F489054
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1050 | 340 | 1047 | 241 |
Family's Representative Sequence
| Representative Sequence | 3300025935|Ga0207709_10032976|Ga0207709_100329764 |
| Length | 274 |
| Sequence | MLLDQAHQTVVDLTPDFARHHRFERRFGHFDGQVALVTGATRGIGRAIALALANAGADVIGTATTDEGAASITDCLRAAGGRGEGLRLDVRDGAAVDATLRDIESRHGPIAILVNNAGVTRDNLLVRMKDDDWDAIMATNLKPAFALAKGVLRGMMKARRGRIIQIGSVVGSSGNPGQTNYAAAKAALIGFTKSLALEVGSRDITVNCVAPGFVDTEMTQKLPQPQRDALLARIPLGRLGTPDDIANAVLFLASPRAGYITGATLHVNGGMLML |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 2 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 3 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 4 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 123 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 124 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 193 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 197 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 199 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 200 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 201 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 202 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 203 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 204 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 205 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 208 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 209 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 210 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 211 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 212 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 213 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 214 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 216 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 217 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 218 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 219 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 220 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 221 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 222 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 223 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 224 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 225 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 226 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 227 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 228 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 229 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 230 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 231 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 234 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 236 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 237 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 238 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 239 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 240 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 241 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 242 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 245 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 246 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 247 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 248 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 249 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 250 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 251 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 254 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 255 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 256 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 257 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 258 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 259 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 260 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 261 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 262 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 263 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 264 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 265 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 266 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 283 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 284 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 285 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 286 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 287 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 288 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 291 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 292 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 293 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 294 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 295 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 296 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 318 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 319 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 326 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 337 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 338 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 339 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.52 |
| Metatranscriptomes | 0.19 |
| Isolates | 0.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.57 |
| Nodule | 0 |
| Rhizoplane | 4.48 |
| Rhizosphere | 93.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.9 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058863_11727546 | 3300004799 | Bacteria | 873 |
| 2 | Ga0065715_10131453 | 3300005293 | Bacteria | 2007 |
| 3 | Ga0065715_10199719 | 3300005293 | Bacteria | 1325 |
| 4 | Ga0065715_10289579 | 3300005293 | Bacteria | 1066 |
| 5 | Ga0065715_10313025 | 3300005293 | Bacteria | 1016 |
| 6 | Ga0070658_10030721 | 3300005327 | Bacteria | 4315 |
| 7 | Ga0070658_10036744 | 3300005327 | Bacteria | 3948 |
| 8 | Ga0070658_10099113 | 3300005327 | Bacteria | 2408 |
| 9 | Ga0070676_10009423 | 3300005328 | Bacteria | 5275 |
| 10 | Ga0070676_10043387 | 3300005328 | Bacteria | 2614 |
| 11 | Ga0070676_10061097 | 3300005328 | Bacteria | 2239 |
| 12 | Ga0070676_10086000 | 3300005328 | Bacteria | 1917 |
| 13 | Ga0070676_10190150 | 3300005328 | Bacteria | 1340 |
| 14 | Ga0070683_100000103 | 3300005329 | Bacteria | 55332 |
| 15 | Ga0070683_100003892 | 3300005329 | Bacteria | 12211 |
| 16 | Ga0070683_100007321 | 3300005329 | Bacteria | 9319 |
| 17 | Ga0070683_100016811 | 3300005329 | Bacteria | 6455 |
| 18 | Ga0070683_100090357 | 3300005329 | Bacteria | 2875 |
| 19 | Ga0070683_100523154 | 3300005329 | Bacteria | 1133 |
| 20 | Ga0070690_100010236 | 3300005330 | Bacteria | 5451 |
| 21 | Ga0070690_100051381 | 3300005330 | Bacteria | 2631 |
| 22 | Ga0070690_100144819 | 3300005330 | Bacteria | 1615 |
| 23 | Ga0070670_100000067 | 3300005331 | Bacteria | 107051 |
| 24 | Ga0070670_100002410 | 3300005331 | Bacteria | 15422 |
| 25 | Ga0070670_100006838 | 3300005331 | Bacteria | 9664 |
| 26 | Ga0070670_100030395 | 3300005331 | Bacteria | 4651 |
| 27 | Ga0070670_100059281 | 3300005331 | Bacteria | 3285 |
| 28 | Ga0070670_100143517 | 3300005331 | Bacteria | 2065 |
| 29 | Ga0070670_100177231 | 3300005331 | Bacteria | 1850 |
| 30 | Ga0070670_100185117 | 3300005331 | Bacteria | 1808 |
| 31 | Ga0070670_100233573 | 3300005331 | Bacteria | 1601 |
| 32 | Ga0070670_100466707 | 3300005331 | Bacteria | 1120 |
| 33 | Ga0070670_100537385 | 3300005331 | Bacteria | 1042 |
| 34 | Ga0070677_10139765 | 3300005333 | Bacteria | 1115 |
| 35 | Ga0068869_100001503 | 3300005334 | Bacteria | 13819 |
| 36 | Ga0068869_100002596 | 3300005334 | Bacteria | 10912 |
| 37 | Ga0068869_100240986 | 3300005334 | Bacteria | 1441 |
| 38 | Ga0068869_100522555 | 3300005334 | Bacteria | 994 |
| 39 | Ga0070666_10036930 | 3300005335 | Bacteria | 3246 |
| 40 | Ga0070666_10066869 | 3300005335 | Bacteria | 2440 |
| 41 | Ga0070666_10074739 | 3300005335 | Bacteria | 2310 |
| 42 | Ga0070666_10159772 | 3300005335 | Bacteria | 1575 |
| 43 | Ga0070666_10199825 | 3300005335 | Bacteria | 1406 |
| 44 | Ga0070666_10247604 | 3300005335 | Bacteria | 1261 |
| 45 | Ga0070666_10297375 | 3300005335 | Bacteria | 1149 |
| 46 | Ga0070680_100010342 | 3300005336 | Bacteria | 7192 |
| 47 | Ga0070680_100027651 | 3300005336 | Bacteria | 4543 |
| 48 | Ga0070680_100085042 | 3300005336 | Bacteria | 2613 |
| 49 | Ga0070680_100398658 | 3300005336 | Bacteria | 1173 |
| 50 | Ga0070682_100000010 | 3300005337 | Bacteria | 280957 |
| 51 | Ga0070682_100115728 | 3300005337 | Bacteria | 1793 |
| 52 | Ga0068868_100000249 | 3300005338 | Bacteria | 36630 |
| 53 | Ga0068868_100000558 | 3300005338 | Bacteria | 24973 |
| 54 | Ga0068868_100035790 | 3300005338 | Bacteria | 3839 |
| 55 | Ga0068868_100094582 | 3300005338 | Bacteria | 2411 |
| 56 | Ga0068868_100378529 | 3300005338 | Bacteria | 1217 |
| 57 | Ga0070660_100001424 | 3300005339 | Bacteria | 16292 |
| 58 | Ga0070660_100014318 | 3300005339 | Bacteria | 5713 |
| 59 | Ga0070660_100061388 | 3300005339 | Bacteria | 2918 |
| 60 | Ga0070660_100066723 | 3300005339 | Bacteria | 2802 |
| 61 | Ga0070660_100139432 | 3300005339 | Bacteria | 1944 |
| 62 | Ga0070689_100003762 | 3300005340 | Bacteria | 10154 |
| 63 | Ga0070689_100040781 | 3300005340 | Bacteria | 3560 |
| 64 | Ga0070689_100069597 | 3300005340 | Bacteria | 2746 |
| 65 | Ga0070689_100120693 | 3300005340 | Bacteria | 2093 |
| 66 | Ga0070689_100131609 | 3300005340 | Bacteria | 2006 |
| 67 | Ga0070689_100140224 | 3300005340 | Bacteria | 1944 |
| 68 | Ga0070691_10016151 | 3300005341 | Bacteria | 3431 |
| 69 | Ga0070691_10260118 | 3300005341 | Bacteria | 934 |
| 70 | Ga0070687_100039069 | 3300005343 | Bacteria | 2382 |
| 71 | Ga0070661_100000813 | 3300005344 | Bacteria | 22437 |
| 72 | Ga0070661_100014481 | 3300005344 | Bacteria | 5556 |
| 73 | Ga0070661_100035223 | 3300005344 | Bacteria | 3634 |
| 74 | Ga0070661_100282494 | 3300005344 | Bacteria | 1288 |
| 75 | Ga0070692_10078323 | 3300005345 | Bacteria | 1775 |
| 76 | Ga0070668_100018243 | 3300005347 | Bacteria | 5265 |
| 77 | Ga0070668_100020426 | 3300005347 | Bacteria | 4998 |
| 78 | Ga0070668_100072726 | 3300005347 | Bacteria | 2679 |
| 79 | Ga0070668_100089160 | 3300005347 | Bacteria | 2429 |
| 80 | Ga0070668_100167689 | 3300005347 | Bacteria | 1786 |
| 81 | Ga0070669_100009649 | 3300005353 | Bacteria | 6875 |
| 82 | Ga0070669_100014658 | 3300005353 | Bacteria | 5580 |
| 83 | Ga0070669_100018415 | 3300005353 | Bacteria | 4991 |
| 84 | Ga0070669_100040387 | 3300005353 | Bacteria | 3391 |
| 85 | Ga0070669_100054955 | 3300005353 | Bacteria | 2917 |
| 86 | Ga0070669_100154226 | 3300005353 | Bacteria | 1780 |
| 87 | Ga0070669_100160261 | 3300005353 | Bacteria | 1748 |
| 88 | Ga0070669_100161997 | 3300005353 | Bacteria | 1739 |
| 89 | Ga0070669_100290856 | 3300005353 | Bacteria | 1311 |
| 90 | Ga0070669_100370318 | 3300005353 | Bacteria | 1167 |
| 91 | Ga0070675_100000024 | 3300005354 | Bacteria | 117191 |
| 92 | Ga0070675_100005401 | 3300005354 | Bacteria | 9769 |
| 93 | Ga0070675_100022458 | 3300005354 | Bacteria | 5042 |
| 94 | Ga0070675_100097323 | 3300005354 | Bacteria | 2474 |
| 95 | Ga0070675_100198227 | 3300005354 | Bacteria | 1742 |
| 96 | Ga0070675_100278424 | 3300005354 | Bacteria | 1469 |
| 97 | Ga0070671_100004012 | 3300005355 | Bacteria | 11601 |
| 98 | Ga0070671_100201322 | 3300005355 | Bacteria | 1688 |
| 99 | Ga0070674_100003652 | 3300005356 | Bacteria | 8667 |
| 100 | Ga0070674_100024606 | 3300005356 | Bacteria | 3910 |
| 101 | Ga0070674_100045494 | 3300005356 | Bacteria | 2999 |
| 102 | Ga0070674_100071548 | 3300005356 | Bacteria | 2453 |
| 103 | Ga0070674_100206600 | 3300005356 | Bacteria | 1520 |
| 104 | Ga0070674_100270495 | 3300005356 | Bacteria | 1343 |
| 105 | Ga0070673_100010272 | 3300005364 | Bacteria | 6330 |
| 106 | Ga0070673_100028043 | 3300005364 | Bacteria | 4182 |
| 107 | Ga0070673_100033153 | 3300005364 | Bacteria | 3895 |
| 108 | Ga0070673_100095905 | 3300005364 | Bacteria | 2433 |
| 109 | Ga0070673_100102714 | 3300005364 | Bacteria | 2357 |
| 110 | Ga0070673_100126635 | 3300005364 | Bacteria | 2138 |
| 111 | Ga0070673_100166618 | 3300005364 | Bacteria | 1878 |
| 112 | Ga0070673_100254886 | 3300005364 | Bacteria | 1531 |
| 113 | Ga0070688_100015314 | 3300005365 | Bacteria | 4360 |
| 114 | Ga0070688_100090761 | 3300005365 | Bacteria | 1996 |
| 115 | Ga0070688_100193180 | 3300005365 | Bacteria | 1419 |
| 116 | Ga0070688_100356666 | 3300005365 | Bacteria | 1072 |
| 117 | Ga0070688_100421906 | 3300005365 | Bacteria | 992 |
| 118 | Ga0070659_100002336 | 3300005366 | Bacteria | 13495 |
| 119 | Ga0070659_100018516 | 3300005366 | Bacteria | 5254 |
| 120 | Ga0070659_100030277 | 3300005366 | Bacteria | 4188 |
| 121 | Ga0070659_100058644 | 3300005366 | Bacteria | 3038 |
| 122 | Ga0070659_100114770 | 3300005366 | Bacteria | 2176 |
| 123 | Ga0070659_100164043 | 3300005366 | Bacteria | 1818 |
| 124 | Ga0070667_100006047 | 3300005367 | Bacteria | 10053 |
| 125 | Ga0070667_100031487 | 3300005367 | Bacteria | 4422 |
| 126 | Ga0070667_100053230 | 3300005367 | Bacteria | 3416 |
| 127 | Ga0070667_100168212 | 3300005367 | Bacteria | 1934 |
| 128 | Ga0070667_100428952 | 3300005367 | Bacteria | 1206 |
| 129 | Ga0070667_100812854 | 3300005367 | Bacteria | 868 |
| 130 | Ga0070709_10236003 | 3300005434 | Bacteria | 1311 |
| 131 | Ga0070709_10555411 | 3300005434 | Bacteria | 879 |
| 132 | Ga0070714_100156608 | 3300005435 | Bacteria | 2057 |
| 133 | Ga0070714_100320031 | 3300005435 | Bacteria | 1450 |
| 134 | Ga0070713_100017090 | 3300005436 | Bacteria | 5475 |
| 135 | Ga0070713_100212468 | 3300005436 | Bacteria | 1752 |
| 136 | Ga0070701_10000046 | 3300005438 | Bacteria | 31405 |
| 137 | Ga0070701_10063976 | 3300005438 | Bacteria | 1948 |
| 138 | Ga0070701_10341148 | 3300005438 | Bacteria | 933 |
| 139 | Ga0070711_100320137 | 3300005439 | Bacteria | 1239 |
| 140 | Ga0070705_100008967 | 3300005440 | Bacteria | 4962 |
| 141 | Ga0070705_100070152 | 3300005440 | Bacteria | 2116 |
| 142 | Ga0070705_100288396 | 3300005440 | Bacteria | 1170 |
| 143 | Ga0070700_100000002 | 3300005441 | Bacteria | 261904 |
| 144 | Ga0070700_100140371 | 3300005441 | Bacteria | 1641 |
| 145 | Ga0070694_100088039 | 3300005444 | Bacteria | 2173 |
| 146 | Ga0070694_100129220 | 3300005444 | Bacteria | 1823 |
| 147 | Ga0070708_100004030 | 3300005445 | Bacteria | 11541 |
| 148 | Ga0070663_100067580 | 3300005455 | Bacteria | 2593 |
| 149 | Ga0070678_100029651 | 3300005456 | Bacteria | 3750 |
| 150 | Ga0070678_100172994 | 3300005456 | Bacteria | 1761 |
| 151 | Ga0070678_100206274 | 3300005456 | Bacteria | 1625 |
| 152 | Ga0070678_100416255 | 3300005456 | Bacteria | 1170 |
| 153 | Ga0070678_100630479 | 3300005456 | Bacteria | 960 |
| 154 | Ga0070662_100001043 | 3300005457 | Bacteria | 16937 |
| 155 | Ga0070681_10012786 | 3300005458 | Bacteria | 8331 |
| 156 | Ga0070681_10202495 | 3300005458 | Bacteria | 1903 |
| 157 | Ga0070681_10210485 | 3300005458 | Bacteria | 1860 |
| 158 | Ga0070681_10236600 | 3300005458 | Bacteria | 1740 |
| 159 | Ga0070681_10349633 | 3300005458 | Bacteria | 1388 |
| 160 | Ga0068867_100005228 | 3300005459 | Bacteria | 9159 |
| 161 | Ga0068867_100009941 | 3300005459 | Bacteria | 6702 |
| 162 | Ga0068867_100034852 | 3300005459 | Bacteria | 3649 |
| 163 | Ga0068867_100065639 | 3300005459 | Bacteria | 2701 |
| 164 | Ga0068867_100351233 | 3300005459 | Bacteria | 1230 |
| 165 | Ga0070685_10052729 | 3300005466 | Bacteria | 2354 |
| 166 | Ga0070685_10102132 | 3300005466 | Bacteria | 1753 |
| 167 | Ga0070706_100008767 | 3300005467 | Bacteria | 9423 |
| 168 | Ga0070707_100673925 | 3300005468 | Bacteria | 997 |
| 169 | Ga0070698_100196617 | 3300005471 | Bacteria | 1953 |
| 170 | Ga0070699_100029308 | 3300005518 | Bacteria | 4745 |
| 171 | Ga0070699_100097321 | 3300005518 | Bacteria | 2578 |
| 172 | Ga0070699_100420738 | 3300005518 | Bacteria | 1209 |
| 173 | Ga0070679_100010882 | 3300005530 | Bacteria | 8642 |
| 174 | Ga0070679_100092060 | 3300005530 | Bacteria | 3020 |
| 175 | Ga0070684_100000272 | 3300005535 | Bacteria | 35847 |
| 176 | Ga0070684_100003202 | 3300005535 | Bacteria | 12240 |
| 177 | Ga0070684_100005117 | 3300005535 | Bacteria | 10018 |
| 178 | Ga0070684_100031500 | 3300005535 | Bacteria | 4515 |
| 179 | Ga0070684_100301319 | 3300005535 | Bacteria | 1471 |
| 180 | Ga0070697_100051373 | 3300005536 | Bacteria | 3349 |
| 181 | Ga0068853_100004333 | 3300005539 | Bacteria | 10977 |
| 182 | Ga0068853_100007729 | 3300005539 | Bacteria | 8622 |
| 183 | Ga0068853_100021278 | 3300005539 | Bacteria | 5405 |
| 184 | Ga0068853_100029977 | 3300005539 | Bacteria | 4592 |
| 185 | Ga0068853_100265985 | 3300005539 | Bacteria | 1578 |
| 186 | Ga0070672_100000697 | 3300005543 | Bacteria | 19893 |
| 187 | Ga0070672_100004237 | 3300005543 | Bacteria | 9375 |
| 188 | Ga0070672_100154318 | 3300005543 | Bacteria | 1901 |
| 189 | Ga0070672_100336758 | 3300005543 | Bacteria | 1284 |
| 190 | Ga0070686_100002492 | 3300005544 | Bacteria | 10135 |
| 191 | Ga0070686_100075171 | 3300005544 | Bacteria | 2222 |
| 192 | Ga0070686_100139275 | 3300005544 | Bacteria | 1687 |
| 193 | Ga0070686_100384271 | 3300005544 | Bacteria | 1063 |
| 194 | Ga0070695_100012541 | 3300005545 | Bacteria | 5088 |
| 195 | Ga0070695_100063286 | 3300005545 | Bacteria | 2404 |
| 196 | Ga0070696_100035542 | 3300005546 | Bacteria | 3431 |
| 197 | Ga0070696_100151782 | 3300005546 | Bacteria | 1701 |
| 198 | Ga0070696_100383092 | 3300005546 | Bacteria | 1096 |
| 199 | Ga0070693_100179540 | 3300005547 | Bacteria | 1362 |
| 200 | Ga0070693_100231999 | 3300005547 | Bacteria | 1215 |
| 201 | Ga0070665_100001511 | 3300005548 | Bacteria | 27024 |
| 202 | Ga0070665_100008939 | 3300005548 | Bacteria | 10151 |
| 203 | Ga0070665_100126978 | 3300005548 | Bacteria | 2553 |
| 204 | Ga0070704_100024190 | 3300005549 | Bacteria | 3982 |
| 205 | Ga0070704_100143459 | 3300005549 | Bacteria | 1868 |
| 206 | Ga0068855_100002546 | 3300005563 | Bacteria | 22453 |
| 207 | Ga0068855_100008719 | 3300005563 | Bacteria | 12260 |
| 208 | Ga0068855_100105409 | 3300005563 | Bacteria | 3242 |
| 209 | Ga0068855_100268303 | 3300005563 | Bacteria | 1899 |
| 210 | Ga0068855_100349002 | 3300005563 | Bacteria | 1630 |
