F489046
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1050 | 382 | 2100 | 269 |
Family's Representative Sequence
| Representative Sequence | 3300005468|Ga0070707_100076242|Ga0070707_1000762421 |
| Length | 272 |
| Sequence | MIEKLQAHYGFTRMPFGRDLAPGMLHRHAAHNEACARITWCIAERAIGVITGEAGAGKTASVRTVLAGLDATRHTIIYLPNPMIGVRGLHEAIVTAFGQPPSQISSRLIAKASAALAAERDERGRTPVLVIDEAHLLRYEQLETIRMLTNNPTTMDADSPLACLLAGQPTLRRTMKLAVLAALEQRTALRYTMPPMTAAETTSYISHHIKLAGRSDTLFSDDAAALIHQTSRGYPRAVNNLAIQALVATYTGGKTIVDQAAARAAVTEITDD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 73 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 74 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 103 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 104 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 105 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 106 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 166 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 167 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 168 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 169 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 170 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 171 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 172 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 173 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 174 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 175 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 176 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 178 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 179 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 180 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 181 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 182 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 183 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 184 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 185 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 186 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 187 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 188 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 189 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 190 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 191 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 192 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 193 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 194 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 195 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 196 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 198 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 199 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 200 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 201 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 202 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 204 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 205 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 206 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 209 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 210 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 213 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 214 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 215 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 217 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 219 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 220 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 221 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 222 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 223 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 224 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 225 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 226 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 227 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 228 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 229 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 230 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 232 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 233 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 234 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 235 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 236 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 237 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 238 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 239 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 240 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 241 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 242 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 243 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 244 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 245 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 246 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 247 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 248 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 314 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 315 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 316 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 317 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 318 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 319 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 322 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 323 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 324 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 325 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 326 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 327 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 328 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 329 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 330 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 331 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 332 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 359 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 373 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 374 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 375 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 376 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 377 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 380 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 381 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 382 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.95 |
| Metatranscriptomes | 0.48 |
| Isolates | 0.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.57 |
| Nodule | 0.38 |
| Rhizoplane | 5.14 |
| Rhizosphere | 89.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070707_100076242 | 3300005468 | Bacteria | 3234 |
| 2 | JGI25406J46586_10014240 | 3300003203 | Bacteria | 3388 |
| 3 | JGI25406J46586_10014431 | 3300003203 | Bacteria | 3359 |
| 4 | JGI25406J46586_10030198 | 3300003203 | Bacteria | 2042 |
| 5 | JGI25406J46586_10053968 | 3300003203 | Bacteria | 1332 |
| 6 | rootL2_10004996 | 3300003322 | Bacteria | 4647 |
| 7 | rootH1_10037886 | 3300003323 | Bacteria | 13878 |
| 8 | JGI25404J52841_10004486 | 3300003659 | Bacteria | 2832 |
| 9 | Ga0070658_10028001 | 3300005327 | Bacteria | 4523 |
| 10 | Ga0070683_100431266 | 3300005329 | Bacteria | 1258 |
| 11 | Ga0068869_100053899 | 3300005334 | Bacteria | 2926 |
| 12 | Ga0070666_10188510 | 3300005335 | Bacteria | 1449 |
| 13 | Ga0070666_10357437 | 3300005335 | Bacteria | 1046 |
| 14 | Ga0070680_100011908 | 3300005336 | Bacteria | 6749 |
| 15 | Ga0070680_100142243 | 3300005336 | Bacteria | 2012 |
| 16 | Ga0070682_100007899 | 3300005337 | Bacteria | 5988 |
| 17 | Ga0070682_100013960 | 3300005337 | Bacteria | 4634 |
| 18 | Ga0070682_100018888 | 3300005337 | Bacteria | 4037 |
| 19 | Ga0070682_100085006 | 3300005337 | Bacteria | 2057 |
| 20 | Ga0070682_100293262 | 3300005337 | Bacteria | 1190 |
| 21 | Ga0068868_100078378 | 3300005338 | Bacteria | 2645 |
| 22 | Ga0068868_100100825 | 3300005338 | Bacteria | 2336 |
| 23 | Ga0068868_100325359 | 3300005338 | Bacteria | 1311 |
| 24 | Ga0070660_100031064 | 3300005339 | Bacteria | 4009 |
| 25 | Ga0070660_100037982 | 3300005339 | Bacteria | 3653 |
| 26 | Ga0070691_10148853 | 3300005341 | Bacteria | 1199 |
| 27 | Ga0070687_100219443 | 3300005343 | Bacteria | 1163 |
| 28 | Ga0070687_100220464 | 3300005343 | Bacteria | 1161 |
| 29 | Ga0070661_100016582 | 3300005344 | Bacteria | 5211 |
| 30 | Ga0070692_10008892 | 3300005345 | Bacteria | 4501 |
| 31 | Ga0070692_10008907 | 3300005345 | Bacteria | 4498 |
| 32 | Ga0070668_100048108 | 3300005347 | Bacteria | 3280 |
| 33 | Ga0070668_100244301 | 3300005347 | Bacteria | 1488 |
| 34 | Ga0070674_100029725 | 3300005356 | Bacteria | 3605 |
| 35 | Ga0070674_100038007 | 3300005356 | Bacteria | 3241 |
| 36 | Ga0070673_100237856 | 3300005364 | Bacteria | 1582 |
| 37 | Ga0070659_100013364 | 3300005366 | Bacteria | 6108 |
| 38 | Ga0070659_100156036 | 3300005366 | Bacteria | 1864 |
| 39 | Ga0070703_10053897 | 3300005406 | Bacteria | 1295 |
| 40 | Ga0070709_10018337 | 3300005434 | Bacteria | 4028 |
| 41 | Ga0070709_10034296 | 3300005434 | Bacteria | 3076 |
| 42 | Ga0070709_10156443 | 3300005434 | Bacteria | 1580 |
| 43 | Ga0070714_100053004 | 3300005435 | Bacteria | 3461 |
| 44 | Ga0070714_100082883 | 3300005435 | Bacteria | 2795 |
| 45 | Ga0070714_100130421 | 3300005435 | Bacteria | 2246 |
| 46 | Ga0070714_100433485 | 3300005435 | Bacteria | 1246 |
| 47 | Ga0070714_100578204 | 3300005435 | Bacteria | 1077 |
| 48 | Ga0070714_100594436 | 3300005435 | Bacteria | 1062 |
| 49 | Ga0070713_100041851 | 3300005436 | Bacteria | 3735 |
| 50 | Ga0070713_100459918 | 3300005436 | Bacteria | 1196 |
| 51 | Ga0070710_10068331 | 3300005437 | Bacteria | 2041 |
| 52 | Ga0070710_10222009 | 3300005437 | Bacteria | 1203 |
| 53 | Ga0070710_10271732 | 3300005437 | Bacteria | 1097 |
| 54 | Ga0070711_100023271 | 3300005439 | Bacteria | 4026 |
| 55 | Ga0070711_100048497 | 3300005439 | Bacteria | 2905 |
| 56 | Ga0070711_100181231 | 3300005439 | Bacteria | 1612 |
| 57 | Ga0070711_100208345 | 3300005439 | Bacteria | 1512 |
| 58 | Ga0070705_100012792 | 3300005440 | Bacteria | 4276 |
| 59 | Ga0070705_100107418 | 3300005440 | Bacteria | 1776 |
| 60 | Ga0070705_100431671 | 3300005440 | Bacteria | 984 |
| 61 | Ga0070708_100049236 | 3300005445 | Bacteria | 3727 |
| 62 | Ga0070708_100053855 | 3300005445 | Bacteria | 3572 |
| 63 | Ga0070708_100059461 | 3300005445 | Bacteria | 3407 |
| 64 | Ga0070708_100185112 | 3300005445 | Bacteria | 1947 |
| 65 | Ga0070663_100113387 | 3300005455 | Bacteria | 2040 |
| 66 | Ga0070663_100388747 | 3300005455 | Bacteria | 1138 |
| 67 | Ga0070678_100038854 | 3300005456 | Bacteria | 3354 |
| 68 | Ga0070662_100256431 | 3300005457 | Bacteria | 1408 |
| 69 | Ga0070681_10013155 | 3300005458 | Bacteria | 8220 |
| 70 | Ga0070681_10069832 | 3300005458 | Bacteria | 3479 |
| 71 | Ga0070681_10202662 | 3300005458 | Bacteria | 1902 |
| 72 | Ga0068867_100061539 | 3300005459 | Bacteria | 2787 |
| 73 | Ga0070706_100036169 | 3300005467 | Bacteria | 4560 |
| 74 | Ga0070706_100085822 | 3300005467 | Bacteria | 2917 |
| 75 | Ga0070706_100337311 | 3300005467 | Bacteria | 1405 |
| 76 | Ga0070707_100047658 | 3300005468 | Bacteria | 4102 |
| 77 | Ga0070707_100068837 | 3300005468 | Bacteria | 3407 |
| 78 | Ga0070698_100050947 | 3300005471 | Bacteria | 4218 |
| 79 | Ga0070698_100054611 | 3300005471 | Bacteria | 4054 |
| 80 | Ga0070698_100100102 | 3300005471 | Bacteria | 2871 |
| 81 | Ga0070698_100277209 | 3300005471 | Bacteria | 1609 |
| 82 | Ga0070698_100308773 | 3300005471 | Bacteria | 1512 |
| 83 | Ga0070699_100044656 | 3300005518 | Bacteria | 3836 |
| 84 | Ga0070699_100056215 | 3300005518 | Bacteria | 3407 |
| 85 | Ga0070699_100392135 | 3300005518 | Bacteria | 1255 |
| 86 | Ga0070679_100037365 | 3300005530 | Bacteria | 4823 |
| 87 | Ga0070679_100080365 | 3300005530 | Bacteria | 3249 |
| 88 | Ga0070684_100801516 | 3300005535 | Bacteria | 880 |
| 89 | Ga0068853_100048337 | 3300005539 | Bacteria | 3654 |
| 90 | Ga0068853_100453714 | 3300005539 | Bacteria | 1206 |
| 91 | Ga0070686_100143482 | 3300005544 | Bacteria | 1665 |
| 92 | Ga0070693_100021014 | 3300005547 | Bacteria | 3452 |
| 93 | Ga0070693_100377839 | 3300005547 | Bacteria | 977 |
| 94 | Ga0070665_100100923 | 3300005548 | Bacteria | 2890 |
| 95 | Ga0070665_100413790 | 3300005548 | Bacteria | 1357 |
| 96 | Ga0070704_100039062 | 3300005549 | Bacteria | 3256 |
| 97 | Ga0070704_100110369 | 3300005549 | Bacteria | 2092 |
| 98 | Ga0070704_100247997 | 3300005549 | Bacteria | 1461 |
| 99 | Ga0070704_100340459 | 3300005549 | Bacteria | 1263 |
| 100 | Ga0068855_100069582 | 3300005563 | Bacteria | 4095 |
| 101 | Ga0070664_100046197 | 3300005564 | Bacteria | 3678 |
| 102 | Ga0070664_100065924 | 3300005564 | Bacteria | 3091 |
| 103 | Ga0068857_100096709 | 3300005577 | Bacteria | 2646 |
| 104 | Ga0068857_100228136 | 3300005577 | Bacteria | 1703 |
| 105 | Ga0068857_100657192 | 3300005577 | Bacteria | 994 |
| 106 | Ga0068854_100315945 | 3300005578 | Bacteria | 1268 |
| 107 | Ga0068856_100067507 | 3300005614 | Bacteria | 3534 |
| 108 | Ga0068856_100073152 | 3300005614 | Bacteria | 3394 |
