F489046

General Info

Members Datasets Scaffolds Average Seq Length
1050 382 2100 269

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100076242|Ga0070707_1000762421
Length 272
Sequence MIEKLQAHYGFTRMPFGRDLAPGMLHRHAAHNEACARITWCIAERAIGVITGEAGAGKTASVRTVLAGLDATRHTIIYLPNPMIGVRGLHEAIVTAFGQPPSQISSRLIAKASAALAAERDERGRTPVLVIDEAHLLRYEQLETIRMLTNNPTTMDADSPLACLLAGQPTLRRTMKLAVLAALEQRTALRYTMPPMTAAETTSYISHHIKLAGRSDTLFSDDAAALIHQTSRGYPRAVNNLAIQALVATYTGGKTIVDQAAARAAVTEITDD

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
105 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
166 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
167 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
168 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
169 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
170 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
173 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
174 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
175 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
179 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
182 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
186 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
187 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
188 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
189 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
190 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
191 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
192 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
193 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
194 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
195 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
197 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
199 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
200 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
201 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
202 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
203 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
204 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
205 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
206 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
207 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
208 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
209 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
213 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
214 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
215 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
216 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
217 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
219 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
220 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
221 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
222 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
225 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
226 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
227 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
228 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
229 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
230 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
231 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
232 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
233 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
234 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
235 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
236 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
237 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
238 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
239 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
240 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
241 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
242 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
243 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
244 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
245 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
246 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
247 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
248 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
249 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
250 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
251 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
252 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
253 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
254 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
255 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
256 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
257 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
258 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
259 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
260 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
261 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
262 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
263 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
264 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
265 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
266 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
267 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
268 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
269 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
270 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
271 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
272 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
273 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
274 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
275 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
276 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
277 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
278 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
279 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
280 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
281 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
282 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
283 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
284 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
285 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
286 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
287 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
288 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
289 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
290 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
291 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
292 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
293 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
294 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
295 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
296 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
297 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
298 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
299 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
300 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
301 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
302 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
303 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
304 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
305 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
306 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
307 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
308 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
309 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
310 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
311 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
312 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
313 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
314 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
315 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
316 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
317 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
318 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
319 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
320 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
321 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
322 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
323 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
324 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
325 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
326 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
327 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
328 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
329 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
330 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
331 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
332 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
348 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
349 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
350 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
351 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
352 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
353 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
354 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
355 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
356 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
357 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
358 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
359 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
362 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
363 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
364 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
365 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
366 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
367 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
368 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
369 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
370 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
371 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
372 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
373 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
374 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
375 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
376 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
377 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
378 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
379 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
380 2517572101 Frankia sp. DC12 Isolate Nodule
381 2687453737 Frankia sp. BMG5.36 Isolate Nodule
382 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 0.48
Isolates 0.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.57
Nodule 0.38
Rhizoplane 5.14
Rhizosphere 89.52
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100076242 3300005468 Bacteria 3234
2 JGI25406J46586_10014240 3300003203 Bacteria 3388
3 JGI25406J46586_10014431 3300003203 Bacteria 3359
4 JGI25406J46586_10030198 3300003203 Bacteria 2042
5 JGI25406J46586_10053968 3300003203 Bacteria 1332
6 rootL2_10004996 3300003322 Bacteria 4647
7 rootH1_10037886 3300003323 Bacteria 13878
8 JGI25404J52841_10004486 3300003659 Bacteria 2832
9 Ga0070658_10028001 3300005327 Bacteria 4523
10 Ga0070683_100431266 3300005329 Bacteria 1258
11 Ga0068869_100053899 3300005334 Bacteria 2926
12 Ga0070666_10188510 3300005335 Bacteria 1449
13 Ga0070666_10357437 3300005335 Bacteria 1046
14 Ga0070680_100011908 3300005336 Bacteria 6749
15 Ga0070680_100142243 3300005336 Bacteria 2012
16 Ga0070682_100007899 3300005337 Bacteria 5988
17 Ga0070682_100013960 3300005337 Bacteria 4634
18 Ga0070682_100018888 3300005337 Bacteria 4037
19 Ga0070682_100085006 3300005337 Bacteria 2057
20 Ga0070682_100293262 3300005337 Bacteria 1190
21 Ga0068868_100078378 3300005338 Bacteria 2645