| 211 | Ga0068855_100430592 | 3300005563 | Bacteria | 1442 |
| 212 | Ga0070664_100001257 | 3300005564 | Bacteria | 20297 |
| 213 | Ga0070664_100004690 | 3300005564 | Bacteria | 10963 |
| 214 | Ga0070664_100014812 | 3300005564 | Bacteria | 6365 |
| 215 | Ga0070664_100015808 | 3300005564 | Bacteria | 6176 |
| 216 | Ga0070664_100019041 | 3300005564 | Bacteria | 5645 |
| 217 | Ga0070664_100103541 | 3300005564 | Bacteria | 2478 |
| 218 | Ga0070664_100142498 | 3300005564 | Bacteria | 2111 |
| 219 | Ga0070664_100194501 | 3300005564 | Bacteria | 1808 |
| 220 | Ga0070664_100204324 | 3300005564 | Bacteria | 1764 |
| 221 | Ga0070664_100237840 | 3300005564 | Bacteria | 1634 |
| 222 | Ga0070664_100780665 | 3300005564 | Bacteria | 893 |
| 223 | Ga0068857_100004656 | 3300005577 | Bacteria | 11621 |
| 224 | Ga0068857_100006850 | 3300005577 | Bacteria | 9807 |
| 225 | Ga0068857_100049665 | 3300005577 | Bacteria | 3722 |
| 226 | Ga0068857_100127435 | 3300005577 | Bacteria | 2294 |
| 227 | Ga0068854_100005152 | 3300005578 | Bacteria | 8239 |
| 228 | Ga0068854_100006351 | 3300005578 | Bacteria | 7516 |
| 229 | Ga0068854_100012221 | 3300005578 | Bacteria | 5618 |
| 230 | Ga0068854_100081015 | 3300005578 | Bacteria | 2397 |
| 231 | Ga0068854_100097336 | 3300005578 | Bacteria | 2200 |
| 232 | Ga0068856_100001602 | 3300005614 | Bacteria | 23652 |
| 233 | Ga0068856_100016323 | 3300005614 | Bacteria | 7186 |
| 234 | Ga0068856_100039285 | 3300005614 | Bacteria | 4646 |
| 235 | Ga0068856_100040533 | 3300005614 | Bacteria | 4575 |
| 236 | Ga0068856_100164239 | 3300005614 | Bacteria | 2231 |
| 237 | Ga0070702_100003512 | 3300005615 | Bacteria | 7023 |
| 238 | Ga0070702_100078567 | 3300005615 | Bacteria | 1970 |
| 239 | Ga0070702_100263541 | 3300005615 | Bacteria | 1174 |
| 240 | Ga0068852_100001206 | 3300005616 | Bacteria | 17155 |
| 241 | Ga0068852_100002065 | 3300005616 | Bacteria | 13708 |
| 242 | Ga0068852_100062049 | 3300005616 | Bacteria | 3250 |
| 243 | Ga0068859_100008168 | 3300005617 | Bacteria | 10619 |
| 244 | Ga0068859_100095758 | 3300005617 | Bacteria | 3021 |
| 245 | Ga0068859_100112325 | 3300005617 | Bacteria | 2788 |
| 246 | Ga0068859_100191464 | 3300005617 | Bacteria | 2130 |
| 247 | Ga0068859_100760190 | 3300005617 | Bacteria | 1058 |
| 248 | Ga0068864_100000008 | 3300005618 | Bacteria | 390035 |
| 249 | Ga0068864_100000456 | 3300005618 | Bacteria | 35356 |
| 250 | Ga0068864_100003435 | 3300005618 | Bacteria | 13101 |
| 251 | Ga0068866_10023053 | 3300005718 | Bacteria | 2890 |
| 252 | Ga0068861_100023402 | 3300005719 | Bacteria | 4454 |
| 253 | Ga0068861_100062251 | 3300005719 | Bacteria | 2866 |
| 254 | Ga0068861_100409636 | 3300005719 | Bacteria | 1205 |
| 255 | Ga0068861_100540080 | 3300005719 | Bacteria | 1060 |
| 256 | Ga0068851_10003695 | 3300005834 | Bacteria | 6833 |
| 257 | Ga0068851_10007447 | 3300005834 | Bacteria | 5026 |
| 258 | Ga0068851_10105317 | 3300005834 | Bacteria | 1501 |
| 259 | Ga0068851_10283666 | 3300005834 | Bacteria | 948 |
| 260 | Ga0068870_10006057 | 3300005840 | Bacteria | 5313 |
| 261 | Ga0068870_10012623 | 3300005840 | Bacteria | 3951 |
| 262 | Ga0068870_10015161 | 3300005840 | Bacteria | 3652 |
| 263 | Ga0068870_10211757 | 3300005840 | Bacteria | 1181 |
| 264 | Ga0068870_10424111 | 3300005840 | Bacteria | 871 |
| 265 | Ga0068863_100013369 | 3300005841 | Bacteria | 7914 |
| 266 | Ga0068863_100039196 | 3300005841 | Bacteria | 4508 |
| 267 | Ga0068863_100078037 | 3300005841 | Bacteria | 3135 |
| 268 | Ga0068863_100082598 | 3300005841 | Bacteria | 3045 |
| 269 | Ga0068863_100090613 | 3300005841 | Bacteria | 2899 |
| 270 | Ga0068863_100271052 | 3300005841 | Bacteria | 1643 |
| 271 | Ga0068863_100389847 | 3300005841 | Bacteria | 1361 |
| 272 | Ga0068863_100433795 | 3300005841 | Bacteria | 1288 |
| 273 | Ga0068863_100528436 | 3300005841 | Bacteria | 1163 |
| 274 | Ga0068858_100000518 | 3300005842 | Bacteria | 40503 |
| 275 | Ga0068858_100008910 | 3300005842 | Bacteria | 9618 |
| 276 | Ga0068858_100035200 | 3300005842 | Bacteria | 4644 |
| 277 | Ga0068858_100059594 | 3300005842 | Bacteria | 3528 |
| 278 | Ga0068858_100060821 | 3300005842 | Bacteria | 3491 |
| 279 | Ga0068858_100233860 | 3300005842 | Bacteria | 1743 |
| 280 | Ga0068858_100378784 | 3300005842 | Bacteria | 1358 |
| 281 | Ga0068858_100532851 | 3300005842 | Bacteria | 1136 |
| 282 | Ga0068858_100671672 | 3300005842 | Bacteria | 1007 |
| 283 | Ga0068860_100008086 | 3300005843 | Bacteria | 10474 |
| 284 | Ga0068860_100066331 | 3300005843 | Bacteria | 3428 |
| 285 | Ga0068860_100072839 | 3300005843 | Bacteria | 3265 |
| 286 | Ga0068860_100073073 | 3300005843 | Bacteria | 3260 |
| 287 | Ga0068860_100076833 | 3300005843 | Bacteria | 3175 |
| 288 | Ga0068860_100104511 | 3300005843 | Bacteria | 2704 |
| 289 | Ga0068860_100109492 | 3300005843 | Bacteria | 2640 |
| 290 | Ga0068860_100155186 | 3300005843 | Bacteria | 2206 |
| 291 | Ga0068860_100159852 | 3300005843 | Bacteria | 2172 |
| 292 | Ga0068860_100216873 | 3300005843 | Bacteria | 1857 |
| 293 | Ga0068860_100620822 | 3300005843 | Bacteria | 1087 |
| 294 | Ga0068862_100035873 | 3300005844 | Bacteria | 4201 |
| 295 | Ga0068862_100098405 | 3300005844 | Bacteria | 2555 |
| 296 | Ga0068862_100100687 | 3300005844 | Bacteria | 2527 |
| 297 | Ga0068862_100130380 | 3300005844 | Bacteria | 2223 |
| 298 | Ga0068862_100147463 | 3300005844 | Bacteria | 2092 |
| 299 | Ga0068862_100716574 | 3300005844 | Bacteria | 970 |
| 300 | Ga0070717_10000173 | 3300006028 | Bacteria | 48151 |
| 301 | Ga0075365_10027146 | 3300006038 | Bacteria | 3640 |
| 302 | Ga0070716_100053080 | 3300006173 | Bacteria | 2310 |
| 303 | Ga0070712_100082736 | 3300006175 | Bacteria | 2329 |
| 304 | Ga0070712_100440612 | 3300006175 | Bacteria | 1083 |
| 305 | Ga0097621_100143559 | 3300006237 | Bacteria | 2042 |
| 306 | Ga0097621_100237521 | 3300006237 | Bacteria | 1592 |
| 307 | Ga0097621_100383543 | 3300006237 | Bacteria | 1256 |
| 308 | Ga0097621_100394255 | 3300006237 | Bacteria | 1238 |
| 309 | Ga0097621_100584032 | 3300006237 | Bacteria | 1020 |
| 310 | Ga0097621_100690649 | 3300006237 | Bacteria | 939 |
| 311 | Ga0068871_100098921 | 3300006358 | Bacteria | 2441 |
| 312 | Ga0068871_100388610 | 3300006358 | Bacteria | 1241 |
| 313 | Ga0068871_100460687 | 3300006358 | Bacteria | 1141 |
| 314 | Ga0068871_100565834 | 3300006358 | Bacteria | 1031 |
| 315 | Ga0075428_100000766 | 3300006844 | Bacteria | 33418 |
| 316 | Ga0075428_100032301 | 3300006844 | Bacteria | 5781 |
| 317 | Ga0075428_100372954 | 3300006844 | Bacteria | 1530 |
| 318 | Ga0075431_100071048 | 3300006847 | Bacteria | 3591 |
| 319 | Ga0075431_100458835 | 3300006847 | Bacteria | 1269 |
| 320 | Ga0075433_10000591 | 3300006852 | Bacteria | 24054 |
| 321 | Ga0075433_10019284 | 3300006852 | Bacteria | 5681 |
| 322 | Ga0075433_10026331 | 3300006852 | Bacteria | 4923 |
| 323 | Ga0075433_10105430 | 3300006852 | Bacteria | 2498 |
| 324 | Ga0075434_100000646 | 3300006871 | Bacteria | 26961 |
| 325 | Ga0075434_100007152 | 3300006871 | Bacteria | 10318 |
| 326 | Ga0075434_100107638 | 3300006871 | Bacteria | 2798 |
| 327 | Ga0075434_100316128 | 3300006871 | Bacteria | 1582 |
| 328 | Ga0075434_100360792 | 3300006871 | Bacteria | 1474 |
| 329 | Ga0075434_100387945 | 3300006871 | Bacteria | 1418 |
| 330 | Ga0075434_100390397 | 3300006871 | Bacteria | 1413 |
| 331 | Ga0075434_100483855 | 3300006871 | Bacteria | 1259 |
| 332 | Ga0075429_100026441 | 3300006880 | Bacteria | 5038 |
| 333 | Ga0068865_100038656 | 3300006881 | Bacteria | 3231 |
| 334 | Ga0068865_100070463 | 3300006881 | Bacteria | 2477 |
| 335 | Ga0068865_100417660 | 3300006881 | Bacteria | 1102 |
| 336 | Ga0075436_100004991 | 3300006914 | Bacteria | 9117 |
| 337 | Ga0075436_100023587 | 3300006914 | Bacteria | 4226 |
| 338 | Ga0075436_100061454 | 3300006914 | Bacteria | 2595 |
| 339 | Ga0075436_100175483 | 3300006914 | Bacteria | 1513 |
| 340 | Ga0097620_100008167 | 3300006931 | Bacteria | 10619 |
| 341 | Ga0097620_100050245 | 3300006931 | Bacteria | 4189 |
| 342 | Ga0097620_100095749 | 3300006931 | Bacteria | 3021 |
| 343 | Ga0097620_100112323 | 3300006931 | Bacteria | 2788 |
| 344 | Ga0097620_100191467 | 3300006931 | Bacteria | 2130 |
| 345 | Ga0097620_100760088 | 3300006931 | Bacteria | 1058 |
| 346 | Ga0075435_100000206 | 3300007076 | Bacteria | 35805 |
| 347 | Ga0075435_100000827 | 3300007076 | Bacteria | 19283 |
| 348 | Ga0075435_100017210 | 3300007076 | Bacteria | 5465 |
| 349 | Ga0075435_100053442 | 3300007076 | Bacteria | 3258 |
| 350 | Ga0075435_100241052 | 3300007076 | Bacteria | 1538 |
| 351 | Ga0105240_10011838 | 3300009093 | Bacteria | 12115 |
| 352 | Ga0105240_10016656 | 3300009093 | Bacteria | 9942 |
| 353 | Ga0105240_10059153 | 3300009093 | Bacteria | 4783 |
| 354 | Ga0105240_10307336 | 3300009093 | Bacteria | 1812 |
| 355 | Ga0111539_10000006 | 3300009094 | Bacteria | 463720 |
| 356 | Ga0111539_10026736 | 3300009094 | Bacteria | 7052 |
| 357 | Ga0111539_10035710 | 3300009094 | Bacteria | 6017 |
| 358 | Ga0105245_10000003 | 3300009098 | Bacteria | 488207 |
| 359 | Ga0105245_10003461 | 3300009098 | Bacteria | 14140 |
| 360 | Ga0105245_10078619 | 3300009098 | Bacteria | 3010 |
| 361 | Ga0105245_10131807 | 3300009098 | Bacteria | 2345 |
| 362 | Ga0105245_10697245 | 3300009098 | Bacteria | 1048 |
| 363 | Ga0114129_10011524 | 3300009147 | Bacteria | 12591 |
| 364 | Ga0114129_10022775 | 3300009147 | Bacteria | 8882 |
| 365 | Ga0114129_10040772 | 3300009147 | Bacteria | 6545 |
| 366 | Ga0114129_10071391 | 3300009147 | Bacteria | 4841 |
| 367 | Ga0114129_10128654 | 3300009147 | Bacteria | 3480 |
| 368 | Ga0114129_10140398 | 3300009147 | Bacteria | 3312 |
| 369 | Ga0114129_10204178 | 3300009147 | Bacteria | 2675 |
| 370 | Ga0114129_10332317 | 3300009147 | Bacteria | 2017 |
| 371 | Ga0114129_10460278 | 3300009147 | Bacteria | 1667 |
| 372 | Ga0114129_10734743 | 3300009147 | Bacteria | 1265 |
| 373 | Ga0105243_10081994 | 3300009148 | Bacteria | 2635 |
| 374 | Ga0105243_10121295 | 3300009148 | Bacteria | 2204 |
| 375 | Ga0105243_10309941 | 3300009148 | Bacteria | 1434 |
| 376 | Ga0105243_10451610 | 3300009148 | Bacteria | 1206 |
| 377 | Ga0105241_10014961 | 3300009174 | Bacteria | 5681 |
| 378 | Ga0105241_10041662 | 3300009174 | Bacteria | 3470 |
| 379 | Ga0105241_10044133 | 3300009174 | Bacteria | 3377 |
| 380 | Ga0105241_10060366 | 3300009174 | Bacteria | 2917 |
| 381 | Ga0105241_10198729 | 3300009174 | Bacteria | 1673 |
| 382 | Ga0105242_10047887 | 3300009176 | Bacteria | 3472 |
| 383 | Ga0105242_10048474 | 3300009176 | Bacteria | 3453 |
| 384 | Ga0105242_10055487 | 3300009176 | Bacteria | 3241 |
| 385 | Ga0105242_10058900 | 3300009176 | Bacteria | 3150 |
| 386 | Ga0105242_10100215 | 3300009176 | Bacteria | 2453 |
| 387 | Ga0105242_10108271 | 3300009176 | Bacteria | 2365 |
| 388 | Ga0105242_10159342 | 3300009176 | Bacteria | 1974 |
| 389 | Ga0105242_10784137 | 3300009176 | Bacteria | 942 |
| 390 | Ga0105248_10016076 | 3300009177 | Bacteria | 8237 |
| 391 | Ga0105248_10024569 | 3300009177 | Bacteria | 6700 |
| 392 | Ga0105248_10075824 | 3300009177 | Bacteria | 3780 |
| 393 | Ga0105248_10178399 | 3300009177 | Bacteria | 2394 |
| 394 | Ga0105248_10209183 | 3300009177 | Bacteria | 2198 |
| 395 | Ga0105248_10211065 | 3300009177 | Bacteria | 2188 |
| 396 | Ga0105248_10430971 | 3300009177 | Bacteria | 1485 |
| 397 | Ga0105248_10632373 | 3300009177 | Bacteria | 1207 |
| 398 | Ga0105248_10749364 | 3300009177 | Bacteria | 1102 |
| 399 | Ga0105248_10911896 | 3300009177 | Bacteria | 992 |
| 400 | Ga0105237_10023342 | 3300009545 | Bacteria | 6339 |
| 401 | Ga0105237_10058764 | 3300009545 | Bacteria | 3849 |
| 402 | Ga0105237_10082777 | 3300009545 | Bacteria | 3200 |
| 403 | Ga0105237_10084650 | 3300009545 | Bacteria | 3161 |
| 404 | Ga0105237_10170942 | 3300009545 | Bacteria | 2173 |
| 405 | Ga0105238_10000001 | 3300009551 | Bacteria | 2036163 |
| 406 | Ga0105238_10003217 | 3300009551 | Bacteria | 16314 |
| 407 | Ga0105238_10098453 | 3300009551 | Bacteria | 2908 |
| 408 | Ga0105238_10211442 | 3300009551 | Bacteria | 1916 |
| 409 | Ga0105249_10009507 | 3300009553 | Bacteria | 8517 |
| 410 | Ga0105239_10006983 | 3300010375 | Bacteria | 13009 |
| 411 | Ga0105239_10074856 | 3300010375 | Bacteria | 3723 |
| 412 | Ga0105239_10168258 | 3300010375 | Bacteria | 2451 |
| 413 | Ga0105239_10638298 | 3300010375 | Bacteria | 1216 |
| 414 | Ga0105246_10077902 | 3300011119 | Bacteria | 2353 |
| 415 | Ga0157373_10000924 | 3300013100 | Bacteria | 22752 |
| 416 | Ga0157373_10006638 | 3300013100 | Bacteria | 8623 |
| 417 | Ga0157373_10008811 | 3300013100 | Bacteria | 7474 |
| 418 | Ga0157371_10000522 | 3300013102 | Bacteria | 45892 |
| 419 | Ga0157371_10190681 | 3300013102 | Bacteria | 1468 |
| 420 | Ga0157371_10273908 | 3300013102 | Bacteria | 1218 |
| 421 | Ga0157370_10005379 | 3300013104 | Bacteria | 14376 |
| 422 | Ga0157370_10031830 | 3300013104 | Bacteria | 5156 |
| 423 | Ga0157370_10057832 | 3300013104 | Bacteria | 3685 |
| 424 | Ga0157370_10061023 | 3300013104 | Bacteria | 3578 |
| 425 | Ga0157369_10000189 | 3300013105 | Bacteria | 85144 |
| 426 | Ga0157369_10004689 | 3300013105 | Bacteria | 16077 |
| 427 | Ga0157369_10058789 | 3300013105 | Bacteria | 4147 |
| 428 | Ga0157369_10092042 | 3300013105 | Bacteria | 3236 |
| 429 | Ga0157369_10189251 | 3300013105 | Bacteria | 2163 |
| 430 | Ga0157369_10792833 | 3300013105 | Bacteria | 974 |
| 431 | Ga0157374_10000037 | 3300013296 | Bacteria | 170359 |
| 432 | Ga0157374_10016513 | 3300013296 | Bacteria | 6492 |
| 433 | Ga0157374_10143435 | 3300013296 | Bacteria | 2319 |
| 434 | Ga0157374_11123983 | 3300013296 | Bacteria | 806 |
| 435 | Ga0157374_11182159 | 3300013296 | Bacteria | 786 |
| 436 | Ga0157378_10000335 | 3300013297 | Bacteria | 46123 |
| 437 | Ga0157378_10004023 | 3300013297 | Bacteria | 12980 |
| 438 | Ga0157378_10020571 | 3300013297 | Bacteria | 5803 |
| 439 | Ga0157378_10054920 | 3300013297 | Bacteria | 3547 |
| 440 | Ga0157378_10077918 | 3300013297 | Bacteria | 2988 |
| 441 | Ga0157378_10088588 | 3300013297 | Bacteria | 2809 |
| 442 | Ga0157378_10114262 | 3300013297 | Bacteria | 2480 |
| 443 | Ga0157378_10143982 | 3300013297 | Bacteria | 2215 |
| 444 | Ga0157378_10323692 | 3300013297 | Bacteria | 1498 |
| 445 | Ga0157378_10461376 | 3300013297 | Bacteria | 1262 |
| 446 | Ga0163162_10004418 | 3300013306 | Bacteria | 13535 |
| 447 | Ga0163162_10103173 | 3300013306 | Bacteria | 2946 |
| 448 | Ga0163162_10162856 | 3300013306 | Bacteria | 2353 |
| 449 | Ga0163162_10211090 | 3300013306 | Bacteria | 2071 |
| 450 | Ga0163162_10517852 | 3300013306 | Bacteria | 1322 |
| 451 | Ga0163162_10718787 | 3300013306 | Bacteria | 1120 |
| 452 | Ga0157372_10000791 | 3300013307 | Bacteria | 34366 |
| 453 | Ga0157372_10020911 | 3300013307 | Bacteria | 7064 |
| 454 | Ga0157372_11261980 | 3300013307 | Bacteria | 853 |
| 455 | Ga0157375_10000009 | 3300013308 | Bacteria | 366440 |
| 456 | Ga0157375_10000090 | 3300013308 | Bacteria | 91416 |
| 457 | Ga0157375_10002231 | 3300013308 | Bacteria | 16762 |
| 458 | Ga0157375_10043801 | 3300013308 | Bacteria | 4343 |
| 459 | Ga0157375_10050520 | 3300013308 | Bacteria | 4079 |
| 460 | Ga0157375_10059025 | 3300013308 | Bacteria | 3798 |
| 461 | Ga0157375_10087017 | 3300013308 | Bacteria | 3176 |
| 462 | Ga0163163_10011827 | 3300014325 | Bacteria | 7936 |
| 463 | Ga0157380_10001455 | 3300014326 | Bacteria | 15496 |
| 464 | Ga0157380_10018325 | 3300014326 | Bacteria | 5195 |
| 465 | Ga0157380_10018974 | 3300014326 | Bacteria | 5118 |
| 466 | Ga0157380_10029606 | 3300014326 | Bacteria | 4186 |
| 467 | Ga0157380_10084164 | 3300014326 | Bacteria | 2608 |
| 468 | Ga0157380_10418274 | 3300014326 | Bacteria | 1277 |
| 469 | Ga0157380_10845906 | 3300014326 | Bacteria | 936 |
| 470 | Ga0157377_10000008 | 3300014745 | Bacteria | 394748 |
| 471 | Ga0157377_10071610 | 3300014745 | Bacteria | 2005 |
| 472 | Ga0157377_10339025 | 3300014745 | Bacteria | 1005 |
| 473 | Ga0157377_10465382 | 3300014745 | Bacteria | 876 |
| 474 | Ga0157379_10000246 | 3300014968 | Bacteria | 42489 |
| 475 | Ga0157379_10026158 | 3300014968 | Bacteria | 5193 |
| 476 | Ga0157379_10069965 | 3300014968 | Bacteria | 3139 |
| 477 | Ga0157379_10090502 | 3300014968 | Bacteria | 2745 |
| 478 | Ga0157379_10142200 | 3300014968 | Bacteria | 2163 |
| 479 | Ga0157379_10204127 | 3300014968 | Bacteria | 1788 |
| 480 | Ga0157379_10998805 | 3300014968 | Bacteria | 798 |
| 481 | Ga0157376_10000006 | 3300014969 | Bacteria | 368549 |
| 482 | Ga0157376_10024704 | 3300014969 | Bacteria | 4723 |
| 483 | Ga0157376_10054971 | 3300014969 | Bacteria | 3320 |
| 484 | Ga0157376_10176462 | 3300014969 | Bacteria | 1949 |
| 485 | Ga0157376_10189913 | 3300014969 | Bacteria | 1883 |
| 486 | Ga0157376_10270027 | 3300014969 | Bacteria | 1597 |
| 487 | Ga0157376_10442726 | 3300014969 | Bacteria | 1266 |
| 488 | Ga0163161_10343154 | 3300017792 | Bacteria | 1185 |
| 489 | Ga0213873_10000004 | 3300021358 | Bacteria | 774374 |
| 490 | Ga0213876_10000007 | 3300021384 | Bacteria | 670340 |
| 491 | Ga0213876_10000188 | 3300021384 | Bacteria | 64172 |
| 492 | Ga0213876_10001441 | 3300021384 | Bacteria | 14794 |
| 493 | Ga0213876_10012783 | 3300021384 | Bacteria | 4463 |
| 494 | Ga0213876_10013225 | 3300021384 | Bacteria | 4386 |
| 495 | Ga0224712_10007074 | 3300022467 | Bacteria | 3244 |
| 496 | Ga0209256_1001169 | 3300025299 | Bacteria | 29578 |
| 497 | Ga0207697_10000450 | 3300025315 | Bacteria | 23178 |
| 498 | Ga0207697_10093776 | 3300025315 | Bacteria | 1274 |
| 499 | Ga0207656_10002897 | 3300025321 | Bacteria | 5849 |
| 500 | Ga0207655_1034605 | 3300025728 | Bacteria | 2268 |
| 501 | Ga0207653_10022344 | 3300025885 | Bacteria | 2009 |
| 502 | Ga0207682_10011341 | 3300025893 | Bacteria | 3481 |
| 503 | Ga0207682_10024253 | 3300025893 | Bacteria | 2400 |
| 504 | Ga0207688_10010669 | 3300025901 | Bacteria | 4998 |
| 505 | Ga0207688_10252004 | 3300025901 | Bacteria | 1069 |
| 506 | Ga0207680_10038955 | 3300025903 | Bacteria | 2754 |
| 507 | Ga0207680_10049915 | 3300025903 | Bacteria | 2493 |
| 508 | Ga0207680_10070062 | 3300025903 | Bacteria | 2169 |
| 509 | Ga0207680_10189782 | 3300025903 | Bacteria | 1394 |
| 510 | Ga0207685_10003073 | 3300025905 | Bacteria | 3980 |
| 511 | Ga0207685_10059931 | 3300025905 | Bacteria | 1503 |
| 512 | Ga0207645_10031672 | 3300025907 | Bacteria | 3402 |
