F489027
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1049 | 474 | 2092 | 459 |
Family's Representative Sequence
| Representative Sequence | 3300026041|Ga0207639_10141064|Ga0207639_101410642 |
| Length | 537 |
| Sequence | MSLHSESIRMRTKSMQVTSDTIYALSSGGLPSGVAVIRMSGAKALEVTESLAGSLPAARQAVLKTIRTRNGLILDRGLVLIFPGPNSFTGEDCAEIHVHGGKAVVAALLAVLLTNPAWVLPMFSGIFMEKMVGFVKLYFPVFMLGAIFGKVIELSGFSQSIVSAVIKIVGRERAMLSIVLVCAILTYGGVSLFVVVFAVYPFAAEMFRQSDIPKRLIPGTIALGAFTFTMDALPGTPQIQNIIPTTFFNTTAYAAPWLGIIGAVFILVVGLAYLEWRRRQAAAKHEGYGSGHTNEPDPVSEAELPNPVVAIIPLILVGVLNKVFTQAIPAAFGSSFTIPVPDHPVTVQVTPLAAIWAVEGALLVGILSVLAFRFRTVISKFAEGTKAAVAGSLLASMNTASEYGFGGVIAALPGFLVVSDALRAIPNPLFNEAVTVTVLAGITGSASGGMSIALAAMSDTFVQAANAANIPLEVLHRVASMASGGMDTLPHNGAVITLLAVTGLTHRQSYGDVFAITCIKTLAVAVAIGAYYLFGIV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 7 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 8 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 14 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 69 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 71 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 72 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 73 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 120 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 193 | 3300030083 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 | Metagenome | Unclassified |
| 194 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 195 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 196 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 197 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 199 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 200 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 201 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 202 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 206 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 207 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 210 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 211 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 212 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 213 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 214 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 215 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 218 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 219 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 220 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 221 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 222 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 223 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 224 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 225 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 226 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 227 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 228 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 229 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 230 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 231 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 232 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 233 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 234 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 235 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 325 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 326 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 327 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 328 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 329 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 330 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 333 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 334 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 335 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 336 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 337 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 338 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 339 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 340 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 341 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 342 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 343 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 353 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 355 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 356 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 357 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 358 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 363 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 366 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 369 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 370 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 371 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 372 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 373 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 374 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 375 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 376 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 377 | 2545555800 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 378 | 2551306352 | Acinetobacter sp. GG2 | Isolate | Rhizosphere |
| 379 | 2576861599 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 380 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 381 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 382 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 383 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 384 | 2630968484 | Bacillus methylotrophicus KACC 13105 | Isolate | Rhizosphere |
| 385 | 2639762793 | Acinetobacter calcoaceticus GK1 | Isolate | Rhizosphere |
| 386 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 387 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 388 | 2643221665 | Acinetobacter sp. Root1280 | Isolate | Unclassified |
| 389 | 2643221729 | Bacillus sp. Root11 | Isolate | Unclassified |
| 390 | 2643221730 | Bacillus sp. Root131 | Isolate | Unclassified |