| 109 | Ga0068856_100400290 | 3300005614 | Bacteria | 1393 |
| 110 | Ga0070702_100010381 | 3300005615 | Bacteria | 4585 |
| 111 | Ga0070702_100051411 | 3300005615 | Bacteria | 2359 |
| 112 | Ga0070702_100331883 | 3300005615 | Bacteria | 1064 |
| 113 | Ga0068852_100052086 | 3300005616 | Bacteria | 3517 |
| 114 | Ga0068852_100184390 | 3300005616 | Bacteria | 1964 |
| 115 | Ga0068859_100450296 | 3300005617 | Bacteria | 1383 |
| 116 | Ga0068859_100652234 | 3300005617 | Bacteria | 1145 |
| 117 | Ga0068864_100037091 | 3300005618 | Bacteria | 4158 |
| 118 | Ga0068864_100448392 | 3300005618 | Bacteria | 1234 |
| 119 | Ga0068866_10004480 | 3300005718 | Bacteria | 5730 |
| 120 | Ga0068866_10016550 | 3300005718 | Bacteria | 3298 |
| 121 | Ga0068866_10295188 | 3300005718 | Bacteria | 1010 |
| 122 | Ga0068861_100031949 | 3300005719 | Bacteria | 3872 |
| 123 | Ga0068870_10021346 | 3300005840 | Bacteria | 3166 |
| 124 | Ga0068860_100053178 | 3300005843 | Bacteria | 3851 |
| 125 | Ga0068860_100163892 | 3300005843 | Bacteria | 2145 |
| 126 | Ga0081455_10046024 | 3300005937 | Bacteria | 3790 |
| 127 | Ga0081455_10055028 | 3300005937 | Bacteria | 3387 |
| 128 | Ga0081455_10133349 | 3300005937 | Bacteria | 1939 |
| 129 | Ga0081540_1016232 | 3300005983 | Bacteria | 4672 |
| 130 | Ga0081539_10027034 | 3300005985 | Bacteria | 3643 |
| 131 | Ga0081539_10027050 | 3300005985 | Bacteria | 3641 |
| 132 | Ga0081539_10027923 | 3300005985 | Bacteria | 3561 |
| 133 | Ga0081539_10028627 | 3300005985 | Bacteria | 3499 |
| 134 | Ga0081539_10028691 | 3300005985 | Bacteria | 3495 |
| 135 | Ga0081539_10033901 | 3300005985 | Bacteria | 3099 |
| 136 | Ga0081539_10037314 | 3300005985 | Bacteria | 2896 |
| 137 | Ga0081539_10104474 | 3300005985 | Bacteria | 1437 |
| 138 | Ga0081539_10138062 | 3300005985 | Bacteria | 1188 |
| 139 | Ga0070717_10027374 | 3300006028 | Bacteria | 4556 |
| 140 | Ga0070717_10105493 | 3300006028 | Bacteria | 2398 |
| 141 | Ga0070717_10168116 | 3300006028 | Bacteria | 1906 |
| 142 | Ga0070717_10358572 | 3300006028 | Bacteria | 1304 |
| 143 | Ga0070717_10369213 | 3300006028 | Bacteria | 1285 |
| 144 | Ga0070716_100347891 | 3300006173 | Bacteria | 1048 |
| 145 | Ga0070712_100039606 | 3300006175 | Bacteria | 3226 |
| 146 | Ga0070712_100048743 | 3300006175 | Bacteria | 2938 |
| 147 | Ga0070712_100252262 | 3300006175 | Bacteria | 1410 |
| 148 | Ga0070712_100511471 | 3300006175 | Bacteria | 1008 |
| 149 | Ga0068871_100165677 | 3300006358 | Bacteria | 1892 |
| 150 | Ga0068871_100197056 | 3300006358 | Bacteria | 1737 |
| 151 | Ga0068871_100364193 | 3300006358 | Bacteria | 1281 |
| 152 | Ga0075428_100007835 | 3300006844 | Bacteria | 11838 |
| 153 | Ga0075428_100717465 | 3300006844 | Bacteria | 1065 |
| 154 | Ga0075430_100005412 | 3300006846 | Bacteria | 10783 |
| 155 | Ga0075430_100047964 | 3300006846 | Bacteria | 3606 |
| 156 | Ga0075430_100049169 | 3300006846 | Bacteria | 3559 |
| 157 | Ga0075431_100077047 | 3300006847 | Bacteria | 3441 |
| 158 | Ga0075431_100078596 | 3300006847 | Bacteria | 3405 |
| 159 | Ga0075431_100113627 | 3300006847 | Bacteria | 2795 |
| 160 | Ga0075431_100630831 | 3300006847 | Bacteria | 1053 |
| 161 | Ga0075434_100186487 | 3300006871 | Bacteria | 2095 |
| 162 | Ga0075429_100001408 | 3300006880 | Bacteria | 19699 |
| 163 | Ga0075429_100039518 | 3300006880 | Bacteria | 4106 |
| 164 | Ga0075429_100048169 | 3300006880 | Bacteria | 3707 |
| 165 | Ga0068865_100012409 | 3300006881 | Bacteria | 5361 |
| 166 | Ga0068865_100244756 | 3300006881 | Bacteria | 1413 |
| 167 | Ga0068865_100349070 | 3300006881 | Bacteria | 1198 |
| 168 | Ga0097620_100450263 | 3300006931 | Bacteria | 1383 |
| 169 | Ga0097620_100652244 | 3300006931 | Bacteria | 1145 |
| 170 | Ga0075435_100114159 | 3300007076 | Bacteria | 2249 |
| 171 | Ga0099794_10011259 | 3300007265 | Bacteria | 3824 |
| 172 | Ga0099794_10128931 | 3300007265 | Bacteria | 1276 |
| 173 | Ga0105244_10046359 | 3300009036 | Bacteria | 2233 |
| 174 | Ga0105240_10156885 | 3300009093 | Bacteria | 2706 |
| 175 | Ga0105245_10061183 | 3300009098 | Bacteria | 3393 |
| 176 | Ga0105245_10156140 | 3300009098 | Bacteria | 2161 |
| 177 | Ga0105245_10250315 | 3300009098 | Bacteria | 1721 |
| 178 | Ga0105247_10023037 | 3300009101 | Bacteria | 3750 |
| 179 | Ga0105247_10026549 | 3300009101 | Bacteria | 3498 |
| 180 | Ga0114129_10036834 | 3300009147 | Bacteria | 6908 |
| 181 | Ga0114129_10048530 | 3300009147 | Bacteria | 5965 |
| 182 | Ga0114129_10121047 | 3300009147 | Bacteria | 3602 |
| 183 | Ga0114129_10381182 | 3300009147 | Bacteria | 1862 |
| 184 | Ga0114129_10442441 | 3300009147 | Bacteria | 1706 |
| 185 | Ga0105243_10109285 | 3300009148 | Bacteria | 2310 |
| 186 | Ga0105243_10138090 | 3300009148 | Bacteria | 2076 |
| 187 | Ga0105243_10194859 | 3300009148 | Bacteria | 1773 |
| 188 | Ga0105243_10203306 | 3300009148 | Bacteria | 1739 |
| 189 | Ga0105243_10537983 | 3300009148 | Bacteria | 1114 |
| 190 | Ga0105241_10280460 | 3300009174 | Bacteria | 1423 |
| 191 | Ga0105241_10476137 | 3300009174 | Bacteria | 1109 |
| 192 | Ga0105242_10445990 | 3300009176 | Bacteria | 1219 |
| 193 | Ga0105242_10646833 | 3300009176 | Bacteria | 1028 |
| 194 | Ga0105248_10082123 | 3300009177 | Bacteria | 3623 |
| 195 | Ga0105237_10142930 | 3300009545 | Bacteria | 2387 |
| 196 | Ga0105237_10242964 | 3300009545 | Bacteria | 1802 |
| 197 | Ga0105237_10458711 | 3300009545 | Bacteria | 1280 |
| 198 | Ga0105237_10481336 | 3300009545 | Bacteria | 1247 |
| 199 | Ga0105238_10047852 | 3300009551 | Bacteria | 4310 |
| 200 | Ga0105238_10065522 | 3300009551 | Bacteria | 3634 |
| 201 | Ga0105238_10440816 | 3300009551 | Bacteria | 1299 |
| 202 | Ga0105238_10542253 | 3300009551 | Bacteria | 1167 |
| 203 | Ga0105249_10317858 | 3300009553 | Bacteria | 1567 |
| 204 | Ga0105249_10333136 | 3300009553 | Bacteria | 1532 |
| 205 | Ga0105249_10737029 | 3300009553 | Bacteria | 1047 |
| 206 | Ga0099796_10027687 | 3300010159 | Bacteria | 1813 |
| 207 | Ga0105239_10564865 | 3300010375 | Bacteria | 1296 |
| 208 | Ga0105239_10572403 | 3300010375 | Bacteria | 1287 |
| 209 | Ga0105246_10290642 | 3300011119 | Bacteria | 1315 |
| 210 | Ga0157369_10083360 | 3300013105 | Bacteria | 3420 |
| 211 | Ga0157369_10114812 | 3300013105 | Bacteria | 2859 |
| 212 | Ga0157369_10844467 | 3300013105 | Bacteria | 940 |
| 213 | Ga0157374_10435322 | 3300013296 | Bacteria | 1311 |
| 214 | Ga0157378_10056522 | 3300013297 | Bacteria | 3497 |
| 215 | Ga0157378_10244000 | 3300013297 | Bacteria | 1717 |
| 216 | Ga0163162_10139462 | 3300013306 | Bacteria | 2537 |
| 217 | Ga0157372_10067740 | 3300013307 | Bacteria | 4012 |
| 218 | Ga0157372_10102892 | 3300013307 | Bacteria | 3263 |
| 219 | Ga0157375_10560112 | 3300013308 | Bacteria | 1304 |
| 220 | Ga0157380_10308200 | 3300014326 | Bacteria | 1462 |
| 221 | Ga0157380_10483720 | 3300014326 | Bacteria | 1198 |
| 222 | Ga0157380_10562671 | 3300014326 | Bacteria | 1121 |
| 223 | Ga0182008_10019877 | 3300014497 | Bacteria | 3462 |
| 224 | Ga0157379_10031533 | 3300014968 | Bacteria | 4722 |
| 225 | Ga0157376_10047951 | 3300014969 | Bacteria | 3529 |
| 226 | Ga0157376_10049063 | 3300014969 | Bacteria | 3496 |
| 227 | Ga0157376_10150257 | 3300014969 | Bacteria | 2100 |
| 228 | Ga0163161_10300191 | 3300017792 | Bacteria | 1265 |
| 229 | Ga0206354_11267655 | 3300020081 | Bacteria | 3279 |
| 230 | Ga0206354_11647855 | 3300020081 | Bacteria | 3109 |
| 231 | Ga0206353_10402092 | 3300020082 | Bacteria | 3893 |
| 232 | Ga0206353_10772945 | 3300020082 | Bacteria | 4257 |
| 233 | Ga0206353_11026265 | 3300020082 | Bacteria | 1206 |
| 234 | Ga0213873_10000235 | 3300021358 | Bacteria | 9759 |
| 235 | Ga0213876_10023868 | 3300021384 | Bacteria | 3229 |
| 236 | Ga0213876_10188496 | 3300021384 | Bacteria | 1097 |
| 237 | Ga0213875_10003575 | 3300021388 | Bacteria | 8818 |
| 238 | Ga0213875_10004856 | 3300021388 | Bacteria | 7300 |
| 239 | Ga0213875_10198406 | 3300021388 | Bacteria | 944 |
| 240 | Ga0213871_10066111 | 3300021441 | Bacteria | 1014 |
| 241 | Ga0207656_10086684 | 3300025321 | Bacteria | 1415 |
| 242 | Ga0207653_10093688 | 3300025885 | Bacteria | 1055 |
| 243 | Ga0207692_10022999 | 3300025898 | Bacteria | 2877 |
| 244 | Ga0207692_10111111 | 3300025898 | Bacteria | 1520 |
| 245 | Ga0207692_10165905 | 3300025898 | Bacteria | 1276 |
| 246 | Ga0207692_10318251 | 3300025898 | Bacteria | 951 |
| 247 | Ga0207692_10350976 | 3300025898 | Bacteria | 909 |
| 248 | Ga0207710_10013377 | 3300025900 | Bacteria | 3454 |
| 249 | Ga0207688_10024196 | 3300025901 | Bacteria | 3329 |
| 250 | Ga0207688_10096311 | 3300025901 | Bacteria | 1704 |
| 251 | Ga0207680_10258385 | 3300025903 | Bacteria | 1205 |
| 252 | Ga0207647_10120303 | 3300025904 | Bacteria | 1548 |
| 253 | Ga0207647_10234138 | 3300025904 | Bacteria | 1056 |
| 254 | Ga0207699_10024684 | 3300025906 | Bacteria | 3290 |
| 255 | Ga0207699_10093258 | 3300025906 | Bacteria | 1895 |
| 256 | Ga0207699_10252727 | 3300025906 | Bacteria | 1215 |
| 257 | Ga0207643_10192186 | 3300025908 | Bacteria | 1239 |
| 258 | Ga0207705_10010177 | 3300025909 | Bacteria | 6843 |
| 259 | Ga0207705_10023492 | 3300025909 | Bacteria | 4398 |
| 260 | Ga0207684_10043777 | 3300025910 | Bacteria | 3796 |
| 261 | Ga0207684_10044680 | 3300025910 | Bacteria | 3757 |
| 262 | Ga0207684_10213484 | 3300025910 | Bacteria | 1665 |
| 263 | Ga0207684_10232445 | 3300025910 | Bacteria | 1591 |
| 264 | Ga0207707_10026561 | 3300025912 | Bacteria | 5061 |
| 265 | Ga0207707_10082845 | 3300025912 | Bacteria | 2801 |
| 266 | Ga0207695_10119327 | 3300025913 | Bacteria | 2607 |
| 267 | Ga0207671_10037508 | 3300025914 | Bacteria | 3594 |
| 268 | Ga0207671_10192524 | 3300025914 | Bacteria | 1590 |
| 269 | Ga0207671_10328721 | 3300025914 | Bacteria | 1210 |
| 270 | Ga0207693_10031545 | 3300025915 | Bacteria | 4187 |
| 271 | Ga0207693_10040116 | 3300025915 | Bacteria | 3687 |
| 272 | Ga0207693_10040842 | 3300025915 | Bacteria | 3654 |
| 273 | Ga0207693_10095242 | 3300025915 | Bacteria | 2334 |
| 274 | Ga0207693_10342734 | 3300025915 | Bacteria | 1170 |
| 275 | Ga0207693_10396909 | 3300025915 | Bacteria | 1078 |
| 276 | Ga0207663_10016253 | 3300025916 | Bacteria | 4121 |
| 277 | Ga0207663_10048792 | 3300025916 | Bacteria | 2622 |
| 278 | Ga0207663_10202237 | 3300025916 | Bacteria | 1434 |
| 279 | Ga0207663_10249811 | 3300025916 | Bacteria | 1305 |
| 280 | Ga0207663_10271431 | 3300025916 | Bacteria | 1256 |
| 281 | Ga0207660_10034720 | 3300025917 | Bacteria | 3496 |
| 282 | Ga0207660_10120064 | 3300025917 | Bacteria | 1990 |
| 283 | Ga0207662_10086825 | 3300025918 | Bacteria | 1918 |
| 284 | Ga0207662_10274738 | 3300025918 | Bacteria | 1113 |
| 285 | Ga0207657_10039762 | 3300025919 | Bacteria | 4175 |
| 286 | Ga0207649_10028963 | 3300025920 | Bacteria | 3267 |
| 287 | Ga0207652_10001454 | 3300025921 | Bacteria | 20971 |
| 288 | Ga0207652_10006068 | 3300025921 | Bacteria | 9777 |
| 289 | Ga0207652_10127750 | 3300025921 | Bacteria | 2265 |
| 290 | Ga0207646_10027639 | 3300025922 | Bacteria | 5171 |
| 291 | Ga0207646_10029503 | 3300025922 | Bacteria | 4983 |
| 292 | Ga0207646_10048680 | 3300025922 | Bacteria | 3799 |
| 293 | Ga0207646_10055390 | 3300025922 | Bacteria | 3545 |
| 294 | Ga0207646_10060764 | 3300025922 | Bacteria | 3374 |
| 295 | Ga0207646_10131536 | 3300025922 | Bacteria | 2252 |
| 296 | Ga0207646_10352859 | 3300025922 | Bacteria | 1329 |
| 297 | Ga0207694_10067935 | 3300025924 | Bacteria | 2783 |
| 298 | Ga0207694_10431909 | 3300025924 | Bacteria | 1098 |
| 299 | Ga0207687_10038200 | 3300025927 | Bacteria | 3280 |
| 300 | Ga0207687_10108256 | 3300025927 | Bacteria | 2058 |
| 301 | Ga0207687_10360260 | 3300025927 | Bacteria | 1187 |
| 302 | Ga0207700_10053320 | 3300025928 | Bacteria | 3029 |
| 303 | Ga0207664_10050606 | 3300025929 | Bacteria | 3277 |
| 304 | Ga0207664_10077862 | 3300025929 | Bacteria | 2688 |
| 305 | Ga0207644_10361995 | 3300025931 | Bacteria | 1180 |
| 306 | Ga0207690_10019587 | 3300025932 | Bacteria | 4170 |
| 307 | Ga0207690_10283360 | 3300025932 | Bacteria | 1291 |
| 308 | Ga0207706_10132764 | 3300025933 | Bacteria | 2190 |
| 309 | Ga0207686_10086607 | 3300025934 | Bacteria | 2058 |
| 310 | Ga0207709_10031715 | 3300025935 | Bacteria | 3089 |
| 311 | Ga0207709_10141572 | 3300025935 | Bacteria | 1654 |
| 312 | Ga0207670_10071647 | 3300025936 | Bacteria | 2397 |
| 313 | Ga0207669_10022132 | 3300025937 | Bacteria | 3370 |
| 314 | Ga0207669_10110367 | 3300025937 | Bacteria | 1842 |
| 315 | Ga0207669_10252292 | 3300025937 | Bacteria | 1314 |
| 316 | Ga0207704_10187958 | 3300025938 | Bacteria | 1500 |
| 317 | Ga0207665_10026734 | 3300025939 | Bacteria | 3811 |
| 318 | Ga0207665_10143945 | 3300025939 | Bacteria | 1702 |
| 319 | Ga0207691_10040802 | 3300025940 | Bacteria | 4288 |
| 320 | Ga0207711_10057476 | 3300025941 | Bacteria | 3345 |
| 321 | Ga0207711_10230056 | 3300025941 | Unclassified | 1698 |
| 322 | Ga0207689_10052403 | 3300025942 | Bacteria | 3362 |
| 323 | Ga0207689_10110788 | 3300025942 | Bacteria | 2256 |
| 324 | Ga0207661_10000736 | 3300025944 | Bacteria | 21239 |
| 325 | Ga0207661_10005583 | 3300025944 | Bacteria | 8870 |
| 326 | Ga0207661_10346683 | 3300025944 | Bacteria | 1339 |
| 327 | Ga0207679_10023434 | 3300025945 | Bacteria | 4222 |
| 328 | Ga0207679_10697175 | 3300025945 | Bacteria | 921 |
| 329 | Ga0207667_10068174 | 3300025949 | Bacteria | 3705 |