| 513 | Ga0207645_10048029 | 3300025907 | Bacteria | 2725 |
| 514 | Ga0207645_10088890 | 3300025907 | Bacteria | 1986 |
| 515 | Ga0207645_10144397 | 3300025907 | Bacteria | 1551 |
| 516 | Ga0207643_10000429 | 3300025908 | Bacteria | 27769 |
| 517 | Ga0207643_10006465 | 3300025908 | Bacteria | 6274 |
| 518 | Ga0207643_10061984 | 3300025908 | Bacteria | 2136 |
| 519 | Ga0207643_10268673 | 3300025908 | Bacteria | 1055 |
| 520 | Ga0207643_10345605 | 3300025908 | Bacteria | 933 |
| 521 | Ga0207705_10014155 | 3300025909 | Bacteria | 5746 |
| 522 | Ga0207705_10028399 | 3300025909 | Bacteria | 3988 |
| 523 | Ga0207705_10066572 | 3300025909 | Bacteria | 2606 |
| 524 | Ga0207654_10029791 | 3300025911 | Bacteria | 2991 |
| 525 | Ga0207654_10263827 | 3300025911 | Bacteria | 1159 |
| 526 | Ga0207707_10002432 | 3300025912 | Bacteria | 16755 |
| 527 | Ga0207707_10021196 | 3300025912 | Bacteria | 5680 |
| 528 | Ga0207707_10024558 | 3300025912 | Bacteria | 5275 |
| 529 | Ga0207707_10104251 | 3300025912 | Bacteria | 2478 |
| 530 | Ga0207707_10218897 | 3300025912 | Bacteria | 1657 |
| 531 | Ga0207707_10292269 | 3300025912 | Bacteria | 1410 |
| 532 | Ga0207695_10015923 | 3300025913 | Bacteria | 8830 |
| 533 | Ga0207695_10018572 | 3300025913 | Bacteria | 8033 |
| 534 | Ga0207695_10028893 | 3300025913 | Bacteria | 6137 |
| 535 | Ga0207671_10281235 | 3300025914 | Bacteria | 1312 |
| 536 | Ga0207693_10309411 | 3300025915 | Bacteria | 1237 |
| 537 | Ga0207663_10421801 | 3300025916 | Bacteria | 1024 |
| 538 | Ga0207662_10023329 | 3300025918 | Bacteria | 3555 |
| 539 | Ga0207662_10037923 | 3300025918 | Bacteria | 2823 |
| 540 | Ga0207662_10131893 | 3300025918 | Bacteria | 1576 |
| 541 | Ga0207657_10000297 | 3300025919 | Bacteria | 52991 |
| 542 | Ga0207657_10000657 | 3300025919 | Bacteria | 36802 |
| 543 | Ga0207657_10005722 | 3300025919 | Bacteria | 12970 |
| 544 | Ga0207657_10019066 | 3300025919 | Bacteria | 6527 |
| 545 | Ga0207657_10032758 | 3300025919 | Bacteria | 4691 |
| 546 | Ga0207657_10054479 | 3300025919 | Bacteria | 3458 |
| 547 | Ga0207649_10000924 | 3300025920 | Bacteria | 18501 |
| 548 | Ga0207649_10023356 | 3300025920 | Bacteria | 3581 |
| 549 | Ga0207649_10036123 | 3300025920 | Bacteria | 2974 |
| 550 | Ga0207649_10097269 | 3300025920 | Bacteria | 1941 |
| 551 | Ga0207649_10325072 | 3300025920 | Bacteria | 1131 |
| 552 | Ga0207649_10452621 | 3300025920 | Bacteria | 969 |
| 553 | Ga0207652_10015488 | 3300025921 | Bacteria | 6199 |
| 554 | Ga0207652_10018332 | 3300025921 | Bacteria | 5740 |
| 555 | Ga0207652_10270319 | 3300025921 | Bacteria | 1533 |
| 556 | Ga0207652_10534900 | 3300025921 | Bacteria | 1054 |
| 557 | Ga0207646_10014498 | 3300025922 | Bacteria | 7482 |
| 558 | Ga0207646_10144424 | 3300025922 | Bacteria | 2144 |
| 559 | Ga0207681_10007040 | 3300025923 | Bacteria | 6903 |
| 560 | Ga0207681_10019593 | 3300025923 | Bacteria | 4276 |
| 561 | Ga0207681_10046474 | 3300025923 | Bacteria | 2920 |
| 562 | Ga0207681_10096142 | 3300025923 | Bacteria | 2126 |
| 563 | Ga0207681_10157126 | 3300025923 | Bacteria | 1710 |
| 564 | Ga0207681_10248008 | 3300025923 | Bacteria | 1389 |
| 565 | Ga0207694_10000001 | 3300025924 | Bacteria | 4078485 |
| 566 | Ga0207694_10003088 | 3300025924 | Bacteria | 13330 |
| 567 | Ga0207694_10023028 | 3300025924 | Bacteria | 4727 |
| 568 | Ga0207694_10699319 | 3300025924 | Bacteria | 855 |
| 569 | Ga0207650_10000067 | 3300025925 | Bacteria | 140196 |
| 570 | Ga0207650_10000503 | 3300025925 | Bacteria | 32602 |
| 571 | Ga0207650_10004702 | 3300025925 | Bacteria | 9329 |
| 572 | Ga0207650_10017867 | 3300025925 | Bacteria | 4969 |
| 573 | Ga0207650_10030839 | 3300025925 | Bacteria | 3867 |
| 574 | Ga0207650_10094165 | 3300025925 | Bacteria | 2294 |
| 575 | Ga0207650_10116911 | 3300025925 | Bacteria | 2071 |
| 576 | Ga0207650_10126693 | 3300025925 | Bacteria | 1994 |
| 577 | Ga0207650_10128475 | 3300025925 | Bacteria | 1981 |
| 578 | Ga0207650_10239313 | 3300025925 | Bacteria | 1466 |
| 579 | Ga0207650_10483916 | 3300025925 | Bacteria | 1033 |
| 580 | Ga0207659_10000029 | 3300025926 | Bacteria | 129487 |
| 581 | Ga0207659_10007970 | 3300025926 | Bacteria | 6547 |
| 582 | Ga0207659_10015450 | 3300025926 | Bacteria | 4947 |
| 583 | Ga0207659_10062527 | 3300025926 | Bacteria | 2687 |
| 584 | Ga0207659_10072091 | 3300025926 | Bacteria | 2524 |
| 585 | Ga0207659_10297812 | 3300025926 | Bacteria | 1324 |
| 586 | Ga0207687_10000002 | 3300025927 | Bacteria | 975489 |
| 587 | Ga0207687_10031920 | 3300025927 | Bacteria | 3563 |
| 588 | Ga0207687_10143765 | 3300025927 | Bacteria | 1813 |
| 589 | Ga0207687_10219150 | 3300025927 | Bacteria | 1497 |
| 590 | Ga0207687_10292402 | 3300025927 | Bacteria | 1310 |
| 591 | Ga0207700_10012662 | 3300025928 | Bacteria | 5451 |
| 592 | Ga0207664_10015733 | 3300025929 | Bacteria | 5501 |
| 593 | Ga0207644_10010522 | 3300025931 | Bacteria | 6098 |
| 594 | Ga0207644_10019227 | 3300025931 | Bacteria | 4630 |
| 595 | Ga0207644_10285726 | 3300025931 | Bacteria | 1325 |
| 596 | Ga0207644_10311228 | 3300025931 | Bacteria | 1271 |
| 597 | Ga0207644_10542136 | 3300025931 | Bacteria | 962 |
| 598 | Ga0207690_10000412 | 3300025932 | Bacteria | 28034 |
| 599 | Ga0207690_10010823 | 3300025932 | Bacteria | 5436 |
| 600 | Ga0207690_10046407 | 3300025932 | Bacteria | 2877 |
| 601 | Ga0207690_10052009 | 3300025932 | Bacteria | 2742 |
| 602 | Ga0207690_10265743 | 3300025932 | Bacteria | 1331 |
| 603 | Ga0207706_10000164 | 3300025933 | Bacteria | 73885 |
| 604 | Ga0207706_10012798 | 3300025933 | Bacteria | 7634 |
| 605 | Ga0207706_10069498 | 3300025933 | Bacteria | 3098 |
| 606 | Ga0207706_10096475 | 3300025933 | Bacteria | 2600 |
| 607 | Ga0207706_10155069 | 3300025933 | Bacteria | 2014 |
| 608 | Ga0207686_10032295 | 3300025934 | Bacteria | 3115 |
| 609 | Ga0207686_10037331 | 3300025934 | Bacteria | 2931 |
| 610 | Ga0207686_10083358 | 3300025934 | Bacteria | 2092 |
| 611 | Ga0207686_10095479 | 3300025934 | Bacteria | 1973 |
| 612 | Ga0207686_10122173 | 3300025934 | Bacteria | 1774 |
| 613 | Ga0207686_10149491 | 3300025934 | Bacteria | 1624 |
| 614 | Ga0207686_10438937 | 3300025934 | Bacteria | 1002 |
| 615 | Ga0207709_10032976 | 3300025935 | Bacteria | 3037 |
| 616 | Ga0207709_10072229 | 3300025935 | Bacteria | 2194 |
| 617 | Ga0207709_10380402 | 3300025935 | Bacteria | 1074 |
| 618 | Ga0207670_10002387 | 3300025936 | Bacteria | 9835 |
| 619 | Ga0207670_10022259 | 3300025936 | Bacteria | 3925 |
| 620 | Ga0207670_10131433 | 3300025936 | Bacteria | 1835 |
| 621 | Ga0207670_10156452 | 3300025936 | Bacteria | 1697 |
| 622 | Ga0207669_10014593 | 3300025937 | Bacteria | 3942 |
| 623 | Ga0207669_10064114 | 3300025937 | Bacteria | 2272 |
| 624 | Ga0207669_10077132 | 3300025937 | Bacteria | 2118 |
| 625 | Ga0207669_10484956 | 3300025937 | Bacteria | 986 |
| 626 | Ga0207704_10086725 | 3300025938 | Bacteria | 2042 |
| 627 | Ga0207704_10170536 | 3300025938 | Bacteria | 1560 |
| 628 | Ga0207665_10268481 | 3300025939 | Bacteria | 1266 |
| 629 | Ga0207691_10000507 | 3300025940 | Bacteria | 38790 |
| 630 | Ga0207691_10007860 | 3300025940 | Bacteria | 10272 |
| 631 | Ga0207691_10016301 | 3300025940 | Bacteria | 7055 |
| 632 | Ga0207691_10069774 | 3300025940 | Bacteria | 3174 |
| 633 | Ga0207691_10325923 | 3300025940 | Bacteria | 1316 |
| 634 | Ga0207691_10340622 | 3300025940 | Bacteria | 1284 |
| 635 | Ga0207711_10036106 | 3300025941 | Bacteria | 4193 |
| 636 | Ga0207711_10040866 | 3300025941 | Bacteria | 3947 |
| 637 | Ga0207711_10157690 | 3300025941 | Bacteria | 2052 |
| 638 | Ga0207711_10216573 | 3300025941 | Bacteria | 1750 |
| 639 | Ga0207711_10392049 | 3300025941 | Bacteria | 1289 |
| 640 | Ga0207689_10001032 | 3300025942 | Bacteria | 26745 |
| 641 | Ga0207689_10003889 | 3300025942 | Bacteria | 13608 |
| 642 | Ga0207689_10013673 | 3300025942 | Bacteria | 6921 |
| 643 | Ga0207689_10030304 | 3300025942 | Bacteria | 4509 |
| 644 | Ga0207661_10000007 | 3300025944 | Bacteria | 471636 |
| 645 | Ga0207661_10027401 | 3300025944 | Bacteria | 4352 |
| 646 | Ga0207661_10031821 | 3300025944 | Bacteria | 4080 |
| 647 | Ga0207661_10041533 | 3300025944 | Bacteria | 3621 |
| 648 | Ga0207661_10089770 | 3300025944 | Bacteria | 2557 |
| 649 | Ga0207661_10168781 | 3300025944 | Bacteria | 1904 |
| 650 | Ga0207661_10688701 | 3300025944 | Bacteria | 940 |
| 651 | Ga0207679_10000601 | 3300025945 | Bacteria | 24040 |
| 652 | Ga0207679_10013736 | 3300025945 | Bacteria | 5310 |
| 653 | Ga0207679_10031779 | 3300025945 | Bacteria | 3698 |
| 654 | Ga0207679_10066044 | 3300025945 | Bacteria | 2709 |
| 655 | Ga0207679_10106553 | 3300025945 | Bacteria | 2203 |
| 656 | Ga0207679_10142336 | 3300025945 | Bacteria | 1940 |
| 657 | Ga0207679_10337098 | 3300025945 | Bacteria | 1310 |
| 658 | Ga0207667_10000695 | 3300025949 | Bacteria | 43623 |
| 659 | Ga0207667_10006146 | 3300025949 | Bacteria | 14589 |
| 660 | Ga0207667_10019236 | 3300025949 | Bacteria | 7634 |
| 661 | Ga0207667_10095391 | 3300025949 | Bacteria | 3071 |
| 662 | Ga0207667_10129880 | 3300025949 | Bacteria | 2595 |
| 663 | Ga0207667_10458857 | 3300025949 | Bacteria | 1294 |
| 664 | Ga0207651_10025885 | 3300025960 | Bacteria | 3654 |
| 665 | Ga0207651_10046652 | 3300025960 | Bacteria | 2915 |
| 666 | Ga0207651_10126960 | 3300025960 | Bacteria | 1945 |
| 667 | Ga0207651_10154501 | 3300025960 | Bacteria | 1791 |
| 668 | Ga0207651_10292791 | 3300025960 | Bacteria | 1350 |
| 669 | Ga0207651_10817812 | 3300025960 | Bacteria | 827 |
| 670 | Ga0207712_10044024 | 3300025961 | Bacteria | 3083 |
| 671 | Ga0207712_10273813 | 3300025961 | Bacteria | 1375 |
| 672 | Ga0207668_10036725 | 3300025972 | Bacteria | 3273 |
| 673 | Ga0207668_10080220 | 3300025972 | Bacteria | 2363 |
| 674 | Ga0207668_10121593 | 3300025972 | Bacteria | 1978 |
| 675 | Ga0207668_10285142 | 3300025972 | Bacteria | 1356 |
| 676 | Ga0207640_10000706 | 3300025981 | Bacteria | 19362 |
| 677 | Ga0207640_10013301 | 3300025981 | Bacteria | 4713 |
| 678 | Ga0207640_10016813 | 3300025981 | Bacteria | 4264 |
| 679 | Ga0207640_10125635 | 3300025981 | Bacteria | 1846 |
| 680 | Ga0207640_10140977 | 3300025981 | Bacteria | 1757 |
| 681 | Ga0207640_10169104 | 3300025981 | Bacteria | 1627 |
| 682 | Ga0207658_10004931 | 3300025986 | Bacteria | 9207 |
| 683 | Ga0207658_10273361 | 3300025986 | Bacteria | 1445 |
| 684 | Ga0207658_10712156 | 3300025986 | Bacteria | 908 |
| 685 | Ga0207677_10000008 | 3300026023 | Bacteria | 266293 |
| 686 | Ga0207677_10000133 | 3300026023 | Bacteria | 61065 |
| 687 | Ga0207677_10021944 | 3300026023 | Bacteria | 3913 |
| 688 | Ga0207677_10093523 | 3300026023 | Bacteria | 2192 |
| 689 | Ga0207703_10000164 | 3300026035 | Bacteria | 76934 |
| 690 | Ga0207703_10007505 | 3300026035 | Bacteria | 8656 |
| 691 | Ga0207703_10101067 | 3300026035 | Bacteria | 2445 |
| 692 | Ga0207703_10133703 | 3300026035 | Bacteria | 2145 |
| 693 | Ga0207703_10172194 | 3300026035 | Bacteria | 1905 |
| 694 | Ga0207703_10284565 | 3300026035 | Bacteria | 1503 |
| 695 | Ga0207703_10319808 | 3300026035 | Bacteria | 1421 |
| 696 | Ga0207703_10420203 | 3300026035 | Bacteria | 1244 |
| 697 | Ga0207703_10580803 | 3300026035 | Bacteria | 1059 |
| 698 | Ga0207639_10000020 | 3300026041 | Bacteria | 236698 |
| 699 | Ga0207639_10004129 | 3300026041 | Bacteria | 9780 |
| 700 | Ga0207639_10030218 | 3300026041 | Bacteria | 3972 |
| 701 | Ga0207639_10143244 | 3300026041 | Bacteria | 1994 |
| 702 | Ga0207639_10542994 | 3300026041 | Bacteria | 1066 |
| 703 | Ga0207678_10022800 | 3300026067 | Bacteria | 5482 |
| 704 | Ga0207678_10046316 | 3300026067 | Bacteria | 3761 |
| 705 | Ga0207678_10046744 | 3300026067 | Bacteria | 3743 |
| 706 | Ga0207678_10081046 | 3300026067 | Bacteria | 2778 |
| 707 | Ga0207708_10000137 | 3300026075 | Bacteria | 57745 |
| 708 | Ga0207708_10004851 | 3300026075 | Bacteria | 9911 |
| 709 | Ga0207702_10003782 | 3300026078 | Bacteria | 13659 |
| 710 | Ga0207702_10053520 | 3300026078 | Bacteria | 3417 |
| 711 | Ga0207641_10013613 | 3300026088 | Bacteria | 6671 |
| 712 | Ga0207641_10043578 | 3300026088 | Bacteria | 3769 |
| 713 | Ga0207641_10138084 | 3300026088 | Bacteria | 2196 |
| 714 | Ga0207641_10184808 | 3300026088 | Bacteria | 1911 |
| 715 | Ga0207641_10199161 | 3300026088 | Bacteria | 1845 |
| 716 | Ga0207641_10308856 | 3300026088 | Bacteria | 1496 |
| 717 | Ga0207641_10391541 | 3300026088 | Bacteria | 1333 |
| 718 | Ga0207648_10004696 | 3300026089 | Bacteria | 13969 |
| 719 | Ga0207648_10021903 | 3300026089 | Bacteria | 5741 |
| 720 | Ga0207648_10068442 | 3300026089 | Bacteria | 3093 |
| 721 | Ga0207648_10154746 | 3300026089 | Bacteria | 2024 |
| 722 | Ga0207648_10294259 | 3300026089 | Bacteria | 1454 |
| 723 | Ga0207648_10298493 | 3300026089 | Bacteria | 1444 |
| 724 | Ga0207648_10410248 | 3300026089 | Bacteria | 1228 |
| 725 | Ga0207648_10421914 | 3300026089 | Bacteria | 1211 |
| 726 | Ga0207648_10758783 | 3300026089 | Bacteria | 901 |
| 727 | Ga0207676_10000070 | 3300026095 | Bacteria | 104103 |
| 728 | Ga0207676_10001747 | 3300026095 | Bacteria | 15971 |
| 729 | Ga0207676_10060928 | 3300026095 | Bacteria | 2986 |
| 730 | Ga0207676_10092706 | 3300026095 | Bacteria | 2485 |
| 731 | Ga0207676_10324824 | 3300026095 | Bacteria | 1414 |
| 732 | Ga0207674_10000396 | 3300026116 | Bacteria | 56376 |
| 733 | Ga0207674_10000536 | 3300026116 | Bacteria | 49766 |
| 734 | Ga0207674_10007956 | 3300026116 | Bacteria | 12303 |
| 735 | Ga0207674_10116743 | 3300026116 | Bacteria | 2640 |
| 736 | Ga0207674_10172923 | 3300026116 | Bacteria | 2113 |
| 737 | Ga0207674_10242800 | 3300026116 | Bacteria | 1748 |
| 738 | Ga0207675_100004233 | 3300026118 | Bacteria | 13885 |
| 739 | Ga0207675_100006036 | 3300026118 | Bacteria | 11526 |
| 740 | Ga0207675_100027931 | 3300026118 | Bacteria | 5254 |
| 741 | Ga0207675_100042406 | 3300026118 | Bacteria | 4249 |
| 742 | Ga0207675_100067821 | 3300026118 | Bacteria | 3335 |
| 743 | Ga0207675_100280705 | 3300026118 | Bacteria | 1618 |
| 744 | Ga0207675_100282800 | 3300026118 | Bacteria | 1612 |
| 745 | Ga0207675_100323764 | 3300026118 | Bacteria | 1505 |
| 746 | Ga0207675_100612701 | 3300026118 | Bacteria | 1092 |
| 747 | Ga0207675_100828272 | 3300026118 | Bacteria | 940 |
| 748 | Ga0207683_10007047 | 3300026121 | Bacteria | 9639 |
| 749 | Ga0207683_10033759 | 3300026121 | Bacteria | 4446 |
| 750 | Ga0207683_10064063 | 3300026121 | Bacteria | 3239 |
| 751 | Ga0207683_10094302 | 3300026121 | Bacteria | 2667 |
| 752 | Ga0207683_10148174 | 3300026121 | Bacteria | 2117 |
| 753 | Ga0207698_10012426 | 3300026142 | Bacteria | 5571 |
| 754 | Ga0207698_10017296 | 3300026142 | Bacteria | 4888 |
| 755 | Ga0207698_10257072 | 3300026142 | Bacteria | 1602 |
| 756 | Ga0207698_10433472 | 3300026142 | Bacteria | 1265 |
| 757 | Ga0207698_10576903 | 3300026142 | Bacteria | 1106 |
| 758 | Ga0209970_1001342 | 3300027614 | Bacteria | 4304 |
| 759 | Ga0209970_1018522 | 3300027614 | Bacteria | 1169 |
| 760 | Ga0209983_1014893 | 3300027665 | Bacteria | 1604 |
| 761 | Ga0209971_1000841 | 3300027682 | Bacteria | 7924 |
| 762 | Ga0209971_1059943 | 3300027682 | Bacteria | 921 |
| 763 | Ga0209974_10004242 | 3300027876 | Bacteria | 5119 |
| 764 | Ga0207428_10000007 | 3300027907 | Bacteria | 463715 |
| 765 | Ga0207428_10030188 | 3300027907 | Bacteria | 4484 |
| 766 | Ga0268266_10019500 | 3300028379 | Bacteria | 5778 |
| 767 | Ga0268266_10044417 | 3300028379 | Bacteria | 3798 |
| 768 | Ga0268266_10115607 | 3300028379 | Bacteria | 2382 |
| 769 | Ga0268265_10027358 | 3300028380 | Bacteria | 4069 |
| 770 | Ga0268265_10049224 | 3300028380 | Bacteria | 3168 |
| 771 | Ga0268265_10119302 | 3300028380 | Bacteria | 2170 |
| 772 | Ga0268265_10318472 | 3300028380 | Bacteria | 1407 |
| 773 | Ga0268265_10849730 | 3300028380 | Bacteria | 893 |
| 774 | Ga0268264_10005591 | 3300028381 | Bacteria | 10650 |
| 775 | Ga0268264_10024593 | 3300028381 | Bacteria | 4917 |
| 776 | Ga0268264_10032442 | 3300028381 | Bacteria | 4286 |
| 777 | Ga0268264_10046748 | 3300028381 | Bacteria | 3596 |
| 778 | Ga0268264_10109607 | 3300028381 | Bacteria | 2416 |
| 779 | Ga0268264_10361791 | 3300028381 | Bacteria | 1384 |
| 780 | Ga0268264_10411383 | 3300028381 | Bacteria | 1302 |
| 781 | Ga0268264_10452669 | 3300028381 | Bacteria | 1244 |
| 782 | Ga0265323_10003583 | 3300028653 | Bacteria | 6824 |
| 783 | Ga0265323_10062659 | 3300028653 | Bacteria | 1289 |
| 784 | Ga0265336_10002300 | 3300028666 | Bacteria | 7973 |
| 785 | Ga0265324_10000005 | 3300029957 | Bacteria | 347038 |
| 786 | Ga0307511_10005518 | 3300030521 | Bacteria | 12851 |
| 787 | Ga0316177_1030295 | 3300030731 | Bacteria | 6701 |
| 788 | Ga0314311_1144403 | 3300030733 | Bacteria | 16756 |
| 789 | Ga0316179_1069783 | 3300030734 | Bacteria | 2671 |
| 790 | Ga0316180_1031618 | 3300030736 | Bacteria | 5701 |
| 791 | Ga0316183_1091323 | 3300030742 | Bacteria | 8925 |
| 792 | Ga0265330_10009093 | 3300031235 | Bacteria | 4737 |
| 793 | Ga0265332_10000824 | 3300031238 | Bacteria | 18837 |
| 794 | Ga0265325_10001486 | 3300031241 | Bacteria | 16510 |
| 795 | Ga0265329_10004859 | 3300031242 | Bacteria | 5509 |
| 796 | Ga0265331_10000305 | 3300031250 | Bacteria | 53782 |
| 797 | Ga0265327_10004446 | 3300031251 | Bacteria | 12401 |
| 798 | Ga0265327_10236819 | 3300031251 | Bacteria | 816 |
| 799 | Ga0265316_10015795 | 3300031344 | Bacteria | 6581 |
| 800 | Ga0265313_10102510 | 3300031595 | Bacteria | 1268 |
| 801 | Ga0316575_10004145 | 3300031665 | Bacteria | 5085 |
| 802 | Ga0265314_10026066 | 3300031711 | Bacteria | 4399 |
| 803 | Ga0265342_10031924 | 3300031712 | Bacteria | 3251 |
| 804 | Ga0307405_10016482 | 3300031731 | Bacteria | 4031 |
| 805 | Ga0307410_10001317 | 3300031852 | Bacteria | 11086 |
| 806 | Ga0307410_10116672 | 3300031852 | Bacteria | 1940 |
| 807 | Ga0307406_10131645 | 3300031901 | Bacteria | 1757 |
| 808 | Ga0307407_10008613 | 3300031903 | Bacteria | 4697 |
| 809 | Ga0307409_100033201 | 3300031995 | Bacteria | 3752 |
| 810 | Ga0307416_100001846 | 3300032002 | Bacteria | 11816 |
| 811 | Ga0307416_100254564 | 3300032002 | Bacteria | 1711 |
| 812 | Ga0307414_10235179 | 3300032004 | Bacteria | 1513 |
| 813 | Ga0307411_10006888 | 3300032005 | Bacteria | 5730 |
| 814 | Ga0307411_10178481 | 3300032005 | Bacteria | 1609 |
| 815 | Ga0373930_0002059 | 3300034816 | Bacteria | 3076 |
| 816 | Ga0373948_0015607 | 3300034817 | Bacteria | 1396 |
| 817 | Ga0373950_0001150 | 3300034818 | Bacteria | 3396 |