| 391 | 2648501850 | Bacillus amyloliquefaciens RHNK22 | Isolate | Rhizosphere |
| 392 | 2671180844 | Bacillus amyloliquefaciens Bs006 | Isolate | Unclassified |
| 393 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 394 | 2675903507 | Acinetobacter calcoaceticus GK2 | Isolate | Unclassified |
| 395 | 2684622632 | Bacillus cereus 905 | Isolate | Unclassified |
| 396 | 2695420354 | Bacillus sp. Co1-6 | Isolate | Unclassified |
| 397 | 2695420987 | Bacillus thuringiensis KNU-07 | Isolate | Unclassified |
| 398 | 2703719227 | Bacillus mycoides GOE6 | Isolate | Rhizosphere |
| 399 | 2716884898 | Bacillus methylotrophicus FKM10 | Isolate | Rhizosphere |
| 400 | 2718218445 | Bacillus sp. B25(2016b) | Isolate | Rhizosphere |
| 401 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 402 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 403 | 2738541295 | Bacillus sp. OK085 | Isolate | Unclassified |
| 404 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 405 | 2738541358 | Bacillus sp. OV752 | Isolate | Unclassified |
| 406 | 2738543006 | Bacillus sp. OK077 | Isolate | Unclassified |
| 407 | 2738543017 | Bacillus sp. OV186 | Isolate | Unclassified |
| 408 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 409 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 410 | 2744054655 | Acinetobacter sp. BMW17 | Isolate | Unclassified |
| 411 | 2773857761 | Acinetobacter sp. 3664 | Isolate | Unclassified |
| 412 | 2773857770 | Acinetobacter sp. 3636 | Isolate | Unclassified |
| 413 | 2791355199 | |||
| 414 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 415 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 416 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 417 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 418 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 419 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 420 | 2818991443 | Bacillus thuringiensis 1230 | Isolate | Unclassified |
| 421 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 422 | 2857581216 | Bacillus sp. R-71922 | Isolate | Unclassified |
| 423 | 2857604169 | Domibacillus sp. R-71921 | Isolate | Unclassified |
| 424 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 425 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 426 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 427 | 2877768649 | Bacillus amyloliquefaciens Y14 | Isolate | Rhizosphere |
| 428 | 2880169592 | Bacillus velezensis T20E-257 | Isolate | Unclassified |
| 429 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 430 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 431 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 432 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 433 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 434 | 2916699645 | Acinetobacter ursingii M3 | Isolate | Unclassified |
| 435 | 2919182534 | Acinetobacter calcoaceticus 2589 | Isolate | Rhizosphere |
| 436 | 2919414237 | Neobacillus niacini 3240 | Isolate | Rhizosphere |
| 437 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 438 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 439 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 440 | 2928515477 | Acinetobacter bereziniae 1375 | Isolate | Rhizosphere |
| 441 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 442 | 2936361878 | Neobacillus endophyticus BRMEA1 | Isolate | Unclassified |
| 443 | 2938917290 | Bacillus sp. CR71 | Isolate | Unclassified |
| 444 | 2947426588 | Bacillus sp. RZ2MS9 | Isolate | Rhizosphere |
| 445 | 2965761152 | Bacillus sp. COPE52 | Isolate | Unclassified |
| 446 | 2969141011 | Bacillus velezensis MH25 | Isolate | Unclassified |
| 447 | 2971893375 | Bacillus sp. HNA3 | Isolate | Rhizosphere |
| 448 | 2979083700 | Bacillus toyonensis SORGH_AS 407 | Isolate | Unclassified |
| 449 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 450 | 2984568884 | Acinetobacter baylyi SORGH_AS893 | Isolate | Aerial Root |
| 451 | 3001892409 | Neobacillus rhizophilus FJAT-49825 | Isolate | Rhizosphere |
| 452 | 3006879489 | Bacillus atrophaeus UCMB-5137 | Isolate | Rhizosphere |
| 453 | 3006973921 | Bacillus sp. FJAT-49736 | Isolate | Rhizosphere |
| 454 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 455 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 456 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 457 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 458 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 459 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 460 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 461 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 462 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 463 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 464 | 8022621104 | Bacillus sp. PIC28 | Isolate | Rhizosphere |
| 465 | 8022630665 | Bacillus sp. PW192 | Isolate | Rhizosphere |
| 466 | 8022792930 | Bacillus sp. Xin | Isolate | Rhizosphere |
| 467 | 8022948649 | Bacillus endophyticus FH5 | Isolate | Rhizosphere |
| 468 | 8023438354 | Bacillus sp. BH2 | Isolate | Unclassified |
| 469 | 8023444577 | Bacillus sp. BH32 | Isolate | Unclassified |
| 470 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 471 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 472 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 473 | 8054280661 | Metabacillus kandeliae GX 13764 | Isolate | Rhizosphere |
| 474 | 8057582654 | Bacillus arachidis YX15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.98 |
| Metatranscriptomes | 0.1 |
| Isolates | 9.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.1 |
| Bulb | 0 |
| Endosphere | 6.39 |
| Nodule | 0.48 |
| Rhizoplane | 7.05 |
| Rhizosphere | 78.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207639_10141064 | 3300026041 | Bacteria | 2008 |
| 2 | JGI24736J21556_1010749 | 3300001904 | Bacteria | 1494 |
| 3 | JGI24739J22299_10003563 | 3300001989 | Bacteria | 5950 |
| 4 | JGI24735J21928_10023965 | 3300002067 | Bacteria | 1849 |
| 5 | JGI25159J45721_1001328 | 3300002987 | Bacteria | 10397 |
| 6 | JGI25159J45721_1011754 | 3300002987 | Bacteria | 2125 |
| 7 | JGI25151J46595_10000302 | 3300003187 | Bacteria | 54102 |
| 8 | JGI25