| 330 | Ga0207667_10084188 | 3300025949 | Bacteria | 3292 |
| 331 | Ga0207651_10313774 | 3300025960 | Bacteria | 1308 |
| 332 | Ga0207712_10014393 | 3300025961 | Bacteria | 5089 |
| 333 | Ga0207712_10446524 | 3300025961 | Bacteria | 1096 |
| 334 | Ga0207668_10030048 | 3300025972 | Bacteria | 3568 |
| 335 | Ga0207668_10039369 | 3300025972 | Bacteria | 3181 |
| 336 | Ga0207677_10036002 | 3300026023 | Bacteria | 3221 |
| 337 | Ga0207677_10136607 | 3300026023 | Bacteria | 1870 |
| 338 | Ga0207677_10557772 | 3300026023 | Bacteria | 999 |
| 339 | Ga0207639_10500304 | 3300026041 | Bacteria | 1110 |
| 340 | Ga0207678_10054507 | 3300026067 | Bacteria | 3444 |
| 341 | Ga0207678_10082852 | 3300026067 | Bacteria | 2744 |
| 342 | Ga0207678_10129250 | 3300026067 | Bacteria | 2154 |
| 343 | Ga0207678_10259046 | 3300026067 | Bacteria | 1491 |
| 344 | Ga0207678_10264631 | 3300026067 | Bacteria | 1474 |
| 345 | Ga0207708_10224253 | 3300026075 | Bacteria | 1507 |
| 346 | Ga0207702_10046581 | 3300026078 | Bacteria | 3650 |
| 347 | Ga0207702_10058070 | 3300026078 | Bacteria | 3292 |
| 348 | Ga0207702_10113460 | 3300026078 | Bacteria | 2413 |
| 349 | Ga0207702_10390651 | 3300026078 | Bacteria | 1340 |
| 350 | Ga0207702_10474290 | 3300026078 | Bacteria | 1217 |
| 351 | Ga0207641_10360332 | 3300026088 | Bacteria | 1388 |
| 352 | Ga0207648_10056503 | 3300026089 | Bacteria | 3425 |
| 353 | Ga0207648_10153793 | 3300026089 | Bacteria | 2030 |
| 354 | Ga0207674_10055416 | 3300026116 | Bacteria | 4030 |
| 355 | Ga0207674_10362289 | 3300026116 | Bacteria | 1401 |
| 356 | Ga0207674_10488679 | 3300026116 | Bacteria | 1190 |
| 357 | Ga0207674_10639867 | 3300026116 | Bacteria | 1027 |
| 358 | Ga0207675_100053755 | 3300026118 | Bacteria | 3757 |
| 359 | Ga0207675_100487760 | 3300026118 | Bacteria | 1225 |
| 360 | Ga0207675_100766270 | 3300026118 | Bacteria | 977 |
| 361 | Ga0207683_10007141 | 3300026121 | Bacteria | 9574 |
| 362 | Ga0207683_10059664 | 3300026121 | Bacteria | 3351 |
| 363 | Ga0207683_10226867 | 3300026121 | Bacteria | 1703 |
| 364 | Ga0207683_10326575 | 3300026121 | Bacteria | 1406 |
| 365 | Ga0207698_10046392 | 3300026142 | Bacteria | 3281 |
| 366 | Ga0207698_10151828 | 3300026142 | Bacteria | 2012 |
| 367 | Ga0207698_10276894 | 3300026142 | Bacteria | 1550 |
| 368 | Ga0209588_1004920 | 3300027671 | Bacteria | 3798 |
| 369 | Ga0268266_10055029 | 3300028379 | Bacteria | 3420 |
| 370 | Ga0268266_10344571 | 3300028379 | Bacteria | 1399 |
| 371 | Ga0268265_10053062 | 3300028380 | Bacteria | 3070 |
| 372 | Ga0268265_10157768 | 3300028380 | Bacteria | 1923 |
| 373 | Ga0268264_10049641 | 3300028381 | Bacteria | 3492 |
| 374 | Ga0307515_10002209 | 3300028794 | Bacteria | 42732 |
| 375 | Ga0307515_10090632 | 3300028794 | Bacteria | 3832 |
| 376 | Ga0307515_10112242 | 3300028794 | Bacteria | 3172 |
| 377 | Ga0307515_10114672 | 3300028794 | Bacteria | 3111 |
| 378 | Ga0307515_10351118 | 3300028794 | Bacteria | 1121 |
| 379 | Ga0307511_10002064 | 3300030521 | Bacteria | 21039 |
| 380 | Ga0307511_10036041 | 3300030521 | Bacteria | 4304 |
| 381 | Ga0307512_10053716 | 3300030522 | Bacteria | 3200 |
| 382 | Ga0307512_10053898 | 3300030522 | Bacteria | 3191 |
| 383 | Ga0265340_10009479 | 3300031247 | Bacteria | 5223 |
| 384 | Ga0307513_10026939 | 3300031456 | Bacteria | 6612 |
| 385 | Ga0307513_10190978 | 3300031456 | Bacteria | 1900 |
| 386 | Ga0307509_10069301 | 3300031507 | Bacteria | 3687 |
| 387 | Ga0307408_100117638 | 3300031548 | Bacteria | 2053 |
| 388 | Ga0307408_100232297 | 3300031548 | Bacteria | 1511 |
| 389 | Ga0307508_10006509 | 3300031616 | Bacteria | 10985 |
| 390 | Ga0307508_10049014 | 3300031616 | Bacteria | 3762 |
| 391 | Ga0307508_10053134 | 3300031616 | Bacteria | 3597 |
| 392 | Ga0307508_10233287 | 3300031616 | Bacteria | 1438 |
| 393 | Ga0307508_10276703 | 3300031616 | Bacteria | 1272 |
| 394 | Ga0307514_10044795 | 3300031649 | Bacteria | 3464 |
| 395 | Ga0316576_10039186 | 3300031727 | Bacteria | 3401 |
| 396 | Ga0307516_10009926 | 3300031730 | Bacteria | 10546 |
| 397 | Ga0307516_10064671 | 3300031730 | Bacteria | 3536 |
| 398 | Ga0307405_10020624 | 3300031731 | Bacteria | 3686 |
| 399 | Ga0307405_10026076 | 3300031731 | Bacteria | 3366 |
| 400 | Ga0307405_10142462 | 3300031731 | Bacteria | 1674 |
| 401 | Ga0307405_10366485 | 3300031731 | Bacteria | 1117 |
| 402 | Ga0307413_10023417 | 3300031824 | Bacteria | 3346 |
| 403 | Ga0307518_10037558 | 3300031838 | Bacteria | 3521 |
| 404 | Ga0307410_10032038 | 3300031852 | Bacteria | 3378 |
| 405 | Ga0307410_10146402 | 3300031852 | Bacteria | 1753 |
| 406 | Ga0307410_10208165 | 3300031852 | Bacteria | 1497 |
| 407 | Ga0307410_10287067 | 3300031852 | Bacteria | 1293 |
| 408 | Ga0307410_10334157 | 3300031852 | Bacteria | 1206 |
| 409 | Ga0307406_10019032 | 3300031901 | Bacteria | 4024 |
| 410 | Ga0307406_10030380 | 3300031901 | Bacteria | 3280 |
| 411 | Ga0307406_10133532 | 3300031901 | Bacteria | 1746 |
| 412 | Ga0307406_10310405 | 3300031901 | Bacteria | 1216 |
| 413 | Ga0307406_10468630 | 3300031901 | Bacteria | 1014 |
| 414 | Ga0307407_10018141 | 3300031903 | Bacteria | 3551 |
| 415 | Ga0307407_10056493 | 3300031903 | Bacteria | 2273 |
| 416 | Ga0307407_10295515 | 3300031903 | Bacteria | 1127 |
| 417 | Ga0307407_10384176 | 3300031903 | Bacteria | 1003 |
| 418 | Ga0307412_10071190 | 3300031911 | Bacteria | 2373 |
| 419 | Ga0307409_100032151 | 3300031995 | Bacteria | 3799 |
| 420 | Ga0307409_100032652 | 3300031995 | Bacteria | 3777 |
| 421 | Ga0307409_100039951 | 3300031995 | Bacteria | 3487 |
| 422 | Ga0307409_100040065 | 3300031995 | Bacteria | 3483 |
| 423 | Ga0307409_100244504 | 3300031995 | Bacteria | 1636 |
| 424 | Ga0307409_100615192 | 3300031995 | Bacteria | 1075 |
| 425 | Ga0307409_100739344 | 3300031995 | Bacteria | 987 |
| 426 | Ga0307416_100040611 | 3300032002 | Bacteria | 3616 |
| 427 | Ga0307416_100045313 | 3300032002 | Bacteria | 3462 |
| 428 | Ga0307416_100123145 | 3300032002 | Bacteria | 2317 |
| 429 | Ga0307416_100222627 | 3300032002 | Bacteria | 1811 |
| 430 | Ga0307416_100922055 | 3300032002 | Bacteria | 974 |
| 431 | Ga0307414_10045665 | 3300032004 | Bacteria | 3002 |
| 432 | Ga0307414_10054669 | 3300032004 | Bacteria | 2791 |
| 433 | Ga0307414_10071440 | 3300032004 | Bacteria | 2504 |
| 434 | Ga0307414_10127246 | 3300032004 | Bacteria | 1971 |
| 435 | Ga0307411_10021558 | 3300032005 | Bacteria | 3773 |
| 436 | Ga0307411_10197168 | 3300032005 | Bacteria | 1543 |
| 437 | Ga0307415_100030630 | 3300032126 | Bacteria | 3456 |
| 438 | Ga0307415_100031865 | 3300032126 | Bacteria | 3402 |
| 439 | Ga0307415_100149315 | 3300032126 | Bacteria | 1797 |
| 440 | Ga0307415_100355340 | 3300032126 | Bacteria | 1235 |
| 441 | Ga0307415_100489854 | 3300032126 | Bacteria | 1072 |
| 442 | Ga0307415_100515422 | 3300032126 | Bacteria | 1048 |
| 443 | Ga0316583_10067278 | 3300032133 | Bacteria | 1254 |
| 444 | Ga0307507_10050067 | 3300033179 | Bacteria | 4037 |
| 445 | Ga0307507_10064823 | 3300033179 | Bacteria | 3367 |
| 446 | Ga0307507_10071496 | 3300033179 | Bacteria | 3136 |
| 447 | Ga0307510_10168221 | 3300033180 | Bacteria | 1776 |
| 448 | Ga0373926_0004115 | 3300035083 | Bacteria | 4752 |
| 449 | Ga0373926_0039093 | 3300035083 | Bacteria | 1691 |
| 450 | Ga0373928_0035474 | 3300035084 | Bacteria | 1124 |
| 451 | Ga0373934_0004664 | 3300035086 | Bacteria | 5066 |
| 452 | Ga0373934_0011016 | 3300035086 | Bacteria | 3401 |
| 453 | Ga0373934_0073518 | 3300035086 | Bacteria | 1369 |
| 454 | Ga0373944_0019136 | 3300035089 | Bacteria | 1962 |
| 455 | Ga0373944_0057680 | 3300035089 | Bacteria | 1238 |
| 456 | Ga0373944_0064781 | 3300035089 | Bacteria | 1179 |
| 457 | Ga0373923_0000238 | 3300035111 | Bacteria | 11649 |
| 458 | Ga0373923_0009354 | 3300035111 | Bacteria | 3534 |
| 459 | Ga0373923_0189094 | 3300035111 | Bacteria | 948 |
| 460 | Ga0373932_0068324 | 3300035112 | Bacteria | 1096 |
| 461 | Ga0373936_0000987 | 3300035113 | Bacteria | 10138 |
| 462 | Ga0373936_0006981 | 3300035113 | Bacteria | 4250 |
| 463 | Ga0373936_0231747 | 3300035113 | Bacteria | 821 |
| 464 | Ga0373939_0108731 | 3300035114 | Bacteria | 962 |
| 465 | Ga0373945_0000634 | 3300035116 | Bacteria | 10116 |
| 466 | Ga0373945_0108572 | 3300035116 | Bacteria | 1093 |
| 467 | Ga0373945_0126090 | 3300035116 | Bacteria | 1022 |
| 468 | Ga0373945_0151980 | 3300035116 | Bacteria | 939 |
| 469 | Ga0373953_0004165 | 3300035117 | Bacteria | 4587 |
| 470 | Ga0373953_0006292 | 3300035117 | Bacteria | 3903 |
| 471 | Ga0373953_0007249 | 3300035117 | Bacteria | 3706 |
| 472 | Ga0373953_0060333 | 3300035117 | Bacteria | 1550 |
| 473 | Ga0373954_0002275 | 3300035118 | Bacteria | 7997 |
| 474 | Ga0373954_0014690 | 3300035118 | Bacteria | 3493 |
| 475 | Ga0373954_0028969 | 3300035118 | Bacteria | 2548 |
| 476 | Ga0373954_0113900 | 3300035118 | Bacteria | 1309 |
| 477 | Ga0373956_0004343 | 3300035119 | Bacteria | 5686 |
| 478 | Ga0373956_0005108 | 3300035119 | Bacteria | 5251 |
| 479 | Ga0373956_0011804 | 3300035119 | Bacteria | 3606 |
| 480 | Ga0373956_0014118 | 3300035119 | Bacteria | 3331 |
| 481 | Ga0373956_0085017 | 3300035119 | Bacteria | 1455 |
| 482 | Ga0373956_0175973 | 3300035119 | Bacteria | 1011 |
| 483 | Ga0373957_0005897 | 3300035120 | Bacteria | 3827 |
| 484 | Ga0373957_0006343 | 3300035120 | Bacteria | 3719 |
| 485 | Ga0373957_0008553 | 3300035120 | Bacteria | 3320 |
| 486 | Ga0373957_0069730 | 3300035120 | Bacteria | 1373 |
| 487 | Ga0373960_0049885 | 3300035121 | Bacteria | 1239 |
| 488 | Ga0373960_0058197 | 3300035121 | Bacteria | 1165 |
| 489 | Ga0373943_0004593 | 3300035170 | Bacteria | 6239 |
| 490 | Ga0373943_0037559 | 3300035170 | Bacteria | 2325 |
| 491 | Ga0373943_0144176 | 3300035170 | Bacteria | 1285 |
| 492 | Ga0373943_0169212 | 3300035170 | Bacteria | 1195 |
| 493 | Ga0373946_0001094 | 3300035171 | Bacteria | 9358 |
| 494 | Ga0373946_0022069 | 3300035171 | Bacteria | 2475 |
| 495 | Ga0373946_0028375 | 3300035171 | Bacteria | 2219 |
| 496 | Ga0373946_0066453 | 3300035171 | Bacteria | 1546 |
| 497 | Ga0373946_0134662 | 3300035171 | Bacteria | 1140 |
| 498 | Ga0373955_0015994 | 3300035172 | Bacteria | 3684 |
| 499 | Ga0373955_0049418 | 3300035172 | Bacteria | 2283 |
| 500 | Ga0373955_0053159 | 3300035172 | Bacteria | 2210 |
| 501 | Ga0373955_0187250 | 3300035172 | Bacteria | 1229 |
| 502 | Ga0373955_0307854 | 3300035172 | Bacteria | 956 |
| 503 | Ga0316574_0057625 | 3300035398 | Bacteria | 2433 |
| 504 | Ga0373924_0002738 | 3300035410 | Bacteria | 5954 |
| 505 | Ga0373924_0008098 | 3300035410 | Bacteria | 3807 |
| 506 | Ga0373924_0009195 | 3300035410 | Bacteria | 3617 |
| 507 | Ga0373924_0069586 | 3300035410 | Bacteria | 1483 |
| 508 | Ga0373924_0091147 | 3300035410 | Bacteria | 1304 |
| 509 | Ga0373924_0102108 | 3300035410 | Bacteria | 1234 |
| 510 | Ga0373931_0192478 | 3300035691 | Bacteria | 1214 |
| 511 | Ga0373935_0005788 | 3300035692 | Bacteria | 7312 |
| 512 | Ga0373935_0013913 | 3300035692 | Bacteria | 4858 |
| 513 | Ga0373935_0016469 | 3300035692 | Bacteria | 4472 |
| 514 | Ga0373927_0002592 | 3300035695 | Bacteria | 13178 |
| 515 | Ga0373927_0035790 | 3300035695 | Bacteria | 3229 |
| 516 | Ga0373933_0006148 | 3300035724 | Bacteria | 6535 |
| 517 | Ga0373933_0007518 | 3300035724 | Bacteria | 5951 |
| 518 | Ga0373933_0021414 | 3300035724 | Bacteria | 3672 |
| 519 | Ga0373933_0059833 | 3300035724 | Bacteria | 2295 |
| 520 | Ga0373933_0092354 | 3300035724 | Bacteria | 1869 |
| 521 | Ga0373947_0007335 | 3300035725 | Bacteria | 6383 |
| 522 | Ga0373947_0028950 | 3300035725 | Bacteria | 3249 |
| 523 | Ga0373947_0075951 | 3300035725 | Bacteria | 2070 |
| 524 | Ga0373947_0119031 | 3300035725 | Bacteria | 1676 |
| 525 | Ga0373947_0137869 | 3300035725 | Bacteria | 1562 |
| 526 | Ga0373937_0023747 | 3300036401 | Bacteria | 5526 |
| 527 | Ga0373937_0046519 | 3300036401 | Bacteria | 3968 |
| 528 | Ga0373937_0064010 | 3300036401 | Bacteria | 3382 |
| 529 | Ga0373937_0066270 | 3300036401 | Bacteria | 3325 |
| 530 | Ga0373937_0066969 | 3300036401 | Bacteria | 3308 |
| 531 | Ga0373937_0134224 | 3300036401 | Bacteria | 2314 |
| 532 | Ga0373937_0144486 | 3300036401 | Bacteria | 2226 |
| 533 | Ga0373937_0335025 | 3300036401 | Bacteria | 1432 |
| 534 | Ga0316584_0046991 | 3300036712 | Bacteria | 3224 |
| 535 | Ga0373925_0013705 | 3300037068 | Bacteria | 5869 |
| 536 | Ga0373925_0014822 | 3300037068 | Bacteria | 5634 |
| 537 | Ga0373925_0027143 | 3300037068 | Bacteria | 4193 |
| 538 | Ga0373925_0029939 | 3300037068 | Bacteria | 3993 |
| 539 | Ga0373925_0144892 | 3300037068 | Bacteria | 1862 |
| 540 | Ga0373925_0238169 | 3300037068 | Bacteria | 1457 |
| 541 | Ga0373925_0327546 | 3300037068 | Bacteria | 1240 |
| 542 | Ga0373925_0525326 | 3300037068 | Bacteria | 972 |
| 543 | Ga0373925_0559909 | 3300037068 | Bacteria | 940 |
| 544 | Ga0373925_0701513 | 3300037068 | Bacteria | 834 |
| 545 | Ga0395899_0212376 | 3300037312 | Bacteria | 1344 |
| 546 | Ga0395900_0126398 | 3300037418 | Bacteria | 2622 |
| 547 | Ga0395900_0294937 | 3300037418 | Bacteria | 1609 |
| 548 | Ga0395900_0354824 | 3300037418 | Bacteria | 1439 |
| 549 | Ga0395898_0059635 | 3300037466 | Bacteria | 3711 |
| 550 | Ga0395898_0074781 | 3300037466 | Bacteria | 3272 |
| 551 | Ga0395898_0168393 | 3300037466 | Bacteria | 2094 |
| 552 | Ga0395898_0311647 | 3300037466 | Bacteria | 1501 |
