F489054

General Info

Members Datasets Scaffolds Average Seq Length
1050 340 1047 241

Family's Representative Sequence

Representative Sequence 3300025935|Ga0207709_10032976|Ga0207709_100329764
Length 274
Sequence MLLDQAHQTVVDLTPDFARHHRFERRFGHFDGQVALVTGATRGIGRAIALALANAGADVIGTATTDEGAASITDCLRAAGGRGEGLRLDVRDGAAVDATLRDIESRHGPIAILVNNAGVTRDNLLVRMKDDDWDAIMATNLKPAFALAKGVLRGMMKARRGRIIQIGSVVGSSGNPGQTNYAAAKAALIGFTKSLALEVGSRDITVNCVAPGFVDTEMTQKLPQPQRDALLARIPLGRLGTPDDIANAVLFLASPRAGYITGATLHVNGGMLML

Samples

Sample ID Description Type Environment
1 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
2 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
3 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
123 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
124 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
197 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
198 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
199 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
200 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
201 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
202 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
203 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
204 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
205 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
206 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
207 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
208 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
209 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
210 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
211 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
212 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
213 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
214 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
215 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
216 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
217 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
218 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
219 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
220 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
221 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
222 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
223 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
224 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
225 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
226 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
227 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
228 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
229 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
230 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
231 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
232 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
233 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
234 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
235 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
236 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
237 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
238 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
239 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
240 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
241 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
242 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
243 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
244 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
245 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
246 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
247 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
248 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
249 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
250 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
251 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
252 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
253 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
254 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
255 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
256 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
257 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
258 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
259 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
260 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
261 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
262 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
263 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
264 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
265 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
266 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
267 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
268 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
269 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
270 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
271 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
272 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
273 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
274 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
275 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
276 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
277 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
278 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
279 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
280 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
281 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
282 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
283 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
284 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
285 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
286 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
287 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
288 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
289 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
290 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
291 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
292 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
293 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
294 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
295 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
296 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
309 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
310 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
311 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
312 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
313 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
314 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
315 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
316 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
317 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
318 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
319 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
320 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
321 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
322 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
325 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
326 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
327 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
328 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
329 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
330 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
331 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
332 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
333 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
334 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
335 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
336 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
337 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
338 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
339 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
340 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0.19
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.57
Nodule 0
Rhizoplane 4.48
Rhizosphere 93.05
Stem 0
Stem Tuber 0
Unclassified 1.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058863_11727546 3300004799 Bacteria 873
2 Ga0065715_10131453 3300005293 Bacteria 2007
3 Ga0065715_10199719 3300005293 Bacteria 1325
4 Ga0065715_10289579 3300005293 Bacteria 1066
5 Ga0065715_10313025 3300005293 Bacteria 1016
6 Ga0070658_10030721 3300005327 Bacteria 4315
7 Ga0070658_10036744 3300005327 Bacteria 3948
8 Ga0070658_10099113 3300005327 Bacteria 2408
9 Ga0070676_10009423 3300005328 Bacteria 5275
10 Ga0070676_10043387 3300005328 Bacteria 2614
11 Ga0070676_10061097 3300005328 Bacteria 2239
12 Ga0070676_10086000 3300005328 Bacteria 1917
13 Ga0070676_10190150 3300005328 Bacteria 1340
14 Ga0070683_100000103 3300005329 Bacteria 55332
15 Ga0070683_100003892 3300005329 Bacteria 12211
16 Ga0070683_100007321 3300005329 Bacteria 9319
17 Ga0070683_100016811 3300005329 Bacteria 6455
18 Ga0070683_100090357 3300005329 Bacteria 2875
19 Ga0070683_100523154 3300005329 Bacteria 1133
20 Ga0070690_100010236 3300005330 Bacteria 5451
21 Ga0070690_100051381 3300005330 Bacteria 2631
22 Ga0070690_100144819 3300005330 Bacteria 1615
23 Ga0070670_100000067 3300005331 Bacteria 107051
24 Ga0070670_100002410 3300005331 Bacteria 15422
25 Ga0070670_100006838 3300005331 Bacteria 9664
26 Ga0070670_100030395 3300005331 Bacteria 4651
27 Ga0070670_100059281 3300005331 Bacteria 3285
28 Ga0070670_100143517 3300005331 Bacteria 2065
29 Ga0070670_100177231 3300005331 Bacteria 1850
30 Ga0070670_100185117 3300005331 Bacteria 1808
31 Ga0070670_100233573 3300005331 Bacteria 1601
32 Ga0070670_100466707 3300005331 Bacteria 1120
33 Ga0070670_100537385 3300005331 Bacteria 1042
34 Ga0070677_10139765 3300005333 Bacteria 1115
35 Ga0068869_100001503 3300005334 Bacteria 13819
36 Ga0068869_100002596 3300005334 Bacteria 10912
37 Ga0068869_100240986 3300005334 Bacteria 1441
38 Ga0068869_100522555 3300005334 Bacteria 994
39 Ga0070666_10036930 3300005335 Bacteria 3246
40 Ga0070666_10066869 3300005335 Bacteria 2440
41 Ga0070666_10074739 3300005335 Bacteria 2310
42 Ga0070666_10159772 3300005335 Bacteria 1575
43 Ga0070666_10199825 3300005335 Bacteria 1406
44 Ga0070666_10247604 3300005335 Bacteria 1261
45 Ga0070666_10297375 3300005335 Bacteria 1149
46 Ga0070680_100010342 3300005336 Bacteria 7192
47 Ga0070680_100027651 3300005336 Bacteria 4543
48 Ga0070680_100085042 3300005336 Bacteria 2613
49 Ga0070680_100398658 3300005336 Bacteria 1173
50 Ga0070682_100000010 3300005337 Bacteria 280957
51 Ga0070682_100115728 3300005337 Bacteria 1793
52 Ga0068868_100000249 3300005338 Bacteria 36630
53 Ga0068868_100000558 3300005338 Bacteria 24973
54 Ga0068868_100035790 3300005338 Bacteria 3839
55 Ga0068868_100094582 3300005338 Bacteria 2411
56 Ga0068868_100378529 3300005338 Bacteria 1217
57 Ga0070660_100001424 3300005339 Bacteria 16292
58 Ga0070660_100014318 3300005339 Bacteria 5713
59 Ga0070660_100061388 3300005339 Bacteria 2918
60 Ga0070660_100066723 3300005339 Bacteria 2802
61 Ga0070660_100139432 3300005339 Bacteria 1944
62 Ga0070689_100003762 3300005340 Bacteria 10154
63 Ga0070689_100040781 3300005340 Bacteria 3560
64 Ga0070689_100069597 3300005340 Bacteria 2746
65 Ga0070689_100120693 3300005340 Bacteria 2093
66 Ga0070689_100131609 3300005340 Bacteria 2006
67 Ga0070689_100140224 3300005340 Bacteria 1944
68 Ga0070691_10016151 3300005341 Bacteria 3431
69 Ga0070691_10260118 3300005341 Bacteria 934
70 Ga0070687_100039069 3300005343 Bacteria 2382
71 Ga0070661_100000813 3300005344 Bacteria 22437
72 Ga0070661_100014481 3300005344 Bacteria 5556
73 Ga0070661_100035223 3300005344 Bacteria 3634
74 Ga0070661_100282494 3300005344 Bacteria 1288
75 Ga0070692_10078323 3300005345 Bacteria 1775
76 Ga0070668_100018243 3300005347 Bacteria 5265
77 Ga0070668_100020426 3300005347 Bacteria 4998
78 Ga0070668_100072726 3300005347 Bacteria 2679
79 Ga0070668_100089160 3300005347 Bacteria 2429
80 Ga0070668_100167689 3300005347 Bacteria 1786
81 Ga0070669_100009649 3300005353 Bacteria 6875
82 Ga0070669_100014658 3300005353 Bacteria 5580
83 Ga0070669_100018415 3300005353 Bacteria 4991
84 Ga0070669_100040387 3300005353 Bacteria 3391
85 Ga0070669_100054955 3300005353 Bacteria 2917
86 Ga0070669_100154226 3300005353 Bacteria 1780
87 Ga0070669_100160261 3300005353 Bacteria 1748
88 Ga0070669_100161997 3300005353 Bacteria 1739
89 Ga0070669_100290856 3300005353 Bacteria 1311
90 Ga0070669_100370318 3300005353 Bacteria 1167
91 Ga0070675_100000024 3300005354 Bacteria 117191
92 Ga0070675_100005401 3300005354 Bacteria 9769
93 Ga0070675_100022458 3300005354 Bacteria 5042
94 Ga0070675_100097323 3300005354 Bacteria 2474
95 Ga0070675_100198227 3300005354 Bacteria 1742
96 Ga0070675_100278424 3300005354 Bacteria 1469
97 Ga0070671_100004012 3300005355 Bacteria 11601
98 Ga0070671_100201322 3300005355 Bacteria 1688
99 Ga0070674_100003652 3300005356 Bacteria 8667
100 Ga0070674_100024606 3300005356 Bacteria 3910
101 Ga0070674_100045494 3300005356 Bacteria 2999
102 Ga0070674_100071548 3300005356 Bacteria 2453
103 Ga0070674_100206600 3300005356 Bacteria 1520
104 Ga0070674_100270495 3300005356 Bacteria 1343
105 Ga0070673_100010272 3300005364 Bacteria 6330
106 Ga0070673_100028043 3300005364 Bacteria 4182
107 Ga0070673_100033153 3300005364 Bacteria 3895
108 Ga0070673_100095905 3300005364 Bacteria 2433
109 Ga0070673_100102714 3300005364 Bacteria 2357
110 Ga0070673_100126635 3300005364 Bacteria 2138
111 Ga0070673_100166618 3300005364 Bacteria 1878
112 Ga0070673_100254886 3300005364 Bacteria 1531
113 Ga0070688_100015314 3300005365 Bacteria 4360
114 Ga0070688_100090761 3300005365 Bacteria 1996
115 Ga0070688_100193180 3300005365 Bacteria 1419
116 Ga0070688_100356666 3300005365 Bacteria 1072
117 Ga0070688_100421906 3300005365 Bacteria 992
118 Ga0070659_100002336 3300005366 Bacteria 13495
119 Ga0070659_100018516 3300005366 Bacteria 5254
120 Ga0070659_100030277 3300005366 Bacteria 4188
121 Ga0070659_100058644 3300005366 Bacteria 3038
122 Ga0070659_100114770 3300005366 Bacteria 2176
123 Ga0070659_100164043 3300005366 Bacteria 1818
124 Ga0070667_100006047 3300005367 Bacteria 10053
125 Ga0070667_100031487 3300005367 Bacteria 4422
126 Ga0070667_100053230 3300005367 Bacteria 3416
127 Ga0070667_100168212 3300005367 Bacteria 1934
128 Ga0070667_100428952 3300005367 Bacteria 1206
129 Ga0070667_100812854 3300005367 Bacteria 868
130 Ga0070709_10236003 3300005434 Bacteria 1311
131 Ga0070709_10555411 3300005434 Bacteria 879
132 Ga0070714_100156608 3300005435 Bacteria 2057
133 Ga0070714_100320031 3300005435 Bacteria 1450
134 Ga0070713_100017090 3300005436 Bacteria 5475
135 Ga0070713_100212468 3300005436 Bacteria 1752
136 Ga0070701_10000046 3300005438 Bacteria 31405
137 Ga0070701_10063976 3300005438 Bacteria 1948
138 Ga0070701_10341148 3300005438 Bacteria 933
139 Ga0070711_100320137 3300005439 Bacteria 1239
140 Ga0070705_100008967 3300005440 Bacteria 4962
141 Ga0070705_100070152 3300005440 Bacteria 2116
142 Ga0070705_100288396 3300005440 Bacteria 1170
143 Ga0070700_100000002 3300005441 Bacteria 261904
144 Ga0070700_100140371 3300005441 Bacteria 1641
145 Ga0070694_100088039 3300005444 Bacteria 2173
146 Ga0070694_100129220 3300005444 Bacteria 1823
147 Ga0070708_100004030 3300005445 Bacteria 11541
148 Ga0070663_100067580 3300005455 Bacteria 2593
149 Ga0070678_100029651 3300005456 Bacteria 3750
150 Ga0070678_100172994 3300005456 Bacteria 1761
151 Ga0070678_100206274 3300005456 Bacteria 1625
152 Ga0070678_100416255 3300005456 Bacteria 1170
153 Ga0070678_100630479 3300005456 Bacteria 960
154 Ga0070662_100001043 3300005457 Bacteria 16937
155 Ga0070681_10012786 3300005458 Bacteria 8331
156 Ga0070681_10202495 3300005458 Bacteria 1903
157 Ga0070681_10210485 3300005458 Bacteria 1860
158 Ga0070681_10236600 3300005458 Bacteria 1740
159 Ga0070681_10349633 3300005458 Bacteria 1388
160 Ga0068867_100005228 3300005459 Bacteria 9159
161 Ga0068867_100009941 3300005459 Bacteria 6702
162 Ga0068867_100034852 3300005459 Bacteria 3649
163 Ga0068867_100065639 3300005459 Bacteria 2701
164 Ga0068867_100351233 3300005459 Bacteria 1230
165 Ga0070685_10052729 3300005466 Bacteria 2354
166 Ga0070685_10102132 3300005466 Bacteria 1753
167 Ga0070706_100008767 3300005467 Bacteria 9423
168 Ga0070707_100673925 3300005468 Bacteria 997
169 Ga0070698_100196617 3300005471 Bacteria 1953
170 Ga0070699_100029308 3300005518 Bacteria 4745
171 Ga0070699_100097321 3300005518 Bacteria 2578
172 Ga0070699_100420738 3300005518 Bacteria 1209
173 Ga0070679_100010882 3300005530 Bacteria 8642
174 Ga0070679_100092060 3300005530 Bacteria 3020
175 Ga0070684_100000272 3300005535 Bacteria 35847
176 Ga0070684_100003202 3300005535 Bacteria 12240
177 Ga0070684_100005117 3300005535 Bacteria 10018
178 Ga0070684_100031500 3300005535 Bacteria 4515
179 Ga0070684_100301319 3300005535 Bacteria 1471
180 Ga0070697_100051373 3300005536 Bacteria 3349
181 Ga0068853_100004333 3300005539 Bacteria 10977
182 Ga0068853_100007729 3300005539 Bacteria 8622
183 Ga0068853_100021278 3300005539 Bacteria 5405
184 Ga0068853_100029977 3300005539 Bacteria 4592
185 Ga0068853_100265985 3300005539 Bacteria 1578
186 Ga0070672_100000697 3300005543 Bacteria 19893
187 Ga0070672_100004237 3300005543 Bacteria 9375
188 Ga0070672_100154318 3300005543 Bacteria 1901
189 Ga0070672_100336758 3300005543 Bacteria 1284
190 Ga0070686_100002492 3300005544 Bacteria 10135
191 Ga0070686_100075171 3300005544 Bacteria 2222
192 Ga0070686_100139275 3300005544 Bacteria 1687
193 Ga0070686_100384271 3300005544 Bacteria 1063
194 Ga0070695_100012541 3300005545 Bacteria 5088
195 Ga0070695_100063286 3300005545 Bacteria 2404
196 Ga0070696_100035542 3300005546 Bacteria 3431
197 Ga0070696_100151782 3300005546 Bacteria 1701
198 Ga0070696_100383092 3300005546 Bacteria 1096
199 Ga0070693_100179540 3300005547 Bacteria 1362
200 Ga0070693_100231999 3300005547 Bacteria 1215
201 Ga0070665_100001511 3300005548 Bacteria 27024
202 Ga0070665_100008939 3300005548 Bacteria 10151
203 Ga0070665_100126978 3300005548 Bacteria 2553
204 Ga0070704_100024190 3300005549 Bacteria 3982
205 Ga0070704_100143459 3300005549 Bacteria 1868
206 Ga0068855_100002546 3300005563 Bacteria 22453
207 Ga0068855_100008719 3300005563 Bacteria 12260
208 Ga0068855_100105409 3300005563 Bacteria 3242
209 Ga0068855_100268303 3300005563 Bacteria 1899
210 Ga0068855_100349002 3300005563 Bacteria 1630
211 Ga0068855_100430592 3300005563 Bacteria 1442
212 Ga0070664_100001257 3300005564 Bacteria 20297
213 Ga0070664_100004690 3300005564 Bacteria 10963
214 Ga0070664_100014812 3300005564 Bacteria 6365
215 Ga0070664_100015808 3300005564 Bacteria 6176
216 Ga0070664_100019041 3300005564 Bacteria 5645
217 Ga0070664_100103541 3300005564 Bacteria 2478
218 Ga0070664_100142498 3300005564 Bacteria 2111
219 Ga0070664_100194501 3300005564 Bacteria 1808
220 Ga0070664_100204324 3300005564 Bacteria 1764
221 Ga0070664_100237840 3300005564 Bacteria 1634
222 Ga0070664_100780665 3300005564 Bacteria 893
223 Ga0068857_100004656 3300005577 Bacteria 11621
224 Ga0068857_100006850 3300005577 Bacteria 9807
225 Ga0068857_100049665 3300005577 Bacteria 3722
226 Ga0068857_100127435 3300005577 Bacteria 2294
227 Ga0068854_100005152 3300005578 Bacteria 8239
228 Ga0068854_100006351 3300005578 Bacteria 7516
229 Ga0068854_100012221 3300005578 Bacteria 5618
230 Ga0068854_100081015 3300005578 Bacteria 2397