| 818 | Ga0373959_0003969 | 3300034820 | Bacteria | 2369 |
| 819 | Ga0373938_0002076 | 3300034957 | Bacteria | 3220 |
| 820 | Ga0373928_0003150 | 3300035084 | Bacteria | 3161 |
| 821 | Ga0373929_0001579 | 3300035085 | Bacteria | 4331 |
| 822 | Ga0373940_0002324 | 3300035088 | Bacteria | 3676 |
| 823 | Ga0373951_0000829 | 3300035091 | Bacteria | 8406 |
| 824 | Ga0373952_0002814 | 3300035092 | Bacteria | 3146 |
| 825 | Ga0373932_0001595 | 3300035112 | Bacteria | 6243 |
| 826 | Ga0373939_0000651 | 3300035114 | Bacteria | 8633 |
| 827 | Ga0373953_0099664 | 3300035117 | Bacteria | 1222 |
| 828 | Ga0373954_0041506 | 3300035118 | Bacteria | 2146 |
| 829 | Ga0373954_0420691 | 3300035118 | Bacteria | 661 |
| 830 | Ga0373956_0084689 | 3300035119 | Bacteria | 1457 |
| 831 | Ga0373960_0069817 | 3300035121 | Bacteria | 1084 |
| 832 | Ga0373946_0016175 | 3300035171 | Bacteria | 2839 |
| 833 | Ga0373955_0095029 | 3300035172 | Bacteria | 1704 |
| 834 | Ga0373955_0338157 | 3300035172 | Bacteria | 911 |
| 835 | Ga0373942_0000393 | 3300035207 | Bacteria | 12138 |
| 836 | Ga0373961_0006271 | 3300035241 | Bacteria | 2858 |
| 837 | Ga0373962_0015994 | 3300035242 | Bacteria | 1929 |
| 838 | Ga0373962_0018558 | 3300035242 | Bacteria | 1811 |
| 839 | Ga0316574_0087066 | 3300035398 | Bacteria | 1988 |
| 840 | Ga0373924_0008857 | 3300035410 | Bacteria | 3672 |
| 841 | Ga0373924_0029665 | 3300035410 | Bacteria | 2188 |
| 842 | Ga0373931_0000361 | 3300035691 | Bacteria | 18676 |
| 843 | Ga0373935_0345984 | 3300035692 | Bacteria | 1059 |
| 844 | Ga0373927_0063070 | 3300035695 | Bacteria | 2397 |
| 845 | Ga0373927_0143215 | 3300035695 | Bacteria | 1564 |
| 846 | Ga0373947_0029736 | 3300035725 | Bacteria | 3207 |
| 847 | Ga0373947_0232862 | 3300035725 | Bacteria | 1214 |
| 848 | Ga0373937_0343274 | 3300036401 | Bacteria | 1414 |
| 849 | Ga0373937_0622026 | 3300036401 | Bacteria | 1025 |
| 850 | Ga0373925_0184098 | 3300037068 | Bacteria | 1655 |
| 851 | Ga0373925_0199856 | 3300037068 | Bacteria | 1589 |
| 852 | Ga0373925_0775464 | 3300037068 | Bacteria | 790 |
| 853 | Ga0395900_0019317 | 3300037418 | Bacteria | 6951 |
| 854 | Ga0436364_0470212 | 3300037853 | Bacteria | 24045 |
| 855 | Ga0436364_1377383 | 3300037853 | Bacteria | 2635 |
| 856 | Ga0400490_21567 | 3300038726 | Bacteria | 1078 |
| 857 | Ga0400483_088593 | 3300039062 | Bacteria | 2443 |
| 858 | Ga0400483_220029 | 3300039062 | Bacteria | 1392 |
| 859 | Ga0400483_288640 | 3300039062 | Bacteria | 2955 |
| 860 | Ga0436365_0073603 | 3300039437 | Bacteria | 250590 |
| 861 | Ga0436365_0506999 | 3300039437 | Bacteria | 18404 |
| 862 | Ga0436365_0637274 | 3300039437 | Bacteria | 17734 |
| 863 | Ga0436365_0857751 | 3300039437 | Bacteria | 5248 |
| 864 | Ga0436365_1929564 | 3300039437 | Bacteria | 3931 |
| 865 | Ga0436362_0290430 | 3300039453 | Bacteria | 772596 |
| 866 | Ga0436362_1187303 | 3300039453 | Bacteria | 11856 |
| 867 | Ga0439441_038281 | 3300042001 | Bacteria | 953 |
| 868 | Ga0439435_0003908 | 3300042436 | Bacteria | 3156 |
| 869 | Ga0439464_0043281 | 3300042439 | Bacteria | 1287 |
| 870 | Ga0451577_0039643 | 3300042876 | Bacteria | 4233 |
| 871 | Ga0451577_0057152 | 3300042876 | Bacteria | 3478 |
| 872 | Ga0451577_0117602 | 3300042876 | Bacteria | 2381 |
| 873 | Ga0453684_0012886 | 3300044712 | Bacteria | 13697 |
| 874 | Ga0453684_0026885 | 3300044712 | Bacteria | 8289 |
| 875 | Ga0466957_0279098 | 3300044842 | Bacteria | 1118 |
| 876 | Ga0451576_0000210 | 3300045051 | Bacteria | 146650 |
| 877 | Ga0451576_0258421 | 3300045051 | Bacteria | 1820 |
| 878 | Ga0451576_0411870 | 3300045051 | Bacteria | 1418 |
| 879 | Ga0495592_0170897 | 3300046454 | Bacteria | 1489 |
| 880 | Ga0495603_0098969 | 3300046455 | Bacteria | 1703 |
| 881 | Ga0495580_0000663 | 3300046472 | Bacteria | 29297 |
| 882 | Ga0495582_0030783 | 3300046473 | Bacteria | 2948 |
| 883 | Ga0495582_0172882 | 3300046473 | Bacteria | 1230 |
| 884 | Ga0495620_0001137 | 3300046515 | Bacteria | 16250 |
| 885 | Ga0495663_0004342 | 3300046525 | Bacteria | 3993 |
| 886 | Ga0495640_0123983 | 3300046533 | Bacteria | 1677 |
| 887 | Ga0495640_0411422 | 3300046533 | Bacteria | 829 |
| 888 | Ga0495634_0310140 | 3300046642 | Bacteria | 952 |
| 889 | Ga0495635_0461852 | 3300046663 | Bacteria | 839 |
| 890 | Ga0495647_0035101 | 3300046681 | Bacteria | 1881 |
| 891 | Ga0495658_0028039 | 3300046683 | Bacteria | 3036 |
| 892 | Ga0495658_0107310 | 3300046683 | Bacteria | 1675 |
| 893 | Ga0495658_0246942 | 3300046683 | Bacteria | 1122 |
| 894 | Ga0495658_0303323 | 3300046683 | Bacteria | 1010 |
| 895 | Ga0495613_0239505 | 3300046689 | Bacteria | 1269 |
| 896 | Ga0495674_0341041 | 3300047319 | Bacteria | 1218 |
| 897 | Ga0495679_008002 | 3300047446 | Bacteria | 4344 |
| 898 | Ga0496100_0095621 | 3300048903 | Bacteria | 2037 |
| 899 | Ga0496100_0105940 | 3300048903 | Bacteria | 1945 |
| 900 | Ga0496100_0196378 | 3300048903 | Bacteria | 1468 |
| 901 | Ga0496100_0458303 | 3300048903 | Bacteria | 978 |
| 902 | Ga0496101_0000804 | 3300048904 | Bacteria | 18549 |
| 903 | Ga0496101_0068972 | 3300048904 | Bacteria | 2586 |
| 904 | Ga0496101_0228831 | 3300048904 | Bacteria | 1445 |
| 905 | Ga0496102_0068560 | 3300048905 | Bacteria | 3255 |
| 906 | Ga0496102_0262055 | 3300048905 | Bacteria | 1630 |
| 907 | Ga0496103_0085381 | 3300048906 | Bacteria | 1989 |
| 908 | Ga0496103_0154769 | 3300048906 | Bacteria | 1469 |
| 909 | Ga0496104_0022186 | 3300048907 | Bacteria | 5832 |
| 910 | Ga0496104_0174282 | 3300048907 | Bacteria | 2061 |
| 911 | Ga0496104_0645482 | 3300048907 | Bacteria | 967 |
| 912 | Ga0496105_0016985 | 3300048908 | Bacteria | 5823 |
| 913 | Ga0496105_0244751 | 3300048908 | Bacteria | 1454 |
| 914 | Ga0496106_0012297 | 3300048909 | Bacteria | 6316 |
| 915 | Ga0496106_0014789 | 3300048909 | Bacteria | 5771 |
| 916 | Ga0496106_0073654 | 3300048909 | Bacteria | 2613 |
| 917 | Ga0496106_0091645 | 3300048909 | Bacteria | 2347 |
| 918 | Ga0496107_0001319 | 3300048910 | Bacteria | 15218 |
| 919 | Ga0496107_0027201 | 3300048910 | Bacteria | 4061 |
| 920 | Ga0496107_0047373 | 3300048910 | Bacteria | 3096 |
| 921 | Ga0496107_0264037 | 3300048910 | Bacteria | 1281 |
| 922 | Ga0496107_0488291 | 3300048910 | Bacteria | 914 |
| 923 | Ga0496108_0010757 | 3300048911 | Bacteria | 7428 |
| 924 | Ga0496108_0048768 | 3300048911 | Bacteria | 3541 |
| 925 | Ga0496108_0097513 | 3300048911 | Bacteria | 2505 |
| 926 | Ga0496108_0374234 | 3300048911 | Bacteria | 1244 |
| 927 | Ga0496108_0440771 | 3300048911 | Bacteria | 1138 |
| 928 | Ga0496108_0659313 | 3300048911 | Bacteria | 909 |
| 929 | Ga0496109_0005670 | 3300048912 | Bacteria | 10446 |
| 930 | Ga0496109_0289352 | 3300048912 | Bacteria | 1544 |
| 931 | Ga0496109_0503735 | 3300048912 | Bacteria | 1143 |
| 932 | Ga0496110_0000624 | 3300048913 | Bacteria | 24227 |
| 933 | Ga0496110_0004549 | 3300048913 | Bacteria | 10770 |
| 934 | Ga0496111_0031212 | 3300048914 | Bacteria | 3795 |
| 935 | Ga0496111_0038547 | 3300048914 | Bacteria | 3424 |
| 936 | Ga0496112_0001309 | 3300048915 | Bacteria | 18920 |
| 937 | Ga0496112_0017117 | 3300048915 | Bacteria | 6805 |
| 938 | Ga0496113_0163287 | 3300048916 | Bacteria | 1762 |
| 939 | Ga0496113_0405722 | 3300048916 | Bacteria | 1094 |
| 940 | Ga0496114_0001096 | 3300048917 | Bacteria | 20425 |
| 941 | Ga0496114_0036010 | 3300048917 | Bacteria | 4090 |
| 942 | Ga0496114_0120928 | 3300048917 | Bacteria | 2252 |
| 943 | Ga0496114_0524152 | 3300048917 | Bacteria | 1048 |
| 944 | Ga0496115_0030979 | 3300048918 | Bacteria | 4213 |
| 945 | Ga0501032_0088866 | 3300049569 | Bacteria | 2051 |
| 946 | Ga0501032_0207719 | 3300049569 | Bacteria | 1277 |
| 947 | Ga0501034_0050704 | 3300049571 | Bacteria | 4186 |
| 948 | Ga0501034_0115691 | 3300049571 | Bacteria | 2670 |
| 949 | Ga0501034_0534763 | 3300049571 | Bacteria | 1082 |
| 950 | Ga0501034_0593539 | 3300049571 | Bacteria | 1014 |
| 951 | Ga0501036_0158385 | 3300049572 | Bacteria | 1909 |
| 952 | Ga0501036_0307820 | 3300049572 | Bacteria | 1325 |
| 953 | Ga0501036_0632738 | 3300049572 | Bacteria | 886 |
| 954 | Ga0501037_0220767 | 3300049573 | Bacteria | 1334 |
| 955 | Ga0501038_0090499 | 3300049574 | Bacteria | 2564 |
| 956 | Ga0501038_0433862 | 3300049574 | Bacteria | 1012 |
| 957 | Ga0501039_0053929 | 3300049575 | Bacteria | 3112 |
| 958 | Ga0501040_0394708 | 3300049576 | Bacteria | 993 |
| 959 | Ga0501042_0215406 | 3300049578 | Bacteria | 1385 |
| 960 | Ga0501043_0105553 | 3300049579 | Bacteria | 2213 |
| 961 | Ga0501043_0160626 | 3300049579 | Bacteria | 1756 |
| 962 | Ga0501046_0113097 | 3300049580 | Bacteria | 2072 |
| 963 | Ga0501047_0002575 | 3300049581 | Bacteria | 17304 |
| 964 | Ga0501047_0009177 | 3300049581 | Bacteria | 9339 |
| 965 | Ga0501047_0057812 | 3300049581 | Bacteria | 3749 |
| 966 | Ga0501047_0081175 | 3300049581 | Bacteria | 3117 |
| 967 | Ga0501048_0183220 | 3300049582 | Bacteria | 1484 |
| 968 | Ga0501068_0179003 | 3300049584 | Bacteria | 1340 |
| 969 | Ga0501069_0094477 | 3300049585 | Bacteria | 1692 |
| 970 | Ga0501071_0065368 | 3300049587 | Bacteria | 2641 |
| 971 | Ga0501072_0072881 | 3300049588 | Bacteria | 2715 |
| 972 | Ga0501072_0353991 | 3300049588 | Bacteria | 1166 |
| 973 | Ga0501072_0535589 | 3300049588 | Bacteria | 925 |
| 974 | Ga0501073_0005701 | 3300049589 | Bacteria | 9315 |
| 975 | Ga0501073_0105592 | 3300049589 | Bacteria | 1955 |
| 976 | Ga0501073_0170905 | 3300049589 | Bacteria | 1504 |
| 977 | Ga0501074_0146909 | 3300049590 | Bacteria | 1686 |
| 978 | Ga0501075_0191716 | 3300049591 | Bacteria | 1559 |
| 979 | Ga0501076_0161218 | 3300049592 | Bacteria | 1827 |
| 980 | Ga0501076_0336567 | 3300049592 | Bacteria | 1238 |
| 981 | Ga0501076_0478279 | 3300049592 | Bacteria | 1026 |
| 982 | Ga0501077_0059883 | 3300049593 | Bacteria | 2417 |
| 983 | Ga0501249_003177 | 3300049679 | Bacteria | 3307 |
| 984 | Ga0501225_0008478 | 3300049705 | Bacteria | 2950 |
| 985 | Ga0501080_0172854 | 3300049742 | Bacteria | 1992 |
| 986 | Ga0501080_0192319 | 3300049742 | Bacteria | 1875 |
| 987 | Ga0501080_0279195 | 3300049742 | Bacteria | 1519 |
| 988 | Ga0501080_0315690 | 3300049742 | Bacteria | 1416 |
| 989 | Ga0501080_0415853 | 3300049742 | Bacteria | 1208 |
| 990 | Ga0501081_0649467 | 3300049743 | Bacteria | 791 |
| 991 | Ga0501083_0005216 | 3300049744 | Bacteria | 9195 |
| 992 | Ga0501035_0037068 | 3300049822 | Bacteria | 4417 |
| 993 | Ga0501035_0059697 | 3300049822 | Bacteria | 3397 |
| 994 | Ga0501035_0543620 | 3300049822 | Bacteria | 952 |
| 995 | Ga0501044_0002082 | 3300049823 | Bacteria | 23049 |
| 996 | Ga0501044_0016786 | 3300049823 | Bacteria | 7858 |
| 997 | Ga0501044_0063575 | 3300049823 | Bacteria | 3769 |
| 998 | Ga0501045_0455089 | 3300049824 | Bacteria | 951 |
| 999 | nmdc:mga00v17_332592_c1 | 3300050491 | Bacteria | 987 |
| 1000 | nmdc:mga05p37_2308_c1 | 3300050507 | Bacteria | 22237 |
| 1001 | nmdc:mga05p37_426951_c1 | 3300050507 | Bacteria | 1541 |
| 1002 | nmdc:mga05p37_564957_c1 | 3300050507 | Bacteria | 1292 |
| 1003 | nmdc:mga05p37_70113_c1 | 3300050507 | Bacteria | 4312 |
| 1004 | nmdc:mga05p37_76566_c2 | 3300050507 | Bacteria | 3176 |
| 1005 | nmdc:mga05p37_94815_c1 | 3300050507 | Bacteria | 3677 |
| 1006 | nmdc:mga05p37_98291_c1 | 3300050507 | Bacteria | 3605 |
| 1007 | nmdc:mga0qj67_28397_c1 | 3300050509 | Bacteria | 4342 |
| 1008 | nmdc:mga06r32_293267_c1 | 3300050510 | Bacteria | 1613 |
| 1009 | nmdc:mga06r32_510229_c1 | 3300050510 | Bacteria | 1179 |
| 1010 | nmdc:mga06r32_58829_c1 | 3300050510 | Bacteria | 3694 |
| 1011 | nmdc:mga08y16_11_c1 | 3300050511 | Bacteria | 463712 |
| 1012 | nmdc:mga08y16_170629_c1 | 3300050511 | Bacteria | 2260 |
| 1013 | nmdc:mga08y16_25248_c1 | 3300050511 | Bacteria | 6266 |
| 1014 | nmdc:mga08y16_627183_c1 | 3300050511 | Bacteria | 1081 |
| 1015 | nmdc:mga08y16_74414_c1 | 3300050511 | Bacteria | 3539 |
| 1016 | nmdc:mga0n895_10721_c1 | 3300050512 | Bacteria | 8121 |
| 1017 | nmdc:mga0n895_11721_c1 | 3300050512 | Bacteria | 7836 |
| 1018 | nmdc:mga0n895_118847_c1 | 3300050512 | Bacteria | 2664 |
| 1019 | nmdc:mga0n895_11942_c1 | 3300050512 | Bacteria | 7773 |
| 1020 | nmdc:mga0n895_121367_c1 | 3300050512 | Bacteria | 2634 |
| 1021 | nmdc:mga0n895_197254_c1 | 3300050512 | Bacteria | 2044 |
| 1022 | nmdc:mga0n895_304741_c1 | 3300050512 | Bacteria | 1615 |
| 1023 | nmdc:mga0rr50_1256_c1 | 3300050513 | Bacteria | 13795 |
| 1024 | nmdc:mga0rr50_24004_c1 | 3300050513 | Bacteria | 4217 |
| 1025 | nmdc:mga0rr50_2985_c1 | 3300050513 | Bacteria | 9671 |
| 1026 | nmdc:mga0rr50_53607_c1 | 3300050513 | Bacteria | 3001 |
| 1027 | nmdc:mga08x19_112678_c1 | 3300050514 | Bacteria | 1816 |
| 1028 | nmdc:mga08x19_137947_c1 | 3300050514 | Bacteria | 1645 |
| 1029 | nmdc:mga08x19_146636_c1 | 3300050514 | Bacteria | 1596 |
| 1030 | nmdc:mga08x19_1832_c1 | 3300050514 | Bacteria | 13043 |
| 1031 | nmdc:mga08x19_28730_c1 | 3300050514 | Bacteria | 3485 |
| 1032 | nmdc:mga08x19_493616_c1 | 3300050514 | Bacteria | 864 |
| 1033 | nmdc:mga0a205_120152_c1 | 3300050515 | Bacteria | 2527 |
| 1034 | nmdc:mga0a205_135_c1 | 3300050515 | Bacteria | 46167 |
| 1035 | nmdc:mga0a205_22590_c1 | 3300050515 | Bacteria | 5961 |
| 1036 | nmdc:mga0a205_51011_c1 | 3300050515 | Bacteria | 3994 |
| 1037 | nmdc:mga0a205_6061_c2 | 3300050515 | Bacteria | 7879 |
| 1038 | Ga0495655_0000046 | 3300053083 | Bacteria | 25139 |
| 1039 | Ga0495619_0074996 | 3300053085 | Bacteria | 2269 |
| 1040 | Ga0495619_0079770 | 3300053085 | Bacteria | 2202 |
| 1041 | Ga0495619_0207257 | 3300053085 | Bacteria | 1357 |
| 1042 | Ga0500555_000947 | 3300053103 | Bacteria | 10089 |
| 1043 | Ga0500616_0000358 | 3300053153 | Bacteria | 64893 |
| 1044 | Ga0500645_000794 | 3300053730 | Bacteria | 18915 |
| 1045 | Ga0501084_0064935 | 3300054114 | Bacteria | 3054 |
| 1046 | Ga0501082_0008962 | 3300060353 | Bacteria | 8635 |
| 1047 | Ga0501082_0050120 | 3300060353 | Bacteria | 3601 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035118 | Ga0373954_0420691 | Ga0373954_0420691_26_631 | 201 |
| 2 | 3300005458 | Ga0070681_10202495 | Ga0070681_102024953 | 207 |
| 3 | 3300006871 | Ga0075434_100483855 | Ga0075434_1004838553 | 207 |
| 4 | 3300025912 | Ga0207707_10218897 | Ga0207707_102188972 | 207 |
| 5 | 3300005340 | Ga0070689_100003762 | Ga0070689_10000376210 | 208 |
| 6 | 3300005842 | Ga0068858_100000518 | Ga0068858_10000051817 | 208 |
| 7 | 3300009098 | Ga0105245_10131807 | Ga0105245_101318071 | 208 |
| 8 | 3300025927 | Ga0207687_10031920 | Ga0207687_100319203 | 208 |
| 9 | 3300025936 | Ga0207670_10002387 | Ga0207670_1000238710 | 208 |
| 10 | 3300026035 | Ga0207703_10000164 | Ga0207703_1000016441 | 208 |
| 11 | 3300005338 | Ga0068868_100000558 | Ga0068868_1000005589 | 210 |
| 12 | 3300026023 | Ga0207677_10000008 | Ga0207677_1000000849 | 210 |
| 13 | 3300005331 | Ga0070670_100002410 | Ga0070670_1000024105 | 211 |
| 14 | 3300005564 | Ga0070664_100204324 | Ga0070664_1002043242 | 211 |
| 15 | 3300005841 | Ga0068863_100013369 | Ga0068863_1000133696 | 211 |
| 16 | 3300025925 | Ga0207650_10017867 | Ga0207650_100178672 | 211 |
| 17 | 3300026088 | Ga0207641_10043578 | Ga0207641_100435783 | 211 |
| 18 | 3300005337 | Ga0070682_100000010 | Ga0070682_10000001070 | 213 |
| 19 | 3300025939 | Ga0207665_10268481 | Ga0207665_102684812 | 215 |
| 20 | 3300049743 | Ga0501081_0649467 | Ga0501081_0649467_11_730 | 216 |
| 21 | 3300005328 | Ga0070676_10190150 | Ga0070676_101901502 | 217 |
| 22 | 3300005356 | Ga0070674_100024606 | Ga0070674_1000246065 | 217 |
| 23 | 3300005438 | Ga0070701_10063976 | Ga0070701_100639762 | 217 |
| 24 | 3300009148 | Ga0105243_10451610 | Ga0105243_104516102 | 217 |
| 25 | 3300025907 | Ga0207645_10144397 | Ga0207645_101443972 | 217 |
| 26 | 3300025937 | Ga0207669_10064114 | Ga0207669_100641142 | 217 |
| 27 | 3300026089 | Ga0207648_10421914 | Ga0207648_104219142 | 217 |
| 28 | 3300005366 | Ga0070659_100114770 | Ga0070659_1001147702 | 219 |
| 29 | 3300005564 | Ga0070664_100103541 | Ga0070664_1001035413 | 219 |
| 30 | 3300005834 | Ga0068851_10105317 | Ga0068851_101053172 | 219 |
| 31 | 3300013104 | Ga0157370_10057832 | Ga0157370_100578324 | 219 |
| 32 | 3300025932 | Ga0207690_10052009 | Ga0207690_100520094 | 219 |
| 33 | 3300025945 | Ga0207679_10013736 | Ga0207679_100137367 | 219 |
| 34 | 3300026121 | Ga0207683_10033759 | Ga0207683_100337592 | 219 |
| 35 | 3300028666 | Ga0265336_10002300 | Ga0265336_100023005 | 219 |
| 36 | 3300029957 | Ga0265324_10000005 | Ga0265324_10000005121 | 219 |
| 37 | 3300031241 | Ga0265325_10001486 | Ga0265325_100014865 | 219 |
| 38 | 3300031251 | Ga0265327_10236819 | Ga0265327_102368191 | 219 |
| 39 | 3300031711 | Ga0265314_10026066 | Ga0265314_100260664 | 219 |
| 40 | 3300048911 | Ga0496108_0659313 | Ga0496108_0659313_126_878 | 219 |
| 41 | 3300005327 | Ga0070658_10099113 | Ga0070658_100991133 | 220 |
| 42 | 3300005329 | Ga0070683_100016811 | Ga0070683_1000168115 | 220 |
| 43 | 3300005336 | Ga0070680_100085042 | Ga0070680_1000850423 | 220 |
| 44 | 3300005339 | Ga0070660_100014318 | Ga0070660_1000143184 | 220 |
| 45 | 3300005344 | Ga0070661_100000813 | Ga0070661_10000081318 | 220 |
| 46 | 3300005366 | Ga0070659_100030277 | Ga0070659_1000302774 | 220 |
| 47 | 3300005435 | Ga0070714_100156608 | Ga0070714_1001566082 | 220 |
| 48 | 3300005436 | Ga0070713_100212468 | Ga0070713_1002124681 | 220 |
| 49 | 3300005530 | Ga0070679_100092060 | Ga0070679_1000920602 | 220 |
| 50 | 3300005535 | Ga0070684_100005117 | Ga0070684_1000051176 | 220 |
| 51 | 3300005539 | Ga0068853_100029977 | Ga0068853_1000299772 | 220 |
| 52 | 3300005563 | Ga0068855_100008719 | Ga0068855_10000871911 | 220 |
| 53 | 3300005564 | Ga0070664_100014812 | Ga0070664_1000148124 | 220 |
| 54 | 3300005577 | Ga0068857_100006850 | Ga0068857_10000685012 | 220 |
| 55 | 3300005578 | Ga0068854_100005152 | Ga0068854_1000051527 | 220 |
| 56 | 3300005614 | Ga0068856_100016323 | Ga0068856_1000163234 | 220 |
| 57 | 3300005616 | Ga0068852_100001206 | Ga0068852_1000012068 | 220 |
| 58 | 3300005834 | Ga0068851_10283666 | Ga0068851_102836661 | 220 |
| 59 | 3300009093 | Ga0105240_10059153 | Ga0105240_100591533 | 220 |
| 60 | 3300009174 | Ga0105241_10044133 | Ga0105241_100441333 | 220 |
| 61 | 3300009545 | Ga0105237_10023342 | Ga0105237_100233423 | 220 |
| 62 | 3300009551 | Ga0105238_10003217 | Ga0105238_100032174 | 220 |
| 63 | 3300013100 | Ga0157373_10006638 | Ga0157373_100066386 | 220 |