| 553 | Ga0395898_0359636 | 3300037466 | Bacteria | 1388 |
| 554 | Ga0395905_0041107 | 3300037471 | Bacteria | 4338 |
| 555 | Ga0395905_0194093 | 3300037471 | Bacteria | 1904 |
| 556 | Ga0395905_0342426 | 3300037471 | Bacteria | 1386 |
| 557 | Ga0436364_0026190 | 3300037853 | Bacteria | 6285 |
| 558 | Ga0436364_0956857 | 3300037853 | Bacteria | 9084 |
| 559 | Ga0395901_0064160 | 3300038443 | Bacteria | 3823 |
| 560 | Ga0395901_0079582 | 3300038443 | Bacteria | 3422 |
| 561 | Ga0395901_0162870 | 3300038443 | Bacteria | 2342 |
| 562 | Ga0395901_0203195 | 3300038443 | Bacteria | 2076 |
| 563 | Ga0395901_0601460 | 3300038443 | Bacteria | 1109 |
| 564 | Ga0436365_0714895 | 3300039437 | Bacteria | 1316 |
| 565 | Ga0436365_0785871 | 3300039437 | Bacteria | 2770 |
| 566 | Ga0436365_1743964 | 3300039437 | Bacteria | 6186 |
| 567 | Ga0436360_0354775 | 3300039438 | Bacteria | 1115 |
| 568 | Ga0436361_0669121 | 3300039447 | Bacteria | 1596 |
| 569 | Ga0436363_0425289 | 3300039450 | Bacteria | 27969 |
| 570 | Ga0436363_0853423 | 3300039450 | Bacteria | 2407 |
| 571 | Ga0436363_1642401 | 3300039450 | Bacteria | 968 |
| 572 | Ga0436362_0122283 | 3300039453 | Bacteria | 14344 |
| 573 | Ga0436362_0888059 | 3300039453 | Bacteria | 944 |
| 574 | Ga0436362_1251845 | 3300039453 | Bacteria | 1278 |
| 575 | Ga0439465_0062936 | 3300041413 | Bacteria | 1232 |
| 576 | Ga0451797_1397672 | 3300041453 | Bacteria | 1209 |
| 577 | Ga0451853_1827931 | 3300041512 | Bacteria | 1164 |
| 578 | Ga0439437_005810 | 3300042000 | Bacteria | 1362 |
| 579 | Ga0439448_0005138 | 3300042005 | Bacteria | 3725 |
| 580 | Ga0439448_0006244 | 3300042005 | Bacteria | 3421 |
| 581 | Ga0439450_039612 | 3300042008 | Bacteria | 1089 |
| 582 | Ga0439451_011045 | 3300042009 | Bacteria | 1821 |
| 583 | Ga0439455_0002108 | 3300042012 | Bacteria | 3547 |
| 584 | Ga0439463_004248 | 3300042016 | Bacteria | 3595 |
| 585 | Ga0439459_0001446 | 3300042438 | Bacteria | 3499 |
| 586 | Ga0439464_0003585 | 3300042439 | Bacteria | 3931 |
| 587 | Ga0439464_0081258 | 3300042439 | Bacteria | 968 |
| 588 | Ga0439460_0004780 | 3300042461 | Bacteria | 3305 |
| 589 | Ga0439440_0017136 | 3300042993 | Bacteria | 1593 |
| 590 | Ga0466966_0029401 | 3300044684 | Bacteria | 3575 |
| 591 | Ga0466966_0029477 | 3300044684 | Bacteria | 3570 |
| 592 | Ga0466966_0077106 | 3300044684 | Bacteria | 2080 |
| 593 | Ga0466966_0093794 | 3300044684 | Bacteria | 1861 |
| 594 | Ga0466966_0108283 | 3300044684 | Bacteria | 1714 |
| 595 | Ga0466968_0218774 | 3300044735 | Bacteria | 896 |
| 596 | Ga0466970_0159449 | 3300044765 | Bacteria | 1247 |
| 597 | Ga0466959_0353394 | 3300045049 | Bacteria | 1002 |
| 598 | Ga0466959_0398249 | 3300045049 | Bacteria | 936 |
| 599 | Ga0466958_0027951 | 3300045836 | Bacteria | 3341 |
| 600 | Ga0466967_0026161 | 3300045976 | Bacteria | 4827 |
| 601 | Ga0466967_0180574 | 3300045976 | Bacteria | 1990 |
| 602 | Ga0466967_0774698 | 3300045976 | Bacteria | 952 |
| 603 | Ga0495592_0001231 | 3300046454 | Bacteria | 17772 |
| 604 | Ga0495592_0005292 | 3300046454 | Bacteria | 9510 |
| 605 | Ga0495592_0008135 | 3300046454 | Bacteria | 7877 |
| 606 | Ga0495592_0010917 | 3300046454 | Bacteria | 6852 |
| 607 | Ga0495592_0035499 | 3300046454 | Bacteria | 3757 |
| 608 | Ga0495592_0081280 | 3300046454 | Bacteria | 2343 |
| 609 | Ga0495592_0157302 | 3300046454 | Bacteria | 1566 |
| 610 | Ga0495592_0203484 | 3300046454 | Bacteria | 1334 |
| 611 | Ga0495603_0006458 | 3300046455 | Bacteria | 7022 |
| 612 | Ga0495603_0021597 | 3300046455 | Bacteria | 3898 |
| 613 | Ga0495629_0029695 | 3300046459 | Bacteria | 3877 |
| 614 | Ga0495629_0057988 | 3300046459 | Bacteria | 2707 |
| 615 | Ga0495629_0093924 | 3300046459 | Bacteria | 2093 |
| 616 | Ga0495629_0540787 | 3300046459 | Bacteria | 783 |
| 617 | Ga0495641_0020884 | 3300046461 | Bacteria | 3307 |
| 618 | Ga0495641_0023177 | 3300046461 | Bacteria | 3090 |
| 619 | Ga0495641_0056412 | 3300046461 | Bacteria | 1780 |
| 620 | Ga0495641_0060912 | 3300046461 | Bacteria | 1704 |
| 621 | Ga0495651_0001745 | 3300046462 | Bacteria | 16765 |
| 622 | Ga0495651_0008175 | 3300046462 | Bacteria | 8023 |
| 623 | Ga0495651_0013296 | 3300046462 | Bacteria | 6366 |
| 624 | Ga0495651_0025435 | 3300046462 | Bacteria | 4608 |
| 625 | Ga0495651_0041549 | 3300046462 | Bacteria | 3571 |
| 626 | Ga0495651_0044752 | 3300046462 | Bacteria | 3430 |
| 627 | Ga0495651_0044972 | 3300046462 | Bacteria | 3421 |
| 628 | Ga0495651_0197605 | 3300046462 | Bacteria | 1410 |
| 629 | Ga0495653_0035705 | 3300046463 | Bacteria | 3920 |
| 630 | Ga0495653_0038729 | 3300046463 | Bacteria | 3740 |
| 631 | Ga0495653_0090093 | 3300046463 | Bacteria | 2245 |
| 632 | Ga0495653_0090997 | 3300046463 | Bacteria | 2231 |
| 633 | Ga0495653_0191595 | 3300046463 | Bacteria | 1394 |
| 634 | Ga0495653_0243134 | 3300046463 | Bacteria | 1198 |
| 635 | Ga0495580_0008696 | 3300046472 | Bacteria | 8050 |
| 636 | Ga0495580_0020970 | 3300046472 | Bacteria | 4825 |
| 637 | Ga0495580_0166034 | 3300046472 | Bacteria | 1527 |
| 638 | Ga0495580_0256087 | 3300046472 | Bacteria | 1197 |
| 639 | Ga0495582_0011785 | 3300046473 | Bacteria | 4816 |
| 640 | Ga0495582_0023928 | 3300046473 | Bacteria | 3339 |
| 641 | Ga0495605_0041420 | 3300046474 | Bacteria | 2294 |
| 642 | Ga0495639_0014390 | 3300046475 | Bacteria | 3425 |
| 643 | Ga0495639_0028724 | 3300046475 | Bacteria | 2464 |
| 644 | Ga0495639_0048208 | 3300046475 | Bacteria | 1931 |
| 645 | Ga0495662_0001191 | 3300046476 | Bacteria | 12834 |
| 646 | Ga0495662_0008034 | 3300046476 | Bacteria | 5197 |
| 647 | Ga0495662_0018846 | 3300046476 | Bacteria | 3339 |
| 648 | Ga0495662_0071993 | 3300046476 | Bacteria | 1675 |
| 649 | Ga0495662_0107421 | 3300046476 | Bacteria | 1367 |
| 650 | Ga0495662_0121290 | 3300046476 | Bacteria | 1283 |
| 651 | Ga0495664_0002422 | 3300046477 | Bacteria | 10028 |
| 652 | Ga0495664_0005807 | 3300046477 | Bacteria | 6795 |
| 653 | Ga0495664_0011959 | 3300046477 | Bacteria | 4903 |
| 654 | Ga0495664_0019876 | 3300046477 | Bacteria | 3867 |
| 655 | Ga0495664_0020456 | 3300046477 | Bacteria | 3817 |
| 656 | Ga0495594_0010030 | 3300046499 | Bacteria | 4906 |
| 657 | Ga0495594_0021133 | 3300046499 | Bacteria | 3472 |
| 658 | Ga0495594_0064238 | 3300046499 | Bacteria | 2035 |
| 659 | Ga0495596_0014232 | 3300046500 | Bacteria | 3354 |
| 660 | Ga0495607_0008728 | 3300046501 | Bacteria | 6906 |
| 661 | Ga0495608_0004778 | 3300046511 | Bacteria | 9688 |
| 662 | Ga0495608_0022307 | 3300046511 | Bacteria | 4340 |
| 663 | Ga0495608_0031542 | 3300046511 | Bacteria | 3583 |
| 664 | Ga0495608_0140558 | 3300046511 | Bacteria | 1541 |
| 665 | Ga0495608_0207517 | 3300046511 | Bacteria | 1233 |
| 666 | Ga0495608_0371450 | 3300046511 | Bacteria | 878 |
| 667 | Ga0495616_0028158 | 3300046513 | Bacteria | 2976 |
| 668 | Ga0495618_0001441 | 3300046514 | Bacteria | 15955 |
| 669 | Ga0495618_0019153 | 3300046514 | Bacteria | 4208 |
| 670 | Ga0495618_0026478 | 3300046514 | Bacteria | 3606 |
| 671 | Ga0495618_0027022 | 3300046514 | Bacteria | 3572 |
| 672 | Ga0495618_0032106 | 3300046514 | Bacteria | 3289 |
| 673 | Ga0495618_0075312 | 3300046514 | Bacteria | 2149 |
| 674 | Ga0495628_0004659 | 3300046516 | Bacteria | 12101 |
| 675 | Ga0495628_0021899 | 3300046516 | Bacteria | 5252 |
| 676 | Ga0495628_0022533 | 3300046516 | Bacteria | 5174 |
| 677 | Ga0495628_0034756 | 3300046516 | Bacteria | 4053 |
| 678 | Ga0495628_0040076 | 3300046516 | Bacteria | 3744 |
| 679 | Ga0495628_0301658 | 3300046516 | Bacteria | 1185 |
| 680 | Ga0495628_0320156 | 3300046516 | Bacteria | 1144 |
| 681 | Ga0495628_0515777 | 3300046516 | Bacteria | 862 |
| 682 | Ga0495630_0001842 | 3300046517 | Bacteria | 14798 |
| 683 | Ga0495630_0008304 | 3300046517 | Bacteria | 7454 |
| 684 | Ga0495630_0010610 | 3300046517 | Bacteria | 6653 |
| 685 | Ga0495630_0029784 | 3300046517 | Bacteria | 4058 |
| 686 | Ga0495630_0033205 | 3300046517 | Bacteria | 3848 |
| 687 | Ga0495630_0043238 | 3300046517 | Bacteria | 3364 |
| 688 | Ga0495630_0049230 | 3300046517 | Bacteria | 3154 |
| 689 | Ga0495630_0380247 | 3300046517 | Bacteria | 1082 |
| 690 | Ga0495631_0013227 | 3300046518 | Bacteria | 4011 |
| 691 | Ga0495631_0044303 | 3300046518 | Bacteria | 1961 |
| 692 | Ga0495631_0049442 | 3300046518 | Bacteria | 1841 |
| 693 | Ga0495631_0082084 | 3300046518 | Bacteria | 1390 |
| 694 | Ga0495663_0042612 | 3300046525 | Bacteria | 1384 |
| 695 | Ga0495666_0007807 | 3300046526 | Bacteria | 5357 |
| 696 | Ga0495666_0019908 | 3300046526 | Bacteria | 3328 |
| 697 | Ga0495666_0059533 | 3300046526 | Bacteria | 1826 |
| 698 | Ga0495666_0103680 | 3300046526 | Bacteria | 1339 |
| 699 | Ga0495652_0001251 | 3300046529 | Bacteria | 28407 |
| 700 | Ga0495652_0015295 | 3300046529 | Bacteria | 6867 |
| 701 | Ga0495652_0016983 | 3300046529 | Bacteria | 6502 |
| 702 | Ga0495652_0039031 | 3300046529 | Bacteria | 4107 |
| 703 | Ga0495652_0070003 | 3300046529 | Bacteria | 2935 |
| 704 | Ga0495652_0121799 | 3300046529 | Bacteria | 2078 |
| 705 | Ga0495652_0131330 | 3300046529 | Bacteria | 1982 |
| 706 | Ga0495652_0282210 | 3300046529 | Bacteria | 1215 |
| 707 | Ga0495665_0000445 | 3300046531 | Bacteria | 20843 |
| 708 | Ga0495665_0043861 | 3300046531 | Bacteria | 2377 |
| 709 | Ga0495665_0112845 | 3300046531 | Bacteria | 1425 |
| 710 | Ga0495640_0023758 | 3300046533 | Bacteria | 4460 |
| 711 | Ga0495640_0029488 | 3300046533 | Bacteria | 3940 |
| 712 | Ga0495640_0050918 | 3300046533 | Bacteria | 2850 |
| 713 | Ga0495640_0061433 | 3300046533 | Bacteria | 2552 |
| 714 | Ga0495640_0075802 | 3300046533 | Bacteria | 2245 |
| 715 | Ga0495640_0332265 | 3300046533 | Bacteria | 940 |
| 716 | Ga0495586_0008692 | 3300046535 | Bacteria | 5407 |
| 717 | Ga0495586_0032054 | 3300046535 | Bacteria | 2817 |
| 718 | Ga0495586_0369721 | 3300046535 | Bacteria | 824 |
| 719 | Ga0495587_0000412 | 3300046536 | Bacteria | 30257 |
| 720 | Ga0495587_0000539 | 3300046536 | Bacteria | 26240 |
| 721 | Ga0495587_0015132 | 3300046536 | Bacteria | 4821 |
| 722 | Ga0495587_0080542 | 3300046536 | Bacteria | 1887 |
| 723 | Ga0495587_0176368 | 3300046536 | Bacteria | 1213 |
| 724 | Ga0495587_0212711 | 3300046536 | Bacteria | 1091 |
| 725 | Ga0495587_0287804 | 3300046536 | Bacteria | 920 |
| 726 | Ga0495598_0003384 | 3300046537 | Bacteria | 3385 |
| 727 | Ga0495598_0096023 | 3300046537 | Bacteria | 974 |
| 728 | Ga0495621_0011140 | 3300046539 | Unclassified | 2773 |
| 729 | Ga0495597_0181419 | 3300046542 | Bacteria | 851 |
| 730 | Ga0495645_0001433 | 3300046543 | Bacteria | 16073 |
| 731 | Ga0495645_0001863 | 3300046543 | Bacteria | 14330 |
| 732 | Ga0495645_0003140 | 3300046543 | Bacteria | 11199 |
| 733 | Ga0495645_0032288 | 3300046543 | Bacteria | 3818 |
| 734 | Ga0495645_0041308 | 3300046543 | Bacteria | 3363 |
| 735 | Ga0495645_0141130 | 3300046543 | Bacteria | 1680 |
| 736 | Ga0495622_0011214 | 3300046557 | Bacteria | 4138 |
| 737 | Ga0495667_0001115 | 3300046559 | Bacteria | 17483 |
| 738 | Ga0495667_0002439 | 3300046559 | Bacteria | 12414 |
| 739 | Ga0495667_0012121 | 3300046559 | Bacteria | 5842 |
| 740 | Ga0495667_0013378 | 3300046559 | Bacteria | 5554 |
| 741 | Ga0495667_0023000 | 3300046559 | Bacteria | 4199 |
| 742 | Ga0495667_0029679 | 3300046559 | Bacteria | 3680 |
| 743 | Ga0495667_0077704 | 3300046559 | Bacteria | 2158 |
| 744 | Ga0495667_0092965 | 3300046559 | Bacteria | 1953 |
| 745 | Ga0495667_0159008 | 3300046559 | Bacteria | 1453 |
| 746 | Ga0495656_0208210 | 3300046615 | Bacteria | 973 |
| 747 | Ga0495668_0026217 | 3300046616 | Bacteria | 3308 |
| 748 | Ga0495668_0212142 | 3300046616 | Bacteria | 1060 |
| 749 | Ga0495634_0023608 | 3300046642 | Bacteria | 4320 |
| 750 | Ga0495634_0023825 | 3300046642 | Bacteria | 4300 |
| 751 | Ga0495634_0027779 | 3300046642 | Bacteria | 3934 |
| 752 | Ga0495634_0037102 | 3300046642 | Bacteria | 3331 |
| 753 | Ga0495634_0064968 | 3300046642 | Bacteria | 2419 |
| 754 | Ga0495634_0085250 | 3300046642 | Bacteria | 2059 |
| 755 | Ga0495634_0195841 | 3300046642 | Bacteria | 1257 |
| 756 | Ga0495634_0239817 | 3300046642 | Bacteria | 1112 |
| 757 | Ga0495635_0008637 | 3300046663 | Bacteria | 7112 |
| 758 | Ga0495635_0024838 | 3300046663 | Bacteria | 4175 |
| 759 | Ga0495635_0029679 | 3300046663 | Bacteria | 3803 |
| 760 | Ga0495635_0032425 | 3300046663 | Bacteria | 3624 |
| 761 | Ga0495635_0036669 | 3300046663 | Bacteria | 3397 |
| 762 | Ga0495635_0053316 | 3300046663 | Bacteria | 2786 |
| 763 | Ga0495635_0090437 | 3300046663 | Bacteria | 2093 |
| 764 | Ga0495635_0100730 | 3300046663 | Bacteria | 1974 |
| 765 | Ga0495588_0011852 | 3300046674 | Bacteria | 4103 |
| 766 | Ga0495588_0045462 | 3300046674 | Bacteria | 2250 |
| 767 | Ga0495588_0114713 | 3300046674 | Bacteria | 1420 |
| 768 | Ga0495657_0006095 | 3300046675 | Bacteria | 9454 |
| 769 | Ga0495657_0017298 | 3300046675 | Bacteria | 5236 |
| 770 | Ga0495657_0031745 | 3300046675 | Bacteria | 3689 |
| 771 | Ga0495657_0040649 | 3300046675 | Bacteria | 3188 |
| 772 | Ga0495657_0086071 | 3300046675 | Bacteria | 2025 |
| 773 | Ga0495599_0004111 | 3300046678 | Bacteria | 8587 |
| 774 | Ga0495599_0012943 | 3300046678 | Bacteria | 5150 |
| 775 | Ga0495599_0019198 | 3300046678 | Bacteria | 4262 |
| 776 | Ga0495599_0021962 | 3300046678 | Bacteria | 3982 |
| 777 | Ga0495599_0100637 | 3300046678 | Bacteria | 1801 |