231 Ga0068854_100097336 3300005578 Bacteria 2200
232 Ga0068856_100001602 3300005614 Bacteria 23652
233 Ga0068856_100016323 3300005614 Bacteria 7186
234 Ga0068856_100039285 3300005614 Bacteria 4646
235 Ga0068856_100040533 3300005614 Bacteria 4575
236 Ga0068856_100164239 3300005614 Bacteria 2231
237 Ga0070702_100003512 3300005615 Bacteria 7023
238 Ga0070702_100078567 3300005615 Bacteria 1970
239 Ga0070702_100263541 3300005615 Bacteria 1174
240 Ga0068852_100001206 3300005616 Bacteria 17155
241 Ga0068852_100002065 3300005616 Bacteria 13708
242 Ga0068852_100062049 3300005616 Bacteria 3250
243 Ga0068859_100008168 3300005617 Bacteria 10619
244 Ga0068859_100095758 3300005617 Bacteria 3021
245 Ga0068859_100112325 3300005617 Bacteria 2788
246 Ga0068859_100191464 3300005617 Bacteria 2130
247 Ga0068859_100760190 3300005617 Bacteria 1058
248 Ga0068864_100000008 3300005618 Bacteria 390035
249 Ga0068864_100000456 3300005618 Bacteria 35356
250 Ga0068864_100003435 3300005618 Bacteria 13101
251 Ga0068866_10023053 3300005718 Bacteria 2890
252 Ga0068861_100023402 3300005719 Bacteria 4454
253 Ga0068861_100062251 3300005719 Bacteria 2866
254 Ga0068861_100409636 3300005719 Bacteria 1205
255 Ga0068861_100540080 3300005719 Bacteria 1060
256 Ga0068851_10003695 3300005834 Bacteria 6833
257 Ga0068851_10007447 3300005834 Bacteria 5026
258 Ga0068851_10105317 3300005834 Bacteria 1501
259 Ga0068851_10283666 3300005834 Bacteria 948
260 Ga0068870_10006057 3300005840 Bacteria 5313
261 Ga0068870_10012623 3300005840 Bacteria 3951
262 Ga0068870_10015161 3300005840 Bacteria 3652
263 Ga0068870_10211757 3300005840 Bacteria 1181
264 Ga0068870_10424111 3300005840 Bacteria 871
265 Ga0068863_100013369 3300005841 Bacteria 7914
266 Ga0068863_100039196 3300005841 Bacteria 4508
267 Ga0068863_100078037 3300005841 Bacteria 3135
268 Ga0068863_100082598 3300005841 Bacteria 3045
269 Ga0068863_100090613 3300005841 Bacteria 2899
270 Ga0068863_100271052 3300005841 Bacteria 1643
271 Ga0068863_100389847 3300005841 Bacteria 1361
272 Ga0068863_100433795 3300005841 Bacteria 1288
273 Ga0068863_100528436 3300005841 Bacteria 1163
274 Ga0068858_100000518 3300005842 Bacteria 40503
275 Ga0068858_100008910 3300005842 Bacteria 9618
276 Ga0068858_100035200 3300005842 Bacteria 4644
277 Ga0068858_100059594 3300005842 Bacteria 3528
278 Ga0068858_100060821 3300005842 Bacteria 3491
279 Ga0068858_100233860 3300005842 Bacteria 1743
280 Ga0068858_100378784 3300005842 Bacteria 1358
281 Ga0068858_100532851 3300005842 Bacteria 1136
282 Ga0068858_100671672 3300005842 Bacteria 1007
283 Ga0068860_100008086 3300005843 Bacteria 10474
284 Ga0068860_100066331 3300005843 Bacteria 3428
285 Ga0068860_100072839 3300005843 Bacteria 3265
286 Ga0068860_100073073 3300005843 Bacteria 3260
287 Ga0068860_100076833 3300005843 Bacteria 3175
288 Ga0068860_100104511 3300005843 Bacteria 2704
289 Ga0068860_100109492 3300005843 Bacteria 2640
290 Ga0068860_100155186 3300005843 Bacteria 2206
291 Ga0068860_100159852 3300005843 Bacteria 2172
292 Ga0068860_100216873 3300005843 Bacteria 1857
293 Ga0068860_100620822 3300005843 Bacteria 1087
294 Ga0068862_100035873 3300005844 Bacteria 4201
295 Ga0068862_100098405 3300005844 Bacteria 2555
296 Ga0068862_100100687 3300005844 Bacteria 2527
297 Ga0068862_100130380 3300005844 Bacteria 2223
298 Ga0068862_100147463 3300005844 Bacteria 2092
299 Ga0068862_100716574 3300005844 Bacteria 970
300 Ga0070717_10000173 3300006028 Bacteria 48151
301 Ga0075365_10027146 3300006038 Bacteria 3640
302 Ga0070716_100053080 3300006173 Bacteria 2310
303 Ga0070712_100082736 3300006175 Bacteria 2329
304 Ga0070712_100440612 3300006175 Bacteria 1083
305 Ga0097621_100143559 3300006237 Bacteria 2042
306 Ga0097621_100237521 3300006237 Bacteria 1592
307 Ga0097621_100383543 3300006237 Bacteria 1256
308 Ga0097621_100394255 3300006237 Bacteria 1238
309 Ga0097621_100584032 3300006237 Bacteria 1020
310 Ga0097621_100690649 3300006237 Bacteria 939
311 Ga0068871_100098921 3300006358 Bacteria 2441
312 Ga0068871_100388610 3300006358 Bacteria 1241
313 Ga0068871_100460687 3300006358 Bacteria 1141
314 Ga0068871_100565834 3300006358 Bacteria 1031
315 Ga0075428_100000766 3300006844 Bacteria 33418
316 Ga0075428_100032301 3300006844 Bacteria 5781
317 Ga0075428_100372954 3300006844 Bacteria 1530
318 Ga0075431_100071048 3300006847 Bacteria 3591
319 Ga0075431_100458835 3300006847 Bacteria 1269
320 Ga0075433_10000591 3300006852 Bacteria 24054
321 Ga0075433_10019284 3300006852 Bacteria 5681
322 Ga0075433_10026331 3300006852 Bacteria 4923
323 Ga0075433_10105430 3300006852 Bacteria 2498
324 Ga0075434_100000646 3300006871 Bacteria 26961
325 Ga0075434_100007152 3300006871 Bacteria 10318
326 Ga0075434_100107638 3300006871 Bacteria 2798
327 Ga0075434_100316128 3300006871 Bacteria 1582
328 Ga0075434_100360792 3300006871 Bacteria 1474
329 Ga0075434_100387945 3300006871 Bacteria 1418
330 Ga0075434_100390397 3300006871 Bacteria 1413
331 Ga0075434_100483855 3300006871 Bacteria 1259
332 Ga0075429_100026441 3300006880 Bacteria 5038
333 Ga0068865_100038656 3300006881 Bacteria 3231
334 Ga0068865_100070463 3300006881 Bacteria 2477
335 Ga0068865_100417660 3300006881 Bacteria 1102
336 Ga0075436_100004991 3300006914 Bacteria 9117
337 Ga0075436_100023587 3300006914 Bacteria 4226
338 Ga0075436_100061454 3300006914 Bacteria 2595
339 Ga0075436_100175483 3300006914 Bacteria 1513
340 Ga0097620_100008167 3300006931 Bacteria 10619
341 Ga0097620_100050245 3300006931 Bacteria 4189
342 Ga0097620_100095749 3300006931 Bacteria 3021
343 Ga0097620_100112323 3300006931 Bacteria 2788
344 Ga0097620_100191467 3300006931 Bacteria 2130
345 Ga0097620_100760088 3300006931 Bacteria 1058
346 Ga0075435_100000206 3300007076 Bacteria 35805
347 Ga0075435_100000827 3300007076 Bacteria 19283
348 Ga0075435_100017210 3300007076 Bacteria 5465
349 Ga0075435_100053442 3300007076 Bacteria 3258
350 Ga0075435_100241052 3300007076 Bacteria 1538
351 Ga0105240_10011838 3300009093 Bacteria 12115
352 Ga0105240_10016656 3300009093 Bacteria 9942
353 Ga0105240_10059153 3300009093 Bacteria 4783
354 Ga0105240_10307336 3300009093 Bacteria 1812
355 Ga0111539_10000006 3300009094 Bacteria 463720
356 Ga0111539_10026736 3300009094 Bacteria 7052
357 Ga0111539_10035710 3300009094 Bacteria 6017
358 Ga0105245_10000003 3300009098 Bacteria 488207
359 Ga0105245_10003461 3300009098 Bacteria 14140
360 Ga0105245_10078619 3300009098 Bacteria 3010
361 Ga0105245_10131807 3300009098 Bacteria 2345
362 Ga0105245_10697245 3300009098 Bacteria 1048
363 Ga0114129_10011524 3300009147 Bacteria 12591
364 Ga0114129_10022775 3300009147 Bacteria 8882
365 Ga0114129_10040772 3300009147 Bacteria 6545
366 Ga0114129_10071391 3300009147 Bacteria 4841
367 Ga0114129_10128654 3300009147 Bacteria 3480
368 Ga0114129_10140398 3300009147 Bacteria 3312
369 Ga0114129_10204178 3300009147 Bacteria 2675
370 Ga0114129_10332317 3300009147 Bacteria 2017
371 Ga0114129_10460278 3300009147 Bacteria 1667
372 Ga0114129_10734743 3300009147 Bacteria 1265
373 Ga0105243_10081994 3300009148 Bacteria 2635
374 Ga0105243_10121295 3300009148 Bacteria 2204
375 Ga0105243_10309941 3300009148 Bacteria 1434
376 Ga0105243_10451610 3300009148 Bacteria 1206
377 Ga0105241_10014961 3300009174 Bacteria 5681
378 Ga0105241_10041662 3300009174 Bacteria 3470
379 Ga0105241_10044133 3300009174 Bacteria 3377
380 Ga0105241_10060366 3300009174 Bacteria 2917
381 Ga0105241_10198729 3300009174 Bacteria 1673
382 Ga0105242_10047887 3300009176 Bacteria 3472
383 Ga0105242_10048474 3300009176 Bacteria 3453
384 Ga0105242_10055487 3300009176 Bacteria 3241
385 Ga0105242_10058900 3300009176 Bacteria 3150
386 Ga0105242_10100215 3300009176 Bacteria 2453
387 Ga0105242_10108271 3300009176 Bacteria 2365
388 Ga0105242_10159342 3300009176 Bacteria 1974
389 Ga0105242_10784137 3300009176 Bacteria 942
390 Ga0105248_10016076 3300009177 Bacteria 8237
391 Ga0105248_10024569 3300009177 Bacteria 6700
392 Ga0105248_10075824 3300009177 Bacteria 3780
393 Ga0105248_10178399 3300009177 Bacteria 2394
394 Ga0105248_10209183 3300009177 Bacteria 2198
395 Ga0105248_10211065 3300009177 Bacteria 2188
396 Ga0105248_10430971 3300009177 Bacteria 1485
397 Ga0105248_10632373 3300009177 Bacteria 1207
398 Ga0105248_10749364 3300009177 Bacteria 1102
399 Ga0105248_10911896 3300009177 Bacteria 992
400 Ga0105237_10023342 3300009545 Bacteria 6339
401 Ga0105237_10058764 3300009545 Bacteria 3849
402 Ga0105237_10082777 3300009545 Bacteria 3200
403 Ga0105237_10084650 3300009545 Bacteria 3161
404 Ga0105237_10170942 3300009545 Bacteria 2173
405 Ga0105238_10000001 3300009551 Bacteria 2036163
406 Ga0105238_10003217 3300009551 Bacteria 16314
407 Ga0105238_10098453 3300009551 Bacteria 2908
408 Ga0105238_10211442 3300009551 Bacteria 1916
409 Ga0105249_10009507 3300009553 Bacteria 8517
410 Ga0105239_10006983 3300010375 Bacteria 13009
411 Ga0105239_10074856 3300010375 Bacteria 3723
412 Ga0105239_10168258 3300010375 Bacteria 2451
413 Ga0105239_10638298 3300010375 Bacteria 1216
414 Ga0105246_10077902 3300011119 Bacteria 2353
415 Ga0157373_10000924 3300013100 Bacteria 22752
416 Ga0157373_10006638 3300013100 Bacteria 8623
417 Ga0157373_10008811 3300013100 Bacteria 7474
418 Ga0157371_10000522 3300013102 Bacteria 45892
419 Ga0157371_10190681 3300013102 Bacteria 1468
420 Ga0157371_10273908 3300013102 Bacteria 1218
421 Ga0157370_10005379 3300013104 Bacteria 14376
422 Ga0157370_10031830 3300013104 Bacteria 5156
423 Ga0157370_10057832 3300013104 Bacteria 3685
424 Ga0157370_10061023 3300013104 Bacteria 3578
425 Ga0157369_10000189 3300013105 Bacteria 85144
426 Ga0157369_10004689 3300013105 Bacteria 16077
427 Ga0157369_10058789 3300013105 Bacteria 4147
428 Ga0157369_10092042 3300013105 Bacteria 3236
429 Ga0157369_10189251 3300013105 Bacteria 2163
430 Ga0157369_10792833 3300013105 Bacteria 974
431 Ga0157374_10000037 3300013296 Bacteria 170359
432 Ga0157374_10016513 3300013296 Bacteria 6492
433 Ga0157374_10143435 3300013296 Bacteria 2319
434 Ga0157374_11123983 3300013296 Bacteria 806
435 Ga0157374_11182159 3300013296 Bacteria 786
436 Ga0157378_10000335 3300013297 Bacteria 46123
437 Ga0157378_10004023 3300013297 Bacteria 12980
438 Ga0157378_10020571 3300013297 Bacteria 5803
439 Ga0157378_10054920 3300013297 Bacteria 3547
440 Ga0157378_10077918 3300013297 Bacteria 2988
441 Ga0157378_10088588 3300013297 Bacteria 2809
442 Ga0157378_10114262 3300013297 Bacteria 2480
443 Ga0157378_10143982 3300013297 Bacteria 2215
444 Ga0157378_10323692 3300013297 Bacteria 1498
445 Ga0157378_10461376 3300013297 Bacteria 1262
446 Ga0163162_10004418 3300013306 Bacteria 13535
447 Ga0163162_10103173 3300013306 Bacteria 2946
448 Ga0163162_10162856 3300013306 Bacteria 2353
449 Ga0163162_10211090 3300013306 Bacteria 2071
450 Ga0163162_10517852 3300013306 Bacteria 1322
451 Ga0163162_10718787 3300013306 Bacteria 1120
452 Ga0157372_10000791 3300013307 Bacteria 34366
453 Ga0157372_10020911 3300013307 Bacteria 7064
454 Ga0157372_11261980 3300013307 Bacteria 853
455 Ga0157375_10000009 3300013308 Bacteria 366440
456 Ga0157375_10000090 3300013308 Bacteria 91416
457 Ga0157375_10002231 3300013308 Bacteria 16762
458 Ga0157375_10043801 3300013308 Bacteria 4343
459 Ga0157375_10050520 3300013308 Bacteria 4079
460 Ga0157375_10059025 3300013308 Bacteria 3798
461 Ga0157375_10087017 3300013308 Bacteria 3176
462 Ga0163163_10011827 3300014325 Bacteria 7936
463 Ga0157380_10001455 3300014326 Bacteria 15496
464 Ga0157380_10018325 3300014326 Bacteria 5195
465 Ga0157380_10018974 3300014326 Bacteria 5118
466 Ga0157380_10029606 3300014326 Bacteria 4186
467 Ga0157380_10084164 3300014326 Bacteria 2608
468 Ga0157380_10418274 3300014326 Bacteria 1277
469 Ga0157380_10845906 3300014326 Bacteria 936
470 Ga0157377_10000008 3300014745 Bacteria 394748
471 Ga0157377_10071610 3300014745 Bacteria 2005
472 Ga0157377_10339025 3300014745 Bacteria 1005
473 Ga0157377_10465382 3300014745 Bacteria 876
474 Ga0157379_10000246 3300014968 Bacteria 42489
475 Ga0157379_10026158 3300014968 Bacteria 5193
476 Ga0157379_10069965 3300014968 Bacteria 3139
477 Ga0157379_10090502 3300014968 Bacteria 2745
478 Ga0157379_10142200 3300014968 Bacteria 2163
479 Ga0157379_10204127 3300014968 Bacteria 1788
480 Ga0157379_10998805 3300014968 Bacteria 798
481 Ga0157376_10000006 3300014969 Bacteria 368549
482 Ga0157376_10024704 3300014969 Bacteria 4723
483 Ga0157376_10054971 3300014969 Bacteria 3320
484 Ga0157376_10176462 3300014969 Bacteria 1949
485 Ga0157376_10189913 3300014969 Bacteria 1883
486 Ga0157376_10270027 3300014969 Bacteria 1597
487 Ga0157376_10442726 3300014969 Bacteria 1266
488 Ga0163161_10343154 3300017792 Bacteria 1185
489 Ga0213873_10000004 3300021358 Bacteria 774374
490 Ga0213876_10000007 3300021384 Bacteria 670340
491 Ga0213876_10000188 3300021384 Bacteria 64172
492 Ga0213876_10001441 3300021384 Bacteria 14794
493 Ga0213876_10012783 3300021384 Bacteria 4463
494 Ga0213876_10013225 3300021384 Bacteria 4386
495 Ga0224712_10007074 3300022467 Bacteria 3244
496 Ga0209256_1001169 3300025299 Bacteria 29578
497 Ga0207697_10000450 3300025315 Bacteria 23178
498 Ga0207697_10093776 3300025315 Bacteria 1274
499 Ga0207656_10002897 3300025321 Bacteria 5849
500 Ga0207655_1034605 3300025728 Bacteria 2268
501 Ga0207653_10022344 3300025885 Bacteria 2009
502 Ga0207682_10011341 3300025893 Bacteria 3481
503 Ga0207682_10024253 3300025893 Bacteria 2400
504 Ga0207688_10010669 3300025901 Bacteria 4998
505 Ga0207688_10252004 3300025901 Bacteria 1069
506 Ga0207680_10038955 3300025903 Bacteria 2754
507 Ga0207680_10049915 3300025903 Bacteria 2493
508 Ga0207680_10070062 3300025903 Bacteria 2169
509 Ga0207680_10189782 3300025903 Bacteria 1394
510 Ga0207685_10003073 3300025905 Bacteria 3980
511 Ga0207685_10059931 3300025905 Bacteria 1503
512 Ga0207645_10031672 3300025907 Bacteria 3402
513 Ga0207645_10048029 3300025907 Bacteria 2725
514 Ga0207645_10088890 3300025907 Bacteria 1986
515 Ga0207645_10144397 3300025907 Bacteria 1551
516 Ga0207643_10000429 3300025908 Bacteria 27769
517 Ga0207643_10006465 3300025908 Bacteria 6274
518 Ga0207643_10061984 3300025908 Bacteria 2136
519 Ga0207643_10268673 3300025908 Bacteria 1055
520 Ga0207643_10345605 3300025908 Bacteria 933
521 Ga0207705_10014155 3300025909 Bacteria 5746
522 Ga0207705_10028399 3300025909 Bacteria 3988
523 Ga0207705_10066572 3300025909 Bacteria 2606
524 Ga0207654_10029791 3300025911 Bacteria 2991
525 Ga0207654_10263827 3300025911 Bacteria 1159
526 Ga0207707_10002432 3300025912 Bacteria 16755
527 Ga0207707_10021196 3300025912 Bacteria 5680
528 Ga0207707_10024558 3300025912 Bacteria 5275
529 Ga0207707_10104251 3300025912 Bacteria 2478
530 Ga0207707_10218897 3300025912 Bacteria 1657
531 Ga0207707_10292269 3300025912 Bacteria 1410
532 Ga0207695_10015923 3300025913 Bacteria 8830
533 Ga0207695_10018572 3300025913 Bacteria 8033
534 Ga0207695_10028893 3300025913 Bacteria 6137
535 Ga0207671_10281235 3300025914 Bacteria 1312
536 Ga0207693_10309411 3300025915 Bacteria 1237
537 Ga0207663_10421801 3300025916 Bacteria 1024
538 Ga0207662_10023329 3300025918 Bacteria 3555
539 Ga0207662_10037923 3300025918 Bacteria 2823
540 Ga0207662_10131893 3300025918 Bacteria 1576
541 Ga0207657_10000297 3300025919 Bacteria 52991
542 Ga0207657_10000657 3300025919 Bacteria 36802
543 Ga0207657_10005722 3300025919 Bacteria 12970
544 Ga0207657_10019066 3300025919 Bacteria 6527
545 Ga0207657_10032758 3300025919 Bacteria 4691
546 Ga0207657_10054479 3300025919 Bacteria 3458
547 Ga0207649_10000924 3300025920 Bacteria 18501
548 Ga0207649_10023356 3300025920 Bacteria 3581
549 Ga0207649_10036123 3300025920 Bacteria 2974
550 Ga0207649_10097269 3300025920 Bacteria 1941
551 Ga0207649_10325072 3300025920 Bacteria 1131
552 Ga0207649_10452621 3300025920 Bacteria 969
553 Ga0207652_10015488 3300025921 Bacteria 6199
554 Ga0207652_10018332 3300025921 Bacteria 5740
555 Ga0207652_10270319 3300025921 Bacteria 1533
556 Ga0207652_10534900 3300025921 Bacteria 1054
557 Ga0207646_10014498 3300025922 Bacteria 7482
558 Ga0207646_10144424 3300025922 Bacteria 2144
559 Ga0207681_10007040 3300025923 Bacteria 6903
560 Ga0207681_10019593 3300025923 Bacteria 4276
561 Ga0207681_10046474 3300025923 Bacteria 2920
562 Ga0207681_10096142 3300025923 Bacteria 2126
563 Ga0207681_10157126 3300025923 Bacteria 1710
564 Ga0207681_10248008 3300025923 Bacteria 1389
565 Ga0207694_10000001 3300025924 Bacteria 4078485
566 Ga0207694_10003088 3300025924 Bacteria 13330
567 Ga0207694_10023028 3300025924 Bacteria 4727
568 Ga0207694_10699319 3300025924 Bacteria 855
569 Ga0207650_10000067 3300025925 Bacteria 140196
570 Ga0207650_10000503 3300025925 Bacteria 32602
571 Ga0207650_10004702 3300025925 Bacteria 9329
572 Ga0207650_10017867 3300025925 Bacteria 4969
573 Ga0207650_10030839 3300025925 Bacteria 3867
574 Ga0207650_10094165 3300025925 Bacteria 2294
575 Ga0207650_10116911 3300025925 Bacteria 2071
576 Ga0207650_10126693 3300025925 Bacteria 1994
577 Ga0207650_10128475 3300025925 Bacteria 1981
578 Ga0207650_10239313 3300025925 Bacteria 1466
579 Ga0207650_10483916 3300025925 Bacteria 1033
580 Ga0207659_10000029 3300025926 Bacteria 129487
581 Ga0207659_10007970 3300025926 Bacteria 6547
582 Ga0207659_10015450 3300025926 Bacteria 4947
583 Ga0207659_10062527 3300025926 Bacteria 2687
584 Ga0207659_10072091 3300025926 Bacteria 2524
585 Ga0207659_10297812 3300025926 Bacteria 1324
586 Ga0207687_10000002 3300025927 Bacteria 975489
587 Ga0207687_10031920 3300025927 Bacteria 3563
588 Ga0207687_10143765 3300025927 Bacteria 1813
589 Ga0207687_10219150 3300025927 Bacteria 1497
590 Ga0207687_10292402 3300025927 Bacteria 1310
591 Ga0207700_10012662 3300025928 Bacteria 5451
592 Ga0207664_10015733 3300025929 Bacteria 5501
593 Ga0207644_10010522 3300025931 Bacteria 6098
594 Ga0207644_10019227 3300025931 Bacteria 4630
595 Ga0207644_10285726 3300025931 Bacteria 1325
596 Ga0207644_10311228 3300025931 Bacteria 1271
597 Ga0207644_10542136 3300025931 Bacteria 962
598 Ga0207690_10000412 3300025932 Bacteria 28034
599 Ga0207690_10010823 3300025932 Bacteria 5436
600 Ga0207690_10046407 3300025932 Bacteria 2877
601 Ga0207690_10052009 3300025932 Bacteria 2742
602 Ga0207690_10265743 3300025932 Bacteria 1331
603 Ga0207706_10000164 3300025933 Bacteria 73885
604 Ga0207706_10012798 3300025933 Bacteria 7634
605 Ga0207706_10069498 3300025933 Bacteria 3098
606 Ga0207706_10096475 3300025933 Bacteria 2600
607 Ga0207706_10155069 3300025933 Bacteria 2014
608 Ga0207686_10032295 3300025934 Bacteria 3115
609 Ga0207686_10037331 3300025934 Bacteria 2931
610 Ga0207686_10083358 3300025934 Bacteria 2092
611 Ga0207686_10095479 3300025934 Bacteria 1973
612 Ga0207686_10122173 3300025934 Bacteria 1774
613 Ga0207686_10149491 3300025934 Bacteria 1624
614 Ga0207686_10438937 3300025934 Bacteria 1002
615 Ga0207709_10032976 3300025935 Bacteria 3037
616 Ga0207709_10072229 3300025935 Bacteria 2194
617 Ga0207709_10380402 3300025935 Bacteria 1074
618 Ga0207670_10002387 3300025936 Bacteria 9835
619 Ga0207670_10022259 3300025936 Bacteria 3925
620 Ga0207670_10131433 3300025936 Bacteria 1835
621 Ga0207670_10156452 3300025936 Bacteria 1697
622 Ga0207669_10014593 3300025937 Bacteria 3942
623 Ga0207669_10064114 3300025937 Bacteria 2272
624 Ga0207669_10077132 3300025937 Bacteria 2118
625 Ga0207669_10484956 3300025937 Bacteria 986
626 Ga0207704_10086725 3300025938 Bacteria 2042
627 Ga0207704_10170536 3300025938 Bacteria 1560
628 Ga0207665_10268481 3300025939 Bacteria 1266
629 Ga0207691_10000507 3300025940 Bacteria 38790
630 Ga0207691_10007860 3300025940 Bacteria 10272
631 Ga0207691_10016301 3300025940 Bacteria 7055
632 Ga0207691_10069774 3300025940 Bacteria 3174
633 Ga0207691_10325923 3300025940 Bacteria 1316
634 Ga0207691_10340622 3300025940 Bacteria 1284
635 Ga0207711_10036106 3300025941 Bacteria 4193
636 Ga0207711_10040866 3300025941 Bacteria 3947
637 Ga0207711_10157690 3300025941 Bacteria 2052