| 64 | 3300013102 | Ga0157371_10273908 | Ga0157371_102739083 | 220 |
| 65 | 3300013104 | Ga0157370_10031830 | Ga0157370_100318304 | 220 |
| 66 | 3300013105 | Ga0157369_10004689 | Ga0157369_1000468916 | 220 |
| 67 | 3300013307 | Ga0157372_10020911 | Ga0157372_100209114 | 220 |
| 68 | 3300025909 | Ga0207705_10066572 | Ga0207705_100665723 | 220 |
| 69 | 3300025912 | Ga0207707_10024558 | Ga0207707_100245585 | 220 |
| 70 | 3300025913 | Ga0207695_10018572 | Ga0207695_100185726 | 220 |
| 71 | 3300025919 | Ga0207657_10019066 | Ga0207657_100190664 | 220 |
| 72 | 3300025920 | Ga0207649_10000924 | Ga0207649_100009245 | 220 |
| 73 | 3300025924 | Ga0207694_10003088 | Ga0207694_100030888 | 220 |
| 74 | 3300025929 | Ga0207664_10015733 | Ga0207664_100157333 | 220 |
| 75 | 3300025944 | Ga0207661_10041533 | Ga0207661_100415334 | 220 |
| 76 | 3300025945 | Ga0207679_10066044 | Ga0207679_100660443 | 220 |
| 77 | 3300025949 | Ga0207667_10019236 | Ga0207667_100192365 | 220 |
| 78 | 3300025981 | Ga0207640_10016813 | Ga0207640_100168134 | 220 |
| 79 | 3300026041 | Ga0207639_10143244 | Ga0207639_101432442 | 220 |
| 80 | 3300026078 | Ga0207702_10003782 | Ga0207702_1000378213 | 220 |
| 81 | 3300026116 | Ga0207674_10000536 | Ga0207674_100005366 | 220 |
| 82 | 3300026142 | Ga0207698_10012426 | Ga0207698_100124267 | 220 |
| 83 | 3300030731 | Ga0316177_1030295 | Ga0316177_10302953 | 220 |
| 84 | 3300030733 | Ga0314311_1144403 | Ga0314311_11444037 | 220 |
| 85 | 3300030734 | Ga0316179_1069783 | Ga0316179_10697833 | 220 |
| 86 | 3300030736 | Ga0316180_1031618 | Ga0316180_10316183 | 220 |
| 87 | 3300030742 | Ga0316183_1091323 | Ga0316183_10913237 | 220 |
| 88 | 3300032002 | Ga0307416_100254564 | Ga0307416_1002545643 | 220 |
| 89 | 3300037418 | Ga0395900_0019317 | Ga0395900_0019317_3648_4403 | 220 |
| 90 | 3300048915 | Ga0496112_0017117 | Ga0496112_0017117_5959_6720 | 220 |
| 91 | 3300049569 | Ga0501032_0088866 | Ga0501032_0088866_192_932 | 220 |
| 92 | 3300049571 | Ga0501034_0534763 | Ga0501034_0534763_56_796 | 220 |
| 93 | 3300049571 | Ga0501034_0593539 | Ga0501034_0593539_142_882 | 220 |
| 94 | 3300049572 | Ga0501036_0158385 | Ga0501036_0158385_810_1550 | 220 |
| 95 | 3300049574 | Ga0501038_0090499 | Ga0501038_0090499_1776_2516 | 220 |
| 96 | 3300049579 | Ga0501043_0105553 | Ga0501043_0105553_1095_1835 | 220 |
| 97 | 3300049580 | Ga0501046_0113097 | Ga0501046_0113097_1056_1796 | 220 |
| 98 | 3300049581 | Ga0501047_0057812 | Ga0501047_0057812_238_978 | 220 |
| 99 | 3300049581 | Ga0501047_0081175 | Ga0501047_0081175_2135_2875 | 220 |
| 100 | 3300049582 | Ga0501048_0183220 | Ga0501048_0183220_36_776 | 220 |
| 101 | 3300049584 | Ga0501068_0179003 | Ga0501068_0179003_321_1061 | 220 |
| 102 | 3300049585 | Ga0501069_0094477 | Ga0501069_0094477_809_1549 | 220 |
| 103 | 3300049589 | Ga0501073_0005701 | Ga0501073_0005701_3377_4117 | 220 |
| 104 | 3300049589 | Ga0501073_0170905 | Ga0501073_0170905_658_1398 | 220 |
| 105 | 3300049593 | Ga0501077_0059883 | Ga0501077_0059883_379_1119 | 220 |
| 106 | 3300049679 | Ga0501249_003177 | Ga0501249_003177_665_1408 | 220 |
| 107 | 3300049705 | Ga0501225_0008478 | Ga0501225_0008478_686_1429 | 220 |
| 108 | 3300049742 | Ga0501080_0415853 | Ga0501080_0415853_186_926 | 220 |
| 109 | 3300049744 | Ga0501083_0005216 | Ga0501083_0005216_5116_5856 | 220 |
| 110 | 3300049822 | Ga0501035_0059697 | Ga0501035_0059697_441_1181 | 220 |
| 111 | 3300049823 | Ga0501044_0063575 | Ga0501044_0063575_262_1002 | 220 |
| 112 | 3300049824 | Ga0501045_0455089 | Ga0501045_0455089_132_872 | 220 |
| 113 | 3300060353 | Ga0501082_0008962 | Ga0501082_0008962_1708_2448 | 220 |
| 114 | 3300005356 | Ga0070674_100206600 | Ga0070674_1002066002 | 221 |
| 115 | 3300005456 | Ga0070678_100206274 | Ga0070678_1002062741 | 221 |
| 116 | 3300005459 | Ga0068867_100034852 | Ga0068867_1000348523 | 221 |
| 117 | 3300006358 | Ga0068871_100098921 | Ga0068871_1000989212 | 221 |
| 118 | 3300009176 | Ga0105242_10055487 | Ga0105242_100554872 | 221 |
| 119 | 3300014968 | Ga0157379_10090502 | Ga0157379_100905023 | 221 |
| 120 | 3300026089 | Ga0207648_10294259 | Ga0207648_102942591 | 221 |
| 121 | 3300026121 | Ga0207683_10064063 | Ga0207683_100640633 | 221 |
| 122 | 3300049588 | Ga0501072_0072881 | Ga0501072_0072881_1163_1939 | 221 |
| 123 | 3300009177 | Ga0105248_10016076 | Ga0105248_100160764 | 222 |
| 124 | 3300014968 | Ga0157379_10000246 | Ga0157379_100002469 | 222 |
| 125 | 3300028653 | Ga0265323_10062659 | Ga0265323_100626592 | 222 |
| 126 | 3300037853 | Ga0436364_0470212 | Ga0436364_0470212_10429_11178 | 222 |
| 127 | 3300049581 | Ga0501047_0002575 | Ga0501047_0002575_10250_10987 | 222 |
| 128 | 3300049822 | Ga0501035_0037068 | Ga0501035_0037068_1510_2247 | 222 |
| 129 | 3300049823 | Ga0501044_0002082 | Ga0501044_0002082_2557_3294 | 222 |
| 130 | 3300005842 | Ga0068858_100233860 | Ga0068858_1002338603 | 223 |
| 131 | 3300006358 | Ga0068871_100388610 | Ga0068871_1003886102 | 223 |
| 132 | 3300049571 | Ga0501034_0115691 | Ga0501034_0115691_1487_2227 | 223 |
| 133 | 3300049742 | Ga0501080_0279195 | Ga0501080_0279195_578_1252 | 223 |
| 134 | 3300009147 | Ga0114129_10332317 | Ga0114129_103323173 | 224 |
| 135 | 3300049569 | Ga0501032_0207719 | Ga0501032_0207719_292_1038 | 224 |
| 136 | 3300049572 | Ga0501036_0632738 | Ga0501036_0632738_103_849 | 224 |
| 137 | 3300049575 | Ga0501039_0053929 | Ga0501039_0053929_1215_1961 | 224 |
| 138 | 3300049578 | Ga0501042_0215406 | Ga0501042_0215406_312_1058 | 224 |
| 139 | 3300049579 | Ga0501043_0160626 | Ga0501043_0160626_408_1154 | 224 |
| 140 | 3300049587 | Ga0501071_0065368 | Ga0501071_0065368_945_1691 | 224 |
| 141 | 3300049588 | Ga0501072_0353991 | Ga0501072_0353991_62_802 | 224 |
| 142 | 3300049592 | Ga0501076_0161218 | Ga0501076_0161218_53_799 | 224 |
| 143 | 3300050507 | nmdc:mga05p37_98291_c1 | nmdc:mga05p37_98291_c1_2730_3470 | 224 |
| 144 | 3300005340 | Ga0070689_100120693 | Ga0070689_1001206931 | 225 |
| 145 | 3300005842 | Ga0068858_100671672 | Ga0068858_1006716722 | 225 |
| 146 | 3300005843 | Ga0068860_100066331 | Ga0068860_1000663313 | 225 |
| 147 | 3300009177 | Ga0105248_10911896 | Ga0105248_109118962 | 225 |
| 148 | 3300026067 | Ga0207678_10046744 | Ga0207678_100467443 | 225 |
| 149 | 3300028381 | Ga0268264_10046748 | Ga0268264_100467484 | 225 |
| 150 | 3300049589 | Ga0501073_0105592 | Ga0501073_0105592_177_917 | 225 |
| 151 | 3300005293 | Ga0065715_10199719 | Ga0065715_101997192 | 226 |
| 152 | 3300005328 | Ga0070676_10086000 | Ga0070676_100860002 | 226 |
| 153 | 3300005331 | Ga0070670_100006838 | Ga0070670_10000683810 | 226 |
| 154 | 3300005334 | Ga0068869_100002596 | Ga0068869_1000025967 | 226 |
| 155 | 3300005338 | Ga0068868_100094582 | Ga0068868_1000945823 | 226 |
| 156 | 3300005347 | Ga0070668_100018243 | Ga0070668_1000182433 | 226 |
| 157 | 3300005353 | Ga0070669_100009649 | Ga0070669_1000096493 | 226 |
| 158 | 3300005364 | Ga0070673_100028043 | Ga0070673_1000280431 | 226 |
| 159 | 3300005367 | Ga0070667_100006047 | Ga0070667_1000060476 | 226 |
| 160 | 3300005440 | Ga0070705_100008967 | Ga0070705_1000089672 | 226 |
| 161 | 3300005459 | Ga0068867_100005228 | Ga0068867_1000052288 | 226 |
| 162 | 3300005563 | Ga0068855_100430592 | Ga0068855_1004305922 | 226 |
| 163 | 3300005577 | Ga0068857_100049665 | Ga0068857_1000496654 | 226 |
| 164 | 3300005617 | Ga0068859_100008168 | Ga0068859_1000081688 | 226 |
| 165 | 3300005618 | Ga0068864_100000456 | Ga0068864_1000004567 | 226 |
| 166 | 3300005719 | Ga0068861_100023402 | Ga0068861_1000234023 | 226 |
| 167 | 3300005841 | Ga0068863_100039196 | Ga0068863_1000391962 | 226 |
| 168 | 3300005841 | Ga0068863_100082598 | Ga0068863_1000825983 | 226 |
| 169 | 3300005842 | Ga0068858_100008910 | Ga0068858_1000089107 | 226 |
| 170 | 3300005843 | Ga0068860_100008086 | Ga0068860_1000080868 | 226 |
| 171 | 3300005843 | Ga0068860_100076833 | Ga0068860_1000768333 | 226 |
| 172 | 3300006931 | Ga0097620_100008167 | Ga0097620_1000081678 | 226 |
| 173 | 3300013297 | Ga0157378_10077918 | Ga0157378_100779183 | 226 |
| 174 | 3300014325 | Ga0163163_10011827 | Ga0163163_100118276 | 226 |
| 175 | 3300025907 | Ga0207645_10031672 | Ga0207645_100316721 | 226 |
| 176 | 3300025923 | Ga0207681_10019593 | Ga0207681_100195933 | 226 |
| 177 | 3300025925 | Ga0207650_10004702 | Ga0207650_100047028 | 226 |
| 178 | 3300025942 | Ga0207689_10001032 | Ga0207689_1000103223 | 226 |
| 179 | 3300025949 | Ga0207667_10129880 | Ga0207667_101298801 | 226 |
| 180 | 3300025960 | Ga0207651_10025885 | Ga0207651_100258851 | 226 |
| 181 | 3300025986 | Ga0207658_10004931 | Ga0207658_100049316 | 226 |
| 182 | 3300026035 | Ga0207703_10007505 | Ga0207703_100075055 | 226 |
| 183 | 3300026088 | Ga0207641_10013613 | Ga0207641_100136137 | 226 |
| 184 | 3300026088 | Ga0207641_10308856 | Ga0207641_103088562 | 226 |
| 185 | 3300026089 | Ga0207648_10004696 | Ga0207648_1000469611 | 226 |
| 186 | 3300026095 | Ga0207676_10001747 | Ga0207676_100017477 | 226 |
| 187 | 3300026118 | Ga0207675_100006036 | Ga0207675_1000060363 | 226 |
| 188 | 3300026118 | Ga0207675_100323764 | Ga0207675_1003237641 | 226 |
| 189 | 3300028381 | Ga0268264_10005591 | Ga0268264_100055916 | 226 |
| 190 | 3300028381 | Ga0268264_10032442 | Ga0268264_100324423 | 226 |
| 191 | 3300048904 | Ga0496101_0228831 | Ga0496101_0228831_347_1147 | 226 |
| 192 | 3300048905 | Ga0496102_0068560 | Ga0496102_0068560_1301_2053 | 226 |
| 193 | 3300048911 | Ga0496108_0048768 | Ga0496108_0048768_629_1429 | 226 |
| 194 | 3300048911 | Ga0496108_0097513 | Ga0496108_0097513_1046_1798 | 226 |
| 195 | 3300048912 | Ga0496109_0289352 | Ga0496109_0289352_217_1017 | 226 |
| 196 | 3300048916 | Ga0496113_0163287 | Ga0496113_0163287_416_1216 | 226 |
| 197 | 3300049742 | Ga0501080_0315690 | Ga0501080_0315690_153_899 | 226 |
| 198 | 3300005356 | Ga0070674_100270495 | Ga0070674_1002704952 | 228 |
| 199 | 3300025919 | Ga0207657_10005722 | Ga0207657_100057224 | 228 |
| 200 | 3300025944 | Ga0207661_10688701 | Ga0207661_106887011 | 228 |
| 201 | 3300026118 | Ga0207675_100612701 | Ga0207675_1006127012 | 228 |
| 202 | 3300049588 | Ga0501072_0535589 | Ga0501072_0535589_85_825 | 228 |
| 203 | 3300049590 | Ga0501074_0146909 | Ga0501074_0146909_883_1623 | 228 |
| 204 | 3300049592 | Ga0501076_0336567 | Ga0501076_0336567_419_1159 | 228 |
| 205 | 3300049742 | Ga0501080_0192319 | Ga0501080_0192319_947_1687 | 228 |
| 206 | 3300005328 | Ga0070676_10043387 | Ga0070676_100433872 | 229 |
| 207 | 3300005353 | Ga0070669_100370318 | Ga0070669_1003703181 | 229 |
| 208 | 3300005354 | Ga0070675_100005401 | Ga0070675_1000054013 | 229 |
| 209 | 3300005438 | Ga0070701_10341148 | Ga0070701_103411481 | 229 |
| 210 | 3300005439 | Ga0070711_100320137 | Ga0070711_1003201372 | 229 |
| 211 | 3300006175 | Ga0070712_100440612 | Ga0070712_1004406122 | 229 |
| 212 | 3300006852 | Ga0075433_10019284 | Ga0075433_100192847 | 229 |
| 213 | 3300006871 | Ga0075434_100007152 | Ga0075434_10000715211 | 229 |
| 214 | 3300006914 | Ga0075436_100061454 | Ga0075436_1000614544 | 229 |
| 215 | 3300007076 | Ga0075435_100017210 | Ga0075435_1000172106 | 229 |
| 216 | 3300025915 | Ga0207693_10309411 | Ga0207693_103094112 | 229 |
| 217 | 3300025916 | Ga0207663_10421801 | Ga0207663_104218011 | 229 |
| 218 | 3300025926 | Ga0207659_10072091 | Ga0207659_100720913 | 229 |
| 219 | 3300025960 | Ga0207651_10817812 | Ga0207651_108178121 | 229 |
| 220 | 3300025972 | Ga0207668_10285142 | Ga0207668_102851421 | 229 |
| 221 | 3300026118 | Ga0207675_100828272 | Ga0207675_1008282721 | 229 |
| 222 | 3300027614 | Ga0209970_1001342 | Ga0209970_10013423 | 229 |
| 223 | 3300027665 | Ga0209983_1014893 | Ga0209983_10148932 | 229 |
| 224 | 3300027682 | Ga0209971_1000841 | Ga0209971_10008412 | 229 |
| 225 | 3300027876 | Ga0209974_10004242 | Ga0209974_100042426 | 229 |
| 226 | 3300050512 | nmdc:mga0n895_10721_c1 | nmdc:mga0n895_10721_c1_3056_3802 | 229 |
| 227 | 3300050513 | nmdc:mga0rr50_24004_c1 | nmdc:mga0rr50_24004_c1_2586_3332 | 229 |
| 228 | 3300050514 | nmdc:mga08x19_28730_c1 | nmdc:mga08x19_28730_c1_1950_2696 | 229 |
| 229 | 3300050515 | nmdc:mga0a205_22590_c1 | nmdc:mga0a205_22590_c1_3167_3913 | 229 |
| 230 | 3300005458 | Ga0070681_10349633 | Ga0070681_103496333 | 230 |
| 231 | 3300025921 | Ga0207652_10534900 | Ga0207652_105349002 | 230 |
| 232 | 3300046472 | Ga0495580_0000663 | Ga0495580_0000663_24947_25693 | 230 |
| 233 | 3300060353 | Ga0501082_0050120 | Ga0501082_0050120_1631_2371 | 230 |
| 234 | 3300005364 | Ga0070673_100254886 | Ga0070673_1002548861 | 231 |
| 235 | 3300005546 | Ga0070696_100383092 | Ga0070696_1003830922 | 231 |
| 236 | 3300005841 | Ga0068863_100389847 | Ga0068863_1003898471 | 231 |
| 237 | 3300025920 | Ga0207649_10452621 | Ga0207649_104526212 | 231 |
| 238 | 3300025932 | Ga0207690_10265743 | Ga0207690_102657432 | 231 |
| 239 | 3300053085 | Ga0495619_0079770 | Ga0495619_0079770_778_1530 | 231 |
| 240 | 3300005353 | Ga0070669_100161997 | Ga0070669_1001619971 | 232 |
| 241 | 3300049572 | Ga0501036_0307820 | Ga0501036_0307820_204_944 | 232 |
| 242 | 3300049573 | Ga0501037_0220767 | Ga0501037_0220767_52_792 | 232 |
| 243 | 3300049574 | Ga0501038_0433862 | Ga0501038_0433862_136_876 | 232 |
| 244 | 3300049581 | Ga0501047_0009177 | Ga0501047_0009177_8424_9164 | 232 |
| 245 | 3300049742 | Ga0501080_0172854 | Ga0501080_0172854_153_893 | 232 |
| 246 | 3300049822 | Ga0501035_0543620 | Ga0501035_0543620_129_869 | 232 |
| 247 | 3300049823 | Ga0501044_0016786 | Ga0501044_0016786_2205_2945 | 232 |
| 248 | 3300005339 | Ga0070660_100139432 | Ga0070660_1001394322 | 233 |
| 249 | 3300005344 | Ga0070661_100282494 | Ga0070661_1002824942 | 233 |
| 250 | 3300005365 | Ga0070688_100356666 | Ga0070688_1003566661 | 233 |
| 251 | 3300005366 | Ga0070659_100164043 | Ga0070659_1001640431 | 233 |
| 252 | 3300005543 | Ga0070672_100154318 | Ga0070672_1001543183 | 233 |
| 253 | 3300005616 | Ga0068852_100062049 | Ga0068852_1000620492 | 233 |
| 254 | 3300005844 | Ga0068862_100716574 | Ga0068862_1007165742 | 233 |
| 255 | 3300013104 | Ga0157370_10061023 | Ga0157370_100610232 | 233 |
| 256 | 3300013105 | Ga0157369_10058789 | Ga0157369_100587894 | 233 |
| 257 | 3300013306 | Ga0163162_10718787 | Ga0163162_107187871 | 233 |
| 258 | 3300014745 | Ga0157377_10465382 | Ga0157377_104653821 | 233 |
| 259 | 3300025919 | Ga0207657_10054479 | Ga0207657_100544792 | 233 |
| 260 | 3300025921 | Ga0207652_10270319 | Ga0207652_102703193 | 233 |
| 261 | 3300025940 | Ga0207691_10325923 | Ga0207691_103259231 | 233 |
| 262 | 3300025949 | Ga0207667_10458857 | Ga0207667_104588572 | 233 |
| 263 | 3300005293 | Ga0065715_10289579 | Ga0065715_102895791 | 234 |
| 264 | 3300005329 | Ga0070683_100003892 | Ga0070683_1000038926 | 234 |
| 265 | 3300005331 | Ga0070670_100030395 | Ga0070670_1000303955 | 234 |
| 266 | 3300005331 | Ga0070670_100059281 | Ga0070670_1000592812 | 234 |
| 267 | 3300005335 | Ga0070666_10297375 | Ga0070666_102973751 | 234 |
| 268 | 3300005344 | Ga0070661_100035223 | Ga0070661_1000352233 | 234 |
| 269 | 3300005367 | Ga0070667_100428952 | Ga0070667_1004289522 | 234 |
| 270 | 3300005455 | Ga0070663_100067580 | Ga0070663_1000675803 | 234 |
| 271 | 3300005535 | Ga0070684_100003202 | Ga0070684_10000320212 | 234 |
| 272 | 3300005544 | Ga0070686_100384271 | Ga0070686_1003842711 | 234 |
| 273 | 3300005564 | Ga0070664_100004690 | Ga0070664_1000046906 | 234 |
| 274 | 3300005840 | Ga0068870_10424111 | Ga0068870_104241111 | 234 |
| 275 | 3300005841 | Ga0068863_100271052 | Ga0068863_1002710521 | 234 |
| 276 | 3300009177 | Ga0105248_10075824 | Ga0105248_100758242 | 234 |
| 277 | 3300025908 | Ga0207643_10345605 | Ga0207643_103456051 | 234 |
| 278 | 3300025920 | Ga0207649_10097269 | Ga0207649_100972693 | 234 |
| 279 | 3300025925 | Ga0207650_10116911 | Ga0207650_101169112 | 234 |
| 280 | 3300025933 | Ga0207706_10096475 | Ga0207706_100964753 | 234 |
| 281 | 3300025941 | Ga0207711_10040866 | Ga0207711_100408664 | 234 |
| 282 | 3300025944 | Ga0207661_10027401 | Ga0207661_100274015 | 234 |
| 283 | 3300025944 | Ga0207661_10168781 | Ga0207661_101687813 | 234 |
| 284 | 3300026067 | Ga0207678_10081046 | Ga0207678_100810463 | 234 |
| 285 | 3300026089 | Ga0207648_10068442 | Ga0207648_100684423 | 234 |
| 286 | 3300026142 | Ga0207698_10433472 | Ga0207698_104334722 | 234 |
| 287 | 3300026142 | Ga0207698_10576903 | Ga0207698_105769032 | 234 |
| 288 | 3300028380 | Ga0268265_10119302 | Ga0268265_101193021 | 234 |
| 289 | 3300048907 | Ga0496104_0022186 | Ga0496104_0022186_2129_2869 | 234 |
| 290 | 3300048908 | Ga0496105_0244751 | Ga0496105_0244751_140_880 | 234 |
| 291 | 3300048912 | Ga0496109_0005670 | Ga0496109_0005670_4520_5260 | 234 |
| 292 | 3300048913 | Ga0496110_0000624 | Ga0496110_0000624_5278_6018 | 234 |
| 293 | 3300048914 | Ga0496111_0038547 | Ga0496111_0038547_2386_3126 | 234 |
| 294 | 3300048915 | Ga0496112_0001309 | Ga0496112_0001309_1492_2232 | 234 |
| 295 | 3300050491 | nmdc:mga00v17_332592_c1 | nmdc:mga00v17_332592_c1_25_768 | 234 |
| 296 | 3300005330 | Ga0070690_100144819 | Ga0070690_1001448192 | 235 |
| 297 | 3300005367 | Ga0070667_100031487 | Ga0070667_1000314877 | 235 |
| 298 | 3300005456 | Ga0070678_100630479 | Ga0070678_1006304791 | 235 |
| 299 | 3300005458 | Ga0070681_10210485 | Ga0070681_102104853 | 235 |
| 300 | 3300005459 | Ga0068867_100351233 | Ga0068867_1003512332 | 235 |
| 301 | 3300005535 | Ga0070684_100301319 | Ga0070684_1003013192 | 235 |
| 302 | 3300005539 | Ga0068853_100265985 | Ga0068853_1002659851 | 235 |
| 303 | 3300005547 | Ga0070693_100231999 | Ga0070693_1002319991 | 235 |
| 304 | 3300005577 | Ga0068857_100127435 | Ga0068857_1001274352 | 235 |
| 305 | 3300005614 | Ga0068856_100164239 | Ga0068856_1001642392 | 235 |
| 306 | 3300005841 | Ga0068863_100090613 | Ga0068863_1000906135 | 235 |
| 307 | 3300005842 | Ga0068858_100059594 | Ga0068858_1000595947 | 235 |
| 308 | 3300005843 | Ga0068860_100073073 | Ga0068860_1000730732 | 235 |
| 309 | 3300006237 | Ga0097621_100237521 | Ga0097621_1002375213 | 235 |
| 310 | 3300009098 | Ga0105245_10003461 | Ga0105245_100034612 | 235 |
| 311 | 3300009098 | Ga0105245_10697245 | Ga0105245_106972451 | 235 |
| 312 | 3300009176 | Ga0105242_10108271 | Ga0105242_101082714 | 235 |
| 313 | 3300009176 | Ga0105242_10159342 | Ga0105242_101593424 | 235 |
| 314 | 3300009177 | Ga0105248_10211065 | Ga0105248_102110653 | 235 |
| 315 | 3300009177 | Ga0105248_10632373 | Ga0105248_106323731 | 235 |
| 316 | 3300009545 | Ga0105237_10084650 | Ga0105237_100846504 | 235 |