| 778 | Ga0495599_0136484 | 3300046678 | Bacteria | 1522 |
| 779 | Ga0495599_0185631 | 3300046678 | Bacteria | 1280 |
| 780 | Ga0495599_0261843 | 3300046678 | Bacteria | 1050 |
| 781 | Ga0495599_0295107 | 3300046678 | Bacteria | 979 |
| 782 | Ga0495623_0000446 | 3300046679 | Bacteria | 27167 |
| 783 | Ga0495623_0003870 | 3300046679 | Bacteria | 9869 |
| 784 | Ga0495623_0004008 | 3300046679 | Bacteria | 9692 |
| 785 | Ga0495623_0024774 | 3300046679 | Bacteria | 3864 |
| 786 | Ga0495623_0028584 | 3300046679 | Bacteria | 3587 |
| 787 | Ga0495646_0000857 | 3300046680 | Bacteria | 17239 |
| 788 | Ga0495646_0006001 | 3300046680 | Bacteria | 7698 |
| 789 | Ga0495646_0028261 | 3300046680 | Bacteria | 3513 |
| 790 | Ga0495646_0043110 | 3300046680 | Bacteria | 2765 |
| 791 | Ga0495646_0047322 | 3300046680 | Bacteria | 2618 |
| 792 | Ga0495646_0067494 | 3300046680 | Bacteria | 2113 |
| 793 | Ga0495646_0114086 | 3300046680 | Bacteria | 1536 |
| 794 | Ga0495646_0250652 | 3300046680 | Bacteria | 948 |
| 795 | Ga0495647_0006828 | 3300046681 | Bacteria | 3801 |
| 796 | Ga0495647_0073185 | 3300046681 | Bacteria | 1376 |
| 797 | Ga0495647_0093071 | 3300046681 | Bacteria | 1238 |
| 798 | Ga0495658_0006627 | 3300046683 | Bacteria | 5691 |
| 799 | Ga0495658_0047804 | 3300046683 | Bacteria | 2410 |
| 800 | Ga0495613_0010427 | 3300046689 | Bacteria | 6901 |
| 801 | Ga0495613_0088997 | 3300046689 | Bacteria | 2236 |
| 802 | Ga0495613_0155673 | 3300046689 | Bacteria | 1628 |
| 803 | Ga0495624_0019793 | 3300046690 | Bacteria | 4485 |
| 804 | Ga0495624_0029900 | 3300046690 | Bacteria | 3551 |
| 805 | Ga0495624_0061984 | 3300046690 | Bacteria | 2341 |
| 806 | Ga0495624_0349769 | 3300046690 | Bacteria | 889 |
| 807 | Ga0495671_0029262 | 3300046692 | Bacteria | 2830 |
| 808 | Ga0495671_0046106 | 3300046692 | Bacteria | 2180 |
| 809 | Ga0495589_0141938 | 3300046794 | Bacteria | 1150 |
| 810 | Ga0495600_0000409 | 3300046809 | Bacteria | 22189 |
| 811 | Ga0495600_0000926 | 3300046809 | Bacteria | 15753 |
| 812 | Ga0495600_0021620 | 3300046809 | Bacteria | 4123 |
| 813 | Ga0495600_0022013 | 3300046809 | Bacteria | 4089 |
| 814 | Ga0495600_0022699 | 3300046809 | Bacteria | 4032 |
| 815 | Ga0495600_0214919 | 3300046809 | Bacteria | 1231 |
| 816 | Ga0495660_0041710 | 3300046810 | Bacteria | 2539 |
| 817 | Ga0495581_0005427 | 3300047315 | Bacteria | 7376 |
| 818 | Ga0495581_0021470 | 3300047315 | Bacteria | 3743 |
| 819 | Ga0495581_0024290 | 3300047315 | Bacteria | 3512 |
| 820 | Ga0495581_0070672 | 3300047315 | Bacteria | 2019 |
| 821 | Ga0495581_0105958 | 3300047315 | Bacteria | 1634 |
| 822 | Ga0495581_0228222 | 3300047315 | Bacteria | 1089 |
| 823 | Ga0495604_0000819 | 3300047317 | Bacteria | 26052 |
| 824 | Ga0495604_0000876 | 3300047317 | Bacteria | 25072 |
| 825 | Ga0495604_0001125 | 3300047317 | Bacteria | 22198 |
| 826 | Ga0495604_0009984 | 3300047317 | Bacteria | 7513 |
| 827 | Ga0495604_0012815 | 3300047317 | Bacteria | 6676 |
| 828 | Ga0495604_0021731 | 3300047317 | Bacteria | 5123 |
| 829 | Ga0495604_0149651 | 3300047317 | Bacteria | 1660 |
| 830 | Ga0495604_0208856 | 3300047317 | Bacteria | 1350 |
| 831 | Ga0495674_0010662 | 3300047319 | Bacteria | 8697 |
| 832 | Ga0495674_0015023 | 3300047319 | Bacteria | 7245 |
| 833 | Ga0495674_0030709 | 3300047319 | Bacteria | 4883 |
| 834 | Ga0495674_0044565 | 3300047319 | Bacteria | 3943 |
| 835 | Ga0495674_0051767 | 3300047319 | Bacteria | 3618 |
| 836 | Ga0495674_0087407 | 3300047319 | Bacteria | 2667 |
| 837 | Ga0495674_0089660 | 3300047319 | Bacteria | 2628 |
| 838 | Ga0495674_0212074 | 3300047319 | Bacteria | 1604 |
| 839 | Ga0495676_0033365 | 3300047321 | Bacteria | 4336 |
| 840 | Ga0495676_0047872 | 3300047321 | Bacteria | 3452 |
| 841 | Ga0495676_0078295 | 3300047321 | Bacteria | 2517 |
| 842 | Ga0495676_0154404 | 3300047321 | Bacteria | 1630 |
| 843 | Ga0495680_0003017 | 3300047322 | Bacteria | 16785 |
| 844 | Ga0495680_0013606 | 3300047322 | Bacteria | 7089 |
| 845 | Ga0495680_0043716 | 3300047322 | Bacteria | 3545 |
| 846 | Ga0495680_0078213 | 3300047322 | Bacteria | 2503 |
| 847 | Ga0495680_0082761 | 3300047322 | Bacteria | 2421 |
| 848 | Ga0495680_0121106 | 3300047322 | Bacteria | 1931 |
| 849 | Ga0495680_0331707 | 3300047322 | Unclassified | 1063 |
| 850 | Ga0495675_0000446 | 3300047444 | Bacteria | 27418 |
| 851 | Ga0495675_0004030 | 3300047444 | Bacteria | 8907 |
| 852 | Ga0495675_0024763 | 3300047444 | Bacteria | 3828 |
| 853 | Ga0495675_0025867 | 3300047444 | Bacteria | 3740 |
| 854 | Ga0495677_0019996 | 3300047445 | Bacteria | 2427 |
| 855 | Ga0495685_067021 | 3300047447 | Bacteria | 1205 |
| 856 | Ga0495684_0001931 | 3300047471 | Bacteria | 16619 |
| 857 | Ga0495684_0006538 | 3300047471 | Bacteria | 9044 |
| 858 | Ga0495684_0010771 | 3300047471 | Bacteria | 7066 |
| 859 | Ga0495684_0020791 | 3300047471 | Bacteria | 5057 |
| 860 | Ga0495684_0138748 | 3300047471 | Bacteria | 1823 |
| 861 | Ga0495593_0002270 | 3300047673 | Bacteria | 11525 |
| 862 | Ga0495593_0022735 | 3300047673 | Bacteria | 3488 |
| 863 | Ga0495593_0067614 | 3300047673 | Bacteria | 1860 |
| 864 | Ga0495602_0004263 | 3300048088 | Bacteria | 14882 |
| 865 | Ga0495602_0013534 | 3300048088 | Bacteria | 8335 |
| 866 | Ga0495602_0021648 | 3300048088 | Bacteria | 6321 |
| 867 | Ga0495602_0126727 | 3300048088 | Bacteria | 2044 |
| 868 | Ga0495602_0253677 | 3300048088 | Bacteria | 1309 |
| 869 | Ga0495602_0338788 | 3300048088 | Bacteria | 1088 |
| 870 | Ga0495614_0006675 | 3300048089 | Bacteria | 5166 |
| 871 | Ga0495614_0010643 | 3300048089 | Bacteria | 4053 |
| 872 | Ga0495614_0131514 | 3300048089 | Bacteria | 1108 |
| 873 | Ga0496100_0031621 | 3300048903 | Bacteria | 3292 |
| 874 | Ga0496100_0108650 | 3300048903 | Bacteria | 1924 |
| 875 | Ga0496101_0052186 | 3300048904 | Bacteria | 2948 |
| 876 | Ga0496101_0130191 | 3300048904 | Bacteria | 1910 |
| 877 | Ga0496101_0460700 | 3300048904 | Bacteria | 1003 |
| 878 | Ga0496102_0027189 | 3300048905 | Bacteria | 5109 |
| 879 | Ga0496102_0050319 | 3300048905 | Bacteria | 3793 |
| 880 | Ga0496102_0066199 | 3300048905 | Bacteria | 3311 |
| 881 | Ga0496102_0466827 | 3300048905 | Bacteria | 1183 |
| 882 | Ga0496103_0020438 | 3300048906 | Bacteria | 3976 |
| 883 | Ga0496103_0033231 | 3300048906 | Bacteria | 3151 |
| 884 | Ga0496103_0232208 | 3300048906 | Bacteria | 1187 |
| 885 | Ga0496104_0034424 | 3300048907 | Bacteria | 4724 |
| 886 | Ga0496104_0064798 | 3300048907 | Bacteria | 3466 |
| 887 | Ga0496104_0399504 | 3300048907 | Bacteria | 1287 |
| 888 | Ga0496104_0433156 | 3300048907 | Bacteria | 1227 |
| 889 | Ga0496105_0057680 | 3300048908 | Bacteria | 3205 |
| 890 | Ga0496105_0192360 | 3300048908 | Bacteria | 1668 |
| 891 | Ga0496105_0432745 | 3300048908 | Bacteria | 1040 |
| 892 | Ga0496106_0039137 | 3300048909 | Bacteria | 3551 |
| 893 | Ga0496106_0048839 | 3300048909 | Bacteria | 3187 |
| 894 | Ga0496106_0472156 | 3300048909 | Bacteria | 1008 |
| 895 | Ga0496107_0043357 | 3300048910 | Bacteria | 3232 |
| 896 | Ga0496108_0038147 | 3300048911 | Bacteria | 4002 |
| 897 | Ga0496108_0041954 | 3300048911 | Bacteria | 3819 |
| 898 | Ga0496108_0048757 | 3300048911 | Bacteria | 3541 |
| 899 | Ga0496108_0051532 | 3300048911 | Bacteria | 3448 |
| 900 | Ga0496108_0258918 | 3300048911 | Bacteria | 1514 |
| 901 | Ga0496109_0043284 | 3300048912 | Bacteria | 4081 |
| 902 | Ga0496109_0045135 | 3300048912 | Bacteria | 3998 |
| 903 | Ga0496109_0053510 | 3300048912 | Bacteria | 3681 |
| 904 | Ga0496109_0063826 | 3300048912 | Bacteria | 3369 |
| 905 | Ga0496109_0274065 | 3300048912 | Bacteria | 1590 |
| 906 | Ga0496109_0873220 | 3300048912 | Bacteria | 837 |
| 907 | Ga0496110_0043825 | 3300048913 | Bacteria | 3906 |
| 908 | Ga0496110_0047930 | 3300048913 | Bacteria | 3743 |
| 909 | Ga0496110_0056814 | 3300048913 | Bacteria | 3444 |
| 910 | Ga0496110_0178257 | 3300048913 | Bacteria | 1929 |
| 911 | Ga0496110_0322439 | 3300048913 | Bacteria | 1407 |
| 912 | Ga0496111_0021795 | 3300048914 | Bacteria | 4476 |
| 913 | Ga0496111_0035721 | 3300048914 | Bacteria | 3553 |
| 914 | Ga0496111_0040446 | 3300048914 | Bacteria | 3344 |
| 915 | Ga0496112_0064853 | 3300048915 | Bacteria | 3604 |
| 916 | Ga0496112_0071366 | 3300048915 | Bacteria | 3432 |
| 917 | Ga0496112_0075976 | 3300048915 | Bacteria | 3322 |
| 918 | Ga0496112_0492319 | 3300048915 | Bacteria | 1162 |
| 919 | Ga0496113_0039225 | 3300048916 | Bacteria | 3485 |
| 920 | Ga0496113_0345983 | 3300048916 | Bacteria | 1192 |
| 921 | Ga0496114_0015468 | 3300048917 | Bacteria | 6134 |
| 922 | Ga0496114_0017612 | 3300048917 | Bacteria | 5769 |
| 923 | Ga0496114_0420090 | 3300048917 | Bacteria | 1184 |
| 924 | Ga0496114_0457293 | 3300048917 | Bacteria | 1130 |
| 925 | Ga0496115_0043548 | 3300048918 | Bacteria | 3580 |
| 926 | Ga0496116_0036541 | 3300048919 | Bacteria | 3434 |
| 927 | Ga0496117_0012267 | 3300048920 | Bacteria | 7576 |
| 928 | Ga0496118_0045320 | 3300048921 | Bacteria | 3434 |
| 929 | Ga0496119_0029804 | 3300048922 | Bacteria | 3690 |
| 930 | Ga0496120_0034757 | 3300048923 | Bacteria | 3016 |
| 931 | Ga0501031_0061816 | 3300049568 | Bacteria | 2440 |
| 932 | Ga0501031_0248045 | 3300049568 | Bacteria | 1157 |
| 933 | Ga0501032_0179472 | 3300049569 | Bacteria | 1386 |
| 934 | Ga0501033_0213512 | 3300049570 | Bacteria | 1375 |
| 935 | Ga0501034_0698266 | 3300049571 | Bacteria | 913 |
| 936 | Ga0501036_0008547 | 3300049572 | Bacteria | 8396 |
| 937 | Ga0501036_0146093 | 3300049572 | Bacteria | 1995 |
| 938 | Ga0501036_0338075 | 3300049572 | Bacteria | 1257 |
| 939 | Ga0501037_0078990 | 3300049573 | Bacteria | 2388 |
| 940 | Ga0501038_0019168 | 3300049574 | Bacteria | 6171 |
| 941 | Ga0501038_0058384 | 3300049574 | Bacteria | 3308 |
| 942 | Ga0501039_0048272 | 3300049575 | Bacteria | 3291 |
| 943 | Ga0501039_0159359 | 3300049575 | Bacteria | 1773 |
| 944 | Ga0501039_0357659 | 3300049575 | Bacteria | 1147 |
| 945 | Ga0501040_0034221 | 3300049576 | Bacteria | 3443 |
| 946 | Ga0501040_0052966 | 3300049576 | Bacteria | 2778 |
| 947 | Ga0501040_0256191 | 3300049576 | Bacteria | 1248 |
| 948 | Ga0501041_0002071 | 3300049577 | Bacteria | 11288 |
| 949 | Ga0501041_0250475 | 3300049577 | Bacteria | 1113 |
| 950 | Ga0501042_0040235 | 3300049578 | Bacteria | 3323 |
| 951 | Ga0501042_0126767 | 3300049578 | Bacteria | 1838 |
| 952 | Ga0501042_0411797 | 3300049578 | Bacteria | 979 |
| 953 | Ga0501043_0043716 | 3300049579 | Bacteria | 3521 |
| 954 | Ga0501043_0092820 | 3300049579 | Bacteria | 2373 |
| 955 | Ga0501043_0327476 | 3300049579 | Bacteria | 1167 |
| 956 | Ga0501046_0172361 | 3300049580 | Bacteria | 1623 |
| 957 | Ga0501046_0314638 | 3300049580 | Bacteria | 1141 |
| 958 | Ga0501047_0049780 | 3300049581 | Bacteria | 4045 |
| 959 | Ga0501048_0021552 | 3300049582 | Bacteria | 4719 |
| 960 | Ga0501048_0042636 | 3300049582 | Bacteria | 3248 |
| 961 | Ga0501048_0150438 | 3300049582 | Bacteria | 1646 |
| 962 | Ga0501048_0221423 | 3300049582 | Bacteria | 1342 |
| 963 | Ga0501070_0435359 | 3300049586 | Bacteria | 1058 |
| 964 | Ga0501071_0425873 | 3300049587 | Bacteria | 1014 |
| 965 | Ga0501072_0217566 | 3300049588 | Bacteria | 1522 |
| 966 | Ga0501072_0324942 | 3300049588 | Bacteria | 1222 |
| 967 | Ga0501074_0017670 | 3300049590 | Bacteria | 5180 |
| 968 | Ga0501074_0073969 | 3300049590 | Bacteria | 2447 |
| 969 | Ga0501075_0038226 | 3300049591 | Bacteria | 3587 |
| 970 | Ga0501075_0278246 | 3300049591 | Bacteria | 1275 |
| 971 | Ga0501075_0356611 | 3300049591 | Bacteria | 1114 |
| 972 | Ga0501076_0002605 | 3300049592 | Bacteria | 12412 |
| 973 | Ga0501076_0190855 | 3300049592 | Bacteria | 1672 |
| 974 | Ga0501076_0198382 | 3300049592 | Bacteria | 1638 |
| 975 | Ga0501077_0138159 | 3300049593 | Bacteria | 1545 |
| 976 | Ga0501079_0038092 | 3300049741 | Bacteria | 3708 |
| 977 | Ga0501079_0038394 | 3300049741 | Bacteria | 3692 |
| 978 | Ga0501079_0397216 | 3300049741 | Bacteria | 1081 |
| 979 | Ga0501080_0569333 | 3300049742 | Bacteria | 1008 |
| 980 | Ga0501081_0015277 | 3300049743 | Bacteria | 5064 |
| 981 | Ga0501081_0034956 | 3300049743 | Bacteria | 3421 |
| 982 | Ga0501081_0047658 | 3300049743 | Bacteria | 2948 |
| 983 | Ga0501081_0241059 | 3300049743 | Bacteria | 1318 |
| 984 | Ga0501083_0221553 | 3300049744 | Bacteria | 1232 |
| 985 | Ga0501268_017421 | 3300049765 | Bacteria | 1199 |
| 986 | Ga0501035_0062810 | 3300049822 | Bacteria | 3304 |
| 987 | Ga0501035_0283826 | 3300049822 | Bacteria | 1399 |
| 988 | Ga0501035_0415489 | 3300049822 | Bacteria | 1117 |
| 989 | Ga0501044_0071214 | 3300049823 | Bacteria | 3535 |
| 990 | Ga0501045_0004503 | 3300049824 | Bacteria | 9624 |
| 991 | Ga0501045_0060279 | 3300049824 | Bacteria | 2781 |
| 992 | Ga0501045_0075612 | 3300049824 | Bacteria | 2481 |
| 993 | Ga0501045_0143084 | 3300049824 | Bacteria | 1778 |
| 994 | nmdc:mga05p37_10885_c1 | 3300050507 | Bacteria | 10801 |
| 995 | nmdc:mga05p37_17938_c2 | 3300050507 | Bacteria | 8209 |
| 996 | nmdc:mga05p37_390747_c1 | 3300050507 | Bacteria | 1627 |
| 997 | nmdc:mga05p37_53953_c1 | 3300050507 | Bacteria | 4945 |
| 998 | nmdc:mga09592_18277_c1 | 3300050508 | Bacteria | 5748 |
| 999 | nmdc:mga09592_26866_c1 | 3300050508 | Bacteria | 4772 |
| 1000 | nmdc:mga09592_47527_c1 | 3300050508 | Bacteria | 3617 |
| 1001 | nmdc:mga0qj67_10601_c1 | 3300050509 | Bacteria | 6886 |
| 1002 | nmdc:mga0qj67_415_c1 | 3300050509 | Bacteria | 29140 |