22 Ga0068868_100100825 3300005338 Bacteria 2336
23 Ga0068868_100325359 3300005338 Bacteria 1311
24 Ga0070660_100031064 3300005339 Bacteria 4009
25 Ga0070660_100037982 3300005339 Bacteria 3653
26 Ga0070691_10148853 3300005341 Bacteria 1199
27 Ga0070687_100219443 3300005343 Bacteria 1163
28 Ga0070687_100220464 3300005343 Bacteria 1161
29 Ga0070661_100016582 3300005344 Bacteria 5211
30 Ga0070692_10008892 3300005345 Bacteria 4501
31 Ga0070692_10008907 3300005345 Bacteria 4498
32 Ga0070668_100048108 3300005347 Bacteria 3280
33 Ga0070668_100244301 3300005347 Bacteria 1488
34 Ga0070674_100029725 3300005356 Bacteria 3605
35 Ga0070674_100038007 3300005356 Bacteria 3241
36 Ga0070673_100237856 3300005364 Bacteria 1582
37 Ga0070659_100013364 3300005366 Bacteria 6108
38 Ga0070659_100156036 3300005366 Bacteria 1864
39 Ga0070703_10053897 3300005406 Bacteria 1295
40 Ga0070709_10018337 3300005434 Bacteria 4028
41 Ga0070709_10034296 3300005434 Bacteria 3076
42 Ga0070709_10156443 3300005434 Bacteria 1580
43 Ga0070714_100053004 3300005435 Bacteria 3461
44 Ga0070714_100082883 3300005435 Bacteria 2795
45 Ga0070714_100130421 3300005435 Bacteria 2246
46 Ga0070714_100433485 3300005435 Bacteria 1246
47 Ga0070714_100578204 3300005435 Bacteria 1077
48 Ga0070714_100594436 3300005435 Bacteria 1062
49 Ga0070713_100041851 3300005436 Bacteria 3735
50 Ga0070713_100459918 3300005436 Bacteria 1196
51 Ga0070710_10068331 3300005437 Bacteria 2041
52 Ga0070710_10222009 3300005437 Bacteria 1203
53 Ga0070710_10271732 3300005437 Bacteria 1097
54 Ga0070711_100023271 3300005439 Bacteria 4026
55 Ga0070711_100048497 3300005439 Bacteria 2905
56 Ga0070711_100181231 3300005439 Bacteria 1612
57 Ga0070711_100208345 3300005439 Bacteria 1512
58 Ga0070705_100012792 3300005440 Bacteria 4276
59 Ga0070705_100107418 3300005440 Bacteria 1776
60 Ga0070705_100431671 3300005440 Bacteria 984
61 Ga0070708_100049236 3300005445 Bacteria 3727
62 Ga0070708_100053855 3300005445 Bacteria 3572
63 Ga0070708_100059461 3300005445 Bacteria 3407
64 Ga0070708_100185112 3300005445 Bacteria 1947
65 Ga0070663_100113387 3300005455 Bacteria 2040
66 Ga0070663_100388747 3300005455 Bacteria 1138
67 Ga0070678_100038854 3300005456 Bacteria 3354
68 Ga0070662_100256431 3300005457 Bacteria 1408
69 Ga0070681_10013155 3300005458 Bacteria 8220
70 Ga0070681_10069832 3300005458 Bacteria 3479
71 Ga0070681_10202662 3300005458 Bacteria 1902
72 Ga0068867_100061539 3300005459 Bacteria 2787
73 Ga0070706_100036169 3300005467 Bacteria 4560
74 Ga0070706_100085822 3300005467 Bacteria 2917
75 Ga0070706_100337311 3300005467 Bacteria 1405
76 Ga0070707_100047658 3300005468 Bacteria 4102
77 Ga0070707_100068837 3300005468 Bacteria 3407
78 Ga0070698_100050947 3300005471 Bacteria 4218
79 Ga0070698_100054611 3300005471 Bacteria 4054
80 Ga0070698_100100102 3300005471 Bacteria 2871
81 Ga0070698_100277209 3300005471 Bacteria 1609
82 Ga0070698_100308773 3300005471 Bacteria 1512
83 Ga0070699_100044656 3300005518 Bacteria 3836
84 Ga0070699_100056215 3300005518 Bacteria 3407
85 Ga0070699_100392135 3300005518 Bacteria 1255
86 Ga0070679_100037365 3300005530 Bacteria 4823
87 Ga0070679_100080365 3300005530 Bacteria 3249
88 Ga0070684_100801516 3300005535 Bacteria 880
89 Ga0068853_100048337 3300005539 Bacteria 3654
90 Ga0068853_100453714 3300005539 Bacteria 1206
91 Ga0070686_100143482 3300005544 Bacteria 1665
92 Ga0070693_100021014 3300005547 Bacteria 3452
93 Ga0070693_100377839 3300005547 Bacteria 977
94 Ga0070665_100100923 3300005548 Bacteria 2890
95 Ga0070665_100413790 3300005548 Bacteria 1357
96 Ga0070704_100039062 3300005549 Bacteria 3256
97 Ga0070704_100110369 3300005549 Bacteria 2092
98 Ga0070704_100247997 3300005549 Bacteria 1461
99 Ga0070704_100340459 3300005549 Bacteria 1263
100 Ga0068855_100069582 3300005563 Bacteria 4095
101 Ga0070664_100046197 3300005564 Bacteria 3678
102 Ga0070664_100065924 3300005564 Bacteria 3091
103 Ga0068857_100096709 3300005577 Bacteria 2646
104 Ga0068857_100228136 3300005577 Bacteria 1703
105 Ga0068857_100657192 3300005577 Bacteria 994
106 Ga0068854_100315945 3300005578 Bacteria 1268
107 Ga0068856_100067507 3300005614 Bacteria 3534
108 Ga0068856_100073152 3300005614 Bacteria 3394
109 Ga0068856_100400290 3300005614 Bacteria 1393
110 Ga0070702_100010381 3300005615 Bacteria 4585
111 Ga0070702_100051411 3300005615 Bacteria 2359
112 Ga0070702_100331883 3300005615 Bacteria 1064
113 Ga0068852_100052086 3300005616 Bacteria 3517
114 Ga0068852_100184390 3300005616 Bacteria 1964
115 Ga0068859_100450296 3300005617 Bacteria 1383
116 Ga0068859_100652234 3300005617 Bacteria 1145
117 Ga0068864_100037091 3300005618 Bacteria 4158
118 Ga0068864_100448392 3300005618 Bacteria 1234
119 Ga0068866_10004480 3300005718 Bacteria 5730
120 Ga0068866_10016550 3300005718 Bacteria 3298
121 Ga0068866_10295188 3300005718 Bacteria 1010
122 Ga0068861_100031949 3300005719 Bacteria 3872
123 Ga0068870_10021346 3300005840 Bacteria 3166
124 Ga0068860_100053178 3300005843 Bacteria 3851
125 Ga0068860_100163892 3300005843 Bacteria 2145
126 Ga0081455_10046024 3300005937 Bacteria 3790
127 Ga0081455_10055028 3300005937 Bacteria 3387
128 Ga0081455_10133349 3300005937 Bacteria 1939
129 Ga0081540_1016232 3300005983 Bacteria 4672
130 Ga0081539_10027034 3300005985 Bacteria 3643
131 Ga0081539_10027050 3300005985 Bacteria 3641
132 Ga0081539_10027923 3300005985 Bacteria 3561
133 Ga0081539_10028627 3300005985 Bacteria 3499
134 Ga0081539_10028691 3300005985 Bacteria 3495
135 Ga0081539_10033901 3300005985 Bacteria 3099
136 Ga0081539_10037314 3300005985 Bacteria 2896
137 Ga0081539_10104474 3300005985 Bacteria 1437
138 Ga0081539_10138062 3300005985 Bacteria 1188
139 Ga0070717_10027374 3300006028 Bacteria 4556
140 Ga0070717_10105493 3300006028 Bacteria 2398
141 Ga0070717_10168116 3300006028 Bacteria 1906
142 Ga0070717_10358572 3300006028 Bacteria 1304
143 Ga0070717_10369213 3300006028 Bacteria 1285
144 Ga0070716_100347891 3300006173 Bacteria 1048
145 Ga0070712_100039606 3300006175 Bacteria 3226
146 Ga0070712_100048743 3300006175 Bacteria 2938
147 Ga0070712_100252262 3300006175 Bacteria 1410
148 Ga0070712_100511471 3300006175 Bacteria 1008
149 Ga0068871_100165677 3300006358 Bacteria 1892
150 Ga0068871_100197056 3300006358 Bacteria 1737
151 Ga0068871_100364193 3300006358 Bacteria 1281
152 Ga0075428_100007835 3300006844 Bacteria 11838
153 Ga0075428_100717465 3300006844 Bacteria 1065
154 Ga0075430_100005412 3300006846 Bacteria 10783
155 Ga0075430_100047964 3300006846 Bacteria 3606
156 Ga0075430_100049169 3300006846 Bacteria 3559
157 Ga0075431_100077047 3300006847 Bacteria 3441
158 Ga0075431_100078596 3300006847 Bacteria 3405
159 Ga0075431_100113627 3300006847 Bacteria 2795
160 Ga0075431_100630831 3300006847 Bacteria 1053
161 Ga0075434_100186487 3300006871 Bacteria 2095
162 Ga0075429_100001408 3300006880 Bacteria 19699
163 Ga0075429_100039518 3300006880 Bacteria 4106
164 Ga0075429_100048169 3300006880 Bacteria 3707
165 Ga0068865_100012409 3300006881 Bacteria 5361
166 Ga0068865_100244756 3300006881 Bacteria 1413
167 Ga0068865_100349070 3300006881 Bacteria 1198
168 Ga0097620_100450263 3300006931 Bacteria 1383
169 Ga0097620_100652244 3300006931 Bacteria 1145
170 Ga0075435_100114159 3300007076 Bacteria 2249
171 Ga0099794_10011259 3300007265 Bacteria 3824
172 Ga0099794_10128931 3300007265 Bacteria 1276
173 Ga0105244_10046359 3300009036 Bacteria 2233
174 Ga0105240_10156885 3300009093 Bacteria 2706
175 Ga0105245_10061183 3300009098 Bacteria 3393
176 Ga0105245_10156140 3300009098 Bacteria 2161
177 Ga0105245_10250315 3300009098 Bacteria 1721
178 Ga0105247_10023037 3300009101 Bacteria 3750
179 Ga0105247_10026549 3300009101 Bacteria 3498
180 Ga0114129_10036834 3300009147 Bacteria 6908
181 Ga0114129_10048530 3300009147 Bacteria 5965
182 Ga0114129_10121047 3300009147 Bacteria 3602
183 Ga0114129_10381182 3300009147 Bacteria 1862
184 Ga0114129_10442441 3300009147 Bacteria 1706
185 Ga0105243_10109285 3300009148 Bacteria 2310
186 Ga0105243_10138090 3300009148 Bacteria 2076
187 Ga0105243_10194859 3300009148 Bacteria 1773
188 Ga0105243_10203306 3300009148 Bacteria 1739
189 Ga0105243_10537983 3300009148 Bacteria 1114
190 Ga0105241_10280460 3300009174 Bacteria 1423
191 Ga0105241_10476137 3300009174 Bacteria 1109
192 Ga0105242_10445990 3300009176 Bacteria 1219
193 Ga0105242_10646833 3300009176 Bacteria 1028
194 Ga0105248_10082123 3300009177 Bacteria 3623
195 Ga0105237_10142930 3300009545 Bacteria 2387
196 Ga0105237_10242964 3300009545 Bacteria 1802
197 Ga0105237_10458711 3300009545 Bacteria 1280
198 Ga0105237_10481336 3300009545 Bacteria 1247
199 Ga0105238_10047852 3300009551 Bacteria 4310
200 Ga0105238_10065522 3300009551 Bacteria 3634
201 Ga0105238_10440816 3300009551 Bacteria 1299
202 Ga0105238_10542253 3300009551 Bacteria 1167
203 Ga0105249_10317858 3300009553 Bacteria 1567
204 Ga0105249_10333136 3300009553 Bacteria 1532
205 Ga0105249_10737029 3300009553 Bacteria 1047
206 Ga0099796_10027687 3300010159 Bacteria 1813
207 Ga0105239_10564865 3300010375 Bacteria 1296
208 Ga0105239_10572403 3300010375 Bacteria 1287
209 Ga0105246_10290642 3300011119 Bacteria 1315
210 Ga0157369_10083360 3300013105 Bacteria 3420
211 Ga0157369_10114812 3300013105 Bacteria 2859
212 Ga0157369_10844467 3300013105 Bacteria 940
213 Ga0157374_10435322 3300013296 Bacteria 1311
214 Ga0157378_10056522 3300013297 Bacteria 3497
215 Ga0157378_10244000 3300013297 Bacteria 1717
216 Ga0163162_10139462 3300013306 Bacteria 2537
217 Ga0157372_10067740 3300013307 Bacteria 4012
218 Ga0157372_10102892 3300013307 Bacteria 3263
219 Ga0157375_10560112 3300013308 Bacteria 1304
220 Ga0157380_10308200 3300014326 Bacteria 1462
221 Ga0157380_10483720 3300014326 Bacteria 1198
222 Ga0157380_10562671 3300014326 Bacteria 1121
223 Ga0182008_10019877 3300014497 Bacteria 3462
224 Ga0157379_10031533 3300014968 Bacteria 4722
225 Ga0157376_10047951 3300014969 Bacteria 3529
226 Ga0157376_10049063 3300014969 Bacteria 3496
227 Ga0157376_10150257 3300014969 Bacteria 2100
228 Ga0163161_10300191 3300017792 Bacteria 1265
229 Ga0206354_11267655 3300020081 Bacteria 3279
230 Ga0206354_11647855 3300020081 Bacteria 3109
231 Ga0206353_10402092 3300020082 Bacteria 3893
232 Ga0206353_10772945 3300020082 Bacteria 4257
233 Ga0206353_11026265 3300020082 Bacteria 1206
234 Ga0213873_10000235 3300021358 Bacteria 9759
235 Ga0213876_10023868 3300021384 Bacteria 3229
236 Ga0213876_10188496 3300021384 Bacteria 1097
237 Ga0213875_10003575 3300021388 Bacteria 8818
238 Ga0213875_10004856 3300021388 Bacteria 7300
239 Ga0213875_10198406 3300021388 Bacteria 944
240 Ga0213871_10066111 3300021441 Bacteria 1014
241 Ga0207656_10086684 3300025321 Bacteria 1415
242 Ga0207653_10093688 3300025885 Bacteria 1055
243 Ga0207692_10022999 3300025898 Bacteria 2877
244 Ga0207692_10111111 3300025898 Bacteria 1520
245 Ga0207692_10165905 3300025898 Bacteria 1276
246 Ga0207692_10318251 3300025898 Bacteria 951
247 Ga0207692_10350976 3300025898 Bacteria 909
248 Ga0207710_10013377 3300025900 Bacteria 3454
249 Ga0207688_10024196 3300025901 Bacteria 3329
250 Ga0207688_10096311 3300025901 Bacteria 1704
251 Ga0207680_10258385 3300025903 Bacteria 1205
252 Ga0207647_10120303 3300025904 Bacteria 1548
253 Ga0207647_10234138 3300025904 Bacteria 1056
254 Ga0207699_10024684 3300025906 Bacteria 3290
255 Ga0207699_10093258 3300025906 Bacteria 1895
256 Ga0207699_10252727 3300025906 Bacteria 1215
257 Ga0207643_10192186 3300025908 Bacteria 1239
258 Ga0207705_10010177 3300025909 Bacteria 6843
259 Ga0207705_10023492 3300025909 Bacteria 4398
260 Ga0207684_10043777 3300025910 Bacteria 3796
261 Ga0207684_10044680 3300025910 Bacteria 3757
262 Ga0207684_10213484 3300025910 Bacteria 1665
263 Ga0207684_10232445 3300025910 Bacteria 1591
264 Ga0207707_10026561 3300025912 Bacteria 5061
265 Ga0207707_10082845 3300025912 Bacteria 2801
266 Ga0207695_10119327 3300025913 Bacteria 2607
267 Ga0207671_10037508 3300025914 Bacteria 3594
268 Ga0207671_10192524 3300025914 Bacteria 1590
269 Ga0207671_10328721 3300025914 Bacteria 1210
270 Ga0207693_10031545 3300025915 Bacteria 4187
271 Ga0207693_10040116 3300025915 Bacteria 3687
272 Ga0207693_10040842 3300025915 Bacteria 3654
273 Ga0207693_10095242 3300025915 Bacteria 2334
274 Ga0207693_10342734 3300025915 Bacteria 1170
275 Ga0207693_10396909 3300025915 Bacteria 1078
276 Ga0207663_10016253 3300025916 Bacteria 4121
277 Ga0207663_10048792 3300025916 Bacteria 2622