| 317 | 3300009551 | Ga0105238_10211442 | Ga0105238_102114421 | 235 |
| 318 | 3300011119 | Ga0105246_10077902 | Ga0105246_100779023 | 235 |
| 319 | 3300013296 | Ga0157374_11123983 | Ga0157374_111239831 | 235 |
| 320 | 3300013297 | Ga0157378_10020571 | Ga0157378_100205714 | 235 |
| 321 | 3300013297 | Ga0157378_10143982 | Ga0157378_101439821 | 235 |
| 322 | 3300013306 | Ga0163162_10211090 | Ga0163162_102110904 | 235 |
| 323 | 3300013307 | Ga0157372_11261980 | Ga0157372_112619801 | 235 |
| 324 | 3300013308 | Ga0157375_10087017 | Ga0157375_100870174 | 235 |
| 325 | 3300014968 | Ga0157379_10069965 | Ga0157379_100699656 | 235 |
| 326 | 3300025903 | Ga0207680_10038955 | Ga0207680_100389552 | 235 |
| 327 | 3300025911 | Ga0207654_10263827 | Ga0207654_102638271 | 235 |
| 328 | 3300025912 | Ga0207707_10104251 | Ga0207707_101042511 | 235 |
| 329 | 3300025914 | Ga0207671_10281235 | Ga0207671_102812351 | 235 |
| 330 | 3300025927 | Ga0207687_10219150 | Ga0207687_102191502 | 235 |
| 331 | 3300025927 | Ga0207687_10292402 | Ga0207687_102924021 | 235 |
| 332 | 3300025934 | Ga0207686_10083358 | Ga0207686_100833582 | 235 |
| 333 | 3300025934 | Ga0207686_10095479 | Ga0207686_100954792 | 235 |
| 334 | 3300025941 | Ga0207711_10216573 | Ga0207711_102165733 | 235 |
| 335 | 3300026023 | Ga0207677_10093523 | Ga0207677_100935233 | 235 |
| 336 | 3300026035 | Ga0207703_10133703 | Ga0207703_101337033 | 235 |
| 337 | 3300026041 | Ga0207639_10542994 | Ga0207639_105429942 | 235 |
| 338 | 3300026088 | Ga0207641_10184808 | Ga0207641_101848083 | 235 |
| 339 | 3300026116 | Ga0207674_10172923 | Ga0207674_101729232 | 235 |
| 340 | 3300026116 | Ga0207674_10242800 | Ga0207674_102428002 | 235 |
| 341 | 3300027682 | Ga0209971_1059943 | Ga0209971_10599431 | 235 |
| 342 | 3300028381 | Ga0268264_10024593 | Ga0268264_100245932 | 235 |
| 343 | 3300035692 | Ga0373935_0345984 | Ga0373935_0345984_282_992 | 235 |
| 344 | 3300035695 | Ga0373927_0063070 | Ga0373927_0063070_251_961 | 235 |
| 345 | 3300035725 | Ga0373947_0029736 | Ga0373947_0029736_28_738 | 235 |
| 346 | 3300046473 | Ga0495582_0172882 | Ga0495582_0172882_180_890 | 235 |
| 347 | 3300005330 | Ga0070690_100010236 | Ga0070690_1000102364 | 236 |
| 348 | 3300005335 | Ga0070666_10066869 | Ga0070666_100668693 | 236 |
| 349 | 3300005343 | Ga0070687_100039069 | Ga0070687_1000390692 | 236 |
| 350 | 3300005544 | Ga0070686_100002492 | Ga0070686_10000249210 | 236 |
| 351 | 3300005843 | Ga0068860_100155186 | Ga0068860_1001551863 | 236 |
| 352 | 3300009174 | Ga0105241_10198729 | Ga0105241_101987292 | 236 |
| 353 | 3300025903 | Ga0207680_10049915 | Ga0207680_100499153 | 236 |
| 354 | 3300025905 | Ga0207685_10003073 | Ga0207685_100030733 | 236 |
| 355 | 3300025911 | Ga0207654_10029791 | Ga0207654_100297913 | 236 |
| 356 | 3300025918 | Ga0207662_10037923 | Ga0207662_100379233 | 236 |
| 357 | 3300028381 | Ga0268264_10109607 | Ga0268264_101096072 | 236 |
| 358 | 3300048906 | Ga0496103_0154769 | Ga0496103_0154769_76_816 | 236 |
| 359 | 3300048910 | Ga0496107_0047373 | Ga0496107_0047373_2129_2869 | 236 |
| 360 | 3300049592 | Ga0501076_0478279 | Ga0501076_0478279_306_1016 | 236 |
| 361 | 3300050514 | nmdc:mga08x19_493616_c1 | nmdc:mga08x19_493616_c1_17_760 | 237 |
| 362 | 3300005458 | Ga0070681_10236600 | Ga0070681_102366002 | 238 |
| 363 | 3300005536 | Ga0070697_100051373 | Ga0070697_1000513735 | 238 |
| 364 | 3300028381 | Ga0268264_10452669 | Ga0268264_104526692 | 238 |
| 365 | 3300031731 | Ga0307405_10016482 | Ga0307405_100164824 | 238 |
| 366 | 3300031852 | Ga0307410_10001317 | Ga0307410_100013177 | 238 |
| 367 | 3300031903 | Ga0307407_10008613 | Ga0307407_100086134 | 238 |
| 368 | 3300031995 | Ga0307409_100033201 | Ga0307409_1000332014 | 238 |
| 369 | 3300032002 | Ga0307416_100001846 | Ga0307416_1000018464 | 238 |
| 370 | 3300032004 | Ga0307414_10235179 | Ga0307414_102351791 | 238 |
| 371 | 3300032005 | Ga0307411_10006888 | Ga0307411_100068885 | 238 |
| 372 | 3300042876 | Ga0451577_0039643 | Ga0451577_0039643_3328_4044 | 238 |
| 373 | 3300044712 | Ga0453684_0026885 | Ga0453684_0026885_4593_5309 | 238 |
| 374 | 3300048907 | Ga0496104_0645482 | Ga0496104_0645482_12_728 | 238 |
| 375 | 3300005336 | Ga0070680_100398658 | Ga0070680_1003986581 | 239 |
| 376 | 3300005353 | Ga0070669_100290856 | Ga0070669_1002908562 | 239 |
| 377 | 3300005434 | Ga0070709_10236003 | Ga0070709_102360031 | 239 |
| 378 | 3300005444 | Ga0070694_100129220 | Ga0070694_1001292202 | 239 |
| 379 | 3300005563 | Ga0068855_100268303 | Ga0068855_1002683032 | 239 |
| 380 | 3300005614 | Ga0068856_100040533 | Ga0068856_1000405335 | 239 |
| 381 | 3300006173 | Ga0070716_100053080 | Ga0070716_1000530803 | 239 |
| 382 | 3300006237 | Ga0097621_100143559 | Ga0097621_1001435592 | 239 |
| 383 | 3300007076 | Ga0075435_100053442 | Ga0075435_1000534423 | 239 |
| 384 | 3300009174 | Ga0105241_10041662 | Ga0105241_100416621 | 239 |
| 385 | 3300009174 | Ga0105241_10060366 | Ga0105241_100603662 | 239 |
| 386 | 3300009545 | Ga0105237_10082777 | Ga0105237_100827774 | 239 |
| 387 | 3300009551 | Ga0105238_10098453 | Ga0105238_100984532 | 239 |
| 388 | 3300009553 | Ga0105249_10009507 | Ga0105249_100095077 | 239 |
| 389 | 3300010375 | Ga0105239_10006983 | Ga0105239_100069831 | 239 |
| 390 | 3300013296 | Ga0157374_10016513 | Ga0157374_100165133 | 239 |
| 391 | 3300014968 | Ga0157379_10998805 | Ga0157379_109988051 | 239 |
| 392 | 3300025923 | Ga0207681_10096142 | Ga0207681_100961423 | 239 |
| 393 | 3300025949 | Ga0207667_10095391 | Ga0207667_100953912 | 239 |
| 394 | 3300026078 | Ga0207702_10053520 | Ga0207702_100535205 | 239 |
| 395 | 3300026116 | Ga0207674_10116743 | Ga0207674_101167431 | 239 |
| 396 | 3300031595 | Ga0265313_10102510 | Ga0265313_101025102 | 239 |
| 397 | 3300050512 | nmdc:mga0n895_304741_c1 | nmdc:mga0n895_304741_c1_573_1313 | 239 |
| 398 | 3300050513 | nmdc:mga0rr50_2985_c1 | nmdc:mga0rr50_2985_c1_2296_3036 | 239 |
| 399 | 3300053103 | Ga0500555_000947 | Ga0500555_000947_6597_7316 | 239 |
| 400 | 3300053153 | Ga0500616_0000358 | Ga0500616_0000358_9871_10590 | 239 |
| 401 | 3300053730 | Ga0500645_000794 | Ga0500645_000794_10030_10749 | 239 |
| 402 | 3300005329 | Ga0070683_100523154 | Ga0070683_1005231542 | 240 |
| 403 | 3300005331 | Ga0070670_100233573 | Ga0070670_1002335732 | 240 |
| 404 | 3300005334 | Ga0068869_100240986 | Ga0068869_1002409863 | 240 |
| 405 | 3300005335 | Ga0070666_10159772 | Ga0070666_101597723 | 240 |
| 406 | 3300005338 | Ga0068868_100035790 | Ga0068868_1000357904 | 240 |
| 407 | 3300005354 | Ga0070675_100198227 | Ga0070675_1001982273 | 240 |
| 408 | 3300005434 | Ga0070709_10555411 | Ga0070709_105554111 | 240 |
| 409 | 3300005459 | Ga0068867_100009941 | Ga0068867_1000099413 | 240 |
| 410 | 3300005544 | Ga0070686_100075171 | Ga0070686_1000751713 | 240 |
| 411 | 3300005548 | Ga0070665_100001511 | Ga0070665_1000015114 | 240 |
| 412 | 3300005564 | Ga0070664_100019041 | Ga0070664_1000190414 | 240 |
| 413 | 3300005564 | Ga0070664_100194501 | Ga0070664_1001945012 | 240 |
| 414 | 3300005578 | Ga0068854_100081015 | Ga0068854_1000810152 | 240 |
| 415 | 3300005616 | Ga0068852_100002065 | Ga0068852_10000206512 | 240 |
| 416 | 3300005841 | Ga0068863_100433795 | Ga0068863_1004337952 | 240 |
| 417 | 3300005843 | Ga0068860_100104511 | Ga0068860_1001045113 | 240 |
| 418 | 3300006881 | Ga0068865_100070463 | Ga0068865_1000704631 | 240 |
| 419 | 3300009098 | Ga0105245_10078619 | Ga0105245_100786193 | 240 |
| 420 | 3300009176 | Ga0105242_10100215 | Ga0105242_101002152 | 240 |
| 421 | 3300013306 | Ga0163162_10162856 | Ga0163162_101628563 | 240 |
| 422 | 3300013306 | Ga0163162_10517852 | Ga0163162_105178522 | 240 |
| 423 | 3300013308 | Ga0157375_10043801 | Ga0157375_100438012 | 240 |
| 424 | 3300014745 | Ga0157377_10339025 | Ga0157377_103390252 | 240 |
| 425 | 3300014968 | Ga0157379_10142200 | Ga0157379_101422001 | 240 |
| 426 | 3300025903 | Ga0207680_10070062 | Ga0207680_100700622 | 240 |
| 427 | 3300025927 | Ga0207687_10143765 | Ga0207687_101437652 | 240 |
| 428 | 3300025934 | Ga0207686_10032295 | Ga0207686_100322952 | 240 |
| 429 | 3300025938 | Ga0207704_10086725 | Ga0207704_100867253 | 240 |
| 430 | 3300025941 | Ga0207711_10157690 | Ga0207711_101576902 | 240 |
| 431 | 3300025945 | Ga0207679_10142336 | Ga0207679_101423362 | 240 |
| 432 | 3300025981 | Ga0207640_10125635 | Ga0207640_101256353 | 240 |
| 433 | 3300026023 | Ga0207677_10021944 | Ga0207677_100219445 | 240 |
| 434 | 3300026088 | Ga0207641_10391541 | Ga0207641_103915412 | 240 |
| 435 | 3300026121 | Ga0207683_10094302 | Ga0207683_100943022 | 240 |
| 436 | 3300028379 | Ga0268266_10019500 | Ga0268266_100195003 | 240 |
| 437 | 3300028381 | Ga0268264_10361791 | Ga0268264_103617912 | 240 |
| 438 | 3300044842 | Ga0466957_0279098 | Ga0466957_0279098_252_977 | 240 |
| 439 | 3300048910 | Ga0496107_0488291 | Ga0496107_0488291_119_898 | 240 |
| 440 | 3300048911 | Ga0496108_0374234 | Ga0496108_0374234_72_908 | 240 |
| 441 | 3300048917 | Ga0496114_0120928 | Ga0496114_0120928_907_1686 | 240 |
| 442 | 3300005293 | Ga0065715_10131453 | Ga0065715_101314532 | 241 |
| 443 | 3300005336 | Ga0070680_100027651 | Ga0070680_1000276515 | 241 |
| 444 | 3300005339 | Ga0070660_100001424 | Ga0070660_10000142415 | 241 |
| 445 | 3300005344 | Ga0070661_100014481 | Ga0070661_1000144814 | 241 |
| 446 | 3300005345 | Ga0070692_10078323 | Ga0070692_100783232 | 241 |
| 447 | 3300005354 | Ga0070675_100000024 | Ga0070675_10000002444 | 241 |
| 448 | 3300005355 | Ga0070671_100004012 | Ga0070671_1000040122 | 241 |
| 449 | 3300005364 | Ga0070673_100010272 | Ga0070673_1000102728 | 241 |
| 450 | 3300005366 | Ga0070659_100002336 | Ga0070659_1000023369 | 241 |
| 451 | 3300005441 | Ga0070700_100000002 | Ga0070700_100000002195 | 241 |
| 452 | 3300005457 | Ga0070662_100001043 | Ga0070662_10000104316 | 241 |
| 453 | 3300005466 | Ga0070685_10052729 | Ga0070685_100527292 | 241 |
| 454 | 3300005518 | Ga0070699_100420738 | Ga0070699_1004207382 | 241 |
| 455 | 3300005539 | Ga0068853_100004333 | Ga0068853_10000433311 | 241 |
| 456 | 3300005563 | Ga0068855_100002546 | Ga0068855_10000254613 | 241 |
| 457 | 3300005564 | Ga0070664_100001257 | Ga0070664_10000125711 | 241 |
| 458 | 3300005614 | Ga0068856_100001602 | Ga0068856_10000160215 | 241 |
| 459 | 3300005719 | Ga0068861_100062251 | Ga0068861_1000622512 | 241 |
| 460 | 3300005840 | Ga0068870_10211757 | Ga0068870_102117572 | 241 |
| 461 | 3300006358 | Ga0068871_100565834 | Ga0068871_1005658342 | 241 |
| 462 | 3300006844 | Ga0075428_100000766 | Ga0075428_10000076620 | 241 |
| 463 | 3300006844 | Ga0075428_100372954 | Ga0075428_1003729542 | 241 |
| 464 | 3300006852 | Ga0075433_10000591 | Ga0075433_1000059123 | 241 |
| 465 | 3300006871 | Ga0075434_100000646 | Ga0075434_10000064625 | 241 |
| 466 | 3300006871 | Ga0075434_100316128 | Ga0075434_1003161282 | 241 |
| 467 | 3300007076 | Ga0075435_100241052 | Ga0075435_1002410522 | 241 |
| 468 | 3300009094 | Ga0111539_10000006 | Ga0111539_10000006198 | 241 |
| 469 | 3300009147 | Ga0114129_10128654 | Ga0114129_101286542 | 241 |
| 470 | 3300009147 | Ga0114129_10204178 | Ga0114129_102041782 | 241 |
| 471 | 3300009147 | Ga0114129_10460278 | Ga0114129_104602782 | 241 |
| 472 | 3300009176 | Ga0105242_10058900 | Ga0105242_100589005 | 241 |
| 473 | 3300010375 | Ga0105239_10168258 | Ga0105239_101682582 | 241 |
| 474 | 3300013100 | Ga0157373_10000924 | Ga0157373_1000092413 | 241 |
| 475 | 3300013102 | Ga0157371_10000522 | Ga0157371_1000052230 | 241 |
| 476 | 3300013307 | Ga0157372_10000791 | Ga0157372_1000079117 | 241 |
| 477 | 3300014969 | Ga0157376_10176462 | Ga0157376_101764622 | 241 |
| 478 | 3300021358 | Ga0213873_10000004 | Ga0213873_1000000497 | 241 |
| 479 | 3300021384 | Ga0213876_10000007 | Ga0213876_1000000797 | 241 |
| 480 | 3300025728 | Ga0207655_1034605 | Ga0207655_10346052 | 241 |
| 481 | 3300025908 | Ga0207643_10268673 | Ga0207643_102686732 | 241 |
| 482 | 3300025918 | Ga0207662_10131893 | Ga0207662_101318932 | 241 |
| 483 | 3300025919 | Ga0207657_10000657 | Ga0207657_1000065720 | 241 |
| 484 | 3300025920 | Ga0207649_10036123 | Ga0207649_100361233 | 241 |
| 485 | 3300025925 | Ga0207650_10239313 | Ga0207650_102393131 | 241 |
| 486 | 3300025926 | Ga0207659_10000029 | Ga0207659_1000002954 | 241 |
| 487 | 3300025931 | Ga0207644_10010522 | Ga0207644_100105226 | 241 |
| 488 | 3300025932 | Ga0207690_10000412 | Ga0207690_1000041216 | 241 |
| 489 | 3300025933 | Ga0207706_10000164 | Ga0207706_1000016420 | 241 |
| 490 | 3300025945 | Ga0207679_10000601 | Ga0207679_100006018 | 241 |
| 491 | 3300025949 | Ga0207667_10006146 | Ga0207667_100061467 | 241 |
| 492 | 3300025960 | Ga0207651_10046652 | Ga0207651_100466522 | 241 |
| 493 | 3300026041 | Ga0207639_10004129 | Ga0207639_1000412910 | 241 |
| 494 | 3300026075 | Ga0207708_10000137 | Ga0207708_1000013735 | 241 |
| 495 | 3300026118 | Ga0207675_100042406 | Ga0207675_1000424062 | 241 |
| 496 | 3300026121 | Ga0207683_10148174 | Ga0207683_101481743 | 241 |
| 497 | 3300027614 | Ga0209970_1018522 | Ga0209970_10185222 | 241 |
| 498 | 3300027907 | Ga0207428_10000007 | Ga0207428_10000007197 | 241 |
| 499 | 3300039437 | Ga0436365_0073603 | Ga0436365_0073603_20119_20847 | 241 |
| 500 | 3300039453 | Ga0436362_0290430 | Ga0436362_0290430_661853_662581 | 241 |
| 501 | 3300046515 | Ga0495620_0001137 | Ga0495620_0001137_11301_12029 | 241 |
| 502 | 3300046525 | Ga0495663_0004342 | Ga0495663_0004342_3209_3940 | 241 |
| 503 | 3300048906 | Ga0496103_0085381 | Ga0496103_0085381_169_930 | 241 |
| 504 | 3300048909 | Ga0496106_0012297 | Ga0496106_0012297_307_1068 | 241 |
| 505 | 3300048910 | Ga0496107_0001319 | Ga0496107_0001319_11777_12538 | 241 |
| 506 | 3300050507 | nmdc:mga05p37_426951_c1 | nmdc:mga05p37_426951_c1_618_1397 | 241 |
| 507 | 3300050509 | nmdc:mga0qj67_28397_c1 | nmdc:mga0qj67_28397_c1_3415_4194 | 241 |
| 508 | 3300050510 | nmdc:mga06r32_293267_c1 | nmdc:mga06r32_293267_c1_671_1450 | 241 |
| 509 | 3300050511 | nmdc:mga08y16_11_c1 | nmdc:mga08y16_11_c1_210924_211652 | 241 |
| 510 | 3300050512 | nmdc:mga0n895_11721_c1 | nmdc:mga0n895_11721_c1_4007_4753 | 241 |
| 511 | 3300050515 | nmdc:mga0a205_135_c1 | nmdc:mga0a205_135_c1_9395_10141 | 241 |
| 512 | 3300054114 | Ga0501084_0064935 | Ga0501084_0064935_1635_2414 | 241 |
| 513 | iso_pu_bacteria | 2738541281 | 2738743534 | 241 |
| 514 | iso_pu_bacteria | 2738543032 | 2739352441 | 241 |
| 515 | iso_pu_bacteria | 2842698319 | 2842698399 | 241 |
| 516 | 3300005539 | Ga0068853_100007729 | Ga0068853_1000077299 | 242 |
| 517 | 3300009093 | Ga0105240_10011838 | Ga0105240_100118385 | 242 |
| 518 | 3300013104 | Ga0157370_10005379 | Ga0157370_100053793 | 242 |
| 519 | 3300025913 | Ga0207695_10028893 | Ga0207695_100288935 | 242 |
| 520 | 3300025923 | Ga0207681_10248008 | Ga0207681_102480082 | 242 |
| 521 | 3300026041 | Ga0207639_10000020 | Ga0207639_1000002024 | 242 |
| 522 | 3300005293 | Ga0065715_10313025 | Ga0065715_103130252 | 243 |
| 523 | 3300005543 | Ga0070672_100000697 | Ga0070672_10000069719 | 243 |
| 524 | 3300005618 | Ga0068864_100000008 | Ga0068864_100000008309 | 243 |
| 525 | 3300005840 | Ga0068870_10015161 | Ga0068870_100151613 | 243 |
| 526 | 3300013297 | Ga0157378_10004023 | Ga0157378_100040233 | 243 |
| 527 | 3300013297 | Ga0157378_10088588 | Ga0157378_100885882 | 243 |
| 528 | 3300013308 | Ga0157375_10000090 | Ga0157375_1000009046 | 243 |
| 529 | 3300014326 | Ga0157380_10001455 | Ga0157380_1000145511 | 243 |
| 530 | 3300014745 | Ga0157377_10071610 | Ga0157377_100716102 | 243 |
| 531 | 3300025908 | Ga0207643_10061984 | Ga0207643_100619842 | 243 |
| 532 | 3300025934 | Ga0207686_10438937 | Ga0207686_104389371 | 243 |
| 533 | 3300025940 | Ga0207691_10000507 | Ga0207691_1000050738 | 243 |
| 534 | 3300026035 | Ga0207703_10420203 | Ga0207703_104202032 | 243 |
| 535 | 3300026095 | Ga0207676_10000070 | Ga0207676_1000007014 | 243 |
| 536 | 3300035398 | Ga0316574_0087066 | Ga0316574_0087066_1149_1937 | 243 |
| 537 | 3300013105 | Ga0157369_10792833 | Ga0157369_107928331 | 244 |
| 538 | 3300025299 | Ga0209256_1001169 | Ga0209256_100116929 | 244 |
| 539 | 3300031665 | Ga0316575_10004145 | Ga0316575_100041454 | 244 |
| 540 | 3300031901 | Ga0307406_10131645 | Ga0307406_101316452 | 244 |
| 541 | 3300038726 | Ga0400490_21567 | Ga0400490_21567_116_856 | 244 |
| 542 | 3300039062 | Ga0400483_088593 | Ga0400483_088593_238_978 | 244 |
| 543 | 3300039062 | Ga0400483_220029 | Ga0400483_220029_200_940 | 244 |
| 544 | 3300039062 | Ga0400483_288640 | Ga0400483_288640_149_889 | 244 |
| 545 | 3300046683 | Ga0495658_0303323 | Ga0495658_0303323_65_802 | 244 |
| 546 | 3300005327 | Ga0070658_10036744 | Ga0070658_100367445 | 245 |
| 547 | 3300005328 | Ga0070676_10009423 | Ga0070676_100094231 | 245 |
| 548 | 3300005328 | Ga0070676_10061097 | Ga0070676_100610971 | 245 |
| 549 | 3300005329 | Ga0070683_100000103 | Ga0070683_10000010333 | 245 |
| 550 | 3300005331 | Ga0070670_100000067 | Ga0070670_10000006719 | 245 |
| 551 | 3300005331 | Ga0070670_100537385 | Ga0070670_1005373852 | 245 |
| 552 | 3300005335 | Ga0070666_10247604 | Ga0070666_102476041 | 245 |
| 553 | 3300005337 | Ga0070682_100115728 | Ga0070682_1001157282 | 245 |
| 554 | 3300005338 | Ga0068868_100000249 | Ga0068868_10000024921 | 245 |
| 555 | 3300005341 | Ga0070691_10016151 | Ga0070691_100161514 | 245 |
| 556 | 3300005347 | Ga0070668_100020426 | Ga0070668_1000204265 | 245 |
| 557 | 3300005347 | Ga0070668_100072726 | Ga0070668_1000727263 | 245 |
| 558 | 3300005353 | Ga0070669_100014658 | Ga0070669_1000146583 | 245 |
| 559 | 3300005353 | Ga0070669_100018415 | Ga0070669_1000184153 | 245 |
| 560 | 3300005353 | Ga0070669_100160261 | Ga0070669_1001602612 | 245 |
| 561 | 3300005354 | Ga0070675_100022458 | Ga0070675_1000224586 | 245 |
| 562 | 3300005356 | Ga0070674_100003652 | Ga0070674_1000036525 | 245 |
| 563 | 3300005364 | Ga0070673_100033153 | Ga0070673_1000331533 | 245 |
| 564 | 3300005364 | Ga0070673_100102714 | Ga0070673_1001027142 | 245 |
| 565 | 3300005365 | Ga0070688_100090761 | Ga0070688_1000907612 | 245 |
| 566 | 3300005367 | Ga0070667_100168212 | Ga0070667_1001682123 | 245 |
| 567 | 3300005436 | Ga0070713_100017090 | Ga0070713_1000170904 | 245 |
| 568 | 3300005438 | Ga0070701_10000046 | Ga0070701_100000466 | 245 |
| 569 | 3300005440 | Ga0070705_100070152 | Ga0070705_1000701522 | 245 |
| 570 | 3300005440 | Ga0070705_100288396 | Ga0070705_1002883962 | 245 |
| 571 | 3300005441 | Ga0070700_100140371 | Ga0070700_1001403712 | 245 |