| 1003 | nmdc:mga0qj67_41855_c1 | 3300050509 | Bacteria | 3605 |
| 1004 | nmdc:mga06r32_13500_c1 | 3300050510 | Bacteria | 7403 |
| 1005 | nmdc:mga06r32_18555_c2 | 3300050510 | Bacteria | 5806 |
| 1006 | nmdc:mga06r32_73270_c1 | 3300050510 | Bacteria | 3317 |
| 1007 | nmdc:mga06r32_7479_c1 | 3300050510 | Bacteria | 9825 |
| 1008 | nmdc:mga0rr50_181050_c1 | 3300050513 | Bacteria | 1723 |
| 1009 | nmdc:mga0rr50_391843_c1 | 3300050513 | Bacteria | 1172 |
| 1010 | nmdc:mga0rr50_605112_c1 | 3300050513 | Bacteria | 934 |
| 1011 | nmdc:mga0a205_200466_c1 | 3300050515 | Bacteria | 1886 |
| 1012 | Ga0495601_0012227 | 3300053077 | Bacteria | 5147 |
| 1013 | Ga0495601_0013328 | 3300053077 | Bacteria | 4941 |
| 1014 | Ga0495601_0044254 | 3300053077 | Bacteria | 2798 |
| 1015 | Ga0495601_0260685 | 3300053077 | Bacteria | 1131 |
| 1016 | Ga0495612_0003749 | 3300053078 | Bacteria | 6318 |
| 1017 | Ga0495595_0006043 | 3300053084 | Bacteria | 4921 |
| 1018 | Ga0495595_0014305 | 3300053084 | Bacteria | 3364 |
| 1019 | Ga0495595_0051442 | 3300053084 | Bacteria | 1909 |
| 1020 | Ga0495595_0086137 | 3300053084 | Bacteria | 1503 |
| 1021 | Ga0495595_0138443 | 3300053084 | Bacteria | 1193 |
| 1022 | Ga0495595_0256166 | 3300053084 | Bacteria | 877 |
| 1023 | Ga0495619_0024726 | 3300053085 | Bacteria | 3853 |
| 1024 | Ga0495619_0029196 | 3300053085 | Bacteria | 3562 |
| 1025 | Ga0495619_0033968 | 3300053085 | Bacteria | 3314 |
| 1026 | Ga0495619_0230984 | 3300053085 | Bacteria | 1282 |
| 1027 | Ga0500646_0005538 | 3300053090 | Bacteria | 3193 |
| 1028 | Ga0500660_040572 | 3300053100 | Bacteria | 2370 |
| 1029 | Ga0500569_002159 | 3300053109 | Bacteria | 3831 |
| 1030 | Ga0500588_0003099 | 3300053146 | Bacteria | 3469 |
| 1031 | Ga0500600_0022641 | 3300053149 | Bacteria | 3760 |
| 1032 | Ga0500600_0025625 | 3300053149 | Bacteria | 3505 |
| 1033 | Ga0501084_0050826 | 3300054114 | Bacteria | 3468 |
| 1034 | Ga0501084_0059069 | 3300054114 | Bacteria | 3209 |
| 1035 | Ga0501084_0176138 | 3300054114 | Bacteria | 1805 |
| 1036 | Ga0501082_0050322 | 3300060353 | Bacteria | 3593 |
| 1037 | Ga0501082_0064550 | 3300060353 | Bacteria | 3153 |
| 1038 | Ga0501082_0090565 | 3300060353 | Bacteria | 2641 |
| 1039 | Ga0501082_0387874 | 3300060353 | Bacteria | 1219 |
| 1040 | Ga0530510_0006051 | 3300061734 | Bacteria | 8400 |
| 1041 | Ga0530510_0007140 | 3300061734 | Bacteria | 7774 |
| 1042 | Ga0530510_0322946 | 3300061734 | Bacteria | 1157 |
| 1043 | Ga0530510_0409829 | 3300061734 | Bacteria | 1022 |
| 1044 | Ga0530510_0511870 | 3300061734 | Bacteria | 910 |
| 1045 | 2517759910 | 2517572101 | Bacteria | 6884336 |
| 1046 | 2517760979 | 2517572101 | Bacteria | 6884336 |
| 1047 | 2517761337 | 2517572101 | Bacteria | 6884336 |
| 1048 | 2689959666 | 2687453737 | Bacteria | 11203906 |
| 1049 | 2753266097 | 2751185782 | Bacteria | 11227053 |
| 1050 | 2753272878 | 2751185782 | Bacteria | 11227053 |
| 1051 | Ga0070707_100076242 | |||
| 1052 | JGI25406J46586_10014240 | |||
| 1053 | JGI25406J46586_10014431 | |||
| 1054 | JGI25406J46586_10030198 | |||
| 1055 | JGI25406J46586_10053968 | |||
| 1056 | rootL2_10004996 | |||
| 1057 | rootH1_10037886 | |||
| 1058 | JGI25404J52841_10004486 | |||
| 1059 | Ga0070658_10028001 | |||
| 1060 | Ga0070683_100431266 | |||
| 1061 | Ga0068869_100053899 | |||
| 1062 | Ga0070666_10188510 | |||
| 1063 | Ga0070666_10357437 | |||
| 1064 | Ga0070680_100011908 | |||
| 1065 | Ga0070680_100142243 | |||
| 1066 | Ga0070682_100007899 | |||
| 1067 | Ga0070682_100013960 | |||
| 1068 | Ga0070682_100018888 | |||
| 1069 | Ga0070682_100085006 | |||
| 1070 | Ga0070682_100293262 | |||
| 1071 | Ga0068868_100078378 | |||
| 1072 | Ga0068868_100100825 | |||
| 1073 | Ga0068868_100325359 | |||
| 1074 | Ga0070660_100031064 | |||
| 1075 | Ga0070660_100037982 | |||
| 1076 | Ga0070691_10148853 | |||
| 1077 | Ga0070687_100219443 | |||
| 1078 | Ga0070687_100220464 | |||
| 1079 | Ga0070661_100016582 | |||
| 1080 | Ga0070692_10008892 | |||
| 1081 | Ga0070692_10008907 | |||
| 1082 | Ga0070668_100048108 | |||
| 1083 | Ga0070668_100244301 | |||
| 1084 | Ga0070674_100029725 | |||
| 1085 | Ga0070674_100038007 | |||
| 1086 | Ga0070673_100237856 | |||
| 1087 | Ga0070659_100013364 | |||
| 1088 | Ga0070659_100156036 | |||
| 1089 | Ga0070703_10053897 | |||
| 1090 | Ga0070709_10018337 | |||
| 1091 | Ga0070709_10034296 | |||
| 1092 | Ga0070709_10156443 | |||
| 1093 | Ga0070714_100053004 | |||
| 1094 | Ga0070714_100082883 | |||
| 1095 | Ga0070714_100130421 | |||
| 1096 | Ga0070714_100433485 | |||
| 1097 | Ga0070714_100578204 | |||
| 1098 | Ga0070714_100594436 | |||
| 1099 | Ga0070713_100041851 | |||
| 1100 | Ga0070713_100459918 | |||
| 1101 | Ga0070710_10068331 | |||
| 1102 | Ga0070710_10222009 | |||
| 1103 | Ga0070710_10271732 | |||
| 1104 | Ga0070711_100023271 | |||
| 1105 | Ga0070711_100048497 | |||
| 1106 | Ga0070711_100181231 | |||
| 1107 | Ga0070711_100208345 | |||
| 1108 | Ga0070705_100012792 | |||
| 1109 | Ga0070705_100107418 | |||
| 1110 | Ga0070705_100431671 | |||
| 1111 | Ga0070708_100049236 | |||
| 1112 | Ga0070708_100053855 | |||
| 1113 | Ga0070708_100059461 | |||
| 1114 | Ga0070708_100185112 | |||
| 1115 | Ga0070663_100113387 | |||
| 1116 | Ga0070663_100388747 | |||
| 1117 | Ga0070678_100038854 | |||
| 1118 | Ga0070662_100256431 | |||
| 1119 | Ga0070681_10013155 | |||
| 1120 | Ga0070681_10069832 | |||
| 1121 | Ga0070681_10202662 | |||
| 1122 | Ga0068867_100061539 | |||
| 1123 | Ga0070706_100036169 | |||
| 1124 | Ga0070706_100085822 | |||
| 1125 | Ga0070706_100337311 | |||
| 1126 | Ga0070707_100047658 | |||
| 1127 | Ga0070707_100068837 | |||
| 1128 | Ga0070698_100050947 | |||
| 1129 | Ga0070698_100054611 | |||
| 1130 | Ga0070698_100100102 | |||
| 1131 | Ga0070698_100277209 | |||
| 1132 | Ga0070698_100308773 | |||
| 1133 | Ga0070699_100044656 | |||
| 1134 | Ga0070699_100056215 | |||
| 1135 | Ga0070699_100392135 | |||
| 1136 | Ga0070679_100037365 | |||
| 1137 | Ga0070679_100080365 | |||
| 1138 | Ga0070684_100801516 | |||
| 1139 | Ga0068853_100048337 | |||
| 1140 | Ga0068853_100453714 | |||
| 1141 | Ga0070686_100143482 | |||
| 1142 | Ga0070693_100021014 | |||
| 1143 | Ga0070693_100377839 | |||
| 1144 | Ga0070665_100100923 | |||
| 1145 | Ga0070665_100413790 | |||
| 1146 | Ga0070704_100039062 | |||
| 1147 | Ga0070704_100110369 | |||
| 1148 | Ga0070704_100247997 | |||
| 1149 | Ga0070704_100340459 | |||
| 1150 | Ga0068855_100069582 | |||
| 1151 | Ga0070664_100046197 | |||
| 1152 | Ga0070664_100065924 | |||
| 1153 | Ga0068857_100096709 | |||
| 1154 | Ga0068857_100228136 | |||
| 1155 | Ga0068857_100657192 | |||
| 1156 | Ga0068854_100315945 | |||
| 1157 | Ga0068856_100067507 | |||
| 1158 | Ga0068856_100073152 | |||
| 1159 | Ga0068856_100400290 | |||
| 1160 | Ga0070702_100010381 | |||
| 1161 | Ga0070702_100051411 | |||
| 1162 | Ga0070702_100331883 | |||
| 1163 | Ga0068852_100052086 | |||
| 1164 | Ga0068852_100184390 | |||
| 1165 | Ga0068859_100450296 | |||
| 1166 | Ga0068859_100652234 | |||
| 1167 | Ga0068864_100037091 | |||
| 1168 | Ga0068864_100448392 | |||
| 1169 | Ga0068866_10004480 | |||
| 1170 | Ga0068866_10016550 | |||
| 1171 | Ga0068866_10295188 | |||
| 1172 | Ga0068861_100031949 | |||
| 1173 | Ga0068870_10021346 | |||
| 1174 | Ga0068860_100053178 | |||
| 1175 | Ga0068860_100163892 | |||
| 1176 | Ga0081455_10046024 | |||
| 1177 | Ga0081455_10055028 | |||
| 1178 | Ga0081455_10133349 | |||
| 1179 | Ga0081540_1016232 | |||
| 1180 | Ga0081539_10027034 | |||
| 1181 | Ga0081539_10027050 | |||
| 1182 | Ga0081539_10027923 | |||
| 1183 | Ga0081539_10028627 | |||
| 1184 | Ga0081539_10028691 | |||
| 1185 | Ga0081539_10033901 | |||
| 1186 | Ga0081539_10037314 | |||
| 1187 | Ga0081539_10104474 | |||
| 1188 | Ga0081539_10138062 | |||
| 1189 | Ga0070717_10027374 | |||
| 1190 | Ga0070717_10105493 | |||
| 1191 | Ga0070717_10168116 | |||
| 1192 | Ga0070717_10358572 | |||
| 1193 | Ga0070717_10369213 | |||
| 1194 | Ga0070716_100347891 | |||
| 1195 | Ga0070712_100039606 | |||
| 1196 | Ga0070712_100048743 | |||
| 1197 | Ga0070712_100252262 | |||
| 1198 | Ga0070712_100511471 | |||
| 1199 | Ga0068871_100165677 | |||
| 1200 | Ga0068871_100197056 | |||
| 1201 | Ga0068871_100364193 | |||
| 1202 | Ga0075428_100007835 | |||
| 1203 | Ga0075428_100717465 | |||
| 1204 | Ga0075430_100005412 | |||
| 1205 | Ga0075430_100047964 | |||
| 1206 | Ga0075430_100049169 | |||
| 1207 | Ga0075431_100077047 | |||
| 1208 | Ga0075431_100078596 | |||
| 1209 | Ga0075431_100113627 | |||
| 1210 | Ga0075431_100630831 | |||
| 1211 | Ga0075434_100186487 | |||
| 1212 | Ga0075429_100001408 | |||
| 1213 | Ga0075429_100039518 | |||
| 1214 | Ga0075429_100048169 | |||
| 1215 | Ga0068865_100012409 | |||
| 1216 | Ga0068865_100244756 | |||
| 1217 | Ga0068865_100349070 | |||
| 1218 | Ga0097620_100450263 | |||
| 1219 | Ga0097620_100652244 | |||
| 1220 | Ga0075435_100114159 | |||
| 1221 | Ga0099794_10011259 | |||
| 1222 | Ga0099794_10128931 | |||
| 1223 | Ga0105244_10046359 | |||
| 1224 | Ga0105240_10156885 | |||
| 1225 | Ga0105245_10061183 | |||
| 1226 | Ga0105245_10156140 | |||
| 1227 | Ga0105245_10250315 | |||
| 1228 | Ga0105247_10023037 | |||
| 1229 | Ga0105247_10026549 | |||
| 1230 | Ga0114129_10036834 | |||
| 1231 | Ga0114129_10048530 | |||
| 1232 | Ga0114129_10121047 | |||
| 1233 | Ga0114129_10381182 | |||
| 1234 | Ga0114129_10442441 | |||
| 1235 | Ga0105243_10109285 | |||
| 1236 | Ga0105243_10138090 | |||
| 1237 | Ga0105243_10194859 | |||
| 1238 | Ga0105243_10203306 | |||
| 1239 | Ga0105243_10537983 | |||
| 1240 | Ga0105241_10280460 | |||
| 1241 | Ga0105241_10476137 | |||
| 1242 | Ga0105242_10445990 | |||
| 1243 | Ga0105242_10646833 | |||
| 1244 | Ga0105248_10082123 | |||
| 1245 | Ga0105237_10142930 | |||
| 1246 | Ga0105237_10242964 | |||
| 1247 | Ga0105237_10458711 | |||
| 1248 | Ga0105237_10481336 | |||
| 1249 | Ga0105238_10047852 | |||
| 1250 | Ga0105238_10065522 | |||
| 1251 | Ga0105238_10440816 | |||
| 1252 | Ga0105238_10542253 | |||
| 1253 | Ga0105249_10317858 | |||
| 1254 | Ga0105249_10333136 | |||
| 1255 | Ga0105249_10737029 | |||
| 1256 | Ga0099796_10027687 | |||
| 1257 | Ga0105239_10564865 | |||
| 1258 | Ga0105239_10572403 | |||
| 1259 | Ga0105246_10290642 | |||
| 1260 | Ga0157369_10083360 | |||
| 1261 | Ga0157369_10114812 | |||
| 1262 | Ga0157369_10844467 | |||
| 1263 | Ga0157374_10435322 | |||
| 1264 | Ga0157378_10056522 | |||
| 1265 | Ga0157378_10244000 | |||
| 1266 | Ga0163162_10139462 | |||
| 1267 | Ga0157372_10067740 | |||
| 1268 | Ga0157372_10102892 | |||
| 1269 | Ga0157375_10560112 | |||
| 1270 | Ga0157380_10308200 | |||
| 1271 | Ga0157380_10483720 | |||
| 1272 | Ga0157380_10562671 | |||
| 1273 | Ga0182008_10019877 | |||
| 1274 | Ga0157379_10031533 | |||
| 1275 | Ga0157376_10047951 | |||
| 1276 | Ga0157376_10049063 | |||
| 1277 | Ga0157376_10150257 | |||
| 1278 | Ga0163161_10300191 | |||
| 1279 | Ga0206354_11267655 | |||
| 1280 | Ga0206354_11647855 | |||
| 1281 | Ga0206353_10402092 | |||
| 1282 | Ga0206353_10772945 | |||
| 1283 | Ga0206353_11026265 | |||
| 1284 | Ga0213873_10000235 | |||
| 1285 | Ga0213876_10023868 | |||
| 1286 | Ga0213876_10188496 | |||
| 1287 | Ga0213875_10003575 | |||
| 1288 | Ga0213875_10004856 | |||
| 1289 | Ga0213875_10198406 | |||
| 1290 | Ga0213871_10066111 | |||
| 1291 | Ga0207656_10086684 | |||
| 1292 | Ga0207653_10093688 | |||
| 1293 | Ga0207692_10022999 | |||
| 1294 | Ga0207692_10111111 | |||
| 1295 | Ga0207692_10165905 | |||
| 1296 | Ga0207692_10318251 | |||
| 1297 | Ga0207692_10350976 | |||
| 1298 | Ga0207710_10013377 | |||
| 1299 | Ga0207688_10024196 | |||
| 1300 | Ga0207688_10096311 | |||
| 1301 | Ga0207680_10258385 | |||
| 1302 | Ga0207647_10120303 | |||
| 1303 | Ga0207647_10234138 | |||
| 1304 | Ga0207699_10024684 | |||
| 1305 | Ga0207699_10093258 | |||
| 1306 | Ga0207699_10252727 | |||
| 1307 | Ga0207643_10192186 | |||
| 1308 | Ga0207705_10010177 | |||
| 1309 | Ga0207705_10023492 | |||
| 1310 | Ga0207684_10043777 | |||
| 1311 | Ga0207684_10044680 | |||
| 1312 | Ga0207684_10213484 | |||
| 1313 | Ga0207684_10232445 | |||
| 1314 | Ga0207707_10026561 | |||
| 1315 | Ga0207707_10082845 | |||
| 1316 | Ga0207695_10119327 | |||
| 1317 | Ga0207671_10037508 | |||
| 1318 | Ga0207671_10192524 | |||
| 1319 | Ga0207671_10328721 | |||
| 1320 | Ga0207693_10031545 | |||
| 1321 | Ga0207693_10040116 | |||
| 1322 | Ga0207693_10040842 | |||
| 1323 | Ga0207693_10095242 | |||
| 1324 | Ga0207693_10342734 | |||
| 1325 | Ga0207693_10396909 | |||
| 1326 | Ga0207663_10016253 | |||
| 1327 | Ga0207663_10048792 | |||
| 1328 | Ga0207663_10202237 | |||
| 1329 | Ga0207663_10249811 | |||
| 1330 | Ga0207663_10271431 | |||
| 1331 | Ga0207660_10034720 | |||
| 1332 | Ga0207660_10120064 | |||
| 1333 | Ga0207662_10086825 | |||
| 1334 | Ga0207662_10274738 | |||
| 1335 | Ga0207657_10039762 | |||
| 1336 | Ga0207649_10028963 | |||
| 1337 | Ga0207652_10001454 | |||
| 1338 | Ga0207652_10006068 | |||
| 1339 | Ga0207652_10127750 | |||
| 1340 | Ga0207646_10027639 | |||
| 1341 | Ga0207646_10029503 | |||
| 1342 | Ga0207646_10048680 | |||
| 1343 | Ga0207646_10055390 | |||
| 1344 | Ga0207646_10060764 | |||
| 1345 | Ga0207646_10131536 | |||
| 1346 | Ga0207646_10352859 | |||
| 1347 | Ga0207694_10067935 | |||
| 1348 | Ga0207694_10431909 | |||
| 1349 | Ga0207687_10038200 | |||
| 1350 | Ga0207687_10108256 | |||
| 1351 | Ga0207687_10360260 | |||
| 1352 | Ga0207700_10053320 | |||
| 1353 | Ga0207664_10050606 | |||
| 1354 | Ga0207664_10077862 | |||
| 1355 | Ga0207644_10361995 | |||
| 1356 | Ga0207690_10019587 | |||
| 1357 | Ga0207690_10283360 | |||
| 1358 | Ga0207706_10132764 | |||
| 1359 | Ga0207686_10086607 | |||
| 1360 | Ga0207709_10031715 | |||
| 1361 | Ga0207709_10141572 | |||
| 1362 | Ga0207670_10071647 | |||
| 1363 | Ga0207669_10022132 | |||
| 1364 | Ga0207669_10110367 | |||
| 1365 | Ga0207669_10252292 | |||
| 1366 | Ga0207704_10187958 | |||
| 1367 | Ga0207665_10026734 | |||
| 1368 | Ga0207665_10143945 | |||
| 1369 | Ga0207691_10040802 | |||
| 1370 | Ga0207711_10057476 | |||
| 1371 | Ga0207711_10230056 | |||
| 1372 | Ga0207689_10052403 | |||
| 1373 | Ga0207689_10110788 | |||
| 1374 | Ga0207661_10000736 | |||
| 1375 | Ga0207661_10005583 | |||
| 1376 | Ga0207661_10346683 | |||
| 1377 | Ga0207679_10023434 | |||
| 1378 | Ga0207679_10697175 | |||
| 1379 | Ga0207667_10068174 | |||
| 1380 | Ga0207667_10084188 | |||
| 1381 | Ga0207651_10313774 | |||
| 1382 | Ga0207712_10014393 | |||
| 1383 | Ga0207712_10446524 | |||
| 1384 | Ga0207668_10030048 | |||
| 1385 | Ga0207668_10039369 | |||
| 1386 | Ga0207677_10036002 | |||
| 1387 | Ga0207677_10136607 | |||
| 1388 | Ga0207677_10557772 | |||
| 1389 | Ga0207639_10500304 | |||
| 1390 | Ga0207678_10054507 | |||
| 1391 | Ga0207678_10082852 | |||
| 1392 | Ga0207678_10129250 | |||
| 1393 | Ga0207678_10259046 | |||
| 1394 | Ga0207678_10264631 | |||
| 1395 | Ga0207708_10224253 | |||
| 1396 | Ga0207702_10046581 | |||
| 1397 | Ga0207702_10058070 | |||
| 1398 | Ga0207702_10113460 | |||
| 1399 | Ga0207702_10390651 | |||
| 1400 | Ga0207702_10474290 | |||
| 1401 | Ga0207641_10360332 | |||
| 1402 | Ga0207648_10056503 | |||
| 1403 | Ga0207648_10153793 | |||
| 1404 | Ga0207674_10055416 | |||
| 1405 | Ga0207674_10362289 | |||
| 1406 | Ga0207674_10488679 | |||
| 1407 | Ga0207674_10639867 | |||
| 1408 | Ga0207675_100053755 | |||
| 1409 | Ga0207675_100487760 | |||
| 1410 | Ga0207675_100766270 | |||
| 1411 | Ga0207683_10007141 | |||
| 1412 | Ga0207683_10059664 | |||
| 1413 | Ga0207683_10226867 | |||
| 1414 | Ga0207683_10326575 | |||
| 1415 | Ga0207698_10046392 | |||
| 1416 | Ga0207698_10151828 | |||
| 1417 | Ga0207698_10276894 | |||
| 1418 | Ga0209588_1004920 | |||
| 1419 | Ga0268266_10055029 | |||
| 1420 | Ga0268266_10344571 | |||
| 1421 | Ga0268265_10053062 | |||
| 1422 | Ga0268265_10157768 | |||
| 1423 | Ga0268264_10049641 | |||
| 1424 | Ga0307515_10002209 | |||
| 1425 | Ga0307515_10090632 | |||
| 1426 | Ga0307515_10112242 | |||
| 1427 | Ga0307515_10114672 | |||
| 1428 | Ga0307515_10351118 | |||
| 1429 | Ga0307511_10002064 | |||
| 1430 | Ga0307511_10036041 | |||
| 1431 | Ga0307512_10053716 | |||
| 1432 | Ga0307512_10053898 | |||
| 1433 | Ga0265340_10009479 | |||
| 1434 | Ga0307513_10026939 | |||
| 1435 | Ga0307513_10190978 | |||
| 1436 | Ga0307509_10069301 | |||
| 1437 | Ga0307408_100117638 | |||
| 1438 | Ga0307408_100232297 | |||
| 1439 | Ga0307508_10006509 | |||
| 1440 | Ga0307508_10049014 | |||
| 1441 | Ga0307508_10053134 | |||
| 1442 | Ga0307508_10233287 | |||
| 1443 | Ga0307508_10276703 | |||
| 1444 | Ga0307514_10044795 | |||
| 1445 | Ga0316576_10039186 | |||
| 1446 | Ga0307516_10009926 | |||
| 1447 | Ga0307516_10064671 | |||
| 1448 | Ga0307405_10020624 | |||
| 1449 | Ga0307405_10026076 | |||
| 1450 | Ga0307405_10142462 | |||
| 1451 | Ga0307405_10366485 | |||
| 1452 | Ga0307413_10023417 | |||
| 1453 | Ga0307518_10037558 | |||
| 1454 | Ga0307410_10032038 | |||
| 1455 | Ga0307410_10146402 | |||
| 1456 | Ga0307410_10208165 | |||
| 1457 | Ga0307410_10287067 | |||
| 1458 | Ga0307410_10334157 | |||
| 1459 | Ga0307406_10019032 | |||
| 1460 | Ga0307406_10030380 | |||
| 1461 | Ga0307406_10133532 | |||
| 1462 | Ga0307406_10310405 | |||
| 1463 | Ga0307406_10468630 | |||
| 1464 | Ga0307407_10018141 | |||
| 1465 | Ga0307407_10056493 | |||
| 1466 | Ga0307407_10295515 | |||
| 1467 | Ga0307407_10384176 | |||
| 1468 | Ga0307412_10071190 | |||
| 1469 | Ga0307409_100032151 | |||
| 1470 | Ga0307409_100032652 | |||
| 1471 | Ga0307409_100039951 | |||
| 1472 | Ga0307409_100040065 | |||
| 1473 | Ga0307409_100244504 | |||
| 1474 | Ga0307409_100615192 | |||
| 1475 | Ga0307409_100739344 | |||
| 1476 | Ga0307416_100040611 | |||
| 1477 | Ga0307416_100045313 | |||
| 1478 | Ga0307416_100123145 | |||
| 1479 | Ga0307416_100222627 | |||
| 1480 | Ga0307416_100922055 | |||
| 1481 | Ga0307414_10045665 | |||
| 1482 | Ga0307414_10054669 | |||
| 1483 | Ga0307414_10071440 | |||
| 1484 | Ga0307414_10127246 | |||
| 1485 | Ga0307411_10021558 | |||
| 1486 | Ga0307411_10197168 | |||
| 1487 | Ga0307415_100030630 | |||
| 1488 | Ga0307415_100031865 | |||
| 1489 | Ga0307415_100149315 | |||
| 1490 | Ga0307415_100355340 | |||
| 1491 | Ga0307415_100489854 | |||
| 1492 | Ga0307415_100515422 | |||
| 1493 | Ga0316583_10067278 | |||
| 1494 | Ga0307507_10050067 | |||
| 1495 | Ga0307507_10064823 | |||
| 1496 | Ga0307507_10071496 | |||
| 1497 | Ga0307510_10168221 | |||
| 1498 | Ga0373926_0004115 | |||
| 1499 | Ga0373926_0039093 | |||
| 1500 | Ga0373928_0035474 | |||
| 1501 | Ga0373934_0004664 | |||
| 1502 | Ga0373934_0011016 | |||
| 1503 | Ga0373934_0073518 | |||
| 1504 | Ga0373944_0019136 | |||
| 1505 | Ga0373944_0057680 | |||
| 1506 | Ga0373944_0064781 | |||
| 1507 | Ga0373923_0000238 | |||
| 1508 | Ga0373923_0009354 | |||
| 1509 | Ga0373923_0189094 | |||
| 1510 | Ga0373932_0068324 | |||
| 1511 | Ga0373936_0000987 | |||
| 1512 | Ga0373936_0006981 | |||
| 1513 | Ga0373936_0231747 | |||
| 1514 | Ga0373939_0108731 | |||
| 1515 | Ga0373945_0000634 | |||
| 1516 | Ga0373945_0108572 | |||
| 1517 | Ga0373945_0126090 | |||
| 1518 | Ga0373945_0151980 | |||
| 1519 | Ga0373953_0004165 | |||
| 1520 | Ga0373953_0006292 | |||
| 1521 | Ga0373953_0007249 | |||
| 1522 | Ga0373953_0060333 | |||
| 1523 | Ga0373954_0002275 | |||
| 1524 | Ga0373954_0014690 | |||
| 1525 | Ga0373954_0028969 | |||
| 1526 | Ga0373954_0113900 | |||
| 1527 | Ga0373956_0004343 | |||
| 1528 | Ga0373956_0005108 | |||
| 1529 | Ga0373956_0011804 | |||
| 1530 | Ga0373956_0014118 | |||
| 1531 | Ga0373956_0085017 | |||
| 1532 | Ga0373956_0175973 | |||
| 1533 | Ga0373957_0005897 | |||
| 1534 | Ga0373957_0006343 | |||
| 1535 | Ga0373957_0008553 | |||
| 1536 | Ga0373957_0069730 | |||
| 1537 | Ga0373960_0049885 | |||
| 1538 | Ga0373960_0058197 | |||
| 1539 | Ga0373943_0004593 | |||
| 1540 | Ga0373943_0037559 | |||
| 1541 | Ga0373943_0144176 | |||
| 1542 | Ga0373943_0169212 | |||
| 1543 | Ga0373946_0001094 | |||
| 1544 | Ga0373946_0022069 | |||
| 1545 | Ga0373946_0028375 | |||
| 1546 | Ga0373946_0066453 | |||
| 1547 | Ga0373946_0134662 | |||
| 1548 | Ga0373955_0015994 | |||
| 1549 | Ga0373955_0049418 | |||
| 1550 | Ga0373955_0053159 | |||
| 1551 | Ga0373955_0187250 | |||
| 1552 | Ga0373955_0307854 | |||
| 1553 | Ga0316574_0057625 | |||
| 1554 | Ga0373924_0002738 | |||
| 1555 | Ga0373924_0008098 | |||
| 1556 | Ga0373924_0009195 | |||
| 1557 | Ga0373924_0069586 | |||
| 1558 | Ga0373924_0091147 | |||
| 1559 | Ga0373924_0102108 | |||
| 1560 | Ga0373931_0192478 | |||
| 1561 | Ga0373935_0005788 | |||
| 1562 | Ga0373935_0013913 | |||
| 1563 | Ga0373935_0016469 | |||
| 1564 | Ga0373927_0002592 | |||
| 1565 | Ga0373927_0035790 | |||
| 1566 | Ga0373933_0006148 | |||
| 1567 | Ga0373933_0007518 | |||
| 1568 | Ga0373933_0021414 | |||
| 1569 | Ga0373933_0059833 | |||
| 1570 | Ga0373933_0092354 | |||
| 1571 | Ga0373947_0007335 | |||
| 1572 | Ga0373947_0028950 | |||
| 1573 | Ga0373947_0075951 | |||
| 1574 | Ga0373947_0119031 | |||
| 1575 | Ga0373947_0137869 | |||
| 1576 | Ga0373937_0023747 | |||
| 1577 | Ga0373937_0046519 | |||
| 1578 | Ga0373937_0064010 | |||
| 1579 | Ga0373937_0066270 | |||
| 1580 | Ga0373937_0066969 | |||
| 1581 | Ga0373937_0134224 | |||
| 1582 | Ga0373937_0144486 | |||
| 1583 | Ga0373937_0335025 | |||
| 1584 | Ga0316584_0046991 | |||
| 1585 | Ga0373925_0013705 | |||
| 1586 | Ga0373925_0014822 | |||
| 1587 | Ga0373925_0027143 | |||
| 1588 | Ga0373925_0029939 | |||
| 1589 | Ga0373925_0144892 | |||
| 1590 | Ga0373925_0238169 | |||
| 1591 | Ga0373925_0327546 | |||
| 1592 | Ga0373925_0525326 | |||
| 1593 | Ga0373925_0559909 | |||
| 1594 | Ga0373925_0701513 | |||
| 1595 | Ga0395899_0212376 | |||
| 1596 | Ga0395900_0126398 | |||
| 1597 | Ga0395900_0294937 | |||
| 1598 | Ga0395900_0354824 | |||
| 1599 | Ga0395898_0059635 | |||
| 1600 | Ga0395898_0074781 | |||
| 1601 | Ga0395898_0168393 | |||
| 1602 | Ga0395898_0311647 | |||
| 1603 | Ga0395898_0359636 | |||
| 1604 | Ga0395905_0041107 | |||
| 1605 | Ga0395905_0194093 | |||
| 1606 | Ga0395905_0342426 | |||
| 1607 | Ga0436364_0026190 | |||
| 1608 | Ga0436364_0956857 | |||
| 1609 | Ga0395901_0064160 | |||
| 1610 | Ga0395901_0079582 | |||
| 1611 | Ga0395901_0162870 | |||
| 1612 | Ga0395901_0203195 | |||
| 1613 | Ga0395901_0601460 | |||
| 1614 | Ga0436365_0714895 | |||
| 1615 | Ga0436365_0785871 | |||
| 1616 | Ga0436365_1743964 | |||
| 1617 | Ga0436360_0354775 | |||
| 1618 | Ga0436361_0669121 | |||
| 1619 | Ga0436363_0425289 | |||
| 1620 | Ga0436363_0853423 | |||
| 1621 | Ga0436363_1642401 | |||
| 1622 | Ga0436362_0122283 | |||
| 1623 | Ga0436362_0888059 | |||
| 1624 | Ga0436362_1251845 | |||
| 1625 | Ga0439465_0062936 | |||
| 1626 | Ga0451797_1397672 | |||
| 1627 | Ga0451853_1827931 | |||
| 1628 | Ga0439437_005810 | |||
| 1629 | Ga0439448_0005138 | |||
| 1630 | Ga0439448_0006244 | |||
| 1631 | Ga0439450_039612 | |||
| 1632 | Ga0439451_011045 | |||
| 1633 | Ga0439455_0002108 | |||
| 1634 | Ga0439463_004248 | |||
| 1635 | Ga0439459_0001446 | |||
| 1636 | Ga0439464_0003585 | |||
| 1637 | Ga0439464_0081258 | |||
| 1638 | Ga0439460_0004780 | |||
| 1639 | Ga0439440_0017136 | |||
| 1640 | Ga0466966_0029401 | |||
| 1641 | Ga0466966_0029477 | |||
| 1642 | Ga0466966_0077106 | |||
| 1643 | Ga0466966_0093794 | |||
| 1644 | Ga0466966_0108283 | |||
| 1645 | Ga0466968_0218774 | |||
| 1646 | Ga0466970_0159449 | |||
| 1647 | Ga0466959_0353394 | |||
| 1648 | Ga0466959_0398249 | |||
| 1649 | Ga0466958_0027951 | |||
| 1650 | Ga0466967_0026161 | |||
| 1651 | Ga0466967_0180574 | |||
| 1652 | Ga0466967_0774698 | |||
| 1653 | Ga0495592_0001231 | |||
| 1654 | Ga0495592_0005292 | |||
| 1655 | Ga0495592_0008135 | |||
| 1656 | Ga0495592_0010917 | |||
| 1657 | Ga0495592_0035499 | |||
| 1658 | Ga0495592_0081280 | |||
| 1659 | Ga0495592_0157302 | |||
| 1660 | Ga0495592_0203484 | |||
| 1661 | Ga0495603_0006458 | |||
| 1662 | Ga0495603_0021597 | |||
| 1663 | Ga0495629_0029695 | |||
| 1664 | Ga0495629_0057988 | |||
| 1665 | Ga0495629_0093924 | |||
| 1666 | Ga0495629_0540787 | |||
| 1667 | Ga0495641_0020884 | |||
| 1668 | Ga0495641_0023177 | |||
| 1669 | Ga0495641_0056412 | |||
| 1670 | Ga0495641_0060912 | |||
| 1671 | Ga0495651_0001745 | |||
| 1672 | Ga0495651_0008175 | |||
| 1673 | Ga0495651_0013296 | |||
| 1674 | Ga0495651_0025435 | |||
| 1675 | Ga0495651_0041549 | |||
| 1676 | Ga0495651_0044752 | |||
| 1677 | Ga0495651_0044972 | |||
| 1678 | Ga0495651_0197605 | |||
| 1679 | Ga0495653_0035705 | |||
| 1680 | Ga0495653_0038729 | |||
| 1681 | Ga0495653_0090093 | |||
| 1682 | Ga0495653_0090997 | |||
| 1683 | Ga0495653_0191595 | |||
| 1684 | Ga0495653_0243134 | |||
| 1685 | Ga0495580_0008696 | |||
| 1686 | Ga0495580_0020970 | |||
| 1687 | Ga0495580_0166034 | |||
| 1688 | Ga0495580_0256087 | |||
| 1689 | Ga0495582_0011785 | |||
| 1690 | Ga0495582_0023928 | |||
| 1691 | Ga0495605_0041420 | |||
| 1692 | Ga0495639_0014390 | |||
| 1693 | Ga0495639_0028724 | |||
| 1694 | Ga0495639_0048208 | |||
| 1695 | Ga0495662_0001191 | |||
| 1696 | Ga0495662_0008034 | |||
| 1697 | Ga0495662_0018846 | |||
| 1698 | Ga0495662_0071993 | |||
| 1699 | Ga0495662_0107421 | |||
| 1700 | Ga0495662_0121290 | |||
| 1701 | Ga0495664_0002422 | |||
| 1702 | Ga0495664_0005807 | |||
| 1703 | Ga0495664_0011959 | |||
| 1704 | Ga0495664_0019876 | |||
| 1705 | Ga0495664_0020456 | |||
| 1706 | Ga0495594_0010030 | |||
| 1707 | Ga0495594_0021133 | |||
| 1708 | Ga0495594_0064238 | |||
| 1709 | Ga0495596_0014232 | |||
| 1710 | Ga0495607_0008728 | |||
| 1711 | Ga0495608_0004778 | |||
| 1712 | Ga0495608_0022307 | |||
| 1713 | Ga0495608_0031542 | |||
| 1714 | Ga0495608_0140558 | |||
| 1715 | Ga0495608_0207517 | |||
| 1716 | Ga0495608_0371450 | |||
| 1717 | Ga0495616_0028158 | |||
| 1718 | Ga0495618_0001441 | |||
| 1719 | Ga0495618_0019153 | |||
| 1720 | Ga0495618_0026478 | |||
| 1721 | Ga0495618_0027022 | |||
| 1722 | Ga0495618_0032106 | |||
| 1723 | Ga0495618_0075312 | |||
| 1724 | Ga0495628_0004659 | |||
| 1725 | Ga0495628_0021899 | |||
| 1726 | Ga0495628_0022533 | |||
| 1727 | Ga0495628_0034756 | |||
| 1728 | Ga0495628_0040076 | |||
| 1729 | Ga0495628_0301658 | |||
| 1730 | Ga0495628_0320156 | |||
| 1731 | Ga0495628_0515777 | |||
| 1732 | Ga0495630_0001842 | |||
| 1733 | Ga0495630_0008304 | |||
| 1734 | Ga0495630_0010610 | |||
| 1735 | Ga0495630_0029784 | |||
| 1736 | Ga0495630_0033205 | |||
| 1737 | Ga0495630_0043238 | |||
| 1738 | Ga0495630_0049230 | |||
| 1739 | Ga0495630_0380247 | |||
| 1740 | Ga0495631_0013227 | |||
| 1741 | Ga0495631_0044303 | |||
| 1742 | Ga0495631_0049442 | |||
| 1743 | Ga0495631_0082084 | |||
| 1744 | Ga0495663_0042612 | |||
| 1745 | Ga0495666_0007807 | |||
| 1746 | Ga0495666_0019908 | |||
| 1747 | Ga0495666_0059533 | |||
| 1748 | Ga0495666_0103680 | |||
| 1749 | Ga0495652_0001251 | |||
| 1750 | Ga0495652_0015295 | |||
| 1751 | Ga0495652_0016983 | |||
| 1752 | Ga0495652_0039031 | |||
| 1753 | Ga0495652_0070003 | |||
| 1754 | Ga0495652_0121799 | |||
| 1755 | Ga0495652_0131330 | |||
| 1756 | Ga0495652_0282210 | |||
| 1757 | Ga0495665_0000445 | |||
| 1758 | Ga0495665_0043861 | |||
| 1759 | Ga0495665_0112845 | |||
| 1760 | Ga0495640_0023758 | |||
| 1761 | Ga0495640_0029488 | |||
| 1762 | Ga0495640_0050918 | |||
| 1763 | Ga0495640_0061433 | |||
| 1764 | Ga0495640_0075802 | |||
| 1765 | Ga0495640_0332265 | |||
| 1766 | Ga0495586_0008692 | |||
| 1767 | Ga0495586_0032054 | |||
| 1768 | Ga0495586_0369721 | |||
| 1769 | Ga0495587_0000412 | |||
| 1770 | Ga0495587_0000539 | |||
| 1771 | Ga0495587_0015132 | |||
| 1772 | Ga0495587_0080542 | |||
| 1773 | Ga0495587_0176368 | |||
| 1774 | Ga0495587_0212711 | |||
| 1775 | Ga0495587_0287804 | |||
| 1776 | Ga0495598_0003384 | |||
| 1777 | Ga0495598_0096023 | |||
| 1778 | Ga0495621_0011140 | |||
| 1779 | Ga0495597_0181419 | |||
| 1780 | Ga0495645_0001433 | |||
| 1781 | Ga0495645_0001863 | |||
| 1782 | Ga0495645_0003140 | |||
| 1783 | Ga0495645_0032288 | |||
| 1784 | Ga0495645_0041308 | |||
| 1785 | Ga0495645_0141130 | |||
| 1786 | Ga0495622_0011214 | |||
| 1787 | Ga0495667_0001115 | |||
| 1788 | Ga0495667_0002439 | |||
| 1789 | Ga0495667_0012121 | |||
| 1790 | Ga0495667_0013378 | |||
| 1791 | Ga0495667_0023000 | |||
| 1792 | Ga0495667_0029679 | |||
| 1793 | Ga0495667_0077704 | |||
| 1794 | Ga0495667_0092965 | |||
| 1795 | Ga0495667_0159008 | |||
| 1796 | Ga0495656_0208210 | |||
| 1797 | Ga0495668_0026217 | |||
| 1798 | Ga0495668_0212142 | |||
| 1799 | Ga0495634_0023608 | |||
| 1800 | Ga0495634_0023825 | |||
| 1801 | Ga0495634_0027779 | |||
| 1802 | Ga0495634_0037102 | |||
| 1803 | Ga0495634_0064968 | |||
| 1804 | Ga0495634_0085250 | |||
| 1805 | Ga0495634_0195841 | |||
| 1806 | Ga0495634_0239817 | |||
| 1807 | Ga0495635_0008637 | |||
| 1808 | Ga0495635_0024838 | |||
| 1809 | Ga0495635_0029679 | |||
| 1810 | Ga0495635_0032425 | |||
| 1811 | Ga0495635_0036669 | |||
| 1812 | Ga0495635_0053316 | |||
| 1813 | Ga0495635_0090437 | |||
| 1814 | Ga0495635_0100730 | |||
| 1815 | Ga0495588_0011852 | |||
| 1816 | Ga0495588_0045462 | |||
| 1817 | Ga0495588_0114713 | |||
| 1818 | Ga0495657_0006095 | |||
| 1819 | Ga0495657_0017298 | |||
| 1820 | Ga0495657_0031745 | |||
| 1821 | Ga0495657_0040649 | |||
| 1822 | Ga0495657_0086071 | |||
| 1823 | Ga0495599_0004111 | |||
| 1824 | Ga0495599_0012943 | |||
| 1825 | Ga0495599_0019198 | |||
| 1826 | Ga0495599_0021962 | |||
| 1827 | Ga0495599_0100637 | |||
| 1828 | Ga0495599_0136484 | |||
| 1829 | Ga0495599_0185631 | |||
| 1830 | Ga0495599_0261843 | |||
| 1831 | Ga0495599_0295107 | |||
| 1832 | Ga0495623_0000446 | |||
| 1833 | Ga0495623_0003870 | |||
| 1834 | Ga0495623_0004008 | |||
| 1835 | Ga0495623_0024774 | |||
| 1836 | Ga0495623_0028584 | |||
| 1837 | Ga0495646_0000857 | |||
| 1838 | Ga0495646_0006001 | |||
| 1839 | Ga0495646_0028261 | |||
| 1840 | Ga0495646_0043110 | |||
| 1841 | Ga0495646_0047322 | |||
| 1842 | Ga0495646_0067494 | |||
| 1843 | Ga0495646_0114086 | |||
| 1844 | Ga0495646_0250652 | |||
| 1845 | Ga0495647_0006828 | |||
| 1846 | Ga0495647_0073185 | |||
| 1847 | Ga0495647_0093071 | |||
| 1848 | Ga0495658_0006627 | |||
| 1849 | Ga0495658_0047804 | |||
| 1850 | Ga0495613_0010427 | |||
| 1851 | Ga0495613_0088997 | |||
| 1852 | Ga0495613_0155673 | |||
| 1853 | Ga0495624_0019793 | |||
| 1854 | Ga0495624_0029900 | |||
| 1855 | Ga0495624_0061984 | |||
| 1856 | Ga0495624_0349769 | |||
| 1857 | Ga0495671_0029262 | |||
| 1858 | Ga0495671_0046106 | |||
| 1859 | Ga0495589_0141938 | |||
| 1860 | Ga0495600_0000409 | |||
| 1861 | Ga0495600_0000926 | |||
| 1862 | Ga0495600_0021620 | |||
| 1863 | Ga0495600_0022013 | |||
| 1864 | Ga0495600_0022699 | |||
| 1865 | Ga0495600_0214919 | |||
| 1866 | Ga0495660_0041710 | |||
| 1867 | Ga0495581_0005427 | |||
| 1868 | Ga0495581_0021470 | |||
| 1869 | Ga0495581_0024290 | |||
| 1870 | Ga0495581_0070672 | |||
| 1871 | Ga0495581_0105958 | |||
| 1872 | Ga0495581_0228222 | |||
| 1873 | Ga0495604_0000819 | |||
| 1874 | Ga0495604_0000876 | |||
| 1875 | Ga0495604_0001125 | |||
| 1876 | Ga0495604_0009984 | |||
| 1877 | Ga0495604_0012815 | |||
| 1878 | Ga0495604_0021731 | |||
| 1879 | Ga0495604_0149651 | |||
| 1880 | Ga0495604_0208856 | |||
| 1881 | Ga0495674_0010662 | |||
| 1882 | Ga0495674_0015023 | |||
| 1883 | Ga0495674_0030709 | |||
| 1884 | Ga0495674_0044565 | |||
| 1885 | Ga0495674_0051767 | |||
| 1886 | Ga0495674_0087407 | |||
| 1887 | Ga0495674_0089660 | |||
| 1888 | Ga0495674_0212074 | |||
| 1889 | Ga0495676_0033365 | |||
| 1890 | Ga0495676_0047872 | |||
| 1891 | Ga0495676_0078295 | |||
| 1892 | Ga0495676_0154404 | |||
| 1893 | Ga0495680_0003017 | |||
| 1894 | Ga0495680_0013606 | |||
| 1895 | Ga0495680_0043716 | |||
| 1896 | Ga0495680_0078213 | |||
| 1897 | Ga0495680_0082761 | |||
| 1898 | Ga0495680_0121106 | |||
| 1899 | Ga0495680_0331707 | |||
| 1900 | Ga0495675_0000446 | |||
| 1901 | Ga0495675_0004030 | |||
| 1902 | Ga0495675_0024763 | |||
| 1903 | Ga0495675_0025867 | |||
| 1904 | Ga0495677_0019996 | |||
| 1905 | Ga0495685_067021 | |||
| 1906 | Ga0495684_0001931 | |||
| 1907 | Ga0495684_0006538 | |||
| 1908 | Ga0495684_0010771 | |||
| 1909 | Ga0495684_0020791 | |||
| 1910 | Ga0495684_0138748 | |||
| 1911 | Ga0495593_0002270 | |||
| 1912 | Ga0495593_0022735 | |||
| 1913 | Ga0495593_0067614 | |||
| 1914 | Ga0495602_0004263 | |||
| 1915 | Ga0495602_0013534 | |||
| 1916 | Ga0495602_0021648 | |||
| 1917 | Ga0495602_0126727 | |||
| 1918 | Ga0495602_0253677 | |||
| 1919 | Ga0495602_0338788 | |||
| 1920 | Ga0495614_0006675 | |||
| 1921 | Ga0495614_0010643 | |||
| 1922 | Ga0495614_0131514 | |||
| 1923 | Ga0496100_0031621 | |||
| 1924 | Ga0496100_0108650 | |||
| 1925 | Ga0496101_0052186 | |||
| 1926 | Ga0496101_0130191 | |||
| 1927 | Ga0496101_0460700 | |||
| 1928 | Ga0496102_0027189 | |||
| 1929 | Ga0496102_0050319 | |||
| 1930 | Ga0496102_0066199 | |||
| 1931 | Ga0496102_0466827 | |||
| 1932 | Ga0496103_0020438 | |||
| 1933 | Ga0496103_0033231 | |||
| 1934 | Ga0496103_0232208 | |||
| 1935 | Ga0496104_0034424 | |||
| 1936 | Ga0496104_0064798 | |||
| 1937 | Ga0496104_0399504 | |||
| 1938 | Ga0496104_0433156 | |||
| 1939 | Ga0496105_0057680 | |||
| 1940 | Ga0496105_0192360 | |||
| 1941 | Ga0496105_0432745 | |||
| 1942 | Ga0496106_0039137 | |||
| 1943 | Ga0496106_0048839 | |||
| 1944 | Ga0496106_0472156 | |||
| 1945 | Ga0496107_0043357 | |||
| 1946 | Ga0496108_0038147 | |||
| 1947 | Ga0496108_0041954 | |||
| 1948 | Ga0496108_0048757 | |||
| 1949 | Ga0496108_0051532 | |||
| 1950 | Ga0496108_0258918 | |||
| 1951 | Ga0496109_0043284 | |||
| 1952 | Ga0496109_0045135 | |||
| 1953 | Ga0496109_0053510 | |||
| 1954 | Ga0496109_0063826 | |||
| 1955 | Ga0496109_0274065 | |||
| 1956 | Ga0496109_0873220 | |||
| 1957 | Ga0496110_0043825 | |||
| 1958 | Ga0496110_0047930 | |||
| 1959 | Ga0496110_0056814 | |||
| 1960 | Ga0496110_0178257 | |||
| 1961 | Ga0496110_0322439 | |||
| 1962 | Ga0496111_0021795 | |||
| 1963 | Ga0496111_0035721 | |||
| 1964 | Ga0496111_0040446 | |||
| 1965 | Ga0496112_0064853 | |||
| 1966 | Ga0496112_0071366 | |||
| 1967 | Ga0496112_0075976 | |||
| 1968 | Ga0496112_0492319 | |||
| 1969 | Ga0496113_0039225 | |||
| 1970 | Ga0496113_0345983 | |||
| 1971 | Ga0496114_0015468 | |||
| 1972 | Ga0496114_0017612 | |||
| 1973 | Ga0496114_0420090 | |||
| 1974 | Ga0496114_0457293 | |||
| 1975 | Ga0496115_0043548 | |||
| 1976 | Ga0496116_0036541 | |||
| 1977 | Ga0496117_0012267 | |||
| 1978 | Ga0496118_0045320 | |||
| 1979 | Ga0496119_0029804 | |||
| 1980 | Ga0496120_0034757 | |||
| 1981 | Ga0501031_0061816 | |||
| 1982 | Ga0501031_0248045 | |||
| 1983 | Ga0501032_0179472 | |||
| 1984 | Ga0501033_0213512 | |||
| 1985 | Ga0501034_0698266 | |||
| 1986 | Ga0501036_0008547 | |||
| 1987 | Ga0501036_0146093 | |||
| 1988 | Ga0501036_0338075 | |||
| 1989 | Ga0501037_0078990 | |||
| 1990 | Ga0501038_0019168 | |||
| 1991 | Ga0501038_0058384 | |||
| 1992 | Ga0501039_0048272 | |||
| 1993 | Ga0501039_0159359 | |||
| 1994 | Ga0501039_0357659 | |||
| 1995 | Ga0501040_0034221 | |||
| 1996 | Ga0501040_0052966 | |||
| 1997 | Ga0501040_0256191 | |||
| 1998 | Ga0501041_0002071 | |||
| 1999 | Ga0501041_0250475 | |||
| 2000 | Ga0501042_0040235 | |||
| 2001 | Ga0501042_0126767 | |||
| 2002 | Ga0501042_0411797 | |||
| 2003 | Ga0501043_0043716 | |||
| 2004 | Ga0501043_0092820 | |||
| 2005 | Ga0501043_0327476 | |||
| 2006 | Ga0501046_0172361 | |||
| 2007 | Ga0501046_0314638 | |||
| 2008 | Ga0501047_0049780 | |||
| 2009 | Ga0501048_0021552 | |||
| 2010 | Ga0501048_0042636 | |||
| 2011 | Ga0501048_0150438 | |||
| 2012 | Ga0501048_0221423 | |||
| 2013 | Ga0501070_0435359 | |||
| 2014 | Ga0501071_0425873 | |||
| 2015 | Ga0501072_0217566 | |||
| 2016 | Ga0501072_0324942 | |||
| 2017 | Ga0501074_0017670 | |||
| 2018 | Ga0501074_0073969 | |||
| 2019 | Ga0501075_0038226 | |||
| 2020 | Ga0501075_0278246 | |||
| 2021 | Ga0501075_0356611 | |||
| 2022 | Ga0501076_0002605 | |||
| 2023 | Ga0501076_0190855 | |||
| 2024 | Ga0501076_0198382 | |||
| 2025 | Ga0501077_0138159 | |||
| 2026 | Ga0501079_0038092 | |||
| 2027 | Ga0501079_0038394 | |||
| 2028 | Ga0501079_0397216 | |||
| 2029 | Ga0501080_0569333 | |||
| 2030 | Ga0501081_0015277 | |||
| 2031 | Ga0501081_0034956 | |||
| 2032 | Ga0501081_0047658 | |||
| 2033 | Ga0501081_0241059 | |||
| 2034 | Ga0501083_0221553 | |||
| 2035 | Ga0501268_017421 | |||
| 2036 | Ga0501035_0062810 | |||
| 2037 | Ga0501035_0283826 | |||
| 2038 | Ga0501035_0415489 | |||
| 2039 | Ga0501044_0071214 | |||
| 2040 | Ga0501045_0004503 | |||
| 2041 | Ga0501045_0060279 | |||
| 2042 | Ga0501045_0075612 | |||
| 2043 | Ga0501045_0143084 | |||
| 2044 | nmdc:mga05p37_10885_c1 | |||
| 2045 | nmdc:mga05p37_17938_c2 | |||
| 2046 | nmdc:mga05p37_390747_c1 | |||
| 2047 | nmdc:mga05p37_53953_c1 | |||
| 2048 | nmdc:mga09592_18277_c1 | |||
| 2049 | nmdc:mga09592_26866_c1 | |||
| 2050 | nmdc:mga09592_47527_c1 | |||
| 2051 | nmdc:mga0qj67_10601_c1 | |||
| 2052 | nmdc:mga0qj67_415_c1 | |||
| 2053 | nmdc:mga0qj67_41855_c1 | |||
| 2054 | nmdc:mga06r32_13500_c1 | |||
| 2055 | nmdc:mga06r32_18555_c2 | |||
| 2056 | nmdc:mga06r32_73270_c1 | |||
| 2057 | nmdc:mga06r32_7479_c1 | |||
| 2058 | nmdc:mga0rr50_181050_c1 | |||
| 2059 | nmdc:mga0rr50_391843_c1 | |||
| 2060 | nmdc:mga0rr50_605112_c1 | |||
| 2061 | nmdc:mga0a205_200466_c1 | |||
| 2062 | Ga0495601_0012227 | |||
| 2063 | Ga0495601_0013328 | |||
| 2064 | Ga0495601_0044254 | |||
| 2065 | Ga0495601_0260685 | |||
| 2066 | Ga0495612_0003749 | |||
| 2067 | Ga0495595_0006043 | |||
| 2068 | Ga0495595_0014305 | |||
| 2069 | Ga0495595_0051442 | |||
| 2070 | Ga0495595_0086137 | |||
| 2071 | Ga0495595_0138443 | |||
| 2072 | Ga0495595_0256166 | |||
| 2073 | Ga0495619_0024726 | |||
| 2074 | Ga0495619_0029196 | |||
| 2075 | Ga0495619_0033968 | |||
| 2076 | Ga0495619_0230984 | |||
| 2077 | Ga0500646_0005538 | |||
| 2078 | Ga0500660_040572 | |||
| 2079 | Ga0500569_002159 | |||
| 2080 | Ga0500588_0003099 | |||
| 2081 | Ga0500600_0022641 | |||
| 2082 | Ga0500600_0025625 | |||
| 2083 | Ga0501084_0050826 | |||
| 2084 | Ga0501084_0059069 | |||
| 2085 | Ga0501084_0176138 | |||
| 2086 | Ga0501082_0050322 | |||
| 2087 | Ga0501082_0064550 | |||
| 2088 | Ga0501082_0090565 | |||
| 2089 | Ga0501082_0387874 | |||
| 2090 | Ga0530510_0006051 | |||
| 2091 | Ga0530510_0007140 | |||
| 2092 | Ga0530510_0322946 | |||
| 2093 | Ga0530510_0409829 | |||
| 2094 | Ga0530510_0511870 | |||
| 2095 | 2517759910 | |||
| 2096 | 2517760979 | |||
| 2097 | 2517761337 | |||
| 2098 | 2689959666 | |||
| 2099 | 2753266097 | |||
| 2100 | 2753272878 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1fnn-assembly2.cif.gz_B | crystal structure of cdc6p from pyrobaculum aerophilum | 0.7515 | 16 | 255 |
| 1in8-assembly1.cif.gz_A | thermotoga maritima ruvb t158v | 0.7494 | 31 | 267 |
| 7svu-assembly1.cif.gz_K | tnsbctd-tnsc-tniq complex | 0.7454 | 4 | 266 |
| 1sxj-assembly1.cif.gz_C | crystal structure of the eukaryotic clamp loader (replication factor c, rfc) bound to the dna sliding clamp (proliferating cell nuclear antigen, pcna) | 0.7447 | 13 | 263 |
| 4jpo-assembly3.cif.gz_C | 5a resolution structure of proteasome assembly chaperone hsm3 in complex with a c-terminal fragment of rpt1 | 0.7446 | 215 | 266 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6XFD1_186_270_1.10.8.60 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 1.001 | 186 | 270 | 1.10.8.60 |
| af_I6XFD1_25_185_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9993 | 25 | 185 | 3.40.50.300 |
| af_I6XFD1_25_185_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9931 | 25 | 185 | 3.40.50.300 |
| af_I6XFD1_186_270_1.10.8.60 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9891 | 186 | 270 | 1.10.8.60 |
| 4ww0B02 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9241 | 236 | 266 | 1.10.8.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7U9PML5-F1-model_v4 | deleted | 0.9951 | 2 | 270 |
|
| AF-A0A5C7MJ14-F1-model_v4 | DUF2075 domain-containing protein | 0.9943 | 1 | 238 |
GO:0016887
|
| AF-A0A7U9PML5-F1-model_v4 | deleted | 0.9878 | 2 | 270 |
|
| AF-T0ZGB4-F1-model_v4 | AAA ATPase | 0.9865 | 41 | 270 |
GO:0016887
|
| AF-A0A5C7MJ14-F1-model_v4 | DUF2075 domain-containing protein | 0.9861 | 1 | 238 |
GO:0016887
|