278 Ga0207663_10202237 3300025916 Bacteria 1434
279 Ga0207663_10249811 3300025916 Bacteria 1305
280 Ga0207663_10271431 3300025916 Bacteria 1256
281 Ga0207660_10034720 3300025917 Bacteria 3496
282 Ga0207660_10120064 3300025917 Bacteria 1990
283 Ga0207662_10086825 3300025918 Bacteria 1918
284 Ga0207662_10274738 3300025918 Bacteria 1113
285 Ga0207657_10039762 3300025919 Bacteria 4175
286 Ga0207649_10028963 3300025920 Bacteria 3267
287 Ga0207652_10001454 3300025921 Bacteria 20971
288 Ga0207652_10006068 3300025921 Bacteria 9777
289 Ga0207652_10127750 3300025921 Bacteria 2265
290 Ga0207646_10027639 3300025922 Bacteria 5171
291 Ga0207646_10029503 3300025922 Bacteria 4983
292 Ga0207646_10048680 3300025922 Bacteria 3799
293 Ga0207646_10055390 3300025922 Bacteria 3545
294 Ga0207646_10060764 3300025922 Bacteria 3374
295 Ga0207646_10131536 3300025922 Bacteria 2252
296 Ga0207646_10352859 3300025922 Bacteria 1329
297 Ga0207694_10067935 3300025924 Bacteria 2783
298 Ga0207694_10431909 3300025924 Bacteria 1098
299 Ga0207687_10038200 3300025927 Bacteria 3280
300 Ga0207687_10108256 3300025927 Bacteria 2058
301 Ga0207687_10360260 3300025927 Bacteria 1187
302 Ga0207700_10053320 3300025928 Bacteria 3029
303 Ga0207664_10050606 3300025929 Bacteria 3277
304 Ga0207664_10077862 3300025929 Bacteria 2688
305 Ga0207644_10361995 3300025931 Bacteria 1180
306 Ga0207690_10019587 3300025932 Bacteria 4170
307 Ga0207690_10283360 3300025932 Bacteria 1291
308 Ga0207706_10132764 3300025933 Bacteria 2190
309 Ga0207686_10086607 3300025934 Bacteria 2058
310 Ga0207709_10031715 3300025935 Bacteria 3089
311 Ga0207709_10141572 3300025935 Bacteria 1654
312 Ga0207670_10071647 3300025936 Bacteria 2397
313 Ga0207669_10022132 3300025937 Bacteria 3370
314 Ga0207669_10110367 3300025937 Bacteria 1842
315 Ga0207669_10252292 3300025937 Bacteria 1314
316 Ga0207704_10187958 3300025938 Bacteria 1500
317 Ga0207665_10026734 3300025939 Bacteria 3811
318 Ga0207665_10143945 3300025939 Bacteria 1702
319 Ga0207691_10040802 3300025940 Bacteria 4288
320 Ga0207711_10057476 3300025941 Bacteria 3345
321 Ga0207711_10230056 3300025941 Unclassified 1698
322 Ga0207689_10052403 3300025942 Bacteria 3362
323 Ga0207689_10110788 3300025942 Bacteria 2256
324 Ga0207661_10000736 3300025944 Bacteria 21239
325 Ga0207661_10005583 3300025944 Bacteria 8870
326 Ga0207661_10346683 3300025944 Bacteria 1339
327 Ga0207679_10023434 3300025945 Bacteria 4222
328 Ga0207679_10697175 3300025945 Bacteria 921
329 Ga0207667_10068174 3300025949 Bacteria 3705
330 Ga0207667_10084188 3300025949 Bacteria 3292
331 Ga0207651_10313774 3300025960 Bacteria 1308
332 Ga0207712_10014393 3300025961 Bacteria 5089
333 Ga0207712_10446524 3300025961 Bacteria 1096
334 Ga0207668_10030048 3300025972 Bacteria 3568
335 Ga0207668_10039369 3300025972 Bacteria 3181
336 Ga0207677_10036002 3300026023 Bacteria 3221
337 Ga0207677_10136607 3300026023 Bacteria 1870
338 Ga0207677_10557772 3300026023 Bacteria 999
339 Ga0207639_10500304 3300026041 Bacteria 1110
340 Ga0207678_10054507 3300026067 Bacteria 3444
341 Ga0207678_10082852 3300026067 Bacteria 2744
342 Ga0207678_10129250 3300026067 Bacteria 2154
343 Ga0207678_10259046 3300026067 Bacteria 1491
344 Ga0207678_10264631 3300026067 Bacteria 1474
345 Ga0207708_10224253 3300026075 Bacteria 1507
346 Ga0207702_10046581 3300026078 Bacteria 3650
347 Ga0207702_10058070 3300026078 Bacteria 3292
348 Ga0207702_10113460 3300026078 Bacteria 2413
349 Ga0207702_10390651 3300026078 Bacteria 1340
350 Ga0207702_10474290 3300026078 Bacteria 1217
351 Ga0207641_10360332 3300026088 Bacteria 1388
352 Ga0207648_10056503 3300026089 Bacteria 3425
353 Ga0207648_10153793 3300026089 Bacteria 2030
354 Ga0207674_10055416 3300026116 Bacteria 4030
355 Ga0207674_10362289 3300026116 Bacteria 1401
356 Ga0207674_10488679 3300026116 Bacteria 1190
357 Ga0207674_10639867 3300026116 Bacteria 1027
358 Ga0207675_100053755 3300026118 Bacteria 3757
359 Ga0207675_100487760 3300026118 Bacteria 1225
360 Ga0207675_100766270 3300026118 Bacteria 977
361 Ga0207683_10007141 3300026121 Bacteria 9574
362 Ga0207683_10059664 3300026121 Bacteria 3351
363 Ga0207683_10226867 3300026121 Bacteria 1703
364 Ga0207683_10326575 3300026121 Bacteria 1406
365 Ga0207698_10046392 3300026142 Bacteria 3281
366 Ga0207698_10151828 3300026142 Bacteria 2012
367 Ga0207698_10276894 3300026142 Bacteria 1550
368 Ga0209588_1004920 3300027671 Bacteria 3798
369 Ga0268266_10055029 3300028379 Bacteria 3420
370 Ga0268266_10344571 3300028379 Bacteria 1399
371 Ga0268265_10053062 3300028380 Bacteria 3070
372 Ga0268265_10157768 3300028380 Bacteria 1923
373 Ga0268264_10049641 3300028381 Bacteria 3492
374 Ga0307515_10002209 3300028794 Bacteria 42732
375 Ga0307515_10090632 3300028794 Bacteria 3832
376 Ga0307515_10112242 3300028794 Bacteria 3172
377 Ga0307515_10114672 3300028794 Bacteria 3111
378 Ga0307515_10351118 3300028794 Bacteria 1121
379 Ga0307511_10002064 3300030521 Bacteria 21039
380 Ga0307511_10036041 3300030521 Bacteria 4304
381 Ga0307512_10053716 3300030522 Bacteria 3200
382 Ga0307512_10053898 3300030522 Bacteria 3191
383 Ga0265340_10009479 3300031247 Bacteria 5223
384 Ga0307513_10026939 3300031456 Bacteria 6612
385 Ga0307513_10190978 3300031456 Bacteria 1900
386 Ga0307509_10069301 3300031507 Bacteria 3687
387 Ga0307408_100117638 3300031548 Bacteria 2053
388 Ga0307408_100232297 3300031548 Bacteria 1511
389 Ga0307508_10006509 3300031616 Bacteria 10985
390 Ga0307508_10049014 3300031616 Bacteria 3762
391 Ga0307508_10053134 3300031616 Bacteria 3597
392 Ga0307508_10233287 3300031616 Bacteria 1438
393 Ga0307508_10276703 3300031616 Bacteria 1272
394 Ga0307514_10044795 3300031649 Bacteria 3464
395 Ga0316576_10039186 3300031727 Bacteria 3401
396 Ga0307516_10009926 3300031730 Bacteria 10546
397 Ga0307516_10064671 3300031730 Bacteria 3536
398 Ga0307405_10020624 3300031731 Bacteria 3686
399 Ga0307405_10026076 3300031731 Bacteria 3366
400 Ga0307405_10142462 3300031731 Bacteria 1674
401 Ga0307405_10366485 3300031731 Bacteria 1117
402 Ga0307413_10023417 3300031824 Bacteria 3346
403 Ga0307518_10037558 3300031838 Bacteria 3521
404 Ga0307410_10032038 3300031852 Bacteria 3378
405 Ga0307410_10146402 3300031852 Bacteria 1753
406 Ga0307410_10208165 3300031852 Bacteria 1497
407 Ga0307410_10287067 3300031852 Bacteria 1293
408 Ga0307410_10334157 3300031852 Bacteria 1206
409 Ga0307406_10019032 3300031901 Bacteria 4024
410 Ga0307406_10030380 3300031901 Bacteria 3280
411 Ga0307406_10133532 3300031901 Bacteria 1746
412 Ga0307406_10310405 3300031901 Bacteria 1216
413 Ga0307406_10468630 3300031901 Bacteria 1014
414 Ga0307407_10018141 3300031903 Bacteria 3551
415 Ga0307407_10056493 3300031903 Bacteria 2273
416 Ga0307407_10295515 3300031903 Bacteria 1127
417 Ga0307407_10384176 3300031903 Bacteria 1003
418 Ga0307412_10071190 3300031911 Bacteria 2373
419 Ga0307409_100032151 3300031995 Bacteria 3799
420 Ga0307409_100032652 3300031995 Bacteria 3777
421 Ga0307409_100039951 3300031995 Bacteria 3487
422 Ga0307409_100040065 3300031995 Bacteria 3483
423 Ga0307409_100244504 3300031995 Bacteria 1636
424 Ga0307409_100615192 3300031995 Bacteria 1075
425 Ga0307409_100739344 3300031995 Bacteria 987
426 Ga0307416_100040611 3300032002 Bacteria 3616
427 Ga0307416_100045313 3300032002 Bacteria 3462
428 Ga0307416_100123145 3300032002 Bacteria 2317
429 Ga0307416_100222627 3300032002 Bacteria 1811
430 Ga0307416_100922055 3300032002 Bacteria 974
431 Ga0307414_10045665 3300032004 Bacteria 3002
432 Ga0307414_10054669 3300032004 Bacteria 2791
433 Ga0307414_10071440 3300032004 Bacteria 2504
434 Ga0307414_10127246 3300032004 Bacteria 1971
435 Ga0307411_10021558 3300032005 Bacteria 3773
436 Ga0307411_10197168 3300032005 Bacteria 1543
437 Ga0307415_100030630 3300032126 Bacteria 3456
438 Ga0307415_100031865 3300032126 Bacteria 3402
439 Ga0307415_100149315 3300032126 Bacteria 1797
440 Ga0307415_100355340 3300032126 Bacteria 1235
441 Ga0307415_100489854 3300032126 Bacteria 1072
442 Ga0307415_100515422 3300032126 Bacteria 1048
443 Ga0316583_10067278 3300032133 Bacteria 1254
444 Ga0307507_10050067 3300033179 Bacteria 4037
445 Ga0307507_10064823 3300033179 Bacteria 3367
446 Ga0307507_10071496 3300033179 Bacteria 3136
447 Ga0307510_10168221 3300033180 Bacteria 1776
448 Ga0373926_0004115 3300035083 Bacteria 4752
449 Ga0373926_0039093 3300035083 Bacteria 1691
450 Ga0373928_0035474 3300035084 Bacteria 1124
451 Ga0373934_0004664 3300035086 Bacteria 5066
452 Ga0373934_0011016 3300035086 Bacteria 3401
453 Ga0373934_0073518 3300035086 Bacteria 1369
454 Ga0373944_0019136 3300035089 Bacteria 1962
455 Ga0373944_0057680 3300035089 Bacteria 1238
456 Ga0373944_0064781 3300035089 Bacteria 1179
457 Ga0373923_0000238 3300035111 Bacteria 11649
458 Ga0373923_0009354 3300035111 Bacteria 3534
459 Ga0373923_0189094 3300035111 Bacteria 948
460 Ga0373932_0068324 3300035112 Bacteria 1096
461 Ga0373936_0000987 3300035113 Bacteria 10138
462 Ga0373936_0006981 3300035113 Bacteria 4250
463 Ga0373936_0231747 3300035113 Bacteria 821
464 Ga0373939_0108731 3300035114 Bacteria 962
465 Ga0373945_0000634 3300035116 Bacteria 10116
466 Ga0373945_0108572 3300035116 Bacteria 1093
467 Ga0373945_0126090 3300035116 Bacteria 1022
468 Ga0373945_0151980 3300035116 Bacteria 939
469 Ga0373953_0004165 3300035117 Bacteria 4587
470 Ga0373953_0006292 3300035117 Bacteria 3903
471 Ga0373953_0007249 3300035117 Bacteria 3706
472 Ga0373953_0060333 3300035117 Bacteria 1550
473 Ga0373954_0002275 3300035118 Bacteria 7997
474 Ga0373954_0014690 3300035118 Bacteria 3493
475 Ga0373954_0028969 3300035118 Bacteria 2548
476 Ga0373954_0113900 3300035118 Bacteria 1309
477 Ga0373956_0004343 3300035119 Bacteria 5686
478 Ga0373956_0005108 3300035119 Bacteria 5251
479 Ga0373956_0011804 3300035119 Bacteria 3606
480 Ga0373956_0014118 3300035119 Bacteria 3331
481 Ga0373956_0085017 3300035119 Bacteria 1455
482 Ga0373956_0175973 3300035119 Bacteria 1011
483 Ga0373957_0005897 3300035120 Bacteria 3827
484 Ga0373957_0006343 3300035120 Bacteria 3719
485 Ga0373957_0008553 3300035120 Bacteria 3320
486 Ga0373957_0069730 3300035120 Bacteria 1373
487 Ga0373960_0049885 3300035121 Bacteria 1239
488 Ga0373960_0058197 3300035121 Bacteria 1165
489 Ga0373943_0004593 3300035170 Bacteria 6239
490 Ga0373943_0037559 3300035170 Bacteria 2325
491 Ga0373943_0144176 3300035170 Bacteria 1285
492 Ga0373943_0169212 3300035170 Bacteria 1195
493 Ga0373946_0001094 3300035171 Bacteria 9358
494 Ga0373946_0022069 3300035171 Bacteria 2475
495 Ga0373946_0028375 3300035171 Bacteria 2219
496 Ga0373946_0066453 3300035171 Bacteria 1546
497 Ga0373946_0134662 3300035171 Bacteria 1140
498 Ga0373955_0015994 3300035172 Bacteria 3684
499 Ga0373955_0049418 3300035172 Bacteria 2283
500 Ga0373955_0053159 3300035172 Bacteria 2210
501 Ga0373955_0187250 3300035172 Bacteria 1229
502 Ga0373955_0307854 3300035172 Bacteria 956
503 Ga0316574_0057625 3300035398 Bacteria 2433
504 Ga0373924_0002738 3300035410 Bacteria 5954
505 Ga0373924_0008098 3300035410 Bacteria 3807
506 Ga0373924_0009195 3300035410 Bacteria 3617
507 Ga0373924_0069586 3300035410 Bacteria 1483
508 Ga0373924_0091147 3300035410 Bacteria 1304
509 Ga0373924_0102108 3300035410 Bacteria 1234
510 Ga0373931_0192478 3300035691 Bacteria 1214
511 Ga0373935_0005788 3300035692 Bacteria 7312
512 Ga0373935_0013913 3300035692 Bacteria 4858
513 Ga0373935_0016469 3300035692 Bacteria 4472
514 Ga0373927_0002592 3300035695 Bacteria 13178
515 Ga0373927_0035790 3300035695 Bacteria 3229
516 Ga0373933_0006148 3300035724 Bacteria 6535
517 Ga0373933_0007518 3300035724 Bacteria 5951
518 Ga0373933_0021414 3300035724 Bacteria 3672
519 Ga0373933_0059833 3300035724 Bacteria 2295
520 Ga0373933_0092354 3300035724 Bacteria 1869
521 Ga0373947_0007335 3300035725 Bacteria 6383
522 Ga0373947_0028950 3300035725 Bacteria 3249
523 Ga0373947_0075951 3300035725 Bacteria 2070
524 Ga0373947_0119031 3300035725 Bacteria 1676
525 Ga0373947_0137869 3300035725 Bacteria 1562
526 Ga0373937_0023747 3300036401 Bacteria 5526
527 Ga0373937_0046519 3300036401 Bacteria 3968
528 Ga0373937_0064010 3300036401 Bacteria 3382
529 Ga0373937_0066270 3300036401 Bacteria 3325
530 Ga0373937_0066969 3300036401 Bacteria 3308
531 Ga0373937_0134224 3300036401 Bacteria 2314
532 Ga0373937_0144486 3300036401 Bacteria 2226
533 Ga0373937_0335025 3300036401 Bacteria 1432
534 Ga0316584_0046991 3300036712 Bacteria 3224