| 572 | 3300005444 | Ga0070694_100088039 | Ga0070694_1000880392 | 245 |
| 573 | 3300005456 | Ga0070678_100029651 | Ga0070678_1000296513 | 245 |
| 574 | 3300005459 | Ga0068867_100065639 | Ga0068867_1000656392 | 245 |
| 575 | 3300005467 | Ga0070706_100008767 | Ga0070706_10000876711 | 245 |
| 576 | 3300005518 | Ga0070699_100029308 | Ga0070699_1000293082 | 245 |
| 577 | 3300005535 | Ga0070684_100000272 | Ga0070684_10000027216 | 245 |
| 578 | 3300005544 | Ga0070686_100139275 | Ga0070686_1001392752 | 245 |
| 579 | 3300005545 | Ga0070695_100012541 | Ga0070695_1000125414 | 245 |
| 580 | 3300005545 | Ga0070695_100063286 | Ga0070695_1000632863 | 245 |
| 581 | 3300005546 | Ga0070696_100035542 | Ga0070696_1000355423 | 245 |
| 582 | 3300005546 | Ga0070696_100151782 | Ga0070696_1001517822 | 245 |
| 583 | 3300005549 | Ga0070704_100024190 | Ga0070704_1000241903 | 245 |
| 584 | 3300005549 | Ga0070704_100143459 | Ga0070704_1001434591 | 245 |
| 585 | 3300005564 | Ga0070664_100237840 | Ga0070664_1002378402 | 245 |
| 586 | 3300005578 | Ga0068854_100012221 | Ga0068854_1000122212 | 245 |
| 587 | 3300005578 | Ga0068854_100097336 | Ga0068854_1000973362 | 245 |
| 588 | 3300005615 | Ga0070702_100003512 | Ga0070702_1000035126 | 245 |
| 589 | 3300005617 | Ga0068859_100191464 | Ga0068859_1001914643 | 245 |
| 590 | 3300005617 | Ga0068859_100760190 | Ga0068859_1007601902 | 245 |
| 591 | 3300005842 | Ga0068858_100378784 | Ga0068858_1003787841 | 245 |
| 592 | 3300005844 | Ga0068862_100130380 | Ga0068862_1001303802 | 245 |
| 593 | 3300005844 | Ga0068862_100147463 | Ga0068862_1001474633 | 245 |
| 594 | 3300006028 | Ga0070717_10000173 | Ga0070717_1000017346 | 245 |
| 595 | 3300006175 | Ga0070712_100082736 | Ga0070712_1000827363 | 245 |
| 596 | 3300006237 | Ga0097621_100383543 | Ga0097621_1003835433 | 245 |
| 597 | 3300006237 | Ga0097621_100584032 | Ga0097621_1005840322 | 245 |
| 598 | 3300006358 | Ga0068871_100460687 | Ga0068871_1004606872 | 245 |
| 599 | 3300006844 | Ga0075428_100032301 | Ga0075428_1000323018 | 245 |
| 600 | 3300006847 | Ga0075431_100071048 | Ga0075431_1000710481 | 245 |
| 601 | 3300006847 | Ga0075431_100458835 | Ga0075431_1004588352 | 245 |
| 602 | 3300006852 | Ga0075433_10026331 | Ga0075433_100263313 | 245 |
| 603 | 3300006852 | Ga0075433_10105430 | Ga0075433_101054303 | 245 |
| 604 | 3300006871 | Ga0075434_100107638 | Ga0075434_1001076383 | 245 |
| 605 | 3300006871 | Ga0075434_100360792 | Ga0075434_1003607922 | 245 |
| 606 | 3300006871 | Ga0075434_100390397 | Ga0075434_1003903973 | 245 |
| 607 | 3300006880 | Ga0075429_100026441 | Ga0075429_1000264415 | 245 |
| 608 | 3300006914 | Ga0075436_100004991 | Ga0075436_1000049917 | 245 |
| 609 | 3300006931 | Ga0097620_100191467 | Ga0097620_1001914672 | 245 |
| 610 | 3300006931 | Ga0097620_100760088 | Ga0097620_1007600882 | 245 |
| 611 | 3300007076 | Ga0075435_100000206 | Ga0075435_1000002064 | 245 |
| 612 | 3300007076 | Ga0075435_100000827 | Ga0075435_1000008279 | 245 |
| 613 | 3300009093 | Ga0105240_10307336 | Ga0105240_103073363 | 245 |
| 614 | 3300009094 | Ga0111539_10035710 | Ga0111539_100357104 | 245 |
| 615 | 3300009098 | Ga0105245_10000003 | Ga0105245_10000003212 | 245 |
| 616 | 3300009147 | Ga0114129_10011524 | Ga0114129_1001152415 | 245 |
| 617 | 3300009147 | Ga0114129_10022775 | Ga0114129_100227753 | 245 |
| 618 | 3300009147 | Ga0114129_10040772 | Ga0114129_100407728 | 245 |
| 619 | 3300009147 | Ga0114129_10071391 | Ga0114129_100713915 | 245 |
| 620 | 3300009147 | Ga0114129_10140398 | Ga0114129_101403983 | 245 |
| 621 | 3300009147 | Ga0114129_10734743 | Ga0114129_107347431 | 245 |
| 622 | 3300009148 | Ga0105243_10081994 | Ga0105243_100819942 | 245 |
| 623 | 3300009148 | Ga0105243_10121295 | Ga0105243_101212952 | 245 |
| 624 | 3300009148 | Ga0105243_10309941 | Ga0105243_103099412 | 245 |
| 625 | 3300009176 | Ga0105242_10047887 | Ga0105242_100478875 | 245 |
| 626 | 3300009176 | Ga0105242_10784137 | Ga0105242_107841372 | 245 |
| 627 | 3300009177 | Ga0105248_10178399 | Ga0105248_101783993 | 245 |
| 628 | 3300009177 | Ga0105248_10749364 | Ga0105248_107493642 | 245 |
| 629 | 3300009551 | Ga0105238_10000001 | Ga0105238_100000011746 | 245 |
| 630 | 3300013105 | Ga0157369_10000189 | Ga0157369_1000018963 | 245 |
| 631 | 3300013296 | Ga0157374_10000037 | Ga0157374_1000003746 | 245 |
| 632 | 3300013296 | Ga0157374_11182159 | Ga0157374_111821591 | 245 |
| 633 | 3300013297 | Ga0157378_10000335 | Ga0157378_1000033547 | 245 |
| 634 | 3300013297 | Ga0157378_10054920 | Ga0157378_100549202 | 245 |
| 635 | 3300013308 | Ga0157375_10000009 | Ga0157375_10000009208 | 245 |
| 636 | 3300013308 | Ga0157375_10002231 | Ga0157375_100022311 | 245 |
| 637 | 3300014326 | Ga0157380_10029606 | Ga0157380_100296066 | 245 |
| 638 | 3300014326 | Ga0157380_10418274 | Ga0157380_104182742 | 245 |
| 639 | 3300014326 | Ga0157380_10845906 | Ga0157380_108459061 | 245 |
| 640 | 3300014745 | Ga0157377_10000008 | Ga0157377_1000000845 | 245 |
| 641 | 3300014968 | Ga0157379_10026158 | Ga0157379_100261582 | 245 |
| 642 | 3300014969 | Ga0157376_10000006 | Ga0157376_10000006229 | 245 |
| 643 | 3300014969 | Ga0157376_10189913 | Ga0157376_101899132 | 245 |
| 644 | 3300014969 | Ga0157376_10442726 | Ga0157376_104427262 | 245 |
| 645 | 3300017792 | Ga0163161_10343154 | Ga0163161_103431541 | 245 |
| 646 | 3300021384 | Ga0213876_10000188 | Ga0213876_100001884 | 245 |
| 647 | 3300021384 | Ga0213876_10001441 | Ga0213876_1000144117 | 245 |
| 648 | 3300025315 | Ga0207697_10093776 | Ga0207697_100937762 | 245 |
| 649 | 3300025885 | Ga0207653_10022344 | Ga0207653_100223443 | 245 |
| 650 | 3300025893 | Ga0207682_10011341 | Ga0207682_100113413 | 245 |
| 651 | 3300025901 | Ga0207688_10252004 | Ga0207688_102520042 | 245 |
| 652 | 3300025905 | Ga0207685_10059931 | Ga0207685_100599311 | 245 |
| 653 | 3300025907 | Ga0207645_10048029 | Ga0207645_100480293 | 245 |
| 654 | 3300025909 | Ga0207705_10028399 | Ga0207705_100283995 | 245 |
| 655 | 3300025922 | Ga0207646_10014498 | Ga0207646_100144986 | 245 |
| 656 | 3300025922 | Ga0207646_10144424 | Ga0207646_101444243 | 245 |
| 657 | 3300025923 | Ga0207681_10007040 | Ga0207681_100070406 | 245 |
| 658 | 3300025924 | Ga0207694_10000001 | Ga0207694_100000012778 | 245 |
| 659 | 3300025925 | Ga0207650_10000067 | Ga0207650_1000006734 | 245 |
| 660 | 3300025925 | Ga0207650_10030839 | Ga0207650_100308393 | 245 |
| 661 | 3300025925 | Ga0207650_10094165 | Ga0207650_100941653 | 245 |
| 662 | 3300025925 | Ga0207650_10483916 | Ga0207650_104839162 | 245 |
| 663 | 3300025926 | Ga0207659_10062527 | Ga0207659_100625273 | 245 |
| 664 | 3300025927 | Ga0207687_10000002 | Ga0207687_10000002210 | 245 |
| 665 | 3300025928 | Ga0207700_10012662 | Ga0207700_100126625 | 245 |
| 666 | 3300025933 | Ga0207706_10069498 | Ga0207706_100694983 | 245 |
| 667 | 3300025934 | Ga0207686_10122173 | Ga0207686_101221732 | 245 |
| 668 | 3300025934 | Ga0207686_10149491 | Ga0207686_101494912 | 245 |
| 669 | 3300025935 | Ga0207709_10072229 | Ga0207709_100722291 | 245 |
| 670 | 3300025935 | Ga0207709_10380402 | Ga0207709_103804022 | 245 |
| 671 | 3300025937 | Ga0207669_10014593 | Ga0207669_100145933 | 245 |
| 672 | 3300025937 | Ga0207669_10077132 | Ga0207669_100771322 | 245 |
| 673 | 3300025938 | Ga0207704_10170536 | Ga0207704_101705362 | 245 |
| 674 | 3300025940 | Ga0207691_10069774 | Ga0207691_100697743 | 245 |
| 675 | 3300025942 | Ga0207689_10013673 | Ga0207689_100136736 | 245 |
| 676 | 3300025944 | Ga0207661_10000007 | Ga0207661_10000007104 | 245 |
| 677 | 3300025945 | Ga0207679_10337098 | Ga0207679_103370982 | 245 |
| 678 | 3300025961 | Ga0207712_10044024 | Ga0207712_100440243 | 245 |
| 679 | 3300025972 | Ga0207668_10080220 | Ga0207668_100802202 | 245 |
| 680 | 3300025981 | Ga0207640_10000706 | Ga0207640_1000070611 | 245 |
| 681 | 3300025981 | Ga0207640_10169104 | Ga0207640_101691042 | 245 |
| 682 | 3300026023 | Ga0207677_10000133 | Ga0207677_1000013336 | 245 |
| 683 | 3300026035 | Ga0207703_10319808 | Ga0207703_103198083 | 245 |
| 684 | 3300026035 | Ga0207703_10580803 | Ga0207703_105808032 | 245 |
| 685 | 3300026089 | Ga0207648_10021903 | Ga0207648_100219036 | 245 |
| 686 | 3300026089 | Ga0207648_10298493 | Ga0207648_102984932 | 245 |
| 687 | 3300026089 | Ga0207648_10758783 | Ga0207648_107587831 | 245 |
| 688 | 3300026118 | Ga0207675_100027931 | Ga0207675_1000279315 | 245 |
| 689 | 3300027907 | Ga0207428_10030188 | Ga0207428_100301883 | 245 |
| 690 | 3300028380 | Ga0268265_10849730 | Ga0268265_108497302 | 245 |
| 691 | 3300030521 | Ga0307511_10005518 | Ga0307511_100055183 | 245 |
| 692 | 3300035117 | Ga0373953_0099664 | Ga0373953_0099664_232_972 | 245 |
| 693 | 3300035119 | Ga0373956_0084689 | Ga0373956_0084689_633_1373 | 245 |
| 694 | 3300035172 | Ga0373955_0338157 | Ga0373955_0338157_42_782 | 245 |
| 695 | 3300035410 | Ga0373924_0029665 | Ga0373924_0029665_980_1720 | 245 |
| 696 | 3300036401 | Ga0373937_0343274 | Ga0373937_0343274_189_929 | 245 |
| 697 | 3300036401 | Ga0373937_0622026 | Ga0373937_0622026_22_762 | 245 |
| 698 | 3300037068 | Ga0373925_0199856 | Ga0373925_0199856_101_841 | 245 |
| 699 | 3300037853 | Ga0436364_1377383 | Ga0436364_1377383_853_1593 | 245 |
| 700 | 3300039437 | Ga0436365_0506999 | Ga0436365_0506999_11908_12648 | 245 |
| 701 | 3300039437 | Ga0436365_0637274 | Ga0436365_0637274_2711_3451 | 245 |
| 702 | 3300039453 | Ga0436362_1187303 | Ga0436362_1187303_8460_9200 | 245 |
| 703 | 3300042001 | Ga0439441_038281 | Ga0439441_038281_75_815 | 245 |
| 704 | 3300042436 | Ga0439435_0003908 | Ga0439435_0003908_24_764 | 245 |
| 705 | 3300042439 | Ga0439464_0043281 | Ga0439464_0043281_158_898 | 245 |
| 706 | 3300042876 | Ga0451577_0117602 | Ga0451577_0117602_1290_2030 | 245 |
| 707 | 3300045051 | Ga0451576_0000210 | Ga0451576_0000210_122773_123513 | 245 |
| 708 | 3300045051 | Ga0451576_0411870 | Ga0451576_0411870_154_894 | 245 |
| 709 | 3300046455 | Ga0495603_0098969 | Ga0495603_0098969_354_1094 | 245 |
| 710 | 3300046473 | Ga0495582_0030783 | Ga0495582_0030783_1825_2565 | 245 |
| 711 | 3300046533 | Ga0495640_0123983 | Ga0495640_0123983_129_869 | 245 |
| 712 | 3300046533 | Ga0495640_0411422 | Ga0495640_0411422_42_782 | 245 |
| 713 | 3300046642 | Ga0495634_0310140 | Ga0495634_0310140_15_755 | 245 |
| 714 | 3300046663 | Ga0495635_0461852 | Ga0495635_0461852_34_774 | 245 |
| 715 | 3300046681 | Ga0495647_0035101 | Ga0495647_0035101_85_825 | 245 |
| 716 | 3300046683 | Ga0495658_0028039 | Ga0495658_0028039_972_1712 | 245 |
| 717 | 3300046683 | Ga0495658_0107310 | Ga0495658_0107310_37_777 | 245 |
| 718 | 3300046689 | Ga0495613_0239505 | Ga0495613_0239505_368_1108 | 245 |
| 719 | 3300047319 | Ga0495674_0341041 | Ga0495674_0341041_106_846 | 245 |
| 720 | 3300047446 | Ga0495679_008002 | Ga0495679_008002_3204_3944 | 245 |
| 721 | 3300048903 | Ga0496100_0105940 | Ga0496100_0105940_14_754 | 245 |
| 722 | 3300048903 | Ga0496100_0196378 | Ga0496100_0196378_483_1223 | 245 |
| 723 | 3300048903 | Ga0496100_0458303 | Ga0496100_0458303_152_892 | 245 |
| 724 | 3300048904 | Ga0496101_0000804 | Ga0496101_0000804_16193_16933 | 245 |
| 725 | 3300048907 | Ga0496104_0174282 | Ga0496104_0174282_379_1119 | 245 |
| 726 | 3300048908 | Ga0496105_0016985 | Ga0496105_0016985_3308_4048 | 245 |
| 727 | 3300048909 | Ga0496106_0073654 | Ga0496106_0073654_577_1317 | 245 |
| 728 | 3300048910 | Ga0496107_0027201 | Ga0496107_0027201_735_1475 | 245 |
| 729 | 3300048916 | Ga0496113_0405722 | Ga0496113_0405722_216_956 | 245 |
| 730 | 3300048917 | Ga0496114_0001096 | Ga0496114_0001096_1932_2672 | 245 |
| 731 | 3300048918 | Ga0496115_0030979 | Ga0496115_0030979_3262_4002 | 245 |
| 732 | 3300049571 | Ga0501034_0050704 | Ga0501034_0050704_180_920 | 245 |
| 733 | 3300049591 | Ga0501075_0191716 | Ga0501075_0191716_499_1239 | 245 |
| 734 | 3300050507 | nmdc:mga05p37_2308_c1 | nmdc:mga05p37_2308_c1_6378_7118 | 245 |
| 735 | 3300050507 | nmdc:mga05p37_564957_c1 | nmdc:mga05p37_564957_c1_511_1251 | 245 |
| 736 | 3300050507 | nmdc:mga05p37_70113_c1 | nmdc:mga05p37_70113_c1_2232_2972 | 245 |
| 737 | 3300050507 | nmdc:mga05p37_76566_c2 | nmdc:mga05p37_76566_c2_1366_2106 | 245 |
| 738 | 3300050507 | nmdc:mga05p37_94815_c1 | nmdc:mga05p37_94815_c1_281_1021 | 245 |
| 739 | 3300050510 | nmdc:mga06r32_510229_c1 | nmdc:mga06r32_510229_c1_241_981 | 245 |
| 740 | 3300050510 | nmdc:mga06r32_58829_c1 | nmdc:mga06r32_58829_c1_174_914 | 245 |
| 741 | 3300050511 | nmdc:mga08y16_25248_c1 | nmdc:mga08y16_25248_c1_163_903 | 245 |
| 742 | 3300050511 | nmdc:mga08y16_627183_c1 | nmdc:mga08y16_627183_c1_276_1016 | 245 |
| 743 | 3300050512 | nmdc:mga0n895_11942_c1 | nmdc:mga0n895_11942_c1_4007_4747 | 245 |
| 744 | 3300050512 | nmdc:mga0n895_197254_c1 | nmdc:mga0n895_197254_c1_297_1037 | 245 |
| 745 | 3300050513 | nmdc:mga0rr50_1256_c1 | nmdc:mga0rr50_1256_c1_8332_9072 | 245 |
| 746 | 3300050513 | nmdc:mga0rr50_53607_c1 | nmdc:mga0rr50_53607_c1_1525_2265 | 245 |
| 747 | 3300050514 | nmdc:mga08x19_112678_c1 | nmdc:mga08x19_112678_c1_317_1057 | 245 |
| 748 | 3300050514 | nmdc:mga08x19_1832_c1 | nmdc:mga08x19_1832_c1_7070_7810 | 245 |
| 749 | 3300050515 | nmdc:mga0a205_120152_c1 | nmdc:mga0a205_120152_c1_1544_2284 | 245 |
| 750 | 3300050515 | nmdc:mga0a205_51011_c1 | nmdc:mga0a205_51011_c1_2262_3002 | 245 |
| 751 | 3300050515 | nmdc:mga0a205_6061_c2 | nmdc:mga0a205_6061_c2_1476_2216 | 245 |
| 752 | 3300053083 | Ga0495655_0000046 | Ga0495655_0000046_16817_17557 | 245 |
| 753 | 3300053085 | Ga0495619_0074996 | Ga0495619_0074996_1148_1888 | 245 |
| 754 | 3300053085 | Ga0495619_0207257 | Ga0495619_0207257_285_1025 | 245 |
| 755 | 3300005331 | Ga0070670_100466707 | Ga0070670_1004667071 | 246 |
| 756 | 3300005364 | Ga0070673_100166618 | Ga0070673_1001666182 | 246 |
| 757 | 3300005468 | Ga0070707_100673925 | Ga0070707_1006739251 | 246 |
| 758 | 3300021384 | Ga0213876_10012783 | Ga0213876_100127834 | 246 |
| 759 | 3300025981 | Ga0207640_10013301 | Ga0207640_100133016 | 246 |
| 760 | 3300034816 | Ga0373930_0002059 | Ga0373930_0002059_2120_2863 | 246 |
| 761 | 3300034817 | Ga0373948_0015607 | Ga0373948_0015607_456_1199 | 246 |
| 762 | 3300034818 | Ga0373950_0001150 | Ga0373950_0001150_2587_3330 | 246 |
| 763 | 3300034820 | Ga0373959_0003969 | Ga0373959_0003969_178_921 | 246 |
| 764 | 3300034957 | Ga0373938_0002076 | Ga0373938_0002076_201_944 | 246 |
| 765 | 3300035084 | Ga0373928_0003150 | Ga0373928_0003150_431_1174 | 246 |
| 766 | 3300035085 | Ga0373929_0001579 | Ga0373929_0001579_2718_3461 | 246 |
| 767 | 3300035088 | Ga0373940_0002324 | Ga0373940_0002324_2387_3130 | 246 |
| 768 | 3300035091 | Ga0373951_0000829 | Ga0373951_0000829_5584_6327 | 246 |
| 769 | 3300035092 | Ga0373952_0002814 | Ga0373952_0002814_212_955 | 246 |
| 770 | 3300035112 | Ga0373932_0001595 | Ga0373932_0001595_3284_4027 | 246 |
| 771 | 3300035114 | Ga0373939_0000651 | Ga0373939_0000651_5196_5939 | 246 |
| 772 | 3300035207 | Ga0373942_0000393 | Ga0373942_0000393_6404_7147 | 246 |
| 773 | 3300035241 | Ga0373961_0006271 | Ga0373961_0006271_608_1351 | 246 |
| 774 | 3300035242 | Ga0373962_0015994 | Ga0373962_0015994_518_1261 | 246 |
| 775 | 3300035691 | Ga0373931_0000361 | Ga0373931_0000361_15849_16592 | 246 |
| 776 | 3300039437 | Ga0436365_1929564 | Ga0436365_1929564_1762_2505 | 246 |
| 777 | 3300042876 | Ga0451577_0057152 | Ga0451577_0057152_167_910 | 246 |
| 778 | 3300044712 | Ga0453684_0012886 | Ga0453684_0012886_129_872 | 246 |
| 779 | 3300045051 | Ga0451576_0258421 | Ga0451576_0258421_146_889 | 246 |
| 780 | 3300049576 | Ga0501040_0394708 | Ga0501040_0394708_14_757 | 246 |
| 781 | 3300005331 | Ga0070670_100143517 | Ga0070670_1001435173 | 247 |
| 782 | 3300005340 | Ga0070689_100069597 | Ga0070689_1000695973 | 247 |
| 783 | 3300005353 | Ga0070669_100154226 | Ga0070669_1001542263 | 247 |
| 784 | 3300005365 | Ga0070688_100015314 | Ga0070688_1000153143 | 247 |
| 785 | 3300005466 | Ga0070685_10102132 | Ga0070685_101021323 | 247 |
| 786 | 3300005563 | Ga0068855_100349002 | Ga0068855_1003490022 | 247 |
| 787 | 3300005617 | Ga0068859_100112325 | Ga0068859_1001123251 | 247 |
| 788 | 3300005719 | Ga0068861_100409636 | Ga0068861_1004096362 | 247 |
| 789 | 3300005844 | Ga0068862_100035873 | Ga0068862_1000358734 | 247 |
| 790 | 3300006871 | Ga0075434_100387945 | Ga0075434_1003879451 | 247 |
| 791 | 3300006914 | Ga0075436_100175483 | Ga0075436_1001754831 | 247 |
| 792 | 3300006931 | Ga0097620_100050245 | Ga0097620_1000502454 | 247 |
| 793 | 3300006931 | Ga0097620_100112323 | Ga0097620_1001123231 | 247 |
| 794 | 3300025923 | Ga0207681_10046474 | Ga0207681_100464743 | 247 |
| 795 | 3300025924 | Ga0207694_10699319 | Ga0207694_106993191 | 247 |
| 796 | 3300025925 | Ga0207650_10126693 | Ga0207650_101266933 | 247 |
| 797 | 3300026035 | Ga0207703_10284565 | Ga0207703_102845652 | 247 |
| 798 | 3300026118 | Ga0207675_100280705 | Ga0207675_1002807052 | 247 |
| 799 | 3300028380 | Ga0268265_10049224 | Ga0268265_100492244 | 247 |
| 800 | 3300028653 | Ga0265323_10003583 | Ga0265323_100035835 | 247 |
| 801 | 3300035121 | Ga0373960_0069817 | Ga0373960_0069817_258_1004 | 247 |
| 802 | 3300035242 | Ga0373962_0018558 | Ga0373962_0018558_552_1307 | 247 |
| 803 | 3300035410 | Ga0373924_0008857 | Ga0373924_0008857_2626_3372 | 247 |
| 804 | 3300046454 | Ga0495592_0170897 | Ga0495592_0170897_85_831 | 247 |
| 805 | 3300050511 | nmdc:mga08y16_170629_c1 | nmdc:mga08y16_170629_c1_77_832 | 247 |
| 806 | 3300050512 | nmdc:mga0n895_118847_c1 | nmdc:mga0n895_118847_c1_1217_1963 | 247 |
| 807 | 3300050512 | nmdc:mga0n895_121367_c1 | nmdc:mga0n895_121367_c1_490_1236 | 247 |
| 808 | 3300050514 | nmdc:mga08x19_137947_c1 | nmdc:mga08x19_137947_c1_48_794 | 247 |
| 809 | 3300005331 | Ga0070670_100177231 | Ga0070670_1001772313 | 248 |
| 810 | 3300005340 | Ga0070689_100140224 | Ga0070689_1001402242 | 248 |
| 811 | 3300005353 | Ga0070669_100054955 | Ga0070669_1000549552 | 248 |
| 812 | 3300005354 | Ga0070675_100097323 | Ga0070675_1000973233 | 248 |
| 813 | 3300005365 | Ga0070688_100421906 | Ga0070688_1004219061 | 248 |
| 814 | 3300005843 | Ga0068860_100159852 | Ga0068860_1001598523 | 248 |
| 815 | 3300005844 | Ga0068862_100098405 | Ga0068862_1000984053 | 248 |
| 816 | 3300006038 | Ga0075365_10027146 | Ga0075365_100271462 | 248 |
| 817 | 3300006237 | Ga0097621_100690649 | Ga0097621_1006906491 | 248 |
| 818 | 3300014326 | Ga0157380_10018325 | Ga0157380_100183254 | 248 |
| 819 | 3300021384 | Ga0213876_10013225 | Ga0213876_100132255 | 248 |