638 Ga0207711_10216573 3300025941 Bacteria 1750
639 Ga0207711_10392049 3300025941 Bacteria 1289
640 Ga0207689_10001032 3300025942 Bacteria 26745
641 Ga0207689_10003889 3300025942 Bacteria 13608
642 Ga0207689_10013673 3300025942 Bacteria 6921
643 Ga0207689_10030304 3300025942 Bacteria 4509
644 Ga0207661_10000007 3300025944 Bacteria 471636
645 Ga0207661_10027401 3300025944 Bacteria 4352
646 Ga0207661_10031821 3300025944 Bacteria 4080
647 Ga0207661_10041533 3300025944 Bacteria 3621
648 Ga0207661_10089770 3300025944 Bacteria 2557
649 Ga0207661_10168781 3300025944 Bacteria 1904
650 Ga0207661_10688701 3300025944 Bacteria 940
651 Ga0207679_10000601 3300025945 Bacteria 24040
652 Ga0207679_10013736 3300025945 Bacteria 5310
653 Ga0207679_10031779 3300025945 Bacteria 3698
654 Ga0207679_10066044 3300025945 Bacteria 2709
655 Ga0207679_10106553 3300025945 Bacteria 2203
656 Ga0207679_10142336 3300025945 Bacteria 1940
657 Ga0207679_10337098 3300025945 Bacteria 1310
658 Ga0207667_10000695 3300025949 Bacteria 43623
659 Ga0207667_10006146 3300025949 Bacteria 14589
660 Ga0207667_10019236 3300025949 Bacteria 7634
661 Ga0207667_10095391 3300025949 Bacteria 3071
662 Ga0207667_10129880 3300025949 Bacteria 2595
663 Ga0207667_10458857 3300025949 Bacteria 1294
664 Ga0207651_10025885 3300025960 Bacteria 3654
665 Ga0207651_10046652 3300025960 Bacteria 2915
666 Ga0207651_10126960 3300025960 Bacteria 1945
667 Ga0207651_10154501 3300025960 Bacteria 1791
668 Ga0207651_10292791 3300025960 Bacteria 1350
669 Ga0207651_10817812 3300025960 Bacteria 827
670 Ga0207712_10044024 3300025961 Bacteria 3083
671 Ga0207712_10273813 3300025961 Bacteria 1375
672 Ga0207668_10036725 3300025972 Bacteria 3273
673 Ga0207668_10080220 3300025972 Bacteria 2363
674 Ga0207668_10121593 3300025972 Bacteria 1978
675 Ga0207668_10285142 3300025972 Bacteria 1356
676 Ga0207640_10000706 3300025981 Bacteria 19362
677 Ga0207640_10013301 3300025981 Bacteria 4713
678 Ga0207640_10016813 3300025981 Bacteria 4264
679 Ga0207640_10125635 3300025981 Bacteria 1846
680 Ga0207640_10140977 3300025981 Bacteria 1757
681 Ga0207640_10169104 3300025981 Bacteria 1627
682 Ga0207658_10004931 3300025986 Bacteria 9207
683 Ga0207658_10273361 3300025986 Bacteria 1445
684 Ga0207658_10712156 3300025986 Bacteria 908
685 Ga0207677_10000008 3300026023 Bacteria 266293
686 Ga0207677_10000133 3300026023 Bacteria 61065
687 Ga0207677_10021944 3300026023 Bacteria 3913
688 Ga0207677_10093523 3300026023 Bacteria 2192
689 Ga0207703_10000164 3300026035 Bacteria 76934
690 Ga0207703_10007505 3300026035 Bacteria 8656
691 Ga0207703_10101067 3300026035 Bacteria 2445
692 Ga0207703_10133703 3300026035 Bacteria 2145
693 Ga0207703_10172194 3300026035 Bacteria 1905
694 Ga0207703_10284565 3300026035 Bacteria 1503
695 Ga0207703_10319808 3300026035 Bacteria 1421
696 Ga0207703_10420203 3300026035 Bacteria 1244
697 Ga0207703_10580803 3300026035 Bacteria 1059
698 Ga0207639_10000020 3300026041 Bacteria 236698
699 Ga0207639_10004129 3300026041 Bacteria 9780
700 Ga0207639_10030218 3300026041 Bacteria 3972
701 Ga0207639_10143244 3300026041 Bacteria 1994
702 Ga0207639_10542994 3300026041 Bacteria 1066
703 Ga0207678_10022800 3300026067 Bacteria 5482
704 Ga0207678_10046316 3300026067 Bacteria 3761
705 Ga0207678_10046744 3300026067 Bacteria 3743
706 Ga0207678_10081046 3300026067 Bacteria 2778
707 Ga0207708_10000137 3300026075 Bacteria 57745
708 Ga0207708_10004851 3300026075 Bacteria 9911
709 Ga0207702_10003782 3300026078 Bacteria 13659
710 Ga0207702_10053520 3300026078 Bacteria 3417
711 Ga0207641_10013613 3300026088 Bacteria 6671
712 Ga0207641_10043578 3300026088 Bacteria 3769
713 Ga0207641_10138084 3300026088 Bacteria 2196
714 Ga0207641_10184808 3300026088 Bacteria 1911
715 Ga0207641_10199161 3300026088 Bacteria 1845
716 Ga0207641_10308856 3300026088 Bacteria 1496
717 Ga0207641_10391541 3300026088 Bacteria 1333
718 Ga0207648_10004696 3300026089 Bacteria 13969
719 Ga0207648_10021903 3300026089 Bacteria 5741
720 Ga0207648_10068442 3300026089 Bacteria 3093
721 Ga0207648_10154746 3300026089 Bacteria 2024
722 Ga0207648_10294259 3300026089 Bacteria 1454
723 Ga0207648_10298493 3300026089 Bacteria 1444
724 Ga0207648_10410248 3300026089 Bacteria 1228
725 Ga0207648_10421914 3300026089 Bacteria 1211
726 Ga0207648_10758783 3300026089 Bacteria 901
727 Ga0207676_10000070 3300026095 Bacteria 104103
728 Ga0207676_10001747 3300026095 Bacteria 15971
729 Ga0207676_10060928 3300026095 Bacteria 2986
730 Ga0207676_10092706 3300026095 Bacteria 2485
731 Ga0207676_10324824 3300026095 Bacteria 1414
732 Ga0207674_10000396 3300026116 Bacteria 56376
733 Ga0207674_10000536 3300026116 Bacteria 49766
734 Ga0207674_10007956 3300026116 Bacteria 12303
735 Ga0207674_10116743 3300026116 Bacteria 2640
736 Ga0207674_10172923 3300026116 Bacteria 2113
737 Ga0207674_10242800 3300026116 Bacteria 1748
738 Ga0207675_100004233 3300026118 Bacteria 13885
739 Ga0207675_100006036 3300026118 Bacteria 11526
740 Ga0207675_100027931 3300026118 Bacteria 5254
741 Ga0207675_100042406 3300026118 Bacteria 4249
742 Ga0207675_100067821 3300026118 Bacteria 3335
743 Ga0207675_100280705 3300026118 Bacteria 1618
744 Ga0207675_100282800 3300026118 Bacteria 1612
745 Ga0207675_100323764 3300026118 Bacteria 1505
746 Ga0207675_100612701 3300026118 Bacteria 1092
747 Ga0207675_100828272 3300026118 Bacteria 940
748 Ga0207683_10007047 3300026121 Bacteria 9639
749 Ga0207683_10033759 3300026121 Bacteria 4446
750 Ga0207683_10064063 3300026121 Bacteria 3239
751 Ga0207683_10094302 3300026121 Bacteria 2667
752 Ga0207683_10148174 3300026121 Bacteria 2117
753 Ga0207698_10012426 3300026142 Bacteria 5571
754 Ga0207698_10017296 3300026142 Bacteria 4888
755 Ga0207698_10257072 3300026142 Bacteria 1602
756 Ga0207698_10433472 3300026142 Bacteria 1265
757 Ga0207698_10576903 3300026142 Bacteria 1106
758 Ga0209970_1001342 3300027614 Bacteria 4304
759 Ga0209970_1018522 3300027614 Bacteria 1169
760 Ga0209983_1014893 3300027665 Bacteria 1604
761 Ga0209971_1000841 3300027682 Bacteria 7924
762 Ga0209971_1059943 3300027682 Bacteria 921
763 Ga0209974_10004242 3300027876 Bacteria 5119
764 Ga0207428_10000007 3300027907 Bacteria 463715
765 Ga0207428_10030188 3300027907 Bacteria 4484
766 Ga0268266_10019500 3300028379 Bacteria 5778
767 Ga0268266_10044417 3300028379 Bacteria 3798
768 Ga0268266_10115607 3300028379 Bacteria 2382
769 Ga0268265_10027358 3300028380 Bacteria 4069
770 Ga0268265_10049224 3300028380 Bacteria 3168
771 Ga0268265_10119302 3300028380 Bacteria 2170
772 Ga0268265_10318472 3300028380 Bacteria 1407
773 Ga0268265_10849730 3300028380 Bacteria 893
774 Ga0268264_10005591 3300028381 Bacteria 10650
775 Ga0268264_10024593 3300028381 Bacteria 4917
776 Ga0268264_10032442 3300028381 Bacteria 4286
777 Ga0268264_10046748 3300028381 Bacteria 3596
778 Ga0268264_10109607 3300028381 Bacteria 2416
779 Ga0268264_10361791 3300028381 Bacteria 1384
780 Ga0268264_10411383 3300028381 Bacteria 1302
781 Ga0268264_10452669 3300028381 Bacteria 1244
782 Ga0265323_10003583 3300028653 Bacteria 6824
783 Ga0265323_10062659 3300028653 Bacteria 1289
784 Ga0265336_10002300 3300028666 Bacteria 7973
785 Ga0265324_10000005 3300029957 Bacteria 347038
786 Ga0307511_10005518 3300030521 Bacteria 12851
787 Ga0316177_1030295 3300030731 Bacteria 6701
788 Ga0314311_1144403 3300030733 Bacteria 16756
789 Ga0316179_1069783 3300030734 Bacteria 2671
790 Ga0316180_1031618 3300030736 Bacteria 5701
791 Ga0316183_1091323 3300030742 Bacteria 8925
792 Ga0265330_10009093 3300031235 Bacteria 4737
793 Ga0265332_10000824 3300031238 Bacteria 18837
794 Ga0265325_10001486 3300031241 Bacteria 16510
795 Ga0265329_10004859 3300031242 Bacteria 5509
796 Ga0265331_10000305 3300031250 Bacteria 53782
797 Ga0265327_10004446 3300031251 Bacteria 12401
798 Ga0265327_10236819 3300031251 Bacteria 816
799 Ga0265316_10015795 3300031344 Bacteria 6581
800 Ga0265313_10102510 3300031595 Bacteria 1268
801 Ga0316575_10004145 3300031665 Bacteria 5085
802 Ga0265314_10026066 3300031711 Bacteria 4399
803 Ga0265342_10031924 3300031712 Bacteria 3251
804 Ga0307405_10016482 3300031731 Bacteria 4031
805 Ga0307410_10001317 3300031852 Bacteria 11086
806 Ga0307410_10116672 3300031852 Bacteria 1940
807 Ga0307406_10131645 3300031901 Bacteria 1757
808 Ga0307407_10008613 3300031903 Bacteria 4697
809 Ga0307409_100033201 3300031995 Bacteria 3752
810 Ga0307416_100001846 3300032002 Bacteria 11816
811 Ga0307416_100254564 3300032002 Bacteria 1711
812 Ga0307414_10235179 3300032004 Bacteria 1513
813 Ga0307411_10006888 3300032005 Bacteria 5730
814 Ga0307411_10178481 3300032005 Bacteria 1609
815 Ga0373930_0002059 3300034816 Bacteria 3076
816 Ga0373948_0015607 3300034817 Bacteria 1396
817 Ga0373950_0001150 3300034818 Bacteria 3396
818 Ga0373959_0003969 3300034820 Bacteria 2369
819 Ga0373938_0002076 3300034957 Bacteria 3220
820 Ga0373928_0003150 3300035084 Bacteria 3161
821 Ga0373929_0001579 3300035085 Bacteria 4331
822 Ga0373940_0002324 3300035088 Bacteria 3676
823 Ga0373951_0000829 3300035091 Bacteria 8406
824 Ga0373952_0002814 3300035092 Bacteria 3146
825 Ga0373932_0001595 3300035112 Bacteria 6243
826 Ga0373939_0000651 3300035114 Bacteria 8633
827 Ga0373953_0099664 3300035117 Bacteria 1222
828 Ga0373954_0041506 3300035118 Bacteria 2146
829 Ga0373954_0420691 3300035118 Bacteria 661
830 Ga0373956_0084689 3300035119 Bacteria 1457
831 Ga0373960_0069817 3300035121 Bacteria 1084
832 Ga0373946_0016175 3300035171 Bacteria 2839
833 Ga0373955_0095029 3300035172 Bacteria 1704
834 Ga0373955_0338157 3300035172 Bacteria 911
835 Ga0373942_0000393 3300035207 Bacteria 12138
836 Ga0373961_0006271 3300035241 Bacteria 2858
837 Ga0373962_0015994 3300035242 Bacteria 1929
838 Ga0373962_0018558 3300035242 Bacteria 1811
839 Ga0316574_0087066 3300035398 Bacteria 1988
840 Ga0373924_0008857 3300035410 Bacteria 3672
841 Ga0373924_0029665 3300035410 Bacteria 2188
842 Ga0373931_0000361 3300035691 Bacteria 18676
843 Ga0373935_0345984 3300035692 Bacteria 1059
844 Ga0373927_0063070 3300035695 Bacteria 2397
845 Ga0373927_0143215 3300035695 Bacteria 1564
846 Ga0373947_0029736 3300035725 Bacteria 3207
847 Ga0373947_0232862 3300035725 Bacteria 1214
848 Ga0373937_0343274 3300036401 Bacteria 1414
849 Ga0373937_0622026 3300036401 Bacteria 1025
850 Ga0373925_0184098 3300037068 Bacteria 1655
851 Ga0373925_0199856 3300037068 Bacteria 1589
852 Ga0373925_0775464 3300037068 Bacteria 790
853 Ga0395900_0019317 3300037418 Bacteria 6951
854 Ga0436364_0470212 3300037853 Bacteria 24045
855 Ga0436364_1377383 3300037853 Bacteria 2635
856 Ga0400490_21567 3300038726 Bacteria 1078
857 Ga0400483_088593 3300039062 Bacteria 2443
858 Ga0400483_220029 3300039062 Bacteria 1392
859 Ga0400483_288640 3300039062 Bacteria 2955
860 Ga0436365_0073603 3300039437 Bacteria 250590
861 Ga0436365_0506999 3300039437 Bacteria 18404
862 Ga0436365_0637274 3300039437 Bacteria 17734
863 Ga0436365_0857751 3300039437 Bacteria 5248
864 Ga0436365_1929564 3300039437 Bacteria 3931
865 Ga0436362_0290430 3300039453 Bacteria 772596
866 Ga0436362_1187303 3300039453 Bacteria 11856
867 Ga0439441_038281 3300042001 Bacteria 953
868 Ga0439435_0003908 3300042436 Bacteria 3156
869 Ga0439464_0043281 3300042439 Bacteria 1287
870 Ga0451577_0039643 3300042876 Bacteria 4233
871 Ga0451577_0057152 3300042876 Bacteria 3478
872 Ga0451577_0117602 3300042876 Bacteria 2381
873 Ga0453684_0012886 3300044712 Bacteria 13697
874 Ga0453684_0026885 3300044712 Bacteria 8289
875 Ga0466957_0279098 3300044842 Bacteria 1118
876 Ga0451576_0000210 3300045051 Bacteria 146650
877 Ga0451576_0258421 3300045051 Bacteria 1820
878 Ga0451576_0411870 3300045051 Bacteria 1418
879 Ga0495592_0170897 3300046454 Bacteria 1489
880 Ga0495603_0098969 3300046455 Bacteria 1703
881 Ga0495580_0000663 3300046472 Bacteria 29297
882 Ga0495582_0030783 3300046473 Bacteria 2948
883 Ga0495582_0172882 3300046473 Bacteria 1230
884 Ga0495620_0001137 3300046515 Bacteria 16250
885 Ga0495663_0004342 3300046525 Bacteria 3993
886 Ga0495640_0123983 3300046533 Bacteria 1677
887 Ga0495640_0411422 3300046533 Bacteria 829
888 Ga0495634_0310140 3300046642 Bacteria 952
889 Ga0495635_0461852 3300046663 Bacteria 839
890 Ga0495647_0035101 3300046681 Bacteria 1881
891 Ga0495658_0028039 3300046683 Bacteria 3036
892 Ga0495658_0107310 3300046683 Bacteria 1675
893 Ga0495658_0246942 3300046683 Bacteria 1122
894 Ga0495658_0303323 3300046683 Bacteria 1010
895 Ga0495613_0239505 3300046689 Bacteria 1269
896 Ga0495674_0341041 3300047319 Bacteria 1218
897 Ga0495679_008002 3300047446 Bacteria 4344
898 Ga0496100_0095621 3300048903 Bacteria 2037
899 Ga0496100_0105940 3300048903 Bacteria 1945
900 Ga0496100_0196378 3300048903 Bacteria 1468
901 Ga0496100_0458303 3300048903 Bacteria 978
902 Ga0496101_0000804 3300048904 Bacteria 18549
903 Ga0496101_0068972 3300048904 Bacteria 2586
904 Ga0496101_0228831 3300048904 Bacteria 1445
905 Ga0496102_0068560 3300048905 Bacteria 3255
906 Ga0496102_0262055 3300048905 Bacteria 1630
907 Ga0496103_0085381 3300048906 Bacteria 1989
908 Ga0496103_0154769 3300048906 Bacteria 1469
909 Ga0496104_0022186 3300048907 Bacteria 5832
910 Ga0496104_0174282 3300048907 Bacteria 2061
911 Ga0496104_0645482 3300048907 Bacteria 967
912 Ga0496105_0016985 3300048908 Bacteria 5823
913 Ga0496105_0244751 3300048908 Bacteria 1454
914 Ga0496106_0012297 3300048909 Bacteria 6316
915 Ga0496106_0014789 3300048909 Bacteria 5771
916 Ga0496106_0073654 3300048909 Bacteria 2613
917 Ga0496106_0091645 3300048909 Bacteria 2347
918 Ga0496107_0001319 3300048910 Bacteria 15218
919 Ga0496107_0027201 3300048910 Bacteria 4061
920 Ga0496107_0047373 3300048910 Bacteria 3096
921 Ga0496107_0264037 3300048910 Bacteria 1281
922 Ga0496107_0488291 3300048910 Bacteria 914
923 Ga0496108_0010757 3300048911 Bacteria 7428
924 Ga0496108_0048768 3300048911 Bacteria 3541
925 Ga0496108_0097513 3300048911 Bacteria 2505
926 Ga0496108_0374234 3300048911 Bacteria 1244
927 Ga0496108_0440771 3300048911 Bacteria 1138
928 Ga0496108_0659313 3300048911 Bacteria 909
929 Ga0496109_0005670 3300048912 Bacteria 10446
930 Ga0496109_0289352 3300048912 Bacteria 1544
931 Ga0496109_0503735 3300048912 Bacteria 1143
932 Ga0496110_0000624 3300048913 Bacteria 24227
933 Ga0496110_0004549 3300048913 Bacteria 10770
934 Ga0496111_0031212 3300048914 Bacteria 3795
935 Ga0496111_0038547 3300048914 Bacteria 3424
936 Ga0496112_0001309 3300048915 Bacteria 18920
937 Ga0496112_0017117 3300048915 Bacteria 6805
938 Ga0496113_0163287 3300048916 Bacteria 1762
939 Ga0496113_0405722 3300048916 Bacteria 1094
940 Ga0496114_0001096 3300048917 Bacteria 20425
941 Ga0496114_0036010 3300048917 Bacteria 4090
942 Ga0496114_0120928 3300048917 Bacteria 2252
943 Ga0496114_0524152 3300048917 Bacteria 1048
944 Ga0496115_0030979 3300048918 Bacteria 4213
945 Ga0501032_0088866 3300049569 Bacteria 2051
946 Ga0501032_0207719 3300049569 Bacteria 1277
947 Ga0501034_0050704 3300049571 Bacteria 4186
948 Ga0501034_0115691 3300049571 Bacteria 2670
949 Ga0501034_0534763 3300049571 Bacteria 1082
950 Ga0501034_0593539 3300049571 Bacteria 1014
951 Ga0501036_0158385 3300049572 Bacteria 1909
952 Ga0501036_0307820 3300049572 Bacteria 1325
953 Ga0501036_0632738 3300049572 Bacteria 886
954 Ga0501037_0220767 3300049573 Bacteria 1334
955 Ga0501038_0090499 3300049574 Bacteria 2564
956 Ga0501038_0433862 3300049574 Bacteria 1012
957 Ga0501039_0053929 3300049575 Bacteria 3112
958 Ga0501040_0394708 3300049576 Bacteria 993
959 Ga0501042_0215406 3300049578 Bacteria 1385
960 Ga0501043_0105553 3300049579 Bacteria 2213
961 Ga0501043_0160626 3300049579 Bacteria 1756
962 Ga0501046_0113097 3300049580 Bacteria 2072
963 Ga0501047_0002575 3300049581 Bacteria 17304
964 Ga0501047_0009177 3300049581 Bacteria 9339
965 Ga0501047_0057812 3300049581 Bacteria 3749
966 Ga0501047_0081175 3300049581 Bacteria 3117
967 Ga0501048_0183220 3300049582 Bacteria 1484
968 Ga0501068_0179003 3300049584 Bacteria 1340
969 Ga0501069_0094477 3300049585 Bacteria 1692
970 Ga0501071_0065368 3300049587 Bacteria 2641
971 Ga0501072_0072881 3300049588 Bacteria 2715
972 Ga0501072_0353991 3300049588 Bacteria 1166
973 Ga0501072_0535589 3300049588 Bacteria 925
974 Ga0501073_0005701 3300049589 Bacteria 9315
975 Ga0501073_0105592 3300049589 Bacteria 1955
976 Ga0501073_0170905 3300049589 Bacteria 1504
977 Ga0501074_0146909 3300049590 Bacteria 1686
978 Ga0501075_0191716 3300049591 Bacteria 1559
979 Ga0501076_0161218 3300049592 Bacteria 1827
980 Ga0501076_0336567 3300049592 Bacteria 1238
981 Ga0501076_0478279 3300049592 Bacteria 1026
982 Ga0501077_0059883 3300049593 Bacteria 2417
983 Ga0501249_003177 3300049679 Bacteria 3307
984 Ga0501225_0008478 3300049705 Bacteria 2950
985 Ga0501080_0172854 3300049742 Bacteria 1992
986 Ga0501080_0192319 3300049742 Bacteria 1875
987 Ga0501080_0279195 3300049742 Bacteria 1519
988 Ga0501080_0315690 3300049742 Bacteria 1416
989 Ga0501080_0415853 3300049742 Bacteria 1208
990 Ga0501081_0649467 3300049743 Bacteria 791
991 Ga0501083_0005216 3300049744 Bacteria 9195
992 Ga0501035_0037068 3300049822 Bacteria 4417
993 Ga0501035_0059697 3300049822 Bacteria 3397
994 Ga0501035_0543620 3300049822 Bacteria 952
995 Ga0501044_0002082 3300049823 Bacteria 23049
996 Ga0501044_0016786 3300049823 Bacteria 7858
997 Ga0501044_0063575 3300049823 Bacteria 3769
998 Ga0501045_0455089 3300049824 Bacteria 951
999 nmdc:mga00v17_332592_c1 3300050491 Bacteria 987
1000 nmdc:mga05p37_2308_c1 3300050507 Bacteria 22237
1001 nmdc:mga05p37_426951_c1 3300050507 Bacteria 1541
1002 nmdc:mga05p37_564957_c1 3300050507 Bacteria 1292
1003 nmdc:mga05p37_70113_c1 3300050507 Bacteria 4312
1004 nmdc:mga05p37_76566_c2 3300050507 Bacteria 3176
1005 nmdc:mga05p37_94815_c1 3300050507 Bacteria 3677
1006 nmdc:mga05p37_98291_c1 3300050507 Bacteria 3605
1007 nmdc:mga0qj67_28397_c1 3300050509 Bacteria 4342
1008 nmdc:mga06r32_293267_c1 3300050510 Bacteria 1613
1009 nmdc:mga06r32_510229_c1 3300050510 Bacteria 1179
1010 nmdc:mga06r32_58829_c1 3300050510 Bacteria 3694
1011 nmdc:mga08y16_11_c1 3300050511 Bacteria 463712
1012 nmdc:mga08y16_170629_c1 3300050511 Bacteria 2260
1013 nmdc:mga08y16_25248_c1 3300050511 Bacteria 6266
1014 nmdc:mga08y16_627183_c1 3300050511 Bacteria 1081
1015 nmdc:mga08y16_74414_c1 3300050511 Bacteria 3539
1016 nmdc:mga0n895_10721_c1 3300050512 Bacteria 8121
1017 nmdc:mga0n895_11721_c1 3300050512 Bacteria 7836
1018 nmdc:mga0n895_118847_c1 3300050512 Bacteria 2664
1019 nmdc:mga0n895_11942_c1 3300050512 Bacteria 7773
1020 nmdc:mga0n895_121367_c1 3300050512 Bacteria 2634
1021 nmdc:mga0n895_197254_c1 3300050512 Bacteria 2044
1022 nmdc:mga0n895_304741_c1 3300050512 Bacteria 1615
1023 nmdc:mga0rr50_1256_c1 3300050513 Bacteria 13795
1024 nmdc:mga0rr50_24004_c1 3300050513 Bacteria 4217
1025 nmdc:mga0rr50_2985_c1 3300050513 Bacteria 9671
1026 nmdc:mga0rr50_53607_c1 3300050513 Bacteria 3001
1027 nmdc:mga08x19_112678_c1 3300050514 Bacteria 1816
1028 nmdc:mga08x19_137947_c1 3300050514 Bacteria 1645
1029 nmdc:mga08x19_146636_c1 3300050514 Bacteria 1596
1030 nmdc:mga08x19_1832_c1 3300050514 Bacteria 13043
1031 nmdc:mga08x19_28730_c1 3300050514 Bacteria 3485
1032 nmdc:mga08x19_493616_c1 3300050514 Bacteria 864
1033 nmdc:mga0a205_120152_c1 3300050515 Bacteria 2527
1034 nmdc:mga0a205_135_c1 3300050515 Bacteria 46167
1035 nmdc:mga0a205_22590_c1 3300050515 Bacteria 5961
1036 nmdc:mga0a205_51011_c1 3300050515 Bacteria 3994
1037 nmdc:mga0a205_6061_c2 3300050515 Bacteria 7879
1038 Ga0495655_0000046 3300053083 Bacteria 25139
1039 Ga0495619_0074996 3300053085 Bacteria 2269
1040 Ga0495619_0079770 3300053085 Bacteria 2202
1041 Ga0495619_0207257 3300053085 Bacteria 1357
1042 Ga0500555_000947 3300053103 Bacteria 10089
1043 Ga0500616_0000358 3300053153 Bacteria 64893
1044 Ga0500645_000794 3300053730 Bacteria 18915
1045 Ga0501084_0064935 3300054114 Bacteria 3054
1046 Ga0501082_0008962 3300060353 Bacteria 8635
1047 Ga0501082_0050120 3300060353 Bacteria 3601

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035118 Ga0373954_0420691 Ga0373954_0420691_26_631 201
2 3300005458 Ga0070681_10202495 Ga0070681_102024953 207
3 3300006871 Ga0075434_100483855 Ga0075434_1004838553 207
4 3300025912 Ga0207707_10218897 Ga0207707_102188972 207
5 3300005340 Ga0070689_100003762 Ga0070689_10000376210 208
6 3300005842 Ga0068858_100000518 Ga0068858_10000051817 208
7 3300009098 Ga0105245_10131807 Ga0105245_101318071 208
8 3300025927 Ga0207687_10031920 Ga0207687_100319203 208
9 3300025936 Ga0207670_10002387 Ga0207670_1000238710 208
10 3300026035 Ga0207703_10000164 Ga0207703_1000016441 208
11 3300005338 Ga0068868_100000558 Ga0068868_1000005589 210
12 3300026023 Ga0207677_10000008 Ga0207677_1000000849 210
13 3300005331 Ga0070670_100002410 Ga0070670_1000024105 211
14 3300005564 Ga0070664_100204324 Ga0070664_1002043242 211
15 3300005841 Ga0068863_100013369 Ga0068863_1000133696 211
16 3300025925 Ga0207650_10017867 Ga0207650_100178672 211
17 3300026088 Ga0207641_10043578 Ga0207641_100435783 211
18 3300005337 Ga0070682_100000010 Ga0070682_10000001070 213
19 3300025939 Ga0207665_10268481 Ga0207665_102684812 215
20 3300049743 Ga0501081_0649467 Ga0501081_0649467_11_730 216
21 3300005328 Ga0070676_10190150 Ga0070676_101901502 217
22 3300005356 Ga0070674_100024606 Ga0070674_1000246065 217
23 3300005438 Ga0070701_10063976 Ga0070701_100639762 217
24 3300009148 Ga0105243_10451610 Ga0105243_104516102 217
25 3300025907 Ga0207645_10144397 Ga0207645_101443972 217
26 3300025937 Ga0207669_10064114 Ga0207669_100641142 217
27 3300026089 Ga0207648_10421914 Ga0207648_104219142 217
28 3300005366 Ga0070659_100114770 Ga0070659_1001147702 219
29 3300005564 Ga0070664_100103541 Ga0070664_1001035413 219
30 3300005834 Ga0068851_10105317 Ga0068851_101053172 219
31 3300013104 Ga0157370_10057832 Ga0157370_100578324 219
32 3300025932 Ga0207690_10052009 Ga0207690_100520094 219
33 3300025945 Ga0207679_10013736 Ga0207679_100137367 219
34 3300026121 Ga0207683_10033759 Ga0207683_100337592 219
35 3300028666 Ga0265336_10002300 Ga0265336_100023005 219
36 3300029957 Ga0265324_10000005 Ga0265324_10000005121 219
37 3300031241 Ga0265325_10001486 Ga0265325_100014865 219
38 3300031251 Ga0265327_10236819 Ga0265327_102368191 219
39 3300031711 Ga0265314_10026066 Ga0265314_100260664 219
40 3300048911 Ga0496108_0659313 Ga0496108_0659313_126_878 219
41 3300005327 Ga0070658_10099113 Ga0070658_100991133 220
42 3300005329 Ga0070683_100016811 Ga0070683_1000168115 220
43 3300005336 Ga0070680_100085042 Ga0070680_1000850423 220
44 3300005339 Ga0070660_100014318 Ga0070660_1000143184 220
45 3300005344 Ga0070661_100000813 Ga0070661_10000081318 220
46 3300005366 Ga0070659_100030277 Ga0070659_1000302774 220
47 3300005435 Ga0070714_100156608 Ga0070714_1001566082 220
48 3300005436 Ga0070713_100212468 Ga0070713_1002124681 220
49 3300005530 Ga0070679_100092060 Ga0070679_1000920602 220
50 3300005535 Ga0070684_100005117 Ga0070684_1000051176 220
51 3300005539 Ga0068853_100029977 Ga0068853_1000299772 220
52 3300005563 Ga0068855_100008719 Ga0068855_10000871911 220
53 3300005564 Ga0070664_100014812 Ga0070664_1000148124 220
54 3300005577 Ga0068857_100006850 Ga0068857_10000685012 220
55 3300005578 Ga0068854_100005152 Ga0068854_1000051527 220
56 3300005614 Ga0068856_100016323 Ga0068856_1000163234 220
57 3300005616 Ga0068852_100001206 Ga0068852_1000012068 220
58 3300005834 Ga0068851_10283666 Ga0068851_102836661 220
59 3300009093 Ga0105240_10059153 Ga0105240_100591533 220
60 3300009174 Ga0105241_10044133 Ga0105241_100441333 220
61 3300009545 Ga0105237_10023342 Ga0105237_100233423 220
62 3300009551 Ga0105238_10003217 Ga0105238_100032174 220
63 3300013100 Ga0157373_10006638 Ga0157373_100066386 220
64 3300013102 Ga0157371_10273908 Ga0157371_102739083 220
65 3300013104 Ga0157370_10031830 Ga0157370_100318304 220
66 3300013105 Ga0157369_10004689 Ga0157369_1000468916 220
67 3300013307 Ga0157372_10020911 Ga0157372_100209114 220
68 3300025909 Ga0207705_10066572 Ga0207705_100665723 220
69 3300025912 Ga0207707_10024558 Ga0207707_100245585 220
70 3300025913 Ga0207695_10018572 Ga0207695_100185726 220
71 3300025919 Ga0207657_10019066 Ga0207657_100190664 220
72 3300025920 Ga0207649_10000924 Ga0207649_100009245 220
73 3300025924 Ga0207694_10003088 Ga0207694_100030888 220
74 3300025929 Ga0207664_10015733 Ga0207664_100157333 220
75 3300025944 Ga0207661_10041533 Ga0207661_100415334 220
76 3300025945 Ga0207679_10066044 Ga0207679_100660443 220
77 3300025949 Ga0207667_10019236 Ga0207667_100192365 220
78 3300025981 Ga0207640_10016813 Ga0207640_100168134 220
79 3300026041 Ga0207639_10143244 Ga0207639_101432442 220
80 3300026078 Ga0207702_10003782 Ga0207702_1000378213 220
81 3300026116 Ga0207674_10000536 Ga0207674_100005366 220
82 3300026142 Ga0207698_10012426 Ga0207698_100124267 220
83 3300030731 Ga0316177_1030295 Ga0316177_10302953 220
84 3300030733 Ga0314311_1144403 Ga0314311_11444037 220
85 3300030734 Ga0316179_1069783 Ga0316179_10697833 220
86 3300030736 Ga0316180_1031618 Ga0316180_10316183 220
87 3300030742 Ga0316183_1091323 Ga0316183_10913237 220
88 3300032002 Ga0307416_100254564 Ga0307416_1002545643 220
89 3300037418 Ga0395900_0019317 Ga0395900_0019317_3648_4403 220
90 3300048915 Ga0496112_0017117 Ga0496112_0017117_5959_6720 220
91 3300049569 Ga0501032_0088866 Ga0501032_0088866_192_932 220
92 3300049571 Ga0501034_0534763 Ga0501034_0534763_56_796 220
93 3300049571 Ga0501034_0593539 Ga0501034_0593539_142_882 220
94 3300049572 Ga0501036_0158385 Ga0501036_0158385_810_1550 220
95 3300049574 Ga0501038_0090499 Ga0501038_0090499_1776_2516 220
96 3300049579 Ga0501043_0105553 Ga0501043_0105553_1095_1835 220
97 3300049580 Ga0501046_0113097 Ga0501046_0113097_1056_1796 220
98 3300049581 Ga0501047_0057812 Ga0501047_0057812_238_978 220
99 3300049581 Ga0501047_0081175 Ga0501047_0081175_2135_2875 220
100 3300049582 Ga0501048_0183220 Ga0501048_0183220_36_776 220
101 3300049584 Ga0501068_0179003 Ga0501068_0179003_321_1061 220
102 3300049585 Ga0501069_0094477 Ga0501069_0094477_809_1549 220
103 3300049589 Ga0501073_0005701 Ga0501073_0005701_3377_4117 220
104 3300049589 Ga0501073_0170905 Ga0501073_0170905_658_1398 220
105 3300049593 Ga0501077_0059883 Ga0501077_0059883_379_1119 220
106 3300049679 Ga0501249_003177 Ga0501249_003177_665_1408 220
107 3300049705 Ga0501225_0008478 Ga0501225_0008478_686_1429 220
108 3300049742 Ga0501080_0415853 Ga0501080_0415853_186_926 220
109 3300049744 Ga0501083_0005216 Ga0501083_0005216_5116_5856 220
110 3300049822 Ga0501035_0059697 Ga0501035_0059697_441_1181 220
111 3300049823 Ga0501044_0063575 Ga0501044_0063575_262_1002 220
112 3300049824 Ga0501045_0455089 Ga0501045_0455089_132_872 220
113 3300060353 Ga0501082_0008962 Ga0501082_0008962_1708_2448 220
114 3300005356 Ga0070674_100206600 Ga0070674_1002066002 221
115 3300005456 Ga0070678_100206274 Ga0070678_1002062741 221
116 3300005459 Ga0068867_100034852 Ga0068867_1000348523 221
117 3300006358 Ga0068871_100098921 Ga0068871_1000989212 221
118 3300009176 Ga0105242_10055487 Ga0105242_100554872 221
119 3300014968 Ga0157379_10090502 Ga0157379_100905023 221
120 3300026089 Ga0207648_10294259 Ga0207648_102942591 221
121 3300026121 Ga0207683_10064063 Ga0207683_100640633 221
122 3300049588 Ga0501072_0072881 Ga0501072_0072881_1163_1939 221
123 3300009177 Ga0105248_10016076 Ga0105248_100160764 222
124 3300014968 Ga0157379_10000246 Ga0157379_100002469 222
125 3300028653 Ga0265323_10062659 Ga0265323_100626592 222
126 3300037853 Ga0436364_0470212 Ga0436364_0470212_10429_11178 222
127 3300049581 Ga0501047_0002575 Ga0501047_0002575_10250_10987 222
128 3300049822 Ga0501035_0037068 Ga0501035_0037068_1510_2247 222
129 3300049823 Ga0501044_0002082 Ga0501044_0002082_2557_3294 222
130 3300005842 Ga0068858_100233860 Ga0068858_1002338603 223
131 3300006358 Ga0068871_100388610 Ga0068871_1003886102 223
132 3300049571 Ga0501034_0115691 Ga0501034_0115691_1487_2227 223
133 3300049742 Ga0501080_0279195 Ga0501080_0279195_578_1252 223
134 3300009147 Ga0114129_10332317 Ga0114129_103323173 224
135 3300049569 Ga0501032_0207719 Ga0501032_0207719_292_1038 224
136 3300049572 Ga0501036_0632738 Ga0501036_0632738_103_849 224
137 3300049575 Ga0501039_0053929 Ga0501039_0053929_1215_1961 224
138 3300049578 Ga0501042_0215406 Ga0501042_0215406_312_1058 224
139 3300049579 Ga0501043_0160626 Ga0501043_0160626_408_1154 224
140 3300049587 Ga0501071_0065368 Ga0501071_0065368_945_1691 224
141 3300049588 Ga0501072_0353991 Ga0501072_0353991_62_802 224
142 3300049592 Ga0501076_0161218 Ga0501076_0161218_53_799 224
143 3300050507 nmdc:mga05p37_98291_c1 nmdc:mga05p37_98291_c1_2730_3470 224
144 3300005340 Ga0070689_100120693 Ga0070689_1001206931 225
145 3300005842 Ga0068858_100671672 Ga0068858_1006716722 225
146 3300005843 Ga0068860_100066331 Ga0068860_1000663313 225
147 3300009177 Ga0105248_10911896 Ga0105248_109118962 225
148 3300026067 Ga0207678_10046744 Ga0207678_100467443 225
149 3300028381 Ga0268264_10046748 Ga0268264_100467484 225
150 3300049589 Ga0501073_0105592 Ga0501073_0105592_177_917 225
151 3300005293 Ga0065715_10199719 Ga0065715_101997192 226
152 3300005328 Ga0070676_10086000 Ga0070676_100860002 226
153 3300005331 Ga0070670_100006838 Ga0070670_10000683810 226
154 3300005334 Ga0068869_100002596 Ga0068869_1000025967 226
155 3300005338 Ga0068868_100094582 Ga0068868_1000945823 226
156 3300005347 Ga0070668_100018243 Ga0070668_1000182433 226
157 3300005353 Ga0070669_100009649 Ga0070669_1000096493 226
158 3300005364 Ga0070673_100028043 Ga0070673_1000280431 226
159 3300005367 Ga0070667_100006047 Ga0070667_1000060476 226
160 3300005440 Ga0070705_100008967 Ga0070705_1000089672 226
161 3300005459 Ga0068867_100005228 Ga0068867_1000052288 226
162 3300005563 Ga0068855_100430592 Ga0068855_1004305922 226
163 3300005577 Ga0068857_100049665 Ga0068857_1000496654 226
164 3300005617 Ga0068859_100008168 Ga0068859_1000081688 226
165 3300005618 Ga0068864_100000456 Ga0068864_1000004567 226
166 3300005719 Ga0068861_100023402 Ga0068861_1000234023 226
167 3300005841 Ga0068863_100039196 Ga0068863_1000391962 226
168 3300005841 Ga0068863_100082598 Ga0068863_1000825983 226
169 3300005842 Ga0068858_100008910 Ga0068858_1000089107 226
170 3300005843 Ga0068860_100008086 Ga0068860_1000080868 226
171 3300005843 Ga0068860_100076833 Ga0068860_1000768333 226
172 3300006931 Ga0097620_100008167 Ga0097620_1000081678 226
173 3300013297 Ga0157378_10077918 Ga0157378_100779183 226
174 3300014325 Ga0163163_10011827 Ga0163163_100118276 226
175 3300025907 Ga0207645_10031672 Ga0207645_100316721 226
176 3300025923 Ga0207681_10019593 Ga0207681_100195933 226
177 3300025925 Ga0207650_10004702 Ga0207650_100047028 226
178 3300025942 Ga0207689_10001032 Ga0207689_1000103223 226
179 3300025949 Ga0207667_10129880 Ga0207667_101298801 226
180 3300025960 Ga0207651_10025885 Ga0207651_100258851 226
181 3300025986 Ga0207658_10004931 Ga0207658_100049316 226
182 3300026035 Ga0207703_10007505 Ga0207703_100075055 226
183 3300026088 Ga0207641_10013613 Ga0207641_100136137 226
184 3300026088 Ga0207641_10308856 Ga0207641_103088562 226
185 3300026089 Ga0207648_10004696 Ga0207648_1000469611 226
186 3300026095 Ga0207676_10001747 Ga0207676_100017477 226
187 3300026118 Ga0207675_100006036 Ga0207675_1000060363 226
188 3300026118 Ga0207675_100323764 Ga0207675_1003237641 226
189 3300028381 Ga0268264_10005591 Ga0268264_100055916 226
190 3300028381 Ga0268264_10032442 Ga0268264_100324423 226
191 3300048904 Ga0496101_0228831 Ga0496101_0228831_347_1147 226
192 3300048905 Ga0496102_0068560 Ga0496102_0068560_1301_2053 226
193 3300048911 Ga0496108_0048768 Ga0496108_0048768_629_1429 226
194 3300048911 Ga0496108_0097513 Ga0496108_0097513_1046_1798 226
195 3300048912 Ga0496109_0289352 Ga0496109_0289352_217_1017 226
196 3300048916 Ga0496113_0163287 Ga0496113_0163287_416_1216 226
197 3300049742 Ga0501080_0315690 Ga0501080_0315690_153_899 226
198 3300005356 Ga0070674_100270495 Ga0070674_1002704952 228
199 3300025919 Ga0207657_10005722 Ga0207657_100057224 228
200 3300025944 Ga0207661_10688701 Ga0207661_106887011 228
201 3300026118 Ga0207675_100612701 Ga0207675_1006127012 228
202 3300049588 Ga0501072_0535589 Ga0501072_0535589_85_825 228
203 3300049590 Ga0501074_0146909 Ga0501074_0146909_883_1623 228
204 3300049592 Ga0501076_0336567 Ga0501076_0336567_419_1159 228
205 3300049742 Ga0501080_0192319 Ga0501080_0192319_947_1687 228
206 3300005328 Ga0070676_10043387 Ga0070676_100433872 229
207 3300005353 Ga0070669_100370318 Ga0070669_1003703181 229
208 3300005354 Ga0070675_100005401 Ga0070675_1000054013 229
209 3300005438 Ga0070701_10341148 Ga0070701_103411481 229
210 3300005439 Ga0070711_100320137 Ga0070711_1003201372 229
211 3300006175 Ga0070712_100440612 Ga0070712_1004406122 229
212 3300006852 Ga0075433_10019284 Ga0075433_100192847 229
213 3300006871 Ga0075434_100007152 Ga0075434_10000715211 229
214 3300006914 Ga0075436_100061454 Ga0075436_1000614544 229
215 3300007076 Ga0075435_100017210 Ga0075435_1000172106 229
216 3300025915 Ga0207693_10309411 Ga0207693_103094112 229
217 3300025916 Ga0207663_10421801 Ga0207663_104218011 229
218 3300025926 Ga0207659_10072091 Ga0207659_100720913 229
219 3300025960 Ga0207651_10817812 Ga0207651_108178121 229
220 3300025972 Ga0207668_10285142 Ga0207668_102851421 229
221 3300026118 Ga0207675_100828272 Ga0207675_1008282721 229
222 3300027614 Ga0209970_1001342 Ga0209970_10013423 229
223 3300027665 Ga0209983_1014893 Ga0209983_10148932 229
224 3300027682 Ga0209971_1000841 Ga0209971_10008412 229
225 3300027876 Ga0209974_10004242 Ga0209974_100042426 229
226 3300050512 nmdc:mga0n895_10721_c1 nmdc:mga0n895_10721_c1_3056_3802 229
227 3300050513 nmdc:mga0rr50_24004_c1 nmdc:mga0rr50_24004_c1_2586_3332 229
228 3300050514 nmdc:mga08x19_28730_c1 nmdc:mga08x19_28730_c1_1950_2696 229
229 3300050515 nmdc:mga0a205_22590_c1 nmdc:mga0a205_22590_c1_3167_3913 229
230 3300005458 Ga0070681_10349633 Ga0070681_103496333 230
231 3300025921 Ga0207652_10534900 Ga0207652_105349002 230
232 3300046472 Ga0495580_0000663 Ga0495580_0000663_24947_25693 230
233 3300060353 Ga0501082_0050120 Ga0501082_0050120_1631_2371 230
234 3300005364 Ga0070673_100254886 Ga0070673_1002548861 231
235 3300005546 Ga0070696_100383092 Ga0070696_1003830922 231
236 3300005841 Ga0068863_100389847 Ga0068863_1003898471 231
237 3300025920 Ga0207649_10452621 Ga0207649_104526212 231
238 3300025932 Ga0207690_10265743 Ga0207690_102657432 231
239 3300053085 Ga0495619_0079770 Ga0495619_0079770_778_1530 231
240 3300005353 Ga0070669_100161997 Ga0070669_1001619971 232
241 3300049572 Ga0501036_0307820 Ga0501036_0307820_204_944 232
242 3300049573 Ga0501037_0220767 Ga0501037_0220767_52_792 232
243 3300049574 Ga0501038_0433862 Ga0501038_0433862_136_876 232
244 3300049581 Ga0501047_0009177 Ga0501047_0009177_8424_9164 232
245 3300049742 Ga0501080_0172854 Ga0501080_0172854_153_893 232
246 3300049822 Ga0501035_0543620 Ga0501035_0543620_129_869 232
247 3300049823 Ga0501044_0016786 Ga0501044_0016786_2205_2945 232
248 3300005339 Ga0070660_100139432 Ga0070660_1001394322 233
249 3300005344 Ga0070661_100282494 Ga0070661_1002824942 233
250 3300005365 Ga0070688_100356666 Ga0070688_1003566661 233
251 3300005366 Ga0070659_100164043 Ga0070659_1001640431 233
252 3300005543 Ga0070672_100154318 Ga0070672_1001543183 233
253 3300005616 Ga0068852_100062049 Ga0068852_1000620492 233
254 3300005844 Ga0068862_100716574 Ga0068862_1007165742 233
255 3300013104 Ga0157370_10061023 Ga0157370_100610232 233
256 3300013105 Ga0157369_10058789 Ga0157369_100587894 233
257 3300013306 Ga0163162_10718787 Ga0163162_107187871 233
258 3300014745 Ga0157377_10465382 Ga0157377_104653821 233
259 3300025919 Ga0207657_10054479 Ga0207657_100544792 233
260 3300025921 Ga0207652_10270319 Ga0207652_102703193 233
261 3300025940 Ga0207691_10325923 Ga0207691_103259231 233
262 3300025949 Ga0207667_10458857 Ga0207667_104588572 233
263 3300005293 Ga0065715_10289579 Ga0065715_102895791 234
264 3300005329 Ga0070683_100003892 Ga0070683_1000038926 234
265 3300005331 Ga0070670_100030395 Ga0070670_1000303955 234
266 3300005331 Ga0070670_100059281 Ga0070670_1000592812 234
267 3300005335 Ga0070666_10297375 Ga0070666_102973751 234
268 3300005344 Ga0070661_100035223 Ga0070661_1000352233 234
269 3300005367 Ga0070667_100428952 Ga0070667_1004289522 234
270 3300005455 Ga0070663_100067580 Ga0070663_1000675803 234
271 3300005535 Ga0070684_100003202 Ga0070684_10000320212 234
272 3300005544 Ga0070686_100384271 Ga0070686_1003842711 234
273 3300005564 Ga0070664_100004690 Ga0070664_1000046906 234
274 3300005840 Ga0068870_10424111 Ga0068870_104241111 234
275 3300005841 Ga0068863_100271052 Ga0068863_1002710521 234
276 3300009177 Ga0105248_10075824 Ga0105248_100758242 234
277 3300025908 Ga0207643_10345605 Ga0207643_103456051 234
278 3300025920 Ga0207649_10097269 Ga0207649_100972693 234
279 3300025925 Ga0207650_10116911 Ga0207650_101169112 234
280 3300025933 Ga0207706_10096475 Ga0207706_100964753 234
281 3300025941 Ga0207711_10040866 Ga0207711_100408664 234
282 3300025944 Ga0207661_10027401 Ga0207661_100274015 234
283 3300025944 Ga0207661_10168781 Ga0207661_101687813 234
284 3300026067 Ga0207678_10081046 Ga0207678_100810463 234
285 3300026089 Ga0207648_10068442 Ga0207648_100684423 234
286 3300026142 Ga0207698_10433472 Ga0207698_104334722 234
287 3300026142 Ga0207698_10576903 Ga0207698_105769032 234
288 3300028380 Ga0268265_10119302 Ga0268265_101193021 234
289 3300048907 Ga0496104_0022186 Ga0496104_0022186_2129_2869 234
290 3300048908 Ga0496105_0244751 Ga0496105_0244751_140_880 234
291 3300048912 Ga0496109_0005670 Ga0496109_0005670_4520_5260 234
292 3300048913 Ga0496110_0000624 Ga0496110_0000624_5278_6018 234
293 3300048914 Ga0496111_0038547 Ga0496111_0038547_2386_3126 234
294 3300048915 Ga0496112_0001309 Ga0496112_0001309_1492_2232 234
295 3300050491 nmdc:mga00v17_332592_c1 nmdc:mga00v17_332592_c1_25_768 234
296 3300005330 Ga0070690_100144819 Ga0070690_1001448192 235
297 3300005367 Ga0070667_100031487 Ga0070667_1000314877 235
298 3300005456 Ga0070678_100630479 Ga0070678_1006304791 235
299 3300005458 Ga0070681_10210485 Ga0070681_102104853 235
300 3300005459 Ga0068867_100351233 Ga0068867_1003512332 235
301 3300005535 Ga0070684_100301319 Ga0070684_1003013192 235
302 3300005539 Ga0068853_100265985 Ga0068853_1002659851 235
303 3300005547 Ga0070693_100231999 Ga0070693_1002319991 235
304 3300005577 Ga0068857_100127435 Ga0068857_1001274352 235
305 3300005614 Ga0068856_100164239 Ga0068856_1001642392 235
306 3300005841 Ga0068863_100090613 Ga0068863_1000906135 235
307 3300005842 Ga0068858_100059594 Ga0068858_1000595947 235
308 3300005843 Ga0068860_100073073 Ga0068860_1000730732 235
309 3300006237 Ga0097621_100237521 Ga0097621_1002375213 235
310 3300009098 Ga0105245_10003461 Ga0105245_100034612 235
311 3300009098 Ga0105245_10697245 Ga0105245_106972451 235
312 3300009176 Ga0105242_10108271 Ga0105242_101082714 235
313 3300009176 Ga0105242_10159342 Ga0105242_101593424 235
314 3300009177 Ga0105248_10211065 Ga0105248_102110653 235
315 3300009177 Ga0105248_10632373 Ga0105248_106323731 235
316 3300009545 Ga0105237_10084650 Ga0105237_100846504 235
317 3300009551 Ga0105238_10211442 Ga0105238_102114421 235
318 3300011119 Ga0105246_10077902 Ga0105246_100779023 235
319 3300013296 Ga0157374_11123983 Ga0157374_111239831 235
320 3300013297 Ga0157378_10020571 Ga0157378_100205714 235
321 3300013297 Ga0157378_10143982 Ga0157378_101439821 235
322 3300013306 Ga0163162_10211090 Ga0163162_102110904 235
323 3300013307 Ga0157372_11261980 Ga0157372_112619801 235
324 3300013308 Ga0157375_10087017 Ga0157375_100870174 235
325 3300014968 Ga0157379_10069965 Ga0157379_100699656 235
326 3300025903 Ga0207680_10038955 Ga0207680_100389552 235
327 3300025911 Ga0207654_10263827 Ga0207654_102638271 235
328 3300025912 Ga0207707_10104251 Ga0207707_101042511 235
329 3300025914 Ga0207671_10281235 Ga0207671_102812351 235
330 3300025927 Ga0207687_10219150 Ga0207687_102191502 235
331 3300025927 Ga0207687_10292402 Ga0207687_102924021 235
332 3300025934 Ga0207686_10083358 Ga0207686_100833582 235
333 3300025934 Ga0207686_10095479 Ga0207686_100954792 235
334 3300025941 Ga0207711_10216573 Ga0207711_102165733 235
335 3300026023 Ga0207677_10093523 Ga0207677_100935233 235
336 3300026035 Ga0207703_10133703 Ga0207703_101337033 235
337 3300026041 Ga0207639_10542994 Ga0207639_105429942 235
338 3300026088 Ga0207641_10184808 Ga0207641_101848083 235
339 3300026116 Ga0207674_10172923 Ga0207674_101729232 235
340 3300026116 Ga0207674_10242800 Ga0207674_102428002 235
341 3300027682 Ga0209971_1059943 Ga0209971_10599431 235
342 3300028381 Ga0268264_10024593 Ga0268264_100245932 235
343 3300035692 Ga0373935_0345984 Ga0373935_0345984_282_992 235
344 3300035695 Ga0373927_0063070 Ga0373927_0063070_251_961 235
345 3300035725 Ga0373947_0029736 Ga0373947_0029736_28_738 235
346 3300046473 Ga0495582_0172882 Ga0495582_0172882_180_890 235
347 3300005330 Ga0070690_100010236 Ga0070690_1000102364 236
348 3300005335 Ga0070666_10066869 Ga0070666_100668693 236
349 3300005343 Ga0070687_100039069 Ga0070687_1000390692 236
350 3300005544 Ga0070686_100002492 Ga0070686_10000249210 236
351 3300005843 Ga0068860_100155186 Ga0068860_1001551863 236
352 3300009174 Ga0105241_10198729 Ga0105241_101987292 236
353 3300025903 Ga0207680_10049915 Ga0207680_100499153 236
354 3300025905 Ga0207685_10003073 Ga0207685_100030733 236
355 3300025911 Ga0207654_10029791 Ga0207654_100297913 236
356 3300025918 Ga0207662_10037923 Ga0207662_100379233 236
357 3300028381 Ga0268264_10109607 Ga0268264_101096072 236
358 3300048906 Ga0496103_0154769 Ga0496103_0154769_76_816 236
359 3300048910 Ga0496107_0047373 Ga0496107_0047373_2129_2869 236
360 3300049592 Ga0501076_0478279 Ga0501076_0478279_306_1016 236
361 3300050514 nmdc:mga08x19_493616_c1 nmdc:mga08x19_493616_c1_17_760 237
362 3300005458 Ga0070681_10236600 Ga0070681_102366002 238
363 3300005536 Ga0070697_100051373 Ga0070697_1000513735 238
364 3300028381 Ga0268264_10452669 Ga0268264_104526692 238
365 3300031731 Ga0307405_10016482 Ga0307405_100164824 238
366 3300031852 Ga0307410_10001317 Ga0307410_100013177 238
367 3300031903 Ga0307407_10008613 Ga0307407_100086134 238
368 3300031995 Ga0307409_100033201 Ga0307409_1000332014 238
369 3300032002 Ga0307416_100001846 Ga0307416_1000018464 238
370 3300032004 Ga0307414_10235179 Ga0307414_102351791 238
371 3300032005 Ga0307411_10006888 Ga0307411_100068885 238
372 3300042876 Ga0451577_0039643 Ga0451577_0039643_3328_4044 238
373 3300044712 Ga0453684_0026885 Ga0453684_0026885_4593_5309 238
374 3300048907 Ga0496104_0645482 Ga0496104_0645482_12_728 238
375 3300005336 Ga0070680_100398658 Ga0070680_1003986581 239
376 3300005353 Ga0070669_100290856 Ga0070669_1002908562 239
377 3300005434 Ga0070709_10236003 Ga0070709_102360031 239
378 3300005444 Ga0070694_100129220 Ga0070694_1001292202 239
379 3300005563 Ga0068855_100268303 Ga0068855_1002683032 239
380 3300005614 Ga0068856_100040533 Ga0068856_1000405335 239
381 3300006173 Ga0070716_100053080 Ga0070716_1000530803 239
382 3300006237 Ga0097621_100143559 Ga0097621_1001435592 239
383 3300007076 Ga0075435_100053442 Ga0075435_1000534423 239
384 3300009174 Ga0105241_10041662 Ga0105241_100416621 239
385 3300009174 Ga0105241_10060366 Ga0105241_100603662 239
386 3300009545 Ga0105237_10082777 Ga0105237_100827774 239
387 3300009551 Ga0105238_10098453 Ga0105238_100984532 239
388 3300009553 Ga0105249_10009507 Ga0105249_100095077 239
389 3300010375 Ga0105239_10006983 Ga0105239_100069831 239
390 3300013296 Ga0157374_10016513 Ga0157374_100165133 239
391 3300014968 Ga0157379_10998805 Ga0157379_109988051 239
392 3300025923 Ga0207681_10096142 Ga0207681_100961423 239
393 3300025949 Ga0207667_10095391 Ga0207667_100953912 239
394 3300026078 Ga0207702_10053520 Ga0207702_100535205 239
395 3300026116 Ga0207674_10116743 Ga0207674_101167431 239
396 3300031595 Ga0265313_10102510 Ga0265313_101025102 239
397 3300050512 nmdc:mga0n895_304741_c1 nmdc:mga0n895_304741_c1_573_1313 239
398 3300050513 nmdc:mga0rr50_2985_c1 nmdc:mga0rr50_2985_c1_2296_3036 239
399 3300053103 Ga0500555_000947 Ga0500555_000947_6597_7316 239
400 3300053153 Ga0500616_0000358 Ga0500616_0000358_9871_10590 239
401 3300053730 Ga0500645_000794 Ga0500645_000794_10030_10749 239
402 3300005329 Ga0070683_100523154 Ga0070683_1005231542 240
403 3300005331 Ga0070670_100233573 Ga0070670_1002335732 240
404 3300005334 Ga0068869_100240986 Ga0068869_1002409863 240
405 3300005335 Ga0070666_10159772 Ga0070666_101597723 240
406 3300005338 Ga0068868_100035790 Ga0068868_1000357904 240
407 3300005354 Ga0070675_100198227 Ga0070675_1001982273 240
408 3300005434 Ga0070709_10555411 Ga0070709_105554111 240
409 3300005459 Ga0068867_100009941 Ga0068867_1000099413 240
410 3300005544 Ga0070686_100075171 Ga0070686_1000751713 240
411 3300005548 Ga0070665_100001511 Ga0070665_1000015114 240
412 3300005564 Ga0070664_100019041 Ga0070664_1000190414 240
413 3300005564 Ga0070664_100194501 Ga0070664_1001945012 240
414 3300005578 Ga0068854_100081015 Ga0068854_1000810152 240
415 3300005616 Ga0068852_100002065 Ga0068852_10000206512 240
416 3300005841 Ga0068863_100433795 Ga0068863_1004337952 240
417 3300005843 Ga0068860_100104511 Ga0068860_1001045113 240
418 3300006881 Ga0068865_100070463 Ga0068865_1000704631 240
419 3300009098 Ga0105245_10078619 Ga0105245_100786193 240
420 3300009176 Ga0105242_10100215 Ga0105242_101002152 240
421 3300013306 Ga0163162_10162856 Ga0163162_101628563 240
422 3300013306 Ga0163162_10517852 Ga0163162_105178522 240
423 3300013308 Ga0157375_10043801 Ga0157375_100438012 240
424 3300014745 Ga0157377_10339025 Ga0157377_103390252 240
425 3300014968 Ga0157379_10142200 Ga0157379_101422001 240
426 3300025903 Ga0207680_10070062 Ga0207680_100700622 240
427 3300025927 Ga0207687_10143765 Ga0207687_101437652 240
428 3300025934 Ga0207686_10032295 Ga0207686_100322952 240
429 3300025938 Ga0207704_10086725 Ga0207704_100867253 240
430 3300025941 Ga0207711_10157690 Ga0207711_101576902 240
431 3300025945 Ga0207679_10142336 Ga0207679_101423362 240
432 3300025981 Ga0207640_10125635 Ga0207640_101256353 240
433 3300026023 Ga0207677_10021944 Ga0207677_100219445 240
434 3300026088 Ga0207641_10391541 Ga0207641_103915412 240
435 3300026121 Ga0207683_10094302 Ga0207683_100943022 240
436 3300028379 Ga0268266_10019500 Ga0268266_100195003 240
437 3300028381 Ga0268264_10361791 Ga0268264_103617912 240
438 3300044842 Ga0466957_0279098 Ga0466957_0279098_252_977 240
439 3300048910 Ga0496107_0488291 Ga0496107_0488291_119_898 240
440 3300048911 Ga0496108_0374234 Ga0496108_0374234_72_908 240
441 3300048917 Ga0496114_0120928 Ga0496114_0120928_907_1686 240
442 3300005293 Ga0065715_10131453 Ga0065715_101314532 241
443 3300005336 Ga0070680_100027651 Ga0070680_1000276515 241
444 3300005339 Ga0070660_100001424 Ga0070660_10000142415 241
445 3300005344 Ga0070661_100014481 Ga0070661_1000144814 241
446 3300005345 Ga0070692_10078323 Ga0070692_100783232 241
447 3300005354 Ga0070675_100000024 Ga0070675_10000002444 241
448 3300005355 Ga0070671_100004012 Ga0070671_1000040122 241
449 3300005364 Ga0070673_100010272 Ga0070673_1000102728 241
450 3300005366 Ga0070659_100002336 Ga0070659_1000023369 241
451 3300005441 Ga0070700_100000002 Ga0070700_100000002195 241
452 3300005457 Ga0070662_100001043 Ga0070662_10000104316 241
453 3300005466 Ga0070685_10052729 Ga0070685_100527292 241
454 3300005518 Ga0070699_100420738 Ga0070699_1004207382 241
455 3300005539 Ga0068853_100004333 Ga0068853_10000433311 241
456 3300005563 Ga0068855_100002546 Ga0068855_10000254613 241
457 3300005564 Ga0070664_100001257 Ga0070664_10000125711 241
458 3300005614 Ga0068856_100001602 Ga0068856_10000160215 241
459 3300005719 Ga0068861_100062251 Ga0068861_1000622512 241
460 3300005840 Ga0068870_10211757 Ga0068870_102117572 241
461 3300006358 Ga0068871_100565834 Ga0068871_1005658342 241
462 3300006844 Ga0075428_100000766 Ga0075428_10000076620 241
463 3300006844 Ga0075428_100372954 Ga0075428_1003729542 241
464 3300006852 Ga0075433_10000591 Ga0075433_1000059123 241
465 3300006871 Ga0075434_100000646 Ga0075434_10000064625 241
466 3300006871 Ga0075434_100316128 Ga0075434_1003161282 241
467 3300007076 Ga0075435_100241052 Ga0075435_1002410522 241
468 3300009094 Ga0111539_10000006 Ga0111539_10000006198 241
469 3300009147 Ga0114129_10128654 Ga0114129_101286542 241
470 3300009147 Ga0114129_10204178 Ga0114129_102041782 241
471 3300009147 Ga0114129_10460278 Ga0114129_104602782 241
472 3300009176 Ga0105242_10058900 Ga0105242_100589005 241
473 3300010375 Ga0105239_10168258 Ga0105239_101682582 241
474 3300013100 Ga0157373_10000924 Ga0157373_1000092413 241
475 3300013102 Ga0157371_10000522 Ga0157371_1000052230 241
476 3300013307 Ga0157372_10000791 Ga0157372_1000079117 241
477 3300014969 Ga0157376_10176462 Ga0157376_101764622 241
478 3300021358 Ga0213873_10000004 Ga0213873_1000000497 241
479 3300021384 Ga0213876_10000007 Ga0213876_1000000797 241
480 3300025728 Ga0207655_1034605 Ga0207655_10346052 241
481 3300025908 Ga0207643_10268673 Ga0207643_102686732 241
482 3300025918 Ga0207662_10131893 Ga0207662_101318932 241
483 3300025919 Ga0207657_10000657 Ga0207657_1000065720 241
484 3300025920 Ga0207649_10036123 Ga0207649_100361233 241
485 3300025925 Ga0207650_10239313 Ga0207650_102393131 241
486 3300025926 Ga0207659_10000029 Ga0207659_1000002954 241
487 3300025931 Ga0207644_10010522 Ga0207644_100105226 241
488 3300025932 Ga0207690_10000412 Ga0207690_1000041216 241
489 3300025933 Ga0207706_10000164 Ga0207706_1000016420 241
490 3300025945 Ga0207679_10000601 Ga0207679_100006018 241
491 3300025949 Ga0207667_10006146 Ga0207667_100061467 241
492 3300025960 Ga0207651_10046652 Ga0207651_100466522 241
493 3300026041 Ga0207639_10004129 Ga0207639_1000412910 241
494 3300026075 Ga0207708_10000137 Ga0207708_1000013735 241
495 3300026118 Ga0207675_100042406 Ga0207675_1000424062 241
496 3300026121 Ga0207683_10148174 Ga0207683_101481743 241
497 3300027614 Ga0209970_1018522 Ga0209970_10185222 241
498 3300027907 Ga0207428_10000007 Ga0207428_10000007197 241
499 3300039437 Ga0436365_0073603 Ga0436365_0073603_20119_20847 241
500 3300039453 Ga0436362_0290430 Ga0436362_0290430_661853_662581 241
501 3300046515 Ga0495620_0001137 Ga0495620_0001137_11301_12029 241
502 3300046525 Ga0495663_0004342 Ga0495663_0004342_3209_3940 241
503 3300048906 Ga0496103_0085381 Ga0496103_0085381_169_930 241
504 3300048909 Ga0496106_0012297 Ga0496106_0012297_307_1068 241
505 3300048910 Ga0496107_0001319 Ga0496107_0001319_11777_12538 241
506 3300050507 nmdc:mga05p37_426951_c1 nmdc:mga05p37_426951_c1_618_1397 241
507 3300050509 nmdc:mga0qj67_28397_c1 nmdc:mga0qj67_28397_c1_3415_4194 241
508 3300050510 nmdc:mga06r32_293267_c1 nmdc:mga06r32_293267_c1_671_1450 241
509 3300050511 nmdc:mga08y16_11_c1 nmdc:mga08y16_11_c1_210924_211652 241
510 3300050512 nmdc:mga0n895_11721_c1 nmdc:mga0n895_11721_c1_4007_4753 241
511 3300050515 nmdc:mga0a205_135_c1 nmdc:mga0a205_135_c1_9395_10141 241
512 3300054114 Ga0501084_0064935 Ga0501084_0064935_1635_2414 241
513 iso_pu_bacteria 2738541281 2738743534 241
514 iso_pu_bacteria 2738543032 2739352441 241
515 iso_pu_bacteria 2842698319 2842698399 241
516 3300005539 Ga0068853_100007729 Ga0068853_1000077299 242
517 3300009093 Ga0105240_10011838 Ga0105240_100118385 242
518 3300013104 Ga0157370_10005379 Ga0157370_100053793 242
519 3300025913 Ga0207695_10028893 Ga0207695_100288935 242
520 3300025923 Ga0207681_10248008 Ga0207681_102480082 242
521 3300026041 Ga0207639_10000020 Ga0207639_1000002024 242
522 3300005293 Ga0065715_10313025 Ga0065715_103130252 243
523 3300005543 Ga0070672_100000697 Ga0070672_10000069719 243
524 3300005618 Ga0068864_100000008 Ga0068864_100000008309 243
525 3300005840 Ga0068870_10015161 Ga0068870_100151613 243
526 3300013297 Ga0157378_10004023 Ga0157378_100040233 243
527 3300013297 Ga0157378_10088588 Ga0157378_100885882 243
528 3300013308 Ga0157375_10000090 Ga0157375_1000009046 243
529 3300014326 Ga0157380_10001455 Ga0157380_1000145511 243
530 3300014745 Ga0157377_10071610 Ga0157377_100716102 243
531 3300025908 Ga0207643_10061984 Ga0207643_100619842 243
532 3300025934 Ga0207686_10438937 Ga0207686_104389371 243
533 3300025940 Ga0207691_10000507 Ga0207691_1000050738 243
534 3300026035 Ga0207703_10420203 Ga0207703_104202032 243
535 3300026095 Ga0207676_10000070 Ga0207676_1000007014 243
536 3300035398 Ga0316574_0087066 Ga0316574_0087066_1149_1937 243
537 3300013105 Ga0157369_10792833 Ga0157369_107928331 244
538 3300025299 Ga0209256_1001169 Ga0209256_100116929 244
539 3300031665 Ga0316575_10004145 Ga0316575_100041454 244
540 3300031901 Ga0307406_10131645 Ga0307406_101316452 244
541 3300038726 Ga0400490_21567 Ga0400490_21567_116_856 244
542 3300039062 Ga0400483_088593 Ga0400483_088593_238_978 244
543 3300039062 Ga0400483_220029 Ga0400483_220029_200_940 244
544 3300039062 Ga0400483_288640 Ga0400483_288640_149_889 244
545 3300046683 Ga0495658_0303323 Ga0495658_0303323_65_802 244
546 3300005327 Ga0070658_10036744 Ga0070658_100367445 245
547 3300005328 Ga0070676_10009423 Ga0070676_100094231 245
548 3300005328 Ga0070676_10061097 Ga0070676_100610971 245
549 3300005329 Ga0070683_100000103 Ga0070683_10000010333 245
550 3300005331 Ga0070670_100000067 Ga0070670_10000006719 245
551 3300005331 Ga0070670_100537385 Ga0070670_1005373852 245
552 3300005335 Ga0070666_10247604 Ga0070666_102476041 245
553 3300005337 Ga0070682_100115728 Ga0070682_1001157282 245
554 3300005338 Ga0068868_100000249 Ga0068868_10000024921 245
555 3300005341 Ga0070691_10016151 Ga0070691_100161514 245
556 3300005347 Ga0070668_100020426 Ga0070668_1000204265 245
557 3300005347 Ga0070668_100072726 Ga0070668_1000727263 245
558 3300005353 Ga0070669_100014658 Ga0070669_1000146583 245
559 3300005353 Ga0070669_100018415 Ga0070669_1000184153 245
560 3300005353 Ga0070669_100160261 Ga0070669_1001602612 245
561 3300005354 Ga0070675_100022458 Ga0070675_1000224586 245
562 3300005356 Ga0070674_100003652 Ga0070674_1000036525 245
563 3300005364 Ga0070673_100033153 Ga0070673_1000331533 245
564 3300005364 Ga0070673_100102714 Ga0070673_1001027142 245
565 3300005365 Ga0070688_100090761 Ga0070688_1000907612 245
566 3300005367 Ga0070667_100168212 Ga0070667_1001682123 245
567 3300005436 Ga0070713_100017090 Ga0070713_1000170904 245
568 3300005438 Ga0070701_10000046 Ga0070701_100000466 245
569 3300005440 Ga0070705_100070152 Ga0070705_1000701522 245
570 3300005440 Ga0070705_100288396 Ga0070705_1002883962 245
571 3300005441 Ga0070700_100140371 Ga0070700_1001403712 245
572 3300005444 Ga0070694_100088039 Ga0070694_1000880392 245
573 3300005456 Ga0070678_100029651 Ga0070678_1000296513 245
574 3300005459 Ga0068867_100065639 Ga0068867_1000656392 245
575 3300005467 Ga0070706_100008767 Ga0070706_10000876711 245
576 3300005518 Ga0070699_100029308 Ga0070699_1000293082 245
577 3300005535 Ga0070684_100000272 Ga0070684_10000027216 245
578 3300005544 Ga0070686_100139275 Ga0070686_1001392752 245
579 3300005545 Ga0070695_100012541 Ga0070695_1000125414 245
580 3300005545 Ga0070695_100063286 Ga0070695_1000632863 245
581 3300005546 Ga0070696_100035542 Ga0070696_1000355423 245
582 3300005546 Ga0070696_100151782 Ga0070696_1001517822 245
583 3300005549 Ga0070704_100024190 Ga0070704_1000241903 245
584 3300005549 Ga0070704_100143459 Ga0070704_1001434591 245
585 3300005564 Ga0070664_100237840 Ga0070664_1002378402 245
586 3300005578 Ga0068854_100012221 Ga0068854_1000122212 245
587 3300005578 Ga0068854_100097336 Ga0068854_1000973362 245
588 3300005615 Ga0070702_100003512 Ga0070702_1000035126 245
589 3300005617 Ga0068859_100191464 Ga0068859_1001914643 245
590 3300005617 Ga0068859_100760190 Ga0068859_1007601902 245
591 3300005842 Ga0068858_100378784 Ga0068858_1003787841 245
592 3300005844 Ga0068862_100130380 Ga0068862_1001303802 245
593 3300005844 Ga0068862_100147463 Ga0068862_1001474633 245
594 3300006028 Ga0070717_10000173 Ga0070717_1000017346 245
595 3300006175 Ga0070712_100082736 Ga0070712_1000827363 245
596 3300006237 Ga0097621_100383543 Ga0097621_1003835433 245
597 3300006237 Ga0097621_100584032 Ga0097621_1005840322 245
598 3300006358 Ga0068871_100460687 Ga0068871_1004606872 245
599 3300006844 Ga0075428_100032301 Ga0075428_1000323018 245
600 3300006847 Ga0075431_100071048 Ga0075431_1000710481 245
601 3300006847 Ga0075431_100458835 Ga0075431_1004588352 245
602 3300006852 Ga0075433_10026331 Ga0075433_100263313 245
603 3300006852 Ga0075433_10105430 Ga0075433_101054303 245
604 3300006871 Ga0075434_100107638 Ga0075434_1001076383 245
605 3300006871 Ga0075434_100360792 Ga0075434_1003607922 245
606 3300006871 Ga0075434_100390397 Ga0075434_1003903973 245
607 3300006880 Ga0075429_100026441 Ga0075429_1000264415 245
608 3300006914 Ga0075436_100004991 Ga0075436_1000049917 245
609 3300006931 Ga0097620_100191467 Ga0097620_1001914672 245
610 3300006931 Ga0097620_100760088 Ga0097620_1007600882 245
611 3300007076 Ga0075435_100000206 Ga0075435_1000002064 245
612 3300007076 Ga0075435_100000827 Ga0075435_1000008279 245
613 3300009093 Ga0105240_10307336 Ga0105240_103073363 245
614 3300009094 Ga0111539_10035710 Ga0111539_100357104 245
615 3300009098 Ga0105245_10000003 Ga0105245_10000003212 245
616 3300009147 Ga0114129_10011524 Ga0114129_1001152415 245
617 3300009147 Ga0114129_10022775 Ga0114129_100227753 245
618 3300009147 Ga0114129_10040772 Ga0114129_100407728 245
619 3300009147 Ga0114129_10071391 Ga0114129_100713915 245
620 3300009147 Ga0114129_10140398 Ga0114129_101403983 245
621 3300009147 Ga0114129_10734743 Ga0114129_107347431 245
622 3300009148 Ga0105243_10081994 Ga0105243_100819942 245
623 3300009148 Ga0105243_10121295 Ga0105243_101212952 245
624 3300009148 Ga0105243_10309941 Ga0105243_103099412 245
625 3300009176 Ga0105242_10047887 Ga0105242_100478875 245
626 3300009176 Ga0105242_10784137 Ga0105242_107841372 245
627 3300009177 Ga0105248_10178399 Ga0105248_101783993 245
628 3300009177 Ga0105248_10749364 Ga0105248_107493642 245
629 3300009551 Ga0105238_10000001 Ga0105238_100000011746 245
630 3300013105 Ga0157369_10000189 Ga0157369_1000018963 245
631 3300013296 Ga0157374_10000037 Ga0157374_1000003746 245
632 3300013296 Ga0157374_11182159 Ga0157374_111821591 245
633 3300013297 Ga0157378_10000335 Ga0157378_1000033547 245
634 3300013297 Ga0157378_10054920 Ga0157378_100549202 245
635 3300013308 Ga0157375_10000009 Ga0157375_10000009208 245
636 3300013308 Ga0157375_10002231 Ga0157375_100022311 245
637 3300014326 Ga0157380_10029606 Ga0157380_100296066 245
638 3300014326 Ga0157380_10418274 Ga0157380_104182742 245
639 3300014326 Ga0157380_10845906 Ga0157380_108459061 245
640 3300014745 Ga0157377_10000008 Ga0157377_1000000845 245
641 3300014968 Ga0157379_10026158 Ga0157379_100261582 245
642 3300014969 Ga0157376_10000006 Ga0157376_10000006229 245
643 3300014969 Ga0157376_10189913 Ga0157376_101899132 245
644 3300014969 Ga0157376_10442726 Ga0157376_104427262 245
645 3300017792 Ga0163161_10343154 Ga0163161_103431541 245
646 3300021384 Ga0213876_10000188 Ga0213876_100001884 245
647 3300021384 Ga0213876_10001441 Ga0213876_1000144117 245
648 3300025315 Ga0207697_10093776 Ga0207697_100937762 245
649 3300025885 Ga0207653_10022344 Ga0207653_100223443 245
650 3300025893 Ga0207682_10011341 Ga0207682_100113413 245
651 3300025901 Ga0207688_10252004 Ga0207688_102520042 245
652 3300025905 Ga0207685_10059931 Ga0207685_100599311 245
653 3300025907 Ga0207645_10048029 Ga0207645_100480293 245
654 3300025909 Ga0207705_10028399 Ga0207705_100283995 245
655 3300025922 Ga0207646_10014498 Ga0207646_100144986 245
656 3300025922 Ga0207646_10144424 Ga0207646_101444243 245
657 3300025923 Ga0207681_10007040 Ga0207681_100070406 245
658 3300025924 Ga0207694_10000001 Ga0207694_100000012778 245
659 3300025925 Ga0207650_10000067 Ga0207650_1000006734 245
660 3300025925 Ga0207650_10030839 Ga0207650_100308393 245
661 3300025925 Ga0207650_10094165 Ga0207650_100941653 245
662 3300025925 Ga0207650_10483916 Ga0207650_104839162 245
663 3300025926 Ga0207659_10062527 Ga0207659_100625273 245
664 3300025927 Ga0207687_10000002 Ga0207687_10000002210 245
665 3300025928 Ga0207700_10012662 Ga0207700_100126625 245
666 3300025933 Ga0207706_10069498 Ga0207706_100694983 245
667 3300025934 Ga0207686_10122173 Ga0207686_101221732 245
668 3300025934 Ga0207686_10149491 Ga0207686_101494912 245
669 3300025935 Ga0207709_10072229 Ga0207709_100722291 245
670 3300025935 Ga0207709_10380402 Ga0207709_103804022 245
671 3300025937 Ga0207669_10014593 Ga0207669_100145933 245
672 3300025937 Ga0207669_10077132 Ga0207669_100771322 245
673 3300025938 Ga0207704_10170536 Ga0207704_101705362 245
674 3300025940 Ga0207691_10069774 Ga0207691_100697743 245
675 3300025942 Ga0207689_10013673 Ga0207689_100136736 245
676 3300025944 Ga0207661_10000007 Ga0207661_10000007104 245
677 3300025945 Ga0207679_10337098 Ga0207679_103370982 245
678 3300025961 Ga0207712_10044024 Ga0207712_100440243 245
679 3300025972 Ga0207668_10080220 Ga0207668_100802202 245
680 3300025981 Ga0207640_10000706 Ga0207640_1000070611 245
681 3300025981 Ga0207640_10169104 Ga0207640_101691042 245
682 3300026023 Ga0207677_10000133 Ga0207677_1000013336 245
683 3300026035 Ga0207703_10319808 Ga0207703_103198083 245
684 3300026035 Ga0207703_10580803 Ga0207703_105808032 245
685 3300026089 Ga0207648_10021903 Ga0207648_100219036 245
686 3300026089 Ga0207648_10298493 Ga0207648_102984932 245
687 3300026089 Ga0207648_10758783 Ga0207648_107587831 245
688 3300026118 Ga0207675_100027931 Ga0207675_1000279315 245
689 3300027907 Ga0207428_10030188 Ga0207428_100301883 245
690 3300028380 Ga0268265_10849730 Ga0268265_108497302 245
691 3300030521 Ga0307511_10005518 Ga0307511_100055183 245
692 3300035117 Ga0373953_0099664 Ga0373953_0099664_232_972 245
693 3300035119 Ga0373956_0084689 Ga0373956_0084689_633_1373 245
694 3300035172 Ga0373955_0338157 Ga0373955_0338157_42_782 245
695 3300035410 Ga0373924_0029665 Ga0373924_0029665_980_1720 245
696 3300036401 Ga0373937_0343274 Ga0373937_0343274_189_929 245
697 3300036401 Ga0373937_0622026 Ga0373937_0622026_22_762 245
698 3300037068 Ga0373925_0199856 Ga0373925_0199856_101_841 245
699 3300037853 Ga0436364_1377383 Ga0436364_1377383_853_1593 245
700 3300039437 Ga0436365_0506999 Ga0436365_0506999_11908_12648 245
701 3300039437 Ga0436365_0637274 Ga0436365_0637274_2711_3451 245
702 3300039453 Ga0436362_1187303 Ga0436362_1187303_8460_9200 245
703 3300042001 Ga0439441_038281 Ga0439441_038281_75_815 245
704 3300042436 Ga0439435_0003908 Ga0439435_0003908_24_764 245
705 3300042439 Ga0439464_0043281 Ga0439464_0043281_158_898 245
706 3300042876 Ga0451577_0117602 Ga0451577_0117602_1290_2030 245
707 3300045051 Ga0451576_0000210 Ga0451576_0000210_122773_123513 245
708 3300045051 Ga0451576_0411870 Ga0451576_0411870_154_894 245
709 3300046455 Ga0495603_0098969 Ga0495603_0098969_354_1094 245
710 3300046473 Ga0495582_0030783 Ga0495582_0030783_1825_2565 245
711 3300046533 Ga0495640_0123983 Ga0495640_0123983_129_869 245
712 3300046533 Ga0495640_0411422 Ga0495640_0411422_42_782 245
713 3300046642 Ga0495634_0310140 Ga0495634_0310140_15_755 245
714 3300046663 Ga0495635_0461852 Ga0495635_0461852_34_774 245
715 3300046681 Ga0495647_0035101 Ga0495647_0035101_85_825 245
716 3300046683 Ga0495658_0028039 Ga0495658_0028039_972_1712 245
717 3300046683 Ga0495658_0107310 Ga0495658_0107310_37_777 245
718 3300046689 Ga0495613_0239505 Ga0495613_0239505_368_1108 245
719 3300047319 Ga0495674_0341041 Ga0495674_0341041_106_846 245
720 3300047446 Ga0495679_008002 Ga0495679_008002_3204_3944 245
721 3300048903 Ga0496100_0105940 Ga0496100_0105940_14_754 245
722 3300048903 Ga0496100_0196378 Ga0496100_0196378_483_1223 245
723 3300048903 Ga0496100_0458303 Ga0496100_0458303_152_892 245
724 3300048904 Ga0496101_0000804 Ga0496101_0000804_16193_16933 245
725 3300048907 Ga0496104_0174282 Ga0496104_0174282_379_1119 245
726 3300048908 Ga0496105_0016985 Ga0496105_0016985_3308_4048 245
727 3300048909 Ga0496106_0073654 Ga0496106_0073654_577_1317 245
728 3300048910 Ga0496107_0027201 Ga0496107_0027201_735_1475 245
729 3300048916 Ga0496113_0405722 Ga0496113_0405722_216_956 245
730 3300048917 Ga0496114_0001096 Ga0496114_0001096_1932_2672 245
731 3300048918 Ga0496115_0030979 Ga0496115_0030979_3262_4002 245
732 3300049571 Ga0501034_0050704 Ga0501034_0050704_180_920 245
733 3300049591 Ga0501075_0191716 Ga0501075_0191716_499_1239 245
734 3300050507 nmdc:mga05p37_2308_c1 nmdc:mga05p37_2308_c1_6378_7118 245
735 3300050507 nmdc:mga05p37_564957_c1 nmdc:mga05p37_564957_c1_511_1251 245
736 3300050507 nmdc:mga05p37_70113_c1 nmdc:mga05p37_70113_c1_2232_2972 245
737 3300050507 nmdc:mga05p37_76566_c2 nmdc:mga05p37_76566_c2_1366_2106 245
738 3300050507 nmdc:mga05p37_94815_c1 nmdc:mga05p37_94815_c1_281_1021 245
739 3300050510 nmdc:mga06r32_510229_c1 nmdc:mga06r32_510229_c1_241_981 245
740 3300050510 nmdc:mga06r32_58829_c1 nmdc:mga06r32_58829_c1_174_914 245
741 3300050511 nmdc:mga08y16_25248_c1 nmdc:mga08y16_25248_c1_163_903 245
742 3300050511 nmdc:mga08y16_627183_c1 nmdc:mga08y16_627183_c1_276_1016 245
743 3300050512 nmdc:mga0n895_11942_c1 nmdc:mga0n895_11942_c1_4007_4747 245
744 3300050512 nmdc:mga0n895_197254_c1 nmdc:mga0n895_197254_c1_297_1037 245
745 3300050513 nmdc:mga0rr50_1256_c1 nmdc:mga0rr50_1256_c1_8332_9072 245
746 3300050513 nmdc:mga0rr50_53607_c1 nmdc:mga0rr50_53607_c1_1525_2265 245
747 3300050514 nmdc:mga08x19_112678_c1 nmdc:mga08x19_112678_c1_317_1057 245
748 3300050514 nmdc:mga08x19_1832_c1 nmdc:mga08x19_1832_c1_7070_7810 245
749 3300050515 nmdc:mga0a205_120152_c1 nmdc:mga0a205_120152_c1_1544_2284 245
750 3300050515 nmdc:mga0a205_51011_c1 nmdc:mga0a205_51011_c1_2262_3002 245
751 3300050515 nmdc:mga0a205_6061_c2 nmdc:mga0a205_6061_c2_1476_2216 245
752 3300053083 Ga0495655_0000046 Ga0495655_0000046_16817_17557 245
753 3300053085 Ga0495619_0074996 Ga0495619_0074996_1148_1888 245
754 3300053085 Ga0495619_0207257 Ga0495619_0207257_285_1025 245
755 3300005331 Ga0070670_100466707 Ga0070670_1004667071 246
756 3300005364 Ga0070673_100166618 Ga0070673_1001666182 246
757 3300005468 Ga0070707_100673925 Ga0070707_1006739251 246
758 3300021384 Ga0213876_10012783 Ga0213876_100127834 246
759 3300025981 Ga0207640_10013301 Ga0207640_100133016 246
760 3300034816 Ga0373930_0002059 Ga0373930_0002059_2120_2863 246
761 3300034817 Ga0373948_0015607 Ga0373948_0015607_456_1199 246
762 3300034818 Ga0373950_0001150 Ga0373950_0001150_2587_3330 246
763 3300034820 Ga0373959_0003969 Ga0373959_0003969_178_921 246
764 3300034957 Ga0373938_0002076 Ga0373938_0002076_201_944 246
765 3300035084 Ga0373928_0003150 Ga0373928_0003150_431_1174 246
766 3300035085 Ga0373929_0001579 Ga0373929_0001579_2718_3461 246
767 3300035088 Ga0373940_0002324 Ga0373940_0002324_2387_3130 246
768 3300035091 Ga0373951_0000829 Ga0373951_0000829_5584_6327 246
769 3300035092 Ga0373952_0002814 Ga0373952_0002814_212_955 246
770 3300035112 Ga0373932_0001595 Ga0373932_0001595_3284_4027 246
771 3300035114 Ga0373939_0000651 Ga0373939_0000651_5196_5939 246
772 3300035207 Ga0373942_0000393 Ga0373942_0000393_6404_7147 246
773 3300035241 Ga0373961_0006271 Ga0373961_0006271_608_1351 246
774 3300035242 Ga0373962_0015994 Ga0373962_0015994_518_1261 246
775 3300035691 Ga0373931_0000361 Ga0373931_0000361_15849_16592 246
776 3300039437 Ga0436365_1929564 Ga0436365_1929564_1762_2505 246
777 3300042876 Ga0451577_0057152 Ga0451577_0057152_167_910 246
778 3300044712 Ga0453684_0012886 Ga0453684_0012886_129_872 246
779 3300045051 Ga0451576_0258421 Ga0451576_0258421_146_889 246
780 3300049576 Ga0501040_0394708 Ga0501040_0394708_14_757 246
781 3300005331 Ga0070670_100143517 Ga0070670_1001435173 247
782 3300005340 Ga0070689_100069597 Ga0070689_1000695973 247
783 3300005353 Ga0070669_100154226 Ga0070669_1001542263 247
784 3300005365 Ga0070688_100015314 Ga0070688_1000153143 247
785 3300005466 Ga0070685_10102132 Ga0070685_101021323 247
786 3300005563 Ga0068855_100349002 Ga0068855_1003490022 247
787 3300005617 Ga0068859_100112325 Ga0068859_1001123251 247
788 3300005719 Ga0068861_100409636 Ga0068861_1004096362 247
789 3300005844 Ga0068862_100035873 Ga0068862_1000358734 247
790 3300006871 Ga0075434_100387945 Ga0075434_1003879451 247
791 3300006914 Ga0075436_100175483 Ga0075436_1001754831 247
792 3300006931 Ga0097620_100050245 Ga0097620_1000502454 247
793 3300006931 Ga0097620_100112323 Ga0097620_1001123231 247
794 3300025923 Ga0207681_10046474 Ga0207681_100464743 247
795 3300025924 Ga0207694_10699319 Ga0207694_106993191 247
796 3300025925 Ga0207650_10126693 Ga0207650_101266933 247
797 3300026035 Ga0207703_10284565 Ga0207703_102845652 247
798 3300026118 Ga0207675_100280705 Ga0207675_1002807052 247
799 3300028380 Ga0268265_10049224 Ga0268265_100492244 247
800 3300028653 Ga0265323_10003583 Ga0265323_100035835 247
801 3300035121 Ga0373960_0069817 Ga0373960_0069817_258_1004 247
802 3300035242 Ga0373962_0018558 Ga0373962_0018558_552_1307 247
803 3300035410 Ga0373924_0008857 Ga0373924_0008857_2626_3372 247
804 3300046454 Ga0495592_0170897 Ga0495592_0170897_85_831 247
805 3300050511 nmdc:mga08y16_170629_c1 nmdc:mga08y16_170629_c1_77_832 247
806 3300050512 nmdc:mga0n895_118847_c1 nmdc:mga0n895_118847_c1_1217_1963 247
807 3300050512 nmdc:mga0n895_121367_c1 nmdc:mga0n895_121367_c1_490_1236 247
808 3300050514 nmdc:mga08x19_137947_c1 nmdc:mga08x19_137947_c1_48_794 247
809 3300005331 Ga0070670_100177231 Ga0070670_1001772313 248
810 3300005340 Ga0070689_100140224 Ga0070689_1001402242 248
811 3300005353 Ga0070669_100054955 Ga0070669_1000549552 248
812 3300005354 Ga0070675_100097323 Ga0070675_1000973233 248
813 3300005365 Ga0070688_100421906 Ga0070688_1004219061 248
814 3300005843 Ga0068860_100159852 Ga0068860_1001598523 248
815 3300005844 Ga0068862_100098405 Ga0068862_1000984053 248
816 3300006038 Ga0075365_10027146 Ga0075365_100271462 248
817 3300006237 Ga0097621_100690649 Ga0097621_1006906491 248
818 3300014326 Ga0157380_10018325 Ga0157380_100183254 248
819 3300021384 Ga0213876_10013225 Ga0213876_100132255 248
820 3300025912 Ga0207707_10292269 Ga0207707_102922692 248
821 3300025925 Ga0207650_10128475 Ga0207650_101284752 248
822 3300025926 Ga0207659_10007970 Ga0207659_100079703 248
823 3300025936 Ga0207670_10131433 Ga0207670_101314333 248
824 3300025937 Ga0207669_10484956 Ga0207669_104849561 248
825 3300025986 Ga0207658_10273361 Ga0207658_102733612 248
826 3300026089 Ga0207648_10410248 Ga0207648_104102482 248
827 3300026095 Ga0207676_10324824 Ga0207676_103248242 248
828 3300039437 Ga0436365_0857751 Ga0436365_0857751_2352_3104 248
829 3300048911 Ga0496108_0440771 Ga0496108_0440771_254_1000 248
830 3300005327 Ga0070658_10030721 Ga0070658_100307215 249
831 3300005329 Ga0070683_100007321 Ga0070683_1000073218 249
832 3300005329 Ga0070683_100090357 Ga0070683_1000903572 249
833 3300005330 Ga0070690_100051381 Ga0070690_1000513812 249
834 3300005331 Ga0070670_100185117 Ga0070670_1001851171 249
835 3300005333 Ga0070677_10139765 Ga0070677_101397651 249
836 3300005334 Ga0068869_100001503 Ga0068869_10000150315 249
837 3300005334 Ga0068869_100522555 Ga0068869_1005225551 249
838 3300005335 Ga0070666_10036930 Ga0070666_100369304 249
839 3300005335 Ga0070666_10074739 Ga0070666_100747393 249
840 3300005335 Ga0070666_10199825 Ga0070666_101998252 249
841 3300005336 Ga0070680_100010342 Ga0070680_1000103422 249
842 3300005338 Ga0068868_100378529 Ga0068868_1003785291 249
843 3300005339 Ga0070660_100061388 Ga0070660_1000613881 249
844 3300005339 Ga0070660_100066723 Ga0070660_1000667232 249
845 3300005340 Ga0070689_100040781 Ga0070689_1000407811 249
846 3300005340 Ga0070689_100131609 Ga0070689_1001316093 249
847 3300005341 Ga0070691_10260118 Ga0070691_102601181 249
848 3300005347 Ga0070668_100089160 Ga0070668_1000891601 249
849 3300005347 Ga0070668_100167689 Ga0070668_1001676892 249
850 3300005353 Ga0070669_100040387 Ga0070669_1000403873 249
851 3300005354 Ga0070675_100278424 Ga0070675_1002784242 249
852 3300005355 Ga0070671_100201322 Ga0070671_1002013221 249
853 3300005356 Ga0070674_100045494 Ga0070674_1000454942 249
854 3300005356 Ga0070674_100071548 Ga0070674_1000715482 249
855 3300005364 Ga0070673_100095905 Ga0070673_1000959052 249
856 3300005364 Ga0070673_100126635 Ga0070673_1001266353 249
857 3300005365 Ga0070688_100193180 Ga0070688_1001931801 249
858 3300005366 Ga0070659_100018516 Ga0070659_1000185165 249
859 3300005366 Ga0070659_100058644 Ga0070659_1000586441 249
860 3300005367 Ga0070667_100053230 Ga0070667_1000532304 249
861 3300005367 Ga0070667_100812854 Ga0070667_1008128541 249
862 3300005435 Ga0070714_100320031 Ga0070714_1003200312 249
863 3300005445 Ga0070708_100004030 Ga0070708_1000040302 249
864 3300005456 Ga0070678_100172994 Ga0070678_1001729942 249
865 3300005456 Ga0070678_100416255 Ga0070678_1004162552 249
866 3300005471 Ga0070698_100196617 Ga0070698_1001966172 249
867 3300005518 Ga0070699_100097321 Ga0070699_1000973212 249
868 3300005535 Ga0070684_100031500 Ga0070684_1000315005 249
869 3300005539 Ga0068853_100021278 Ga0068853_1000212783 249
870 3300005543 Ga0070672_100004237 Ga0070672_1000042374 249
871 3300005543 Ga0070672_100336758 Ga0070672_1003367582 249
872 3300005547 Ga0070693_100179540 Ga0070693_1001795401 249
873 3300005548 Ga0070665_100008939 Ga0070665_1000089393 249
874 3300005548 Ga0070665_100126978 Ga0070665_1001269782 249
875 3300005563 Ga0068855_100105409 Ga0068855_1001054092 249
876 3300005564 Ga0070664_100015808 Ga0070664_1000158086 249
877 3300005564 Ga0070664_100142498 Ga0070664_1001424982 249
878 3300005564 Ga0070664_100780665 Ga0070664_1007806651 249
879 3300005577 Ga0068857_100004656 Ga0068857_10000465613 249
880 3300005578 Ga0068854_100006351 Ga0068854_1000063512 249
881 3300005614 Ga0068856_100039285 Ga0068856_1000392854 249
882 3300005615 Ga0070702_100078567 Ga0070702_1000785673 249
883 3300005615 Ga0070702_100263541 Ga0070702_1002635411 249
884 3300005617 Ga0068859_100095758 Ga0068859_1000957584 249
885 3300005618 Ga0068864_100003435 Ga0068864_10000343511 249
886 3300005718 Ga0068866_10023053 Ga0068866_100230533 249
887 3300005719 Ga0068861_100540080 Ga0068861_1005400801 249
888 3300005834 Ga0068851_10003695 Ga0068851_100036958 249
889 3300005834 Ga0068851_10007447 Ga0068851_100074473 249
890 3300005840 Ga0068870_10006057 Ga0068870_100060574 249
891 3300005840 Ga0068870_10012623 Ga0068870_100126233 249
892 3300005841 Ga0068863_100078037 Ga0068863_1000780373 249
893 3300005841 Ga0068863_100528436 Ga0068863_1005284362 249
894 3300005842 Ga0068858_100035200 Ga0068858_1000352006 249
895 3300005842 Ga0068858_100060821 Ga0068858_1000608214 249
896 3300005842 Ga0068858_100532851 Ga0068858_1005328512 249
897 3300005843 Ga0068860_100072839 Ga0068860_1000728394 249
898 3300005843 Ga0068860_100109492 Ga0068860_1001094922 249
899 3300005843 Ga0068860_100216873 Ga0068860_1002168733 249
900 3300005843 Ga0068860_100620822 Ga0068860_1006208222 249
901 3300005844 Ga0068862_100100687 Ga0068862_1001006873 249
902 3300006237 Ga0097621_100394255 Ga0097621_1003942552 249
903 3300006881 Ga0068865_100038656 Ga0068865_1000386564 249
904 3300006881 Ga0068865_100417660 Ga0068865_1004176602 249
905 3300006914 Ga0075436_100023587 Ga0075436_1000235875 249
906 3300006931 Ga0097620_100095749 Ga0097620_1000957494 249
907 3300009093 Ga0105240_10016656 Ga0105240_100166569 249
908 3300009094 Ga0111539_10026736 Ga0111539_100267364 249
909 3300009174 Ga0105241_10014961 Ga0105241_100149615 249
910 3300009176 Ga0105242_10048474 Ga0105242_100484742 249
911 3300009177 Ga0105248_10024569 Ga0105248_100245693 249
912 3300009177 Ga0105248_10209183 Ga0105248_102091833 249
913 3300009177 Ga0105248_10430971 Ga0105248_104309712 249
914 3300009545 Ga0105237_10058764 Ga0105237_100587643 249
915 3300009545 Ga0105237_10170942 Ga0105237_101709423 249
916 3300010375 Ga0105239_10074856 Ga0105239_100748564 249
917 3300010375 Ga0105239_10638298 Ga0105239_106382981 249
918 3300013100 Ga0157373_10008811 Ga0157373_100088116 249
919 3300013102 Ga0157371_10190681 Ga0157371_101906813 249
920 3300013105 Ga0157369_10092042 Ga0157369_100920423 249
921 3300013105 Ga0157369_10189251 Ga0157369_101892513 249
922 3300013296 Ga0157374_10143435 Ga0157374_101434353 249
923 3300013297 Ga0157378_10114262 Ga0157378_101142623 249
924 3300013297 Ga0157378_10323692 Ga0157378_103236922 249
925 3300013297 Ga0157378_10461376 Ga0157378_104613762 249
926 3300013306 Ga0163162_10004418 Ga0163162_1000441810 249
927 3300013306 Ga0163162_10103173 Ga0163162_101031732 249
928 3300013308 Ga0157375_10050520 Ga0157375_100505204 249
929 3300013308 Ga0157375_10059025 Ga0157375_100590254 249
930 3300014326 Ga0157380_10018974 Ga0157380_100189746 249
931 3300014326 Ga0157380_10084164 Ga0157380_100841643 249
932 3300014968 Ga0157379_10204127 Ga0157379_102041272 249
933 3300014969 Ga0157376_10024704 Ga0157376_100247043 249
934 3300014969 Ga0157376_10054971 Ga0157376_100549714 249
935 3300014969 Ga0157376_10270027 Ga0157376_102700272 249
936 3300025315 Ga0207697_10000450 Ga0207697_1000045024 249
937 3300025321 Ga0207656_10002897 Ga0207656_100028973 249
938 3300025893 Ga0207682_10024253 Ga0207682_100242532 249
939 3300025901 Ga0207688_10010669 Ga0207688_100106694 249
940 3300025903 Ga0207680_10189782 Ga0207680_101897822 249
941 3300025907 Ga0207645_10088890 Ga0207645_100888903 249
942 3300025908 Ga0207643_10000429 Ga0207643_1000042924 249
943 3300025908 Ga0207643_10006465 Ga0207643_100064655 249
944 3300025909 Ga0207705_10014155 Ga0207705_100141555 249
945 3300025912 Ga0207707_10021196 Ga0207707_100211966 249
946 3300025913 Ga0207695_10015923 Ga0207695_100159234 249
947 3300025918 Ga0207662_10023329 Ga0207662_100233292 249
948 3300025919 Ga0207657_10000297 Ga0207657_1000029711 249
949 3300025919 Ga0207657_10032758 Ga0207657_100327581 249
950 3300025920 Ga0207649_10023356 Ga0207649_100233563 249
951 3300025920 Ga0207649_10325072 Ga0207649_103250722 249
952 3300025921 Ga0207652_10015488 Ga0207652_100154886 249
953 3300025923 Ga0207681_10157126 Ga0207681_101571263 249
954 3300025924 Ga0207694_10023028 Ga0207694_100230282 249
955 3300025925 Ga0207650_10000503 Ga0207650_100005033 249
956 3300025926 Ga0207659_10015450 Ga0207659_100154506 249
957 3300025926 Ga0207659_10297812 Ga0207659_102978122 249
958 3300025931 Ga0207644_10019227 Ga0207644_100192274 249
959 3300025931 Ga0207644_10285726 Ga0207644_102857262 249
960 3300025931 Ga0207644_10311228 Ga0207644_103112282 249
961 3300025931 Ga0207644_10542136 Ga0207644_105421361 249
962 3300025932 Ga0207690_10010823 Ga0207690_100108233 249
963 3300025932 Ga0207690_10046407 Ga0207690_100464071 249
964 3300025933 Ga0207706_10012798 Ga0207706_1001279810 249
965 3300025933 Ga0207706_10155069 Ga0207706_101550692 249
966 3300025934 Ga0207686_10037331 Ga0207686_100373312 249
967 3300025935 Ga0207709_10032976 Ga0207709_100329764 249
968 3300025936 Ga0207670_10022259 Ga0207670_100222592 249
969 3300025936 Ga0207670_10156452 Ga0207670_101564521 249
970 3300025940 Ga0207691_10007860 Ga0207691_100078603 249
971 3300025940 Ga0207691_10016301 Ga0207691_100163018 249
972 3300025940 Ga0207691_10340622 Ga0207691_103406222 249
973 3300025941 Ga0207711_10036106 Ga0207711_100361063 249
974 3300025941 Ga0207711_10392049 Ga0207711_103920491 249
975 3300025942 Ga0207689_10003889 Ga0207689_1000388912 249
976 3300025942 Ga0207689_10030304 Ga0207689_100303046 249
977 3300025944 Ga0207661_10031821 Ga0207661_100318212 249
978 3300025944 Ga0207661_10089770 Ga0207661_100897702 249
979 3300025945 Ga0207679_10031779 Ga0207679_100317794 249
980 3300025945 Ga0207679_10106553 Ga0207679_101065532 249
981 3300025949 Ga0207667_10000695 Ga0207667_1000069521 249
982 3300025960 Ga0207651_10126960 Ga0207651_101269603 249
983 3300025960 Ga0207651_10154501 Ga0207651_101545012 249
984 3300025960 Ga0207651_10292791 Ga0207651_102927912 249
985 3300025961 Ga0207712_10273813 Ga0207712_102738131 249
986 3300025972 Ga0207668_10036725 Ga0207668_100367254 249
987 3300025972 Ga0207668_10121593 Ga0207668_101215933 249
988 3300025981 Ga0207640_10140977 Ga0207640_101409773 249
989 3300025986 Ga0207658_10712156 Ga0207658_107121561 249
990 3300026035 Ga0207703_10101067 Ga0207703_101010672 249
991 3300026035 Ga0207703_10172194 Ga0207703_101721942 249
992 3300026041 Ga0207639_10030218 Ga0207639_100302183 249
993 3300026067 Ga0207678_10022800 Ga0207678_100228005 249
994 3300026067 Ga0207678_10046316 Ga0207678_100463164 249
995 3300026075 Ga0207708_10004851 Ga0207708_1000485110 249
996 3300026088 Ga0207641_10138084 Ga0207641_101380843 249
997 3300026088 Ga0207641_10199161 Ga0207641_101991611 249
998 3300026089 Ga0207648_10154746 Ga0207648_101547462 249
999 3300026095 Ga0207676_10060928 Ga0207676_100609283 249
1000 3300026095 Ga0207676_10092706 Ga0207676_100927063 249
1001 3300026116 Ga0207674_10000396 Ga0207674_100003965 249
1002 3300026116 Ga0207674_10007956 Ga0207674_1000795611 249
1003 3300026118 Ga0207675_100004233 Ga0207675_1000042331 249
1004 3300026118 Ga0207675_100067821 Ga0207675_1000678212 249
1005 3300026118 Ga0207675_100282800 Ga0207675_1002828002 249
1006 3300026121 Ga0207683_10007047 Ga0207683_100070473 249
1007 3300026142 Ga0207698_10017296 Ga0207698_100172964 249
1008 3300026142 Ga0207698_10257072 Ga0207698_102570722 249
1009 3300028379 Ga0268266_10044417 Ga0268266_100444174 249
1010 3300028379 Ga0268266_10115607 Ga0268266_101156072 249
1011 3300028380 Ga0268265_10027358 Ga0268265_100273583 249
1012 3300028380 Ga0268265_10318472 Ga0268265_103184722 249
1013 3300028381 Ga0268264_10411383 Ga0268264_104113832 249
1014 3300031235 Ga0265330_10009093 Ga0265330_100090936 249
1015 3300031238 Ga0265332_10000824 Ga0265332_100008242 249
1016 3300031242 Ga0265329_10004859 Ga0265329_100048593 249
1017 3300031250 Ga0265331_10000305 Ga0265331_1000030548 249
1018 3300031251 Ga0265327_10004446 Ga0265327_100044464 249
1019 3300031344 Ga0265316_10015795 Ga0265316_100157953 249
1020 3300031712 Ga0265342_10031924 Ga0265342_100319241 249
1021 3300031852 Ga0307410_10116672 Ga0307410_101166722 249
1022 3300032005 Ga0307411_10178481 Ga0307411_101784812 249
1023 3300035118 Ga0373954_0041506 Ga0373954_0041506_840_1592 249
1024 3300035171 Ga0373946_0016175 Ga0373946_0016175_1377_2132 249
1025 3300035172 Ga0373955_0095029 Ga0373955_0095029_784_1536 249
1026 3300035695 Ga0373927_0143215 Ga0373927_0143215_326_1081 249
1027 3300035725 Ga0373947_0232862 Ga0373947_0232862_161_916 249
1028 3300037068 Ga0373925_0184098 Ga0373925_0184098_431_1186 249
1029 3300037068 Ga0373925_0775464 Ga0373925_0775464_17_772 249
1030 3300046683 Ga0495658_0246942 Ga0495658_0246942_105_857 249
1031 3300048903 Ga0496100_0095621 Ga0496100_0095621_639_1394 249
1032 3300048904 Ga0496101_0068972 Ga0496101_0068972_845_1600 249
1033 3300048905 Ga0496102_0262055 Ga0496102_0262055_15_782 249
1034 3300048909 Ga0496106_0014789 Ga0496106_0014789_3013_3768 249
1035 3300048909 Ga0496106_0091645 Ga0496106_0091645_1160_1927 249
1036 3300048910 Ga0496107_0264037 Ga0496107_0264037_377_1132 249
1037 3300048911 Ga0496108_0010757 Ga0496108_0010757_2349_3104 249
1038 3300048912 Ga0496109_0503735 Ga0496109_0503735_217_969 249
1039 3300048913 Ga0496110_0004549 Ga0496110_0004549_6759_7514 249
1040 3300048914 Ga0496111_0031212 Ga0496111_0031212_2618_3373 249
1041 3300048917 Ga0496114_0036010 Ga0496114_0036010_2349_3104 249
1042 3300048917 Ga0496114_0524152 Ga0496114_0524152_131_886 249
1043 3300050511 nmdc:mga08y16_74414_c1 nmdc:mga08y16_74414_c1_497_1252 249
1044 3300050514 nmdc:mga08x19_146636_c1 nmdc:mga08x19_146636_c1_137_889 249
1045 3300004799 Ga0058863_11727546 Ga0058863_117275461 252
1046 3300005458 Ga0070681_10012786 Ga0070681_100127866 252
1047 3300005530 Ga0070679_100010882 Ga0070679_1000108823 252
1048 3300022467 Ga0224712_10007074 Ga0224712_100070741 252
1049 3300025912 Ga0207707_10002432 Ga0207707_100024328 252
1050 3300025921 Ga0207652_10018332 Ga0207652_100183327 252

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

33

227

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

39

272

0.96

PF08659

KR

KR domain

33

210

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sj7-assembly1.cif.gz_B-2 structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with nadph 0.9911 7 248
3osu-assembly1.cif.gz_A crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus 0.9891 9 248
3sj7-assembly1.cif.gz_A-2 structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with nadph 0.9869 8 248
8jf9-assembly1.cif.gz_C crystal structure of 3-oxoacyl-acp reductase fabg from helicobacter pylori 0.9869 7 248
8jfa-assembly1.cif.gz_C crystal structure of 3-oxoacyl-acp reductase fabg in complex with nadph from helicobacter pylori 0.9869 7 248
ID Description Score Start End Superfamily
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9867 85 248 3.40.50.720
af_B7FAC8_69_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9859 9 248 3.40.50.720
4iinB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9836 7 248 3.40.50.720
4hsyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9827 9 250 3.40.50.720
af_A0A1D6J5I0_53_326_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.981 4 248 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2S5MFR3-F1-model_v4 Beta-ketoacyl-ACP reductase 0.9962 88 248 GO:0016491
AF-A0A850V1U6-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 0.9888 169 248
AF-K1T1S4-F1-model_v4 3-oxoacyl-(Acyl-carrier-protein) reductase 0.9878 99 248 GO:0006633
GO:0016616
GO:0048038
AF-A0A4D9ALR0-F1-model_v4 deleted 0.987 6 248
AF-X1DT56-F1-model_v4 Uncharacterized protein 0.9846 94 218 GO:0016491

Feature Viewer

pLDDT pTM Quality
94.41 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map