535 Ga0373925_0013705 3300037068 Bacteria 5869
536 Ga0373925_0014822 3300037068 Bacteria 5634
537 Ga0373925_0027143 3300037068 Bacteria 4193
538 Ga0373925_0029939 3300037068 Bacteria 3993
539 Ga0373925_0144892 3300037068 Bacteria 1862
540 Ga0373925_0238169 3300037068 Bacteria 1457
541 Ga0373925_0327546 3300037068 Bacteria 1240
542 Ga0373925_0525326 3300037068 Bacteria 972
543 Ga0373925_0559909 3300037068 Bacteria 940
544 Ga0373925_0701513 3300037068 Bacteria 834
545 Ga0395899_0212376 3300037312 Bacteria 1344
546 Ga0395900_0126398 3300037418 Bacteria 2622
547 Ga0395900_0294937 3300037418 Bacteria 1609
548 Ga0395900_0354824 3300037418 Bacteria 1439
549 Ga0395898_0059635 3300037466 Bacteria 3711
550 Ga0395898_0074781 3300037466 Bacteria 3272
551 Ga0395898_0168393 3300037466 Bacteria 2094
552 Ga0395898_0311647 3300037466 Bacteria 1501
553 Ga0395898_0359636 3300037466 Bacteria 1388
554 Ga0395905_0041107 3300037471 Bacteria 4338
555 Ga0395905_0194093 3300037471 Bacteria 1904
556 Ga0395905_0342426 3300037471 Bacteria 1386
557 Ga0436364_0026190 3300037853 Bacteria 6285
558 Ga0436364_0956857 3300037853 Bacteria 9084
559 Ga0395901_0064160 3300038443 Bacteria 3823
560 Ga0395901_0079582 3300038443 Bacteria 3422
561 Ga0395901_0162870 3300038443 Bacteria 2342
562 Ga0395901_0203195 3300038443 Bacteria 2076
563 Ga0395901_0601460 3300038443 Bacteria 1109
564 Ga0436365_0714895 3300039437 Bacteria 1316
565 Ga0436365_0785871 3300039437 Bacteria 2770
566 Ga0436365_1743964 3300039437 Bacteria 6186
567 Ga0436360_0354775 3300039438 Bacteria 1115
568 Ga0436361_0669121 3300039447 Bacteria 1596
569 Ga0436363_0425289 3300039450 Bacteria 27969
570 Ga0436363_0853423 3300039450 Bacteria 2407
571 Ga0436363_1642401 3300039450 Bacteria 968
572 Ga0436362_0122283 3300039453 Bacteria 14344
573 Ga0436362_0888059 3300039453 Bacteria 944
574 Ga0436362_1251845 3300039453 Bacteria 1278
575 Ga0439465_0062936 3300041413 Bacteria 1232
576 Ga0451797_1397672 3300041453 Bacteria 1209
577 Ga0451853_1827931 3300041512 Bacteria 1164
578 Ga0439437_005810 3300042000 Bacteria 1362
579 Ga0439448_0005138 3300042005 Bacteria 3725
580 Ga0439448_0006244 3300042005 Bacteria 3421
581 Ga0439450_039612 3300042008 Bacteria 1089
582 Ga0439451_011045 3300042009 Bacteria 1821
583 Ga0439455_0002108 3300042012 Bacteria 3547
584 Ga0439463_004248 3300042016 Bacteria 3595
585 Ga0439459_0001446 3300042438 Bacteria 3499
586 Ga0439464_0003585 3300042439 Bacteria 3931
587 Ga0439464_0081258 3300042439 Bacteria 968
588 Ga0439460_0004780 3300042461 Bacteria 3305
589 Ga0439440_0017136 3300042993 Bacteria 1593
590 Ga0466966_0029401 3300044684 Bacteria 3575
591 Ga0466966_0029477 3300044684 Bacteria 3570
592 Ga0466966_0077106 3300044684 Bacteria 2080
593 Ga0466966_0093794 3300044684 Bacteria 1861
594 Ga0466966_0108283 3300044684 Bacteria 1714
595 Ga0466968_0218774 3300044735 Bacteria 896
596 Ga0466970_0159449 3300044765 Bacteria 1247
597 Ga0466959_0353394 3300045049 Bacteria 1002
598 Ga0466959_0398249 3300045049 Bacteria 936
599 Ga0466958_0027951 3300045836 Bacteria 3341
600 Ga0466967_0026161 3300045976 Bacteria 4827
601 Ga0466967_0180574 3300045976 Bacteria 1990
602 Ga0466967_0774698 3300045976 Bacteria 952
603 Ga0495592_0001231 3300046454 Bacteria 17772
604 Ga0495592_0005292 3300046454 Bacteria 9510
605 Ga0495592_0008135 3300046454 Bacteria 7877
606 Ga0495592_0010917 3300046454 Bacteria 6852
607 Ga0495592_0035499 3300046454 Bacteria 3757
608 Ga0495592_0081280 3300046454 Bacteria 2343
609 Ga0495592_0157302 3300046454 Bacteria 1566
610 Ga0495592_0203484 3300046454 Bacteria 1334
611 Ga0495603_0006458 3300046455 Bacteria 7022
612 Ga0495603_0021597 3300046455 Bacteria 3898
613 Ga0495629_0029695 3300046459 Bacteria 3877
614 Ga0495629_0057988 3300046459 Bacteria 2707
615 Ga0495629_0093924 3300046459 Bacteria 2093
616 Ga0495629_0540787 3300046459 Bacteria 783
617 Ga0495641_0020884 3300046461 Bacteria 3307
618 Ga0495641_0023177 3300046461 Bacteria 3090
619 Ga0495641_0056412 3300046461 Bacteria 1780
620 Ga0495641_0060912 3300046461 Bacteria 1704
621 Ga0495651_0001745 3300046462 Bacteria 16765
622 Ga0495651_0008175 3300046462 Bacteria 8023
623 Ga0495651_0013296 3300046462 Bacteria 6366
624 Ga0495651_0025435 3300046462 Bacteria 4608
625 Ga0495651_0041549 3300046462 Bacteria 3571
626 Ga0495651_0044752 3300046462 Bacteria 3430
627 Ga0495651_0044972 3300046462 Bacteria 3421
628 Ga0495651_0197605 3300046462 Bacteria 1410
629 Ga0495653_0035705 3300046463 Bacteria 3920
630 Ga0495653_0038729 3300046463 Bacteria 3740
631 Ga0495653_0090093 3300046463 Bacteria 2245
632 Ga0495653_0090997 3300046463 Bacteria 2231
633 Ga0495653_0191595 3300046463 Bacteria 1394
634 Ga0495653_0243134 3300046463 Bacteria 1198
635 Ga0495580_0008696 3300046472 Bacteria 8050
636 Ga0495580_0020970 3300046472 Bacteria 4825
637 Ga0495580_0166034 3300046472 Bacteria 1527
638 Ga0495580_0256087 3300046472 Bacteria 1197
639 Ga0495582_0011785 3300046473 Bacteria 4816
640 Ga0495582_0023928 3300046473 Bacteria 3339
641 Ga0495605_0041420 3300046474 Bacteria 2294
642 Ga0495639_0014390 3300046475 Bacteria 3425
643 Ga0495639_0028724 3300046475 Bacteria 2464
644 Ga0495639_0048208 3300046475 Bacteria 1931
645 Ga0495662_0001191 3300046476 Bacteria 12834
646 Ga0495662_0008034 3300046476 Bacteria 5197
647 Ga0495662_0018846 3300046476 Bacteria 3339
648 Ga0495662_0071993 3300046476 Bacteria 1675
649 Ga0495662_0107421 3300046476 Bacteria 1367
650 Ga0495662_0121290 3300046476 Bacteria 1283
651 Ga0495664_0002422 3300046477 Bacteria 10028
652 Ga0495664_0005807 3300046477 Bacteria 6795
653 Ga0495664_0011959 3300046477 Bacteria 4903
654 Ga0495664_0019876 3300046477 Bacteria 3867
655 Ga0495664_0020456 3300046477 Bacteria 3817
656 Ga0495594_0010030 3300046499 Bacteria 4906
657 Ga0495594_0021133 3300046499 Bacteria 3472
658 Ga0495594_0064238 3300046499 Bacteria 2035
659 Ga0495596_0014232 3300046500 Bacteria 3354
660 Ga0495607_0008728 3300046501 Bacteria 6906
661 Ga0495608_0004778 3300046511 Bacteria 9688
662 Ga0495608_0022307 3300046511 Bacteria 4340
663 Ga0495608_0031542 3300046511 Bacteria 3583
664 Ga0495608_0140558 3300046511 Bacteria 1541
665 Ga0495608_0207517 3300046511 Bacteria 1233
666 Ga0495608_0371450 3300046511 Bacteria 878
667 Ga0495616_0028158 3300046513 Bacteria 2976
668 Ga0495618_0001441 3300046514 Bacteria 15955
669 Ga0495618_0019153 3300046514 Bacteria 4208
670 Ga0495618_0026478 3300046514 Bacteria 3606
671 Ga0495618_0027022 3300046514 Bacteria 3572
672 Ga0495618_0032106 3300046514 Bacteria 3289
673 Ga0495618_0075312 3300046514 Bacteria 2149
674 Ga0495628_0004659 3300046516 Bacteria 12101
675 Ga0495628_0021899 3300046516 Bacteria 5252
676 Ga0495628_0022533 3300046516 Bacteria 5174
677 Ga0495628_0034756 3300046516 Bacteria 4053
678 Ga0495628_0040076 3300046516 Bacteria 3744
679 Ga0495628_0301658 3300046516 Bacteria 1185
680 Ga0495628_0320156 3300046516 Bacteria 1144
681 Ga0495628_0515777 3300046516 Bacteria 862
682 Ga0495630_0001842 3300046517 Bacteria 14798
683 Ga0495630_0008304 3300046517 Bacteria 7454
684 Ga0495630_0010610 3300046517 Bacteria 6653
685 Ga0495630_0029784 3300046517 Bacteria 4058
686 Ga0495630_0033205 3300046517 Bacteria 3848
687 Ga0495630_0043238 3300046517 Bacteria 3364
688 Ga0495630_0049230 3300046517 Bacteria 3154
689 Ga0495630_0380247 3300046517 Bacteria 1082
690 Ga0495631_0013227 3300046518 Bacteria 4011
691 Ga0495631_0044303 3300046518 Bacteria 1961
692 Ga0495631_0049442 3300046518 Bacteria 1841
693 Ga0495631_0082084 3300046518 Bacteria 1390
694 Ga0495663_0042612 3300046525 Bacteria 1384
695 Ga0495666_0007807 3300046526 Bacteria 5357
696 Ga0495666_0019908 3300046526 Bacteria 3328
697 Ga0495666_0059533 3300046526 Bacteria 1826
698 Ga0495666_0103680 3300046526 Bacteria 1339
699 Ga0495652_0001251 3300046529 Bacteria 28407
700 Ga0495652_0015295 3300046529 Bacteria 6867
701 Ga0495652_0016983 3300046529 Bacteria 6502
702 Ga0495652_0039031 3300046529 Bacteria 4107
703 Ga0495652_0070003 3300046529 Bacteria 2935
704 Ga0495652_0121799 3300046529 Bacteria 2078
705 Ga0495652_0131330 3300046529 Bacteria 1982
706 Ga0495652_0282210 3300046529 Bacteria 1215
707 Ga0495665_0000445 3300046531 Bacteria 20843
708 Ga0495665_0043861 3300046531 Bacteria 2377
709 Ga0495665_0112845 3300046531 Bacteria 1425
710 Ga0495640_0023758 3300046533 Bacteria 4460
711 Ga0495640_0029488 3300046533 Bacteria 3940
712 Ga0495640_0050918 3300046533 Bacteria 2850
713 Ga0495640_0061433 3300046533 Bacteria 2552
714 Ga0495640_0075802 3300046533 Bacteria 2245
715 Ga0495640_0332265 3300046533 Bacteria 940
716 Ga0495586_0008692 3300046535 Bacteria 5407
717 Ga0495586_0032054 3300046535 Bacteria 2817
718 Ga0495586_0369721 3300046535 Bacteria 824
719 Ga0495587_0000412 3300046536 Bacteria 30257
720 Ga0495587_0000539 3300046536 Bacteria 26240
721 Ga0495587_0015132 3300046536 Bacteria 4821
722 Ga0495587_0080542 3300046536 Bacteria 1887
723 Ga0495587_0176368 3300046536 Bacteria 1213
724 Ga0495587_0212711 3300046536 Bacteria 1091
725 Ga0495587_0287804 3300046536 Bacteria 920
726 Ga0495598_0003384 3300046537 Bacteria 3385
727 Ga0495598_0096023 3300046537 Bacteria 974
728 Ga0495621_0011140 3300046539 Unclassified 2773
729 Ga0495597_0181419 3300046542 Bacteria 851
730 Ga0495645_0001433 3300046543 Bacteria 16073
731 Ga0495645_0001863 3300046543 Bacteria 14330
732 Ga0495645_0003140 3300046543 Bacteria 11199
733 Ga0495645_0032288 3300046543 Bacteria 3818
734 Ga0495645_0041308 3300046543 Bacteria 3363
735 Ga0495645_0141130 3300046543 Bacteria 1680
736 Ga0495622_0011214 3300046557 Bacteria 4138
737 Ga0495667_0001115 3300046559 Bacteria 17483
738 Ga0495667_0002439 3300046559 Bacteria 12414
739 Ga0495667_0012121 3300046559 Bacteria 5842
740 Ga0495667_0013378 3300046559 Bacteria 5554
741 Ga0495667_0023000 3300046559 Bacteria 4199
742 Ga0495667_0029679 3300046559 Bacteria 3680
743 Ga0495667_0077704 3300046559 Bacteria 2158
744 Ga0495667_0092965 3300046559 Bacteria 1953
745 Ga0495667_0159008 3300046559 Bacteria 1453
746 Ga0495656_0208210 3300046615 Bacteria 973
747 Ga0495668_0026217 3300046616 Bacteria 3308
748 Ga0495668_0212142 3300046616 Bacteria 1060
749 Ga0495634_0023608 3300046642 Bacteria 4320
750 Ga0495634_0023825 3300046642 Bacteria 4300
751 Ga0495634_0027779 3300046642 Bacteria 3934
752 Ga0495634_0037102 3300046642 Bacteria 3331
753 Ga0495634_0064968 3300046642 Bacteria 2419
754 Ga0495634_0085250 3300046642 Bacteria 2059
755 Ga0495634_0195841 3300046642 Bacteria 1257
756 Ga0495634_0239817 3300046642 Bacteria 1112
757 Ga0495635_0008637 3300046663 Bacteria 7112
758 Ga0495635_0024838 3300046663 Bacteria 4175
759 Ga0495635_0029679 3300046663 Bacteria 3803
760 Ga0495635_0032425 3300046663 Bacteria 3624
761 Ga0495635_0036669 3300046663 Bacteria 3397
762 Ga0495635_0053316 3300046663 Bacteria 2786
763 Ga0495635_0090437 3300046663 Bacteria 2093
764 Ga0495635_0100730 3300046663 Bacteria 1974
765 Ga0495588_0011852 3300046674 Bacteria 4103
766 Ga0495588_0045462 3300046674 Bacteria 2250
767 Ga0495588_0114713 3300046674 Bacteria 1420
768 Ga0495657_0006095 3300046675 Bacteria 9454
769 Ga0495657_0017298 3300046675 Bacteria 5236
770 Ga0495657_0031745 3300046675 Bacteria 3689
771 Ga0495657_0040649 3300046675 Bacteria 3188
772 Ga0495657_0086071 3300046675 Bacteria 2025
773 Ga0495599_0004111 3300046678 Bacteria 8587
774 Ga0495599_0012943 3300046678 Bacteria 5150
775 Ga0495599_0019198 3300046678 Bacteria 4262
776 Ga0495599_0021962 3300046678 Bacteria 3982
777 Ga0495599_0100637 3300046678 Bacteria 1801
778 Ga0495599_0136484 3300046678 Bacteria 1522
779 Ga0495599_0185631 3300046678 Bacteria 1280
780 Ga0495599_0261843 3300046678 Bacteria 1050
781 Ga0495599_0295107 3300046678 Bacteria 979
782 Ga0495623_0000446 3300046679 Bacteria 27167
783 Ga0495623_0003870 3300046679 Bacteria 9869
784 Ga0495623_0004008 3300046679 Bacteria 9692
785 Ga0495623_0024774 3300046679 Bacteria 3864
786 Ga0495623_0028584 3300046679 Bacteria 3587
787 Ga0495646_0000857 3300046680 Bacteria 17239
788 Ga0495646_0006001 3300046680 Bacteria 7698
789 Ga0495646_0028261 3300046680 Bacteria 3513
790 Ga0495646_0043110 3300046680 Bacteria 2765
791 Ga0495646_0047322 3300046680 Bacteria 2618
792 Ga0495646_0067494 3300046680 Bacteria 2113
793 Ga0495646_0114086 3300046680 Bacteria 1536
794 Ga0495646_0250652 3300046680 Bacteria 948
795 Ga0495647_0006828 3300046681 Bacteria 3801
796 Ga0495647_0073185 3300046681 Bacteria 1376
797 Ga0495647_0093071 3300046681 Bacteria 1238
798 Ga0495658_0006627 3300046683 Bacteria 5691
799 Ga0495658_0047804 3300046683 Bacteria 2410
800 Ga0495613_0010427 3300046689 Bacteria 6901
801 Ga0495613_0088997 3300046689 Bacteria 2236
802 Ga0495613_0155673 3300046689 Bacteria 1628
803 Ga0495624_0019793 3300046690 Bacteria 4485
804 Ga0495624_0029900 3300046690 Bacteria 3551
805 Ga0495624_0061984 3300046690 Bacteria 2341
806 Ga0495624_0349769 3300046690 Bacteria 889
807 Ga0495671_0029262 3300046692 Bacteria 2830
808 Ga0495671_0046106 3300046692 Bacteria 2180
809 Ga0495589_0141938 3300046794 Bacteria 1150
810 Ga0495600_0000409 3300046809 Bacteria 22189
811 Ga0495600_0000926 3300046809 Bacteria 15753
812 Ga0495600_0021620 3300046809 Bacteria 4123
813 Ga0495600_0022013 3300046809 Bacteria 4089
814 Ga0495600_0022699 3300046809 Bacteria 4032
815 Ga0495600_0214919 3300046809 Bacteria 1231
816 Ga0495660_0041710 3300046810 Bacteria 2539
817 Ga0495581_0005427 3300047315 Bacteria 7376
818 Ga0495581_0021470 3300047315 Bacteria 3743
819 Ga0495581_0024290 3300047315 Bacteria 3512
820 Ga0495581_0070672 3300047315 Bacteria 2019
821 Ga0495581_0105958 3300047315 Bacteria 1634
822 Ga0495581_0228222 3300047315 Bacteria 1089
823 Ga0495604_0000819 3300047317 Bacteria 26052
824 Ga0495604_0000876 3300047317 Bacteria 25072
825 Ga0495604_0001125 3300047317 Bacteria 22198
826 Ga0495604_0009984 3300047317 Bacteria 7513
827 Ga0495604_0012815 3300047317 Bacteria 6676
828 Ga0495604_0021731 3300047317 Bacteria 5123
829 Ga0495604_0149651 3300047317 Bacteria 1660
830 Ga0495604_0208856 3300047317 Bacteria 1350
831 Ga0495674_0010662 3300047319 Bacteria 8697
832 Ga0495674_0015023 3300047319 Bacteria 7245
833 Ga0495674_0030709 3300047319 Bacteria 4883
834 Ga0495674_0044565 3300047319 Bacteria 3943
835 Ga0495674_0051767 3300047319 Bacteria 3618
836 Ga0495674_0087407 3300047319 Bacteria 2667
837 Ga0495674_0089660 3300047319 Bacteria 2628
838 Ga0495674_0212074 3300047319 Bacteria 1604
839 Ga0495676_0033365 3300047321 Bacteria 4336
840 Ga0495676_0047872 3300047321 Bacteria 3452
841 Ga0495676_0078295 3300047321 Bacteria 2517
842 Ga0495676_0154404 3300047321 Bacteria 1630
843 Ga0495680_0003017 3300047322 Bacteria 16785
844 Ga0495680_0013606 3300047322 Bacteria 7089
845 Ga0495680_0043716 3300047322 Bacteria 3545
846 Ga0495680_0078213 3300047322 Bacteria 2503
847 Ga0495680_0082761 3300047322 Bacteria 2421
848 Ga0495680_0121106 3300047322 Bacteria 1931
849 Ga0495680_0331707 3300047322 Unclassified 1063
850 Ga0495675_0000446 3300047444 Bacteria 27418
851 Ga0495675_0004030 3300047444 Bacteria 8907
852 Ga0495675_0024763 3300047444 Bacteria 3828
853 Ga0495675_0025867 3300047444 Bacteria 3740
854 Ga0495677_0019996 3300047445 Bacteria 2427
855 Ga0495685_067021 3300047447 Bacteria 1205
856 Ga0495684_0001931 3300047471 Bacteria 16619
857 Ga0495684_0006538 3300047471 Bacteria 9044
858 Ga0495684_0010771 3300047471 Bacteria 7066
859 Ga0495684_0020791 3300047471 Bacteria 5057
860 Ga0495684_0138748 3300047471 Bacteria 1823
861 Ga0495593_0002270 3300047673 Bacteria 11525
862 Ga0495593_0022735 3300047673 Bacteria 3488
863 Ga0495593_0067614 3300047673 Bacteria 1860
864 Ga0495602_0004263 3300048088 Bacteria 14882
865 Ga0495602_0013534 3300048088 Bacteria 8335
866 Ga0495602_0021648 3300048088 Bacteria 6321
867 Ga0495602_0126727 3300048088 Bacteria 2044
868 Ga0495602_0253677 3300048088 Bacteria 1309
869 Ga0495602_0338788 3300048088 Bacteria 1088
870 Ga0495614_0006675 3300048089 Bacteria 5166
871 Ga0495614_0010643 3300048089 Bacteria 4053
872 Ga0495614_0131514 3300048089 Bacteria 1108
873 Ga0496100_0031621 3300048903 Bacteria 3292
874 Ga0496100_0108650 3300048903 Bacteria 1924
875 Ga0496101_0052186 3300048904 Bacteria 2948
876 Ga0496101_0130191 3300048904 Bacteria 1910
877 Ga0496101_0460700 3300048904 Bacteria 1003
878 Ga0496102_0027189 3300048905 Bacteria 5109
879 Ga0496102_0050319 3300048905 Bacteria 3793
880 Ga0496102_0066199 3300048905 Bacteria 3311
881 Ga0496102_0466827 3300048905 Bacteria 1183
882 Ga0496103_0020438 3300048906 Bacteria 3976
883 Ga0496103_0033231 3300048906 Bacteria 3151
884 Ga0496103_0232208 3300048906 Bacteria 1187
885 Ga0496104_0034424 3300048907 Bacteria 4724
886 Ga0496104_0064798 3300048907 Bacteria 3466
887 Ga0496104_0399504 3300048907 Bacteria 1287
888 Ga0496104_0433156 3300048907 Bacteria 1227
889 Ga0496105_0057680 3300048908 Bacteria 3205
890 Ga0496105_0192360 3300048908 Bacteria 1668
891 Ga0496105_0432745 3300048908 Bacteria 1040
892 Ga0496106_0039137 3300048909 Bacteria 3551
893 Ga0496106_0048839 3300048909 Bacteria 3187
894 Ga0496106_0472156 3300048909 Bacteria 1008
895 Ga0496107_0043357 3300048910 Bacteria 3232
896 Ga0496108_0038147 3300048911 Bacteria 4002
897 Ga0496108_0041954 3300048911 Bacteria 3819
898 Ga0496108_0048757 3300048911 Bacteria 3541
899 Ga0496108_0051532 3300048911 Bacteria 3448
900 Ga0496108_0258918 3300048911 Bacteria 1514
901 Ga0496109_0043284 3300048912 Bacteria 4081
902 Ga0496109_0045135 3300048912 Bacteria 3998
903 Ga0496109_0053510 3300048912 Bacteria 3681
904 Ga0496109_0063826 3300048912 Bacteria 3369
905 Ga0496109_0274065 3300048912 Bacteria 1590
906 Ga0496109_0873220 3300048912 Bacteria 837
907 Ga0496110_0043825 3300048913 Bacteria 3906
908 Ga0496110_0047930 3300048913 Bacteria 3743
909 Ga0496110_0056814 3300048913 Bacteria 3444
910 Ga0496110_0178257 3300048913 Bacteria 1929
911 Ga0496110_0322439 3300048913 Bacteria 1407
912 Ga0496111_0021795 3300048914 Bacteria 4476
913 Ga0496111_0035721 3300048914 Bacteria 3553
914 Ga0496111_0040446 3300048914 Bacteria 3344
915 Ga0496112_0064853 3300048915 Bacteria 3604
916 Ga0496112_0071366 3300048915 Bacteria 3432
917 Ga0496112_0075976 3300048915 Bacteria 3322
918 Ga0496112_0492319 3300048915 Bacteria 1162
919 Ga0496113_0039225 3300048916 Bacteria 3485
920 Ga0496113_0345983 3300048916 Bacteria 1192
921 Ga0496114_0015468 3300048917 Bacteria 6134
922 Ga0496114_0017612 3300048917 Bacteria 5769
923 Ga0496114_0420090 3300048917 Bacteria 1184
924 Ga0496114_0457293 3300048917 Bacteria 1130
925 Ga0496115_0043548 3300048918 Bacteria 3580
926 Ga0496116_0036541 3300048919 Bacteria 3434
927 Ga0496117_0012267 3300048920 Bacteria 7576
928 Ga0496118_0045320 3300048921 Bacteria 3434
929 Ga0496119_0029804 3300048922 Bacteria 3690
930 Ga0496120_0034757 3300048923 Bacteria 3016
931 Ga0501031_0061816 3300049568 Bacteria 2440
932 Ga0501031_0248045 3300049568 Bacteria 1157
933 Ga0501032_0179472 3300049569 Bacteria 1386
934 Ga0501033_0213512 3300049570 Bacteria 1375
935 Ga0501034_0698266 3300049571 Bacteria 913
936 Ga0501036_0008547 3300049572 Bacteria 8396
937 Ga0501036_0146093 3300049572 Bacteria 1995
938 Ga0501036_0338075 3300049572 Bacteria 1257
939 Ga0501037_0078990 3300049573 Bacteria 2388
940 Ga0501038_0019168 3300049574 Bacteria 6171
941 Ga0501038_0058384 3300049574 Bacteria 3308
942 Ga0501039_0048272 3300049575 Bacteria 3291
943 Ga0501039_0159359 3300049575 Bacteria 1773
944 Ga0501039_0357659 3300049575 Bacteria 1147
945 Ga0501040_0034221 3300049576 Bacteria 3443
946 Ga0501040_0052966 3300049576 Bacteria 2778
947 Ga0501040_0256191 3300049576 Bacteria 1248
948 Ga0501041_0002071 3300049577 Bacteria 11288
949 Ga0501041_0250475 3300049577 Bacteria 1113
950 Ga0501042_0040235 3300049578 Bacteria 3323
951 Ga0501042_0126767 3300049578 Bacteria 1838
952 Ga0501042_0411797 3300049578 Bacteria 979
953 Ga0501043_0043716 3300049579 Bacteria 3521
954 Ga0501043_0092820 3300049579 Bacteria 2373
955 Ga0501043_0327476 3300049579 Bacteria 1167
956 Ga0501046_0172361 3300049580 Bacteria 1623
957 Ga0501046_0314638 3300049580 Bacteria 1141
958 Ga0501047_0049780 3300049581 Bacteria 4045
959 Ga0501048_0021552 3300049582 Bacteria 4719
960 Ga0501048_0042636 3300049582 Bacteria 3248
961 Ga0501048_0150438 3300049582 Bacteria 1646
962 Ga0501048_0221423 3300049582 Bacteria 1342
963 Ga0501070_0435359 3300049586 Bacteria 1058
964 Ga0501071_0425873 3300049587 Bacteria 1014
965 Ga0501072_0217566 3300049588 Bacteria 1522
966 Ga0501072_0324942 3300049588 Bacteria 1222
967 Ga0501074_0017670 3300049590 Bacteria 5180
968 Ga0501074_0073969 3300049590 Bacteria 2447
969 Ga0501075_0038226 3300049591 Bacteria 3587
970 Ga0501075_0278246 3300049591 Bacteria 1275
971 Ga0501075_0356611 3300049591 Bacteria 1114
972 Ga0501076_0002605 3300049592 Bacteria 12412
973 Ga0501076_0190855 3300049592 Bacteria 1672
974 Ga0501076_0198382 3300049592 Bacteria 1638
975 Ga0501077_0138159 3300049593 Bacteria 1545
976 Ga0501079_0038092 3300049741 Bacteria 3708
977 Ga0501079_0038394 3300049741 Bacteria 3692
978 Ga0501079_0397216 3300049741 Bacteria 1081
979 Ga0501080_0569333 3300049742 Bacteria 1008
980 Ga0501081_0015277 3300049743 Bacteria 5064
981 Ga0501081_0034956 3300049743 Bacteria 3421
982 Ga0501081_0047658 3300049743 Bacteria 2948
983 Ga0501081_0241059 3300049743 Bacteria 1318
984 Ga0501083_0221553 3300049744 Bacteria 1232
985 Ga0501268_017421 3300049765 Bacteria 1199
986 Ga0501035_0062810 3300049822 Bacteria 3304
987 Ga0501035_0283826 3300049822 Bacteria 1399
988 Ga0501035_0415489 3300049822 Bacteria 1117
989 Ga0501044_0071214 3300049823 Bacteria 3535
990 Ga0501045_0004503 3300049824 Bacteria 9624
991 Ga0501045_0060279 3300049824 Bacteria 2781
992 Ga0501045_0075612 3300049824 Bacteria 2481
993 Ga0501045_0143084 3300049824 Bacteria 1778
994 nmdc:mga05p37_10885_c1 3300050507 Bacteria 10801
995 nmdc:mga05p37_17938_c2 3300050507 Bacteria 8209
996 nmdc:mga05p37_390747_c1 3300050507 Bacteria 1627
997 nmdc:mga05p37_53953_c1 3300050507 Bacteria 4945
998 nmdc:mga09592_18277_c1 3300050508 Bacteria 5748
999 nmdc:mga09592_26866_c1 3300050508 Bacteria 4772
1000 nmdc:mga09592_47527_c1 3300050508 Bacteria 3617
1001 nmdc:mga0qj67_10601_c1 3300050509 Bacteria 6886
1002 nmdc:mga0qj67_415_c1 3300050509 Bacteria 29140
1003 nmdc:mga0qj67_41855_c1 3300050509 Bacteria 3605
1004 nmdc:mga06r32_13500_c1 3300050510 Bacteria 7403
1005 nmdc:mga06r32_18555_c2 3300050510 Bacteria 5806
1006 nmdc:mga06r32_73270_c1 3300050510 Bacteria 3317
1007 nmdc:mga06r32_7479_c1 3300050510 Bacteria 9825
1008 nmdc:mga0rr50_181050_c1 3300050513 Bacteria 1723
1009 nmdc:mga0rr50_391843_c1 3300050513 Bacteria 1172
1010 nmdc:mga0rr50_605112_c1 3300050513 Bacteria 934
1011 nmdc:mga0a205_200466_c1 3300050515 Bacteria 1886
1012 Ga0495601_0012227 3300053077 Bacteria 5147
1013 Ga0495601_0013328 3300053077 Bacteria 4941
1014 Ga0495601_0044254 3300053077 Bacteria 2798
1015 Ga0495601_0260685 3300053077 Bacteria 1131
1016 Ga0495612_0003749 3300053078 Bacteria 6318
1017 Ga0495595_0006043 3300053084 Bacteria 4921
1018 Ga0495595_0014305 3300053084 Bacteria 3364
1019 Ga0495595_0051442 3300053084 Bacteria 1909
1020 Ga0495595_0086137 3300053084 Bacteria 1503
1021 Ga0495595_0138443 3300053084 Bacteria 1193
1022 Ga0495595_0256166 3300053084 Bacteria 877
1023 Ga0495619_0024726 3300053085 Bacteria 3853
1024 Ga0495619_0029196 3300053085 Bacteria 3562
1025 Ga0495619_0033968 3300053085 Bacteria 3314
1026 Ga0495619_0230984 3300053085 Bacteria 1282
1027 Ga0500646_0005538 3300053090 Bacteria 3193
1028 Ga0500660_040572 3300053100 Bacteria 2370
1029 Ga0500569_002159 3300053109 Bacteria 3831
1030 Ga0500588_0003099 3300053146 Bacteria 3469
1031 Ga0500600_0022641 3300053149 Bacteria 3760
1032 Ga0500600_0025625 3300053149 Bacteria 3505
1033 Ga0501084_0050826 3300054114 Bacteria 3468
1034 Ga0501084_0059069 3300054114 Bacteria 3209
1035 Ga0501084_0176138 3300054114 Bacteria 1805
1036 Ga0501082_0050322 3300060353 Bacteria 3593
1037 Ga0501082_0064550 3300060353 Bacteria 3153
1038 Ga0501082_0090565 3300060353 Bacteria 2641
1039 Ga0501082_0387874 3300060353 Bacteria 1219
1040 Ga0530510_0006051 3300061734 Bacteria 8400
1041 Ga0530510_0007140 3300061734 Bacteria 7774
1042 Ga0530510_0322946 3300061734 Bacteria 1157
1043 Ga0530510_0409829 3300061734 Bacteria 1022
1044 Ga0530510_0511870 3300061734 Bacteria 910
1045 2517759910 2517572101 Bacteria 6884336
1046 2517760979 2517572101 Bacteria 6884336
1047 2517761337 2517572101 Bacteria 6884336
1048 2689959666 2687453737 Bacteria 11203906
1049 2753266097 2751185782 Bacteria 11227053
1050 2753272878 2751185782 Bacteria 11227053
1051 Ga0070707_100076242
1052 JGI25406J46586_10014240
1053 JGI25406J46586_10014431
1054 JGI25406J46586_10030198
1055 JGI25406J46586_10053968
1056 rootL2_10004996
1057 rootH1_10037886
1058 JGI25404J52841_10004486
1059 Ga0070658_10028001
1060 Ga0070683_100431266
1061 Ga0068869_100053899
1062 Ga0070666_10188510
1063 Ga0070666_10357437
1064 Ga0070680_100011908
1065 Ga0070680_100142243
1066 Ga0070682_100007899
1067 Ga0070682_100013960
1068 Ga0070682_100018888
1069 Ga0070682_100085006
1070 Ga0070682_100293262
1071 Ga0068868_100078378
1072 Ga0068868_100100825
1073 Ga0068868_100325359
1074 Ga0070660_100031064
1075 Ga0070660_100037982
1076 Ga0070691_10148853
1077 Ga0070687_100219443
1078 Ga0070687_100220464
1079 Ga0070661_100016582
1080 Ga0070692_10008892
1081 Ga0070692_10008907
1082 Ga0070668_100048108
1083 Ga0070668_100244301
1084 Ga0070674_100029725
1085 Ga0070674_100038007
1086 Ga0070673_100237856
1087 Ga0070659_100013364
1088 Ga0070659_100156036
1089 Ga0070703_10053897
1090 Ga0070709_10018337
1091 Ga0070709_10034296
1092 Ga0070709_10156443
1093 Ga0070714_100053004
1094 Ga0070714_100082883
1095 Ga0070714_100130421
1096 Ga0070714_100433485
1097 Ga0070714_100578204
1098 Ga0070714_100594436
1099 Ga0070713_100041851
1100 Ga0070713_100459918
1101 Ga0070710_10068331
1102 Ga0070710_10222009
1103 Ga0070710_10271732
1104 Ga0070711_100023271
1105 Ga0070711_100048497
1106 Ga0070711_100181231
1107 Ga0070711_100208345
1108 Ga0070705_100012792
1109 Ga0070705_100107418
1110 Ga0070705_100431671
1111 Ga0070708_100049236
1112 Ga0070708_100053855
1113 Ga0070708_100059461
1114 Ga0070708_100185112
1115 Ga0070663_100113387
1116 Ga0070663_100388747
1117 Ga0070678_100038854
1118 Ga0070662_100256431
1119 Ga0070681_10013155
1120 Ga0070681_10069832
1121 Ga0070681_10202662
1122 Ga0068867_100061539
1123 Ga0070706_100036169
1124 Ga0070706_100085822
1125 Ga0070706_100337311
1126 Ga0070707_100047658
1127 Ga0070707_100068837
1128 Ga0070698_100050947
1129 Ga0070698_100054611
1130 Ga0070698_100100102
1131 Ga0070698_100277209
1132 Ga0070698_100308773
1133 Ga0070699_100044656
1134 Ga0070699_100056215
1135 Ga0070699_100392135
1136 Ga0070679_100037365
1137 Ga0070679_100080365
1138 Ga0070684_100801516
1139 Ga0068853_100048337
1140 Ga0068853_100453714
1141 Ga0070686_100143482
1142 Ga0070693_100021014
1143 Ga0070693_100377839
1144 Ga0070665_100100923
1145 Ga0070665_100413790
1146 Ga0070704_100039062
1147 Ga0070704_100110369
1148 Ga0070704_100247997
1149 Ga0070704_100340459
1150 Ga0068855_100069582
1151 Ga0070664_100046197
1152 Ga0070664_100065924
1153 Ga0068857_100096709
1154 Ga0068857_100228136
1155 Ga0068857_100657192
1156 Ga0068854_100315945
1157 Ga0068856_100067507
1158 Ga0068856_100073152
1159 Ga0068856_100400290
1160 Ga0070702_100010381
1161 Ga0070702_100051411
1162 Ga0070702_100331883
1163 Ga0068852_100052086
1164 Ga0068852_100184390
1165 Ga0068859_100450296
1166 Ga0068859_100652234
1167 Ga0068864_100037091
1168 Ga0068864_100448392
1169 Ga0068866_10004480
1170 Ga0068866_10016550
1171 Ga0068866_10295188
1172 Ga0068861_100031949
1173 Ga0068870_10021346
1174 Ga0068860_100053178
1175 Ga0068860_100163892
1176 Ga0081455_10046024
1177 Ga0081455_10055028
1178 Ga0081455_10133349
1179 Ga0081540_1016232
1180 Ga0081539_10027034
1181 Ga0081539_10027050
1182 Ga0081539_10027923
1183 Ga0081539_10028627
1184 Ga0081539_10028691
1185 Ga0081539_10033901
1186 Ga0081539_10037314
1187 Ga0081539_10104474
1188 Ga0081539_10138062
1189 Ga0070717_10027374
1190 Ga0070717_10105493
1191 Ga0070717_10168116
1192 Ga0070717_10358572
1193 Ga0070717_10369213
1194 Ga0070716_100347891
1195 Ga0070712_100039606
1196 Ga0070712_100048743
1197 Ga0070712_100252262
1198 Ga0070712_100511471
1199 Ga0068871_100165677
1200 Ga0068871_100197056
1201 Ga0068871_100364193
1202 Ga0075428_100007835
1203 Ga0075428_100717465
1204 Ga0075430_100005412
1205 Ga0075430_100047964
1206 Ga0075430_100049169
1207 Ga0075431_100077047
1208 Ga0075431_100078596
1209 Ga0075431_100113627
1210 Ga0075431_100630831
1211 Ga0075434_100186487
1212 Ga0075429_100001408
1213 Ga0075429_100039518
1214 Ga0075429_100048169
1215 Ga0068865_100012409
1216 Ga0068865_100244756
1217 Ga0068865_100349070
1218 Ga0097620_100450263
1219 Ga0097620_100652244
1220 Ga0075435_100114159
1221 Ga0099794_10011259
1222 Ga0099794_10128931
1223 Ga0105244_10046359
1224 Ga0105240_10156885
1225 Ga0105245_10061183
1226 Ga0105245_10156140
1227 Ga0105245_10250315
1228 Ga0105247_10023037
1229 Ga0105247_10026549
1230 Ga0114129_10036834
1231 Ga0114129_10048530
1232 Ga0114129_10121047
1233 Ga0114129_10381182
1234 Ga0114129_10442441
1235 Ga0105243_10109285
1236 Ga0105243_10138090
1237 Ga0105243_10194859
1238 Ga0105243_10203306
1239 Ga0105243_10537983
1240 Ga0105241_10280460
1241 Ga0105241_10476137
1242 Ga0105242_10445990
1243 Ga0105242_10646833
1244 Ga0105248_10082123
1245 Ga0105237_10142930
1246 Ga0105237_10242964
1247 Ga0105237_10458711
1248 Ga0105237_10481336
1249 Ga0105238_10047852
1250 Ga0105238_10065522
1251 Ga0105238_10440816
1252 Ga0105238_10542253
1253 Ga0105249_10317858
1254 Ga0105249_10333136
1255 Ga0105249_10737029
1256 Ga0099796_10027687
1257 Ga0105239_10564865
1258 Ga0105239_10572403
1259 Ga0105246_10290642
1260 Ga0157369_10083360
1261 Ga0157369_10114812
1262 Ga0157369_10844467
1263 Ga0157374_10435322
1264 Ga0157378_10056522
1265 Ga0157378_10244000
1266 Ga0163162_10139462
1267 Ga0157372_10067740
1268 Ga0157372_10102892
1269 Ga0157375_10560112
1270 Ga0157380_10308200
1271 Ga0157380_10483720
1272 Ga0157380_10562671
1273 Ga0182008_10019877
1274 Ga0157379_10031533
1275 Ga0157376_10047951
1276 Ga0157376_10049063
1277 Ga0157376_10150257
1278 Ga0163161_10300191
1279 Ga0206354_11267655
1280 Ga0206354_11647855
1281 Ga0206353_10402092
1282 Ga0206353_10772945
1283 Ga0206353_11026265
1284 Ga0213873_10000235
1285 Ga0213876_10023868
1286 Ga0213876_10188496
1287 Ga0213875_10003575
1288 Ga0213875_10004856
1289 Ga0213875_10198406
1290 Ga0213871_10066111
1291 Ga0207656_10086684
1292 Ga0207653_10093688
1293 Ga0207692_10022999
1294 Ga0207692_10111111
1295 Ga0207692_10165905
1296 Ga0207692_10318251
1297 Ga0207692_10350976
1298 Ga0207710_10013377
1299 Ga0207688_10024196
1300 Ga0207688_10096311
1301 Ga0207680_10258385
1302 Ga0207647_10120303
1303 Ga0207647_10234138
1304 Ga0207699_10024684
1305 Ga0207699_10093258
1306 Ga0207699_10252727
1307 Ga0207643_10192186
1308 Ga0207705_10010177
1309 Ga0207705_10023492
1310 Ga0207684_10043777
1311 Ga0207684_10044680
1312 Ga0207684_10213484
1313 Ga0207684_10232445
1314 Ga0207707_10026561
1315 Ga0207707_10082845
1316 Ga0207695_10119327
1317 Ga0207671_10037508
1318 Ga0207671_10192524
1319 Ga0207671_10328721
1320 Ga0207693_10031545
1321 Ga0207693_10040116
1322 Ga0207693_10040842
1323 Ga0207693_10095242
1324 Ga0207693_10342734
1325 Ga0207693_10396909
1326 Ga0207663_10016253
1327 Ga0207663_10048792
1328 Ga0207663_10202237
1329 Ga0207663_10249811
1330 Ga0207663_10271431
1331 Ga0207660_10034720
1332 Ga0207660_10120064
1333 Ga0207662_10086825
1334 Ga0207662_10274738
1335 Ga0207657_10039762
1336 Ga0207649_10028963
1337 Ga0207652_10001454
1338 Ga0207652_10006068
1339 Ga0207652_10127750
1340 Ga0207646_10027639
1341 Ga0207646_10029503
1342 Ga0207646_10048680
1343 Ga0207646_10055390
1344 Ga0207646_10060764
1345 Ga0207646_10131536
1346 Ga0207646_10352859
1347 Ga0207694_10067935
1348 Ga0207694_10431909
1349 Ga0207687_10038200
1350 Ga0207687_10108256
1351 Ga0207687_10360260
1352 Ga0207700_10053320
1353 Ga0207664_10050606
1354 Ga0207664_10077862
1355 Ga0207644_10361995
1356 Ga0207690_10019587
1357 Ga0207690_10283360
1358 Ga0207706_10132764
1359 Ga0207686_10086607
1360 Ga0207709_10031715
1361 Ga0207709_10141572
1362 Ga0207670_10071647
1363 Ga0207669_10022132
1364 Ga0207669_10110367
1365 Ga0207669_10252292
1366 Ga0207704_10187958
1367 Ga0207665_10026734
1368 Ga0207665_10143945
1369 Ga0207691_10040802
1370 Ga0207711_10057476
1371 Ga0207711_10230056
1372 Ga0207689_10052403
1373 Ga0207689_10110788
1374 Ga0207661_10000736
1375 Ga0207661_10005583
1376 Ga0207661_10346683
1377 Ga0207679_10023434
1378 Ga0207679_10697175
1379 Ga0207667_10068174
1380 Ga0207667_10084188
1381 Ga0207651_10313774
1382 Ga0207712_10014393
1383 Ga0207712_10446524
1384 Ga0207668_10030048
1385 Ga0207668_10039369
1386 Ga0207677_10036002
1387 Ga0207677_10136607
1388 Ga0207677_10557772
1389 Ga0207639_10500304
1390 Ga0207678_10054507
1391 Ga0207678_10082852
1392 Ga0207678_10129250
1393 Ga0207678_10259046
1394 Ga0207678_10264631
1395 Ga0207708_10224253
1396 Ga0207702_10046581
1397 Ga0207702_10058070
1398 Ga0207702_10113460
1399 Ga0207702_10390651
1400 Ga0207702_10474290
1401 Ga0207641_10360332
1402 Ga0207648_10056503
1403 Ga0207648_10153793
1404 Ga0207674_10055416
1405 Ga0207674_10362289
1406 Ga0207674_10488679
1407 Ga0207674_10639867
1408 Ga0207675_100053755
1409 Ga0207675_100487760
1410 Ga0207675_100766270
1411 Ga0207683_10007141
1412 Ga0207683_10059664
1413 Ga0207683_10226867
1414 Ga0207683_10326575
1415 Ga0207698_10046392
1416 Ga0207698_10151828
1417 Ga0207698_10276894
1418 Ga0209588_1004920
1419 Ga0268266_10055029
1420 Ga0268266_10344571
1421 Ga0268265_10053062
1422 Ga0268265_10157768
1423 Ga0268264_10049641
1424 Ga0307515_10002209
1425 Ga0307515_10090632
1426 Ga0307515_10112242
1427 Ga0307515_10114672
1428 Ga0307515_10351118
1429 Ga0307511_10002064
1430 Ga0307511_10036041
1431 Ga0307512_10053716
1432 Ga0307512_10053898
1433 Ga0265340_10009479
1434 Ga0307513_10026939
1435 Ga0307513_10190978
1436 Ga0307509_10069301
1437 Ga0307408_100117638
1438 Ga0307408_100232297
1439 Ga0307508_10006509
1440 Ga0307508_10049014
1441 Ga0307508_10053134
1442 Ga0307508_10233287
1443 Ga0307508_10276703
1444 Ga0307514_10044795
1445 Ga0316576_10039186
1446 Ga0307516_10009926
1447 Ga0307516_10064671
1448 Ga0307405_10020624
1449 Ga0307405_10026076
1450 Ga0307405_10142462
1451 Ga0307405_10366485
1452 Ga0307413_10023417
1453 Ga0307518_10037558
1454 Ga0307410_10032038
1455 Ga0307410_10146402
1456 Ga0307410_10208165
1457 Ga0307410_10287067
1458 Ga0307410_10334157
1459 Ga0307406_10019032
1460 Ga0307406_10030380
1461 Ga0307406_10133532
1462 Ga0307406_10310405
1463 Ga0307406_10468630
1464 Ga0307407_10018141
1465 Ga0307407_10056493
1466 Ga0307407_10295515
1467 Ga0307407_10384176
1468 Ga0307412_10071190
1469 Ga0307409_100032151
1470 Ga0307409_100032652
1471 Ga0307409_100039951
1472 Ga0307409_100040065
1473 Ga0307409_100244504
1474 Ga0307409_100615192
1475 Ga0307409_100739344
1476 Ga0307416_100040611
1477 Ga0307416_100045313
1478 Ga0307416_100123145
1479 Ga0307416_100222627
1480 Ga0307416_100922055
1481 Ga0307414_10045665
1482 Ga0307414_10054669
1483 Ga0307414_10071440
1484 Ga0307414_10127246
1485 Ga0307411_10021558
1486 Ga0307411_10197168
1487 Ga0307415_100030630
1488 Ga0307415_100031865
1489 Ga0307415_100149315
1490 Ga0307415_100355340
1491 Ga0307415_100489854
1492 Ga0307415_100515422
1493 Ga0316583_10067278
1494 Ga0307507_10050067
1495 Ga0307507_10064823
1496 Ga0307507_10071496
1497 Ga0307510_10168221
1498 Ga0373926_0004115
1499 Ga0373926_0039093
1500 Ga0373928_0035474
1501 Ga0373934_0004664
1502 Ga0373934_0011016
1503 Ga0373934_0073518
1504 Ga0373944_0019136
1505 Ga0373944_0057680
1506 Ga0373944_0064781
1507 Ga0373923_0000238
1508 Ga0373923_0009354
1509 Ga0373923_0189094
1510 Ga0373932_0068324
1511 Ga0373936_0000987
1512 Ga0373936_0006981
1513 Ga0373936_0231747
1514 Ga0373939_0108731
1515 Ga0373945_0000634
1516 Ga0373945_0108572
1517 Ga0373945_0126090
1518 Ga0373945_0151980
1519 Ga0373953_0004165
1520 Ga0373953_0006292
1521 Ga0373953_0007249
1522 Ga0373953_0060333
1523 Ga0373954_0002275
1524 Ga0373954_0014690
1525 Ga0373954_0028969
1526 Ga0373954_0113900
1527 Ga0373956_0004343
1528 Ga0373956_0005108
1529 Ga0373956_0011804
1530 Ga0373956_0014118
1531 Ga0373956_0085017
1532 Ga0373956_0175973
1533 Ga0373957_0005897
1534 Ga0373957_0006343
1535 Ga0373957_0008553
1536 Ga0373957_0069730
1537 Ga0373960_0049885
1538 Ga0373960_0058197
1539 Ga0373943_0004593
1540 Ga0373943_0037559
1541 Ga0373943_0144176
1542 Ga0373943_0169212
1543 Ga0373946_0001094
1544 Ga0373946_0022069
1545 Ga0373946_0028375
1546 Ga0373946_0066453
1547 Ga0373946_0134662
1548 Ga0373955_0015994
1549 Ga0373955_0049418
1550 Ga0373955_0053159
1551 Ga0373955_0187250
1552 Ga0373955_0307854
1553 Ga0316574_0057625
1554 Ga0373924_0002738
1555 Ga0373924_0008098
1556 Ga0373924_0009195
1557 Ga0373924_0069586
1558 Ga0373924_0091147
1559 Ga0373924_0102108
1560 Ga0373931_0192478
1561 Ga0373935_0005788
1562 Ga0373935_0013913
1563 Ga0373935_0016469
1564 Ga0373927_0002592
1565 Ga0373927_0035790
1566 Ga0373933_0006148
1567 Ga0373933_0007518
1568 Ga0373933_0021414
1569 Ga0373933_0059833
1570 Ga0373933_0092354
1571 Ga0373947_0007335
1572 Ga0373947_0028950
1573 Ga0373947_0075951
1574 Ga0373947_0119031
1575 Ga0373947_0137869
1576 Ga0373937_0023747
1577 Ga0373937_0046519
1578 Ga0373937_0064010
1579 Ga0373937_0066270
1580 Ga0373937_0066969
1581 Ga0373937_0134224
1582 Ga0373937_0144486
1583 Ga0373937_0335025
1584 Ga0316584_0046991
1585 Ga0373925_0013705
1586 Ga0373925_0014822
1587 Ga0373925_0027143
1588 Ga0373925_0029939
1589 Ga0373925_0144892
1590 Ga0373925_0238169
1591 Ga0373925_0327546
1592 Ga0373925_0525326
1593 Ga0373925_0559909
1594 Ga0373925_0701513
1595 Ga0395899_0212376
1596 Ga0395900_0126398
1597 Ga0395900_0294937
1598 Ga0395900_0354824
1599 Ga0395898_0059635
1600 Ga0395898_0074781
1601 Ga0395898_0168393
1602 Ga0395898_0311647
1603 Ga0395898_0359636
1604 Ga0395905_0041107
1605 Ga0395905_0194093
1606 Ga0395905_0342426
1607 Ga0436364_0026190
1608 Ga0436364_0956857
1609 Ga0395901_0064160
1610 Ga0395901_0079582
1611 Ga0395901_0162870
1612 Ga0395901_0203195
1613 Ga0395901_0601460
1614 Ga0436365_0714895
1615 Ga0436365_0785871
1616 Ga0436365_1743964
1617 Ga0436360_0354775
1618 Ga0436361_0669121
1619 Ga0436363_0425289
1620 Ga0436363_0853423
1621 Ga0436363_1642401
1622 Ga0436362_0122283
1623 Ga0436362_0888059
1624 Ga0436362_1251845
1625 Ga0439465_0062936
1626 Ga0451797_1397672
1627 Ga0451853_1827931
1628 Ga0439437_005810
1629 Ga0439448_0005138
1630 Ga0439448_0006244
1631 Ga0439450_039612
1632 Ga0439451_011045
1633 Ga0439455_0002108
1634 Ga0439463_004248
1635 Ga0439459_0001446
1636 Ga0439464_0003585
1637 Ga0439464_0081258
1638 Ga0439460_0004780
1639 Ga0439440_0017136
1640 Ga0466966_0029401
1641 Ga0466966_0029477
1642 Ga0466966_0077106
1643 Ga0466966_0093794
1644 Ga0466966_0108283
1645 Ga0466968_0218774
1646 Ga0466970_0159449
1647 Ga0466959_0353394
1648 Ga0466959_0398249
1649 Ga0466958_0027951
1650 Ga0466967_0026161
1651 Ga0466967_0180574
1652 Ga0466967_0774698
1653 Ga0495592_0001231
1654 Ga0495592_0005292
1655 Ga0495592_0008135
1656 Ga0495592_0010917
1657 Ga0495592_0035499
1658 Ga0495592_0081280
1659 Ga0495592_0157302
1660 Ga0495592_0203484
1661 Ga0495603_0006458
1662 Ga0495603_0021597
1663 Ga0495629_0029695
1664 Ga0495629_0057988
1665 Ga0495629_0093924
1666 Ga0495629_0540787
1667 Ga0495641_0020884
1668 Ga0495641_0023177
1669 Ga0495641_0056412
1670 Ga0495641_0060912
1671 Ga0495651_0001745
1672 Ga0495651_0008175
1673 Ga0495651_0013296
1674 Ga0495651_0025435
1675 Ga0495651_0041549
1676 Ga0495651_0044752
1677 Ga0495651_0044972
1678 Ga0495651_0197605
1679 Ga0495653_0035705
1680 Ga0495653_0038729
1681 Ga0495653_0090093
1682 Ga0495653_0090997
1683 Ga0495653_0191595
1684 Ga0495653_0243134
1685 Ga0495580_0008696
1686 Ga0495580_0020970
1687 Ga0495580_0166034
1688 Ga0495580_0256087
1689 Ga0495582_0011785
1690 Ga0495582_0023928
1691 Ga0495605_0041420
1692 Ga0495639_0014390
1693 Ga0495639_0028724
1694 Ga0495639_0048208
1695 Ga0495662_0001191
1696 Ga0495662_0008034
1697 Ga0495662_0018846
1698 Ga0495662_0071993
1699 Ga0495662_0107421
1700 Ga0495662_0121290
1701 Ga0495664_0002422
1702 Ga0495664_0005807
1703 Ga0495664_0011959
1704 Ga0495664_0019876
1705 Ga0495664_0020456
1706 Ga0495594_0010030
1707 Ga0495594_0021133
1708 Ga0495594_0064238
1709 Ga0495596_0014232
1710 Ga0495607_0008728
1711 Ga0495608_0004778
1712 Ga0495608_0022307
1713 Ga0495608_0031542
1714 Ga0495608_0140558
1715 Ga0495608_0207517
1716 Ga0495608_0371450
1717 Ga0495616_0028158
1718 Ga0495618_0001441
1719 Ga0495618_0019153
1720 Ga0495618_0026478
1721 Ga0495618_0027022
1722 Ga0495618_0032106
1723 Ga0495618_0075312
1724 Ga0495628_0004659
1725 Ga0495628_0021899
1726 Ga0495628_0022533
1727 Ga0495628_0034756
1728 Ga0495628_0040076
1729 Ga0495628_0301658
1730 Ga0495628_0320156
1731 Ga0495628_0515777
1732 Ga0495630_0001842
1733 Ga0495630_0008304
1734 Ga0495630_0010610
1735 Ga0495630_0029784
1736 Ga0495630_0033205
1737 Ga0495630_0043238
1738 Ga0495630_0049230
1739 Ga0495630_0380247
1740 Ga0495631_0013227
1741 Ga0495631_0044303
1742 Ga0495631_0049442
1743 Ga0495631_0082084
1744 Ga0495663_0042612
1745 Ga0495666_0007807
1746 Ga0495666_0019908
1747 Ga0495666_0059533
1748 Ga0495666_0103680
1749 Ga0495652_0001251
1750 Ga0495652_0015295
1751 Ga0495652_0016983
1752 Ga0495652_0039031
1753 Ga0495652_0070003
1754 Ga0495652_0121799
1755 Ga0495652_0131330
1756 Ga0495652_0282210
1757 Ga0495665_0000445
1758 Ga0495665_0043861
1759 Ga0495665_0112845
1760 Ga0495640_0023758
1761 Ga0495640_0029488
1762 Ga0495640_0050918
1763 Ga0495640_0061433
1764 Ga0495640_0075802
1765 Ga0495640_0332265
1766 Ga0495586_0008692
1767 Ga0495586_0032054
1768 Ga0495586_0369721
1769 Ga0495587_0000412
1770 Ga0495587_0000539
1771 Ga0495587_0015132
1772 Ga0495587_0080542
1773 Ga0495587_0176368
1774 Ga0495587_0212711
1775 Ga0495587_0287804
1776 Ga0495598_0003384
1777 Ga0495598_0096023
1778 Ga0495621_0011140
1779 Ga0495597_0181419
1780 Ga0495645_0001433
1781 Ga0495645_0001863
1782 Ga0495645_0003140
1783 Ga0495645_0032288
1784 Ga0495645_0041308
1785 Ga0495645_0141130
1786 Ga0495622_0011214
1787 Ga0495667_0001115
1788 Ga0495667_0002439
1789 Ga0495667_0012121
1790 Ga0495667_0013378
1791 Ga0495667_0023000
1792 Ga0495667_0029679
1793 Ga0495667_0077704
1794 Ga0495667_0092965
1795 Ga0495667_0159008
1796 Ga0495656_0208210
1797 Ga0495668_0026217
1798 Ga0495668_0212142
1799 Ga0495634_0023608
1800 Ga0495634_0023825
1801 Ga0495634_0027779
1802 Ga0495634_0037102
1803 Ga0495634_0064968
1804 Ga0495634_0085250
1805 Ga0495634_0195841
1806 Ga0495634_0239817
1807 Ga0495635_0008637
1808 Ga0495635_0024838
1809 Ga0495635_0029679
1810 Ga0495635_0032425
1811 Ga0495635_0036669
1812 Ga0495635_0053316
1813 Ga0495635_0090437
1814 Ga0495635_0100730
1815 Ga0495588_0011852
1816 Ga0495588_0045462
1817 Ga0495588_0114713
1818 Ga0495657_0006095
1819 Ga0495657_0017298
1820 Ga0495657_0031745
1821 Ga0495657_0040649
1822 Ga0495657_0086071
1823 Ga0495599_0004111
1824 Ga0495599_0012943
1825 Ga0495599_0019198
1826 Ga0495599_0021962
1827 Ga0495599_0100637
1828 Ga0495599_0136484
1829 Ga0495599_0185631
1830 Ga0495599_0261843
1831 Ga0495599_0295107
1832 Ga0495623_0000446
1833 Ga0495623_0003870
1834 Ga0495623_0004008
1835 Ga0495623_0024774
1836 Ga0495623_0028584
1837 Ga0495646_0000857
1838 Ga0495646_0006001
1839 Ga0495646_0028261
1840 Ga0495646_0043110
1841 Ga0495646_0047322
1842 Ga0495646_0067494
1843 Ga0495646_0114086
1844 Ga0495646_0250652
1845 Ga0495647_0006828
1846 Ga0495647_0073185
1847 Ga0495647_0093071
1848 Ga0495658_0006627
1849 Ga0495658_0047804
1850 Ga0495613_0010427
1851 Ga0495613_0088997
1852 Ga0495613_0155673
1853 Ga0495624_0019793
1854 Ga0495624_0029900
1855 Ga0495624_0061984
1856 Ga0495624_0349769
1857 Ga0495671_0029262
1858 Ga0495671_0046106
1859 Ga0495589_0141938
1860 Ga0495600_0000409
1861 Ga0495600_0000926
1862 Ga0495600_0021620
1863 Ga0495600_0022013
1864 Ga0495600_0022699
1865 Ga0495600_0214919
1866 Ga0495660_0041710
1867 Ga0495581_0005427
1868 Ga0495581_0021470
1869 Ga0495581_0024290
1870 Ga0495581_0070672
1871 Ga0495581_0105958
1872 Ga0495581_0228222
1873 Ga0495604_0000819
1874 Ga0495604_0000876
1875 Ga0495604_0001125
1876 Ga0495604_0009984
1877 Ga0495604_0012815
1878 Ga0495604_0021731
1879 Ga0495604_0149651
1880 Ga0495604_0208856
1881 Ga0495674_0010662
1882 Ga0495674_0015023
1883 Ga0495674_0030709
1884 Ga0495674_0044565
1885 Ga0495674_0051767
1886 Ga0495674_0087407
1887 Ga0495674_0089660
1888 Ga0495674_0212074
1889 Ga0495676_0033365
1890 Ga0495676_0047872
1891 Ga0495676_0078295
1892 Ga0495676_0154404
1893 Ga0495680_0003017
1894 Ga0495680_0013606
1895 Ga0495680_0043716
1896 Ga0495680_0078213
1897 Ga0495680_0082761
1898 Ga0495680_0121106
1899 Ga0495680_0331707
1900 Ga0495675_0000446
1901 Ga0495675_0004030
1902 Ga0495675_0024763
1903 Ga0495675_0025867
1904 Ga0495677_0019996
1905 Ga0495685_067021
1906 Ga0495684_0001931
1907 Ga0495684_0006538
1908 Ga0495684_0010771
1909 Ga0495684_0020791
1910 Ga0495684_0138748
1911 Ga0495593_0002270
1912 Ga0495593_0022735
1913 Ga0495593_0067614
1914 Ga0495602_0004263
1915 Ga0495602_0013534
1916 Ga0495602_0021648
1917 Ga0495602_0126727
1918 Ga0495602_0253677
1919 Ga0495602_0338788
1920 Ga0495614_0006675
1921 Ga0495614_0010643
1922 Ga0495614_0131514
1923 Ga0496100_0031621
1924 Ga0496100_0108650
1925 Ga0496101_0052186
1926 Ga0496101_0130191
1927 Ga0496101_0460700
1928 Ga0496102_0027189
1929 Ga0496102_0050319
1930 Ga0496102_0066199
1931 Ga0496102_0466827
1932 Ga0496103_0020438
1933 Ga0496103_0033231
1934 Ga0496103_0232208
1935 Ga0496104_0034424
1936 Ga0496104_0064798
1937 Ga0496104_0399504
1938 Ga0496104_0433156
1939 Ga0496105_0057680
1940 Ga0496105_0192360
1941 Ga0496105_0432745
1942 Ga0496106_0039137
1943 Ga0496106_0048839
1944 Ga0496106_0472156
1945 Ga0496107_0043357
1946 Ga0496108_0038147
1947 Ga0496108_0041954
1948 Ga0496108_0048757
1949 Ga0496108_0051532
1950 Ga0496108_0258918
1951 Ga0496109_0043284
1952 Ga0496109_0045135
1953 Ga0496109_0053510
1954 Ga0496109_0063826
1955 Ga0496109_0274065
1956 Ga0496109_0873220
1957 Ga0496110_0043825
1958 Ga0496110_0047930
1959 Ga0496110_0056814
1960 Ga0496110_0178257
1961 Ga0496110_0322439
1962 Ga0496111_0021795
1963 Ga0496111_0035721
1964 Ga0496111_0040446
1965 Ga0496112_0064853
1966 Ga0496112_0071366
1967 Ga0496112_0075976
1968 Ga0496112_0492319
1969 Ga0496113_0039225
1970 Ga0496113_0345983
1971 Ga0496114_0015468
1972 Ga0496114_0017612
1973 Ga0496114_0420090
1974 Ga0496114_0457293
1975 Ga0496115_0043548
1976 Ga0496116_0036541
1977 Ga0496117_0012267
1978 Ga0496118_0045320
1979 Ga0496119_0029804
1980 Ga0496120_0034757
1981 Ga0501031_0061816
1982 Ga0501031_0248045
1983 Ga0501032_0179472
1984 Ga0501033_0213512
1985 Ga0501034_0698266
1986 Ga0501036_0008547
1987 Ga0501036_0146093
1988 Ga0501036_0338075
1989 Ga0501037_0078990
1990 Ga0501038_0019168
1991 Ga0501038_0058384
1992 Ga0501039_0048272
1993 Ga0501039_0159359
1994 Ga0501039_0357659
1995 Ga0501040_0034221
1996 Ga0501040_0052966
1997 Ga0501040_0256191
1998 Ga0501041_0002071
1999 Ga0501041_0250475
2000 Ga0501042_0040235
2001 Ga0501042_0126767
2002 Ga0501042_0411797
2003 Ga0501043_0043716
2004 Ga0501043_0092820
2005 Ga0501043_0327476
2006 Ga0501046_0172361
2007 Ga0501046_0314638
2008 Ga0501047_0049780
2009 Ga0501048_0021552
2010 Ga0501048_0042636
2011 Ga0501048_0150438
2012 Ga0501048_0221423
2013 Ga0501070_0435359
2014 Ga0501071_0425873
2015 Ga0501072_0217566
2016 Ga0501072_0324942
2017 Ga0501074_0017670
2018 Ga0501074_0073969
2019 Ga0501075_0038226
2020 Ga0501075_0278246
2021 Ga0501075_0356611
2022 Ga0501076_0002605
2023 Ga0501076_0190855
2024 Ga0501076_0198382
2025 Ga0501077_0138159
2026 Ga0501079_0038092
2027 Ga0501079_0038394
2028 Ga0501079_0397216
2029 Ga0501080_0569333
2030 Ga0501081_0015277
2031 Ga0501081_0034956
2032 Ga0501081_0047658
2033 Ga0501081_0241059
2034 Ga0501083_0221553
2035 Ga0501268_017421
2036 Ga0501035_0062810
2037 Ga0501035_0283826
2038 Ga0501035_0415489
2039 Ga0501044_0071214
2040 Ga0501045_0004503
2041 Ga0501045_0060279
2042 Ga0501045_0075612
2043 Ga0501045_0143084
2044 nmdc:mga05p37_10885_c1
2045 nmdc:mga05p37_17938_c2
2046 nmdc:mga05p37_390747_c1
2047 nmdc:mga05p37_53953_c1
2048 nmdc:mga09592_18277_c1
2049 nmdc:mga09592_26866_c1
2050 nmdc:mga09592_47527_c1
2051 nmdc:mga0qj67_10601_c1
2052 nmdc:mga0qj67_415_c1
2053 nmdc:mga0qj67_41855_c1
2054 nmdc:mga06r32_13500_c1
2055 nmdc:mga06r32_18555_c2
2056 nmdc:mga06r32_73270_c1
2057 nmdc:mga06r32_7479_c1
2058 nmdc:mga0rr50_181050_c1
2059 nmdc:mga0rr50_391843_c1
2060 nmdc:mga0rr50_605112_c1
2061 nmdc:mga0a205_200466_c1
2062 Ga0495601_0012227
2063 Ga0495601_0013328
2064 Ga0495601_0044254
2065 Ga0495601_0260685
2066 Ga0495612_0003749
2067 Ga0495595_0006043
2068 Ga0495595_0014305
2069 Ga0495595_0051442
2070 Ga0495595_0086137
2071 Ga0495595_0138443
2072 Ga0495595_0256166
2073 Ga0495619_0024726
2074 Ga0495619_0029196
2075 Ga0495619_0033968
2076 Ga0495619_0230984
2077 Ga0500646_0005538
2078 Ga0500660_040572
2079 Ga0500569_002159
2080 Ga0500588_0003099
2081 Ga0500600_0022641
2082 Ga0500600_0025625
2083 Ga0501084_0050826
2084 Ga0501084_0059069
2085 Ga0501084_0176138
2086 Ga0501082_0050322
2087 Ga0501082_0064550
2088 Ga0501082_0090565
2089 Ga0501082_0387874
2090 Ga0530510_0006051
2091 Ga0530510_0007140
2092 Ga0530510_0322946
2093 Ga0530510_0409829
2094 Ga0530510_0511870
2095 2517759910
2096 2517760979
2097 2517761337
2098 2689959666
2099 2753266097
2100 2753272878