| 820 | 3300025912 | Ga0207707_10292269 | Ga0207707_102922692 | 248 |
| 821 | 3300025925 | Ga0207650_10128475 | Ga0207650_101284752 | 248 |
| 822 | 3300025926 | Ga0207659_10007970 | Ga0207659_100079703 | 248 |
| 823 | 3300025936 | Ga0207670_10131433 | Ga0207670_101314333 | 248 |
| 824 | 3300025937 | Ga0207669_10484956 | Ga0207669_104849561 | 248 |
| 825 | 3300025986 | Ga0207658_10273361 | Ga0207658_102733612 | 248 |
| 826 | 3300026089 | Ga0207648_10410248 | Ga0207648_104102482 | 248 |
| 827 | 3300026095 | Ga0207676_10324824 | Ga0207676_103248242 | 248 |
| 828 | 3300039437 | Ga0436365_0857751 | Ga0436365_0857751_2352_3104 | 248 |
| 829 | 3300048911 | Ga0496108_0440771 | Ga0496108_0440771_254_1000 | 248 |
| 830 | 3300005327 | Ga0070658_10030721 | Ga0070658_100307215 | 249 |
| 831 | 3300005329 | Ga0070683_100007321 | Ga0070683_1000073218 | 249 |
| 832 | 3300005329 | Ga0070683_100090357 | Ga0070683_1000903572 | 249 |
| 833 | 3300005330 | Ga0070690_100051381 | Ga0070690_1000513812 | 249 |
| 834 | 3300005331 | Ga0070670_100185117 | Ga0070670_1001851171 | 249 |
| 835 | 3300005333 | Ga0070677_10139765 | Ga0070677_101397651 | 249 |
| 836 | 3300005334 | Ga0068869_100001503 | Ga0068869_10000150315 | 249 |
| 837 | 3300005334 | Ga0068869_100522555 | Ga0068869_1005225551 | 249 |
| 838 | 3300005335 | Ga0070666_10036930 | Ga0070666_100369304 | 249 |
| 839 | 3300005335 | Ga0070666_10074739 | Ga0070666_100747393 | 249 |
| 840 | 3300005335 | Ga0070666_10199825 | Ga0070666_101998252 | 249 |
| 841 | 3300005336 | Ga0070680_100010342 | Ga0070680_1000103422 | 249 |
| 842 | 3300005338 | Ga0068868_100378529 | Ga0068868_1003785291 | 249 |
| 843 | 3300005339 | Ga0070660_100061388 | Ga0070660_1000613881 | 249 |
| 844 | 3300005339 | Ga0070660_100066723 | Ga0070660_1000667232 | 249 |
| 845 | 3300005340 | Ga0070689_100040781 | Ga0070689_1000407811 | 249 |
| 846 | 3300005340 | Ga0070689_100131609 | Ga0070689_1001316093 | 249 |
| 847 | 3300005341 | Ga0070691_10260118 | Ga0070691_102601181 | 249 |
| 848 | 3300005347 | Ga0070668_100089160 | Ga0070668_1000891601 | 249 |
| 849 | 3300005347 | Ga0070668_100167689 | Ga0070668_1001676892 | 249 |
| 850 | 3300005353 | Ga0070669_100040387 | Ga0070669_1000403873 | 249 |
| 851 | 3300005354 | Ga0070675_100278424 | Ga0070675_1002784242 | 249 |
| 852 | 3300005355 | Ga0070671_100201322 | Ga0070671_1002013221 | 249 |
| 853 | 3300005356 | Ga0070674_100045494 | Ga0070674_1000454942 | 249 |
| 854 | 3300005356 | Ga0070674_100071548 | Ga0070674_1000715482 | 249 |
| 855 | 3300005364 | Ga0070673_100095905 | Ga0070673_1000959052 | 249 |
| 856 | 3300005364 | Ga0070673_100126635 | Ga0070673_1001266353 | 249 |
| 857 | 3300005365 | Ga0070688_100193180 | Ga0070688_1001931801 | 249 |
| 858 | 3300005366 | Ga0070659_100018516 | Ga0070659_1000185165 | 249 |
| 859 | 3300005366 | Ga0070659_100058644 | Ga0070659_1000586441 | 249 |
| 860 | 3300005367 | Ga0070667_100053230 | Ga0070667_1000532304 | 249 |
| 861 | 3300005367 | Ga0070667_100812854 | Ga0070667_1008128541 | 249 |
| 862 | 3300005435 | Ga0070714_100320031 | Ga0070714_1003200312 | 249 |
| 863 | 3300005445 | Ga0070708_100004030 | Ga0070708_1000040302 | 249 |
| 864 | 3300005456 | Ga0070678_100172994 | Ga0070678_1001729942 | 249 |
| 865 | 3300005456 | Ga0070678_100416255 | Ga0070678_1004162552 | 249 |
| 866 | 3300005471 | Ga0070698_100196617 | Ga0070698_1001966172 | 249 |
| 867 | 3300005518 | Ga0070699_100097321 | Ga0070699_1000973212 | 249 |
| 868 | 3300005535 | Ga0070684_100031500 | Ga0070684_1000315005 | 249 |
| 869 | 3300005539 | Ga0068853_100021278 | Ga0068853_1000212783 | 249 |
| 870 | 3300005543 | Ga0070672_100004237 | Ga0070672_1000042374 | 249 |
| 871 | 3300005543 | Ga0070672_100336758 | Ga0070672_1003367582 | 249 |
| 872 | 3300005547 | Ga0070693_100179540 | Ga0070693_1001795401 | 249 |
| 873 | 3300005548 | Ga0070665_100008939 | Ga0070665_1000089393 | 249 |
| 874 | 3300005548 | Ga0070665_100126978 | Ga0070665_1001269782 | 249 |
| 875 | 3300005563 | Ga0068855_100105409 | Ga0068855_1001054092 | 249 |
| 876 | 3300005564 | Ga0070664_100015808 | Ga0070664_1000158086 | 249 |
| 877 | 3300005564 | Ga0070664_100142498 | Ga0070664_1001424982 | 249 |
| 878 | 3300005564 | Ga0070664_100780665 | Ga0070664_1007806651 | 249 |
| 879 | 3300005577 | Ga0068857_100004656 | Ga0068857_10000465613 | 249 |
| 880 | 3300005578 | Ga0068854_100006351 | Ga0068854_1000063512 | 249 |
| 881 | 3300005614 | Ga0068856_100039285 | Ga0068856_1000392854 | 249 |
| 882 | 3300005615 | Ga0070702_100078567 | Ga0070702_1000785673 | 249 |
| 883 | 3300005615 | Ga0070702_100263541 | Ga0070702_1002635411 | 249 |
| 884 | 3300005617 | Ga0068859_100095758 | Ga0068859_1000957584 | 249 |
| 885 | 3300005618 | Ga0068864_100003435 | Ga0068864_10000343511 | 249 |
| 886 | 3300005718 | Ga0068866_10023053 | Ga0068866_100230533 | 249 |
| 887 | 3300005719 | Ga0068861_100540080 | Ga0068861_1005400801 | 249 |
| 888 | 3300005834 | Ga0068851_10003695 | Ga0068851_100036958 | 249 |
| 889 | 3300005834 | Ga0068851_10007447 | Ga0068851_100074473 | 249 |
| 890 | 3300005840 | Ga0068870_10006057 | Ga0068870_100060574 | 249 |
| 891 | 3300005840 | Ga0068870_10012623 | Ga0068870_100126233 | 249 |
| 892 | 3300005841 | Ga0068863_100078037 | Ga0068863_1000780373 | 249 |
| 893 | 3300005841 | Ga0068863_100528436 | Ga0068863_1005284362 | 249 |
| 894 | 3300005842 | Ga0068858_100035200 | Ga0068858_1000352006 | 249 |
| 895 | 3300005842 | Ga0068858_100060821 | Ga0068858_1000608214 | 249 |
| 896 | 3300005842 | Ga0068858_100532851 | Ga0068858_1005328512 | 249 |
| 897 | 3300005843 | Ga0068860_100072839 | Ga0068860_1000728394 | 249 |
| 898 | 3300005843 | Ga0068860_100109492 | Ga0068860_1001094922 | 249 |
| 899 | 3300005843 | Ga0068860_100216873 | Ga0068860_1002168733 | 249 |
| 900 | 3300005843 | Ga0068860_100620822 | Ga0068860_1006208222 | 249 |
| 901 | 3300005844 | Ga0068862_100100687 | Ga0068862_1001006873 | 249 |
| 902 | 3300006237 | Ga0097621_100394255 | Ga0097621_1003942552 | 249 |
| 903 | 3300006881 | Ga0068865_100038656 | Ga0068865_1000386564 | 249 |
| 904 | 3300006881 | Ga0068865_100417660 | Ga0068865_1004176602 | 249 |
| 905 | 3300006914 | Ga0075436_100023587 | Ga0075436_1000235875 | 249 |
| 906 | 3300006931 | Ga0097620_100095749 | Ga0097620_1000957494 | 249 |
| 907 | 3300009093 | Ga0105240_10016656 | Ga0105240_100166569 | 249 |
| 908 | 3300009094 | Ga0111539_10026736 | Ga0111539_100267364 | 249 |
| 909 | 3300009174 | Ga0105241_10014961 | Ga0105241_100149615 | 249 |
| 910 | 3300009176 | Ga0105242_10048474 | Ga0105242_100484742 | 249 |
| 911 | 3300009177 | Ga0105248_10024569 | Ga0105248_100245693 | 249 |
| 912 | 3300009177 | Ga0105248_10209183 | Ga0105248_102091833 | 249 |
| 913 | 3300009177 | Ga0105248_10430971 | Ga0105248_104309712 | 249 |
| 914 | 3300009545 | Ga0105237_10058764 | Ga0105237_100587643 | 249 |
| 915 | 3300009545 | Ga0105237_10170942 | Ga0105237_101709423 | 249 |
| 916 | 3300010375 | Ga0105239_10074856 | Ga0105239_100748564 | 249 |
| 917 | 3300010375 | Ga0105239_10638298 | Ga0105239_106382981 | 249 |
| 918 | 3300013100 | Ga0157373_10008811 | Ga0157373_100088116 | 249 |
| 919 | 3300013102 | Ga0157371_10190681 | Ga0157371_101906813 | 249 |
| 920 | 3300013105 | Ga0157369_10092042 | Ga0157369_100920423 | 249 |
| 921 | 3300013105 | Ga0157369_10189251 | Ga0157369_101892513 | 249 |
| 922 | 3300013296 | Ga0157374_10143435 | Ga0157374_101434353 | 249 |
| 923 | 3300013297 | Ga0157378_10114262 | Ga0157378_101142623 | 249 |
| 924 | 3300013297 | Ga0157378_10323692 | Ga0157378_103236922 | 249 |
| 925 | 3300013297 | Ga0157378_10461376 | Ga0157378_104613762 | 249 |
| 926 | 3300013306 | Ga0163162_10004418 | Ga0163162_1000441810 | 249 |
| 927 | 3300013306 | Ga0163162_10103173 | Ga0163162_101031732 | 249 |
| 928 | 3300013308 | Ga0157375_10050520 | Ga0157375_100505204 | 249 |
| 929 | 3300013308 | Ga0157375_10059025 | Ga0157375_100590254 | 249 |
| 930 | 3300014326 | Ga0157380_10018974 | Ga0157380_100189746 | 249 |
| 931 | 3300014326 | Ga0157380_10084164 | Ga0157380_100841643 | 249 |
| 932 | 3300014968 | Ga0157379_10204127 | Ga0157379_102041272 | 249 |
| 933 | 3300014969 | Ga0157376_10024704 | Ga0157376_100247043 | 249 |
| 934 | 3300014969 | Ga0157376_10054971 | Ga0157376_100549714 | 249 |
| 935 | 3300014969 | Ga0157376_10270027 | Ga0157376_102700272 | 249 |
| 936 | 3300025315 | Ga0207697_10000450 | Ga0207697_1000045024 | 249 |
| 937 | 3300025321 | Ga0207656_10002897 | Ga0207656_100028973 | 249 |
| 938 | 3300025893 | Ga0207682_10024253 | Ga0207682_100242532 | 249 |
| 939 | 3300025901 | Ga0207688_10010669 | Ga0207688_100106694 | 249 |
| 940 | 3300025903 | Ga0207680_10189782 | Ga0207680_101897822 | 249 |
| 941 | 3300025907 | Ga0207645_10088890 | Ga0207645_100888903 | 249 |
| 942 | 3300025908 | Ga0207643_10000429 | Ga0207643_1000042924 | 249 |
| 943 | 3300025908 | Ga0207643_10006465 | Ga0207643_100064655 | 249 |
| 944 | 3300025909 | Ga0207705_10014155 | Ga0207705_100141555 | 249 |
| 945 | 3300025912 | Ga0207707_10021196 | Ga0207707_100211966 | 249 |
| 946 | 3300025913 | Ga0207695_10015923 | Ga0207695_100159234 | 249 |
| 947 | 3300025918 | Ga0207662_10023329 | Ga0207662_100233292 | 249 |
| 948 | 3300025919 | Ga0207657_10000297 | Ga0207657_1000029711 | 249 |
| 949 | 3300025919 | Ga0207657_10032758 | Ga0207657_100327581 | 249 |
| 950 | 3300025920 | Ga0207649_10023356 | Ga0207649_100233563 | 249 |
| 951 | 3300025920 | Ga0207649_10325072 | Ga0207649_103250722 | 249 |
| 952 | 3300025921 | Ga0207652_10015488 | Ga0207652_100154886 | 249 |
| 953 | 3300025923 | Ga0207681_10157126 | Ga0207681_101571263 | 249 |
| 954 | 3300025924 | Ga0207694_10023028 | Ga0207694_100230282 | 249 |
| 955 | 3300025925 | Ga0207650_10000503 | Ga0207650_100005033 | 249 |
| 956 | 3300025926 | Ga0207659_10015450 | Ga0207659_100154506 | 249 |
| 957 | 3300025926 | Ga0207659_10297812 | Ga0207659_102978122 | 249 |
| 958 | 3300025931 | Ga0207644_10019227 | Ga0207644_100192274 | 249 |
| 959 | 3300025931 | Ga0207644_10285726 | Ga0207644_102857262 | 249 |
| 960 | 3300025931 | Ga0207644_10311228 | Ga0207644_103112282 | 249 |
| 961 | 3300025931 | Ga0207644_10542136 | Ga0207644_105421361 | 249 |
| 962 | 3300025932 | Ga0207690_10010823 | Ga0207690_100108233 | 249 |
| 963 | 3300025932 | Ga0207690_10046407 | Ga0207690_100464071 | 249 |
| 964 | 3300025933 | Ga0207706_10012798 | Ga0207706_1001279810 | 249 |
| 965 | 3300025933 | Ga0207706_10155069 | Ga0207706_101550692 | 249 |
| 966 | 3300025934 | Ga0207686_10037331 | Ga0207686_100373312 | 249 |
| 967 | 3300025935 | Ga0207709_10032976 | Ga0207709_100329764 | 249 |
| 968 | 3300025936 | Ga0207670_10022259 | Ga0207670_100222592 | 249 |
| 969 | 3300025936 | Ga0207670_10156452 | Ga0207670_101564521 | 249 |
| 970 | 3300025940 | Ga0207691_10007860 | Ga0207691_100078603 | 249 |
| 971 | 3300025940 | Ga0207691_10016301 | Ga0207691_100163018 | 249 |
| 972 | 3300025940 | Ga0207691_10340622 | Ga0207691_103406222 | 249 |
| 973 | 3300025941 | Ga0207711_10036106 | Ga0207711_100361063 | 249 |
| 974 | 3300025941 | Ga0207711_10392049 | Ga0207711_103920491 | 249 |
| 975 | 3300025942 | Ga0207689_10003889 | Ga0207689_1000388912 | 249 |
| 976 | 3300025942 | Ga0207689_10030304 | Ga0207689_100303046 | 249 |
| 977 | 3300025944 | Ga0207661_10031821 | Ga0207661_100318212 | 249 |
| 978 | 3300025944 | Ga0207661_10089770 | Ga0207661_100897702 | 249 |
| 979 | 3300025945 | Ga0207679_10031779 | Ga0207679_100317794 | 249 |
| 980 | 3300025945 | Ga0207679_10106553 | Ga0207679_101065532 | 249 |
| 981 | 3300025949 | Ga0207667_10000695 | Ga0207667_1000069521 | 249 |
| 982 | 3300025960 | Ga0207651_10126960 | Ga0207651_101269603 | 249 |
| 983 | 3300025960 | Ga0207651_10154501 | Ga0207651_101545012 | 249 |
| 984 | 3300025960 | Ga0207651_10292791 | Ga0207651_102927912 | 249 |
| 985 | 3300025961 | Ga0207712_10273813 | Ga0207712_102738131 | 249 |
| 986 | 3300025972 | Ga0207668_10036725 | Ga0207668_100367254 | 249 |
| 987 | 3300025972 | Ga0207668_10121593 | Ga0207668_101215933 | 249 |
| 988 | 3300025981 | Ga0207640_10140977 | Ga0207640_101409773 | 249 |
| 989 | 3300025986 | Ga0207658_10712156 | Ga0207658_107121561 | 249 |
| 990 | 3300026035 | Ga0207703_10101067 | Ga0207703_101010672 | 249 |
| 991 | 3300026035 | Ga0207703_10172194 | Ga0207703_101721942 | 249 |
| 992 | 3300026041 | Ga0207639_10030218 | Ga0207639_100302183 | 249 |
| 993 | 3300026067 | Ga0207678_10022800 | Ga0207678_100228005 | 249 |
| 994 | 3300026067 | Ga0207678_10046316 | Ga0207678_100463164 | 249 |
| 995 | 3300026075 | Ga0207708_10004851 | Ga0207708_1000485110 | 249 |
| 996 | 3300026088 | Ga0207641_10138084 | Ga0207641_101380843 | 249 |
| 997 | 3300026088 | Ga0207641_10199161 | Ga0207641_101991611 | 249 |
| 998 | 3300026089 | Ga0207648_10154746 | Ga0207648_101547462 | 249 |
| 999 | 3300026095 | Ga0207676_10060928 | Ga0207676_100609283 | 249 |
| 1000 | 3300026095 | Ga0207676_10092706 | Ga0207676_100927063 | 249 |
| 1001 | 3300026116 | Ga0207674_10000396 | Ga0207674_100003965 | 249 |
| 1002 | 3300026116 | Ga0207674_10007956 | Ga0207674_1000795611 | 249 |
| 1003 | 3300026118 | Ga0207675_100004233 | Ga0207675_1000042331 | 249 |
| 1004 | 3300026118 | Ga0207675_100067821 | Ga0207675_1000678212 | 249 |
| 1005 | 3300026118 | Ga0207675_100282800 | Ga0207675_1002828002 | 249 |
| 1006 | 3300026121 | Ga0207683_10007047 | Ga0207683_100070473 | 249 |
| 1007 | 3300026142 | Ga0207698_10017296 | Ga0207698_100172964 | 249 |
| 1008 | 3300026142 | Ga0207698_10257072 | Ga0207698_102570722 | 249 |
| 1009 | 3300028379 | Ga0268266_10044417 | Ga0268266_100444174 | 249 |
| 1010 | 3300028379 | Ga0268266_10115607 | Ga0268266_101156072 | 249 |
| 1011 | 3300028380 | Ga0268265_10027358 | Ga0268265_100273583 | 249 |
| 1012 | 3300028380 | Ga0268265_10318472 | Ga0268265_103184722 | 249 |
| 1013 | 3300028381 | Ga0268264_10411383 | Ga0268264_104113832 | 249 |
| 1014 | 3300031235 | Ga0265330_10009093 | Ga0265330_100090936 | 249 |
| 1015 | 3300031238 | Ga0265332_10000824 | Ga0265332_100008242 | 249 |
| 1016 | 3300031242 | Ga0265329_10004859 | Ga0265329_100048593 | 249 |
| 1017 | 3300031250 | Ga0265331_10000305 | Ga0265331_1000030548 | 249 |
| 1018 | 3300031251 | Ga0265327_10004446 | Ga0265327_100044464 | 249 |
| 1019 | 3300031344 | Ga0265316_10015795 | Ga0265316_100157953 | 249 |
| 1020 | 3300031712 | Ga0265342_10031924 | Ga0265342_100319241 | 249 |
| 1021 | 3300031852 | Ga0307410_10116672 | Ga0307410_101166722 | 249 |
| 1022 | 3300032005 | Ga0307411_10178481 | Ga0307411_101784812 | 249 |
| 1023 | 3300035118 | Ga0373954_0041506 | Ga0373954_0041506_840_1592 | 249 |
| 1024 | 3300035171 | Ga0373946_0016175 | Ga0373946_0016175_1377_2132 | 249 |
| 1025 | 3300035172 | Ga0373955_0095029 | Ga0373955_0095029_784_1536 | 249 |
| 1026 | 3300035695 | Ga0373927_0143215 | Ga0373927_0143215_326_1081 | 249 |
| 1027 | 3300035725 | Ga0373947_0232862 | Ga0373947_0232862_161_916 | 249 |
| 1028 | 3300037068 | Ga0373925_0184098 | Ga0373925_0184098_431_1186 | 249 |
| 1029 | 3300037068 | Ga0373925_0775464 | Ga0373925_0775464_17_772 | 249 |
| 1030 | 3300046683 | Ga0495658_0246942 | Ga0495658_0246942_105_857 | 249 |
| 1031 | 3300048903 | Ga0496100_0095621 | Ga0496100_0095621_639_1394 | 249 |
| 1032 | 3300048904 | Ga0496101_0068972 | Ga0496101_0068972_845_1600 | 249 |
| 1033 | 3300048905 | Ga0496102_0262055 | Ga0496102_0262055_15_782 | 249 |
| 1034 | 3300048909 | Ga0496106_0014789 | Ga0496106_0014789_3013_3768 | 249 |
| 1035 | 3300048909 | Ga0496106_0091645 | Ga0496106_0091645_1160_1927 | 249 |
| 1036 | 3300048910 | Ga0496107_0264037 | Ga0496107_0264037_377_1132 | 249 |
| 1037 | 3300048911 | Ga0496108_0010757 | Ga0496108_0010757_2349_3104 | 249 |
| 1038 | 3300048912 | Ga0496109_0503735 | Ga0496109_0503735_217_969 | 249 |
| 1039 | 3300048913 | Ga0496110_0004549 | Ga0496110_0004549_6759_7514 | 249 |
| 1040 | 3300048914 | Ga0496111_0031212 | Ga0496111_0031212_2618_3373 | 249 |
| 1041 | 3300048917 | Ga0496114_0036010 | Ga0496114_0036010_2349_3104 | 249 |
| 1042 | 3300048917 | Ga0496114_0524152 | Ga0496114_0524152_131_886 | 249 |
| 1043 | 3300050511 | nmdc:mga08y16_74414_c1 | nmdc:mga08y16_74414_c1_497_1252 | 249 |
| 1044 | 3300050514 | nmdc:mga08x19_146636_c1 | nmdc:mga08x19_146636_c1_137_889 | 249 |
| 1045 | 3300004799 | Ga0058863_11727546 | Ga0058863_117275461 | 252 |
| 1046 | 3300005458 | Ga0070681_10012786 | Ga0070681_100127866 | 252 |
| 1047 | 3300005530 | Ga0070679_100010882 | Ga0070679_1000108823 | 252 |
| 1048 | 3300022467 | Ga0224712_10007074 | Ga0224712_100070741 | 252 |
| 1049 | 3300025912 | Ga0207707_10002432 | Ga0207707_100024328 | 252 |
| 1050 | 3300025921 | Ga0207652_10018332 | Ga0207652_100183327 | 252 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3sj7-assembly1.cif.gz_B-2 | structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with nadph | 0.9911 | 7 | 248 |
| 3osu-assembly1.cif.gz_A | crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus | 0.9891 | 9 | 248 |
| 3sj7-assembly1.cif.gz_A-2 | structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with nadph | 0.9869 | 8 | 248 |
| 8jf9-assembly1.cif.gz_C | crystal structure of 3-oxoacyl-acp reductase fabg from helicobacter pylori | 0.9869 | 7 | 248 |
| 8jfa-assembly1.cif.gz_C | crystal structure of 3-oxoacyl-acp reductase fabg in complex with nadph from helicobacter pylori | 0.9869 | 7 | 248 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q0JDU3_1_168_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9867 | 85 | 248 | 3.40.50.720 |
| af_B7FAC8_69_312_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9859 | 9 | 248 | 3.40.50.720 |
| 4iinB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9836 | 7 | 248 | 3.40.50.720 |
| 4hsyA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9827 | 9 | 250 | 3.40.50.720 |
| af_A0A1D6J5I0_53_326_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.981 | 4 | 248 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S5MFR3-F1-model_v4 | Beta-ketoacyl-ACP reductase | 0.9962 | 88 | 248 |
GO:0016491
|
| AF-A0A850V1U6-F1-model_v4 | 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) | 0.9888 | 169 | 248 |
|
| AF-K1T1S4-F1-model_v4 | 3-oxoacyl-(Acyl-carrier-protein) reductase | 0.9878 | 99 | 248 |
GO:0006633
GO:0016616 GO:0048038 |
| AF-A0A4D9ALR0-F1-model_v4 | deleted | 0.987 | 6 | 248 |
|
| AF-X1DT56-F1-model_v4 | Uncharacterized protein | 0.9846 | 94 | 218 |
GO:0016491
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar