 nmdc:mga0n895_20798_c1_1245_2033 238
1004 3300050512 nmdc:mga0n895_4406_c1 nmdc:mga0n895_4406_c1_284_1072 238
1005 3300050512 nmdc:mga0n895_52553_c1 nmdc:mga0n895_52553_c1_2768_3556 238
1006 3300050512 nmdc:mga0n895_691527_c1 nmdc:mga0n895_691527_c1_220_972 238
1007 3300050512 nmdc:mga0n895_700432_c1 nmdc:mga0n895_700432_c1_213_965 238
1008 3300050512 nmdc:mga0n895_81_c1 nmdc:mga0n895_81_c1_20918_21688 238
1009 3300050513 nmdc:mga0rr50_1_c1 nmdc:mga0rr50_1_c1_136053_136823 238
1010 3300050513 nmdc:mga0rr50_28641_c1 nmdc:mga0rr50_28641_c1_2685_3437 238
1011 3300050513 nmdc:mga0rr50_4248_c1 nmdc:mga0rr50_4248_c1_4294_5064 238
1012 3300050513 nmdc:mga0rr50_83187_c1 nmdc:mga0rr50_83187_c1_1594_2352 238
1013 3300050513 nmdc:mga0rr50_8895_c1 nmdc:mga0rr50_8895_c1_4186_4938 238
1014 3300050514 nmdc:mga08x19_181099_c1 nmdc:mga08x19_181099_c1_308_1078 238
1015 3300050514 nmdc:mga08x19_265_c1 nmdc:mga08x19_265_c1_19356_20126 238
1016 3300050514 nmdc:mga08x19_310417_c1 nmdc:mga08x19_310417_c1_116_868 238
1017 3300050514 nmdc:mga08x19_59349_c1 nmdc:mga08x19_59349_c1_1681_2451 238
1018 3300050514 nmdc:mga08x19_96849_c1 nmdc:mga08x19_96849_c1_650_1426 238
1019 3300050515 nmdc:mga0a205_115510_c1 nmdc:mga0a205_115510_c1_779_1531 238
1020 3300050515 nmdc:mga0a205_116830_c1 nmdc:mga0a205_116830_c1_1544_2293 238
1021 3300050515 nmdc:mga0a205_3136_c1 nmdc:mga0a205_3136_c1_3197_3949 238
1022 3300050515 nmdc:mga0a205_326970_c1 nmdc:mga0a205_326970_c1_178_930 238
1023 3300050515 nmdc:mga0a205_391940_c1 nmdc:mga0a205_391940_c1_480_1232 238
1024 3300050515 nmdc:mga0a205_456663_c1 nmdc:mga0a205_456663_c1_318_1118 238
1025 3300050515 nmdc:mga0a205_45943_c1 nmdc:mga0a205_45943_c1_1132_1920 238
1026 3300050515 nmdc:mga0a205_46215_c1 nmdc:mga0a205_46215_c1_3186_3938 238
1027 3300050515 nmdc:mga0a205_47513_c2 nmdc:mga0a205_47513_c2_186_974 238
1028 3300050515 nmdc:mga0a205_49528_c1 nmdc:mga0a205_49528_c1_1725_2504 238
1029 3300050515 nmdc:mga0a205_61542_c1 nmdc:mga0a205_61542_c1_189_941 238
1030 3300050516 nmdc:mga0sz30_68326_c1 nmdc:mga0sz30_68326_c1_513_1265 238
1031 3300053077 Ga0495601_0025172 Ga0495601_0025172_177_1010 238
1032 3300053077 Ga0495601_0058386 Ga0495601_0058386_284_1063 238
1033 3300053085 Ga0495619_0071124 Ga0495619_0071124_724_1494 238
1034 3300053090 Ga0500646_0081212 Ga0500646_0081212_19_771 238
1035 3300053103 Ga0500555_006197 Ga0500555_006197_635_1387 238
1036 3300054114 Ga0501084_0008116 Ga0501084_0008116_6489_7283 238
1037 3300054114 Ga0501084_0130496 Ga0501084_0130496_286_1038 238
1038 3300054114 Ga0501084_0161438 Ga0501084_0161438_69_821 238
1039 3300054114 Ga0501084_0216963 Ga0501084_0216963_837_1589 238
1040 3300054114 Ga0501084_0383980 Ga0501084_0383980_283_1032 238
1041 3300060353 Ga0501082_0015946 Ga0501082_0015946_5490_6284 238
1042 3300060353 Ga0501082_0024231 Ga0501082_0024231_3679_4431 238
1043 3300060353 Ga0501082_0030564 Ga0501082_0030564_3547_4299 238
1044 3300060353 Ga0501082_0089298 Ga0501082_0089298_1633_2385 238
1045 3300060353 Ga0501082_0291148 Ga0501082_0291148_137_886 238
1046 3300060353 Ga0501082_0317908 Ga0501082_0317908_340_1092 238
1047 3300060353 Ga0501082_0538040 Ga0501082_0538040_69_824 238
1048 3300061734 Ga0530510_0011471 Ga0530510_0011471_3495_4247 238
1049 3300061734 Ga0530510_0092624 Ga0530510_0092624_531_1283 238
1050 3300061734 Ga0530510_0157749 Ga0530510_0157749_472_1221 238

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

29

176

0.98

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

113

211

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rvc-assembly1.cif.gz_A structure of atp binding subunit of abc transporter 0.9368 1 226
7lkp-assembly1.cif.gz_A structure of atp-free human abca4 0.9353 2 211
7tbw-assembly1.cif.gz_A the structure of atp-bound abca1 0.9334 2 210
6cvl-assembly1.cif.gz_D crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein 0.9281 1 204
8edw-assembly1.cif.gz_A cryo-em structure of human abca7 in bpl/ch nanodiscs 0.927 2 210
ID Description Score Start End Superfamily
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9434 2 216 3.40.50.300
4rvcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9368 1 226 3.40.50.300
af_Q9VRG3_1356_1574_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9357 2 199 3.40.50.300
af_P0A9U1_321_563_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9348 2 215 3.40.50.300
af_P78363_1926_2175_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9344 2 216 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A523UXE7-F1-model_v4 ABC transporter ATP-binding protein 0.9743 1 229 GO:0005524
GO:0016887
AF-A0A351RT97-F1-model_v4 ABC transporter 0.9721 1 228 GO:0005524
GO:0016887
AF-Q2YZP3-F1-model_v4 Cytochrome c biogenesis ATP-binding export protein ccmA 0.9716 1 228 GO:0005524
GO:0016887
AF-A0A3E0NKL7-F1-model_v4 ABC transporter ATP-binding protein 0.9685 2 226 GO:0005524
GO:0016887
AF-A0A5C5YM13-F1-model_v4 Putative ABC transporter ATP-binding protein YbhF 0.9662 1 226 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
87.66 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map