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13401

AAA_22

AAA domain

42

175

0.9

PF09848

SLFN-g3_helicase

Schlafen group 3, DNA/RNA helicase domain

45

168

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1fnn-assembly2.cif.gz_B crystal structure of cdc6p from pyrobaculum aerophilum 0.7515 16 255
1in8-assembly1.cif.gz_A thermotoga maritima ruvb t158v 0.7494 31 267
7svu-assembly1.cif.gz_K tnsbctd-tnsc-tniq complex 0.7454 4 266
1sxj-assembly1.cif.gz_C crystal structure of the eukaryotic clamp loader (replication factor c, rfc) bound to the dna sliding clamp (proliferating cell nuclear antigen, pcna) 0.7447 13 263
4jpo-assembly3.cif.gz_C 5a resolution structure of proteasome assembly chaperone hsm3 in complex with a c-terminal fragment of rpt1 0.7446 215 266
ID Description Score Start End Superfamily
af_I6XFD1_186_270_1.10.8.60 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 1.001 186 270 1.10.8.60
af_I6XFD1_25_185_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9993 25 185 3.40.50.300
af_I6XFD1_25_185_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9931 25 185 3.40.50.300
af_I6XFD1_186_270_1.10.8.60 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9891 186 270 1.10.8.60
4ww0B02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9241 236 266 1.10.8.60
ID Description Score Start End GO Terms
AF-A0A7U9PML5-F1-model_v4 deleted 0.9951 2 270
AF-A0A5C7MJ14-F1-model_v4 DUF2075 domain-containing protein 0.9943 1 238 GO:0016887
AF-A0A7U9PML5-F1-model_v4 deleted 0.9878 2 270
AF-T0ZGB4-F1-model_v4 AAA ATPase 0.9865 41 270 GO:0016887
AF-A0A5C7MJ14-F1-model_v4 DUF2075 domain-containing protein 0.9861 1 238 GO:0016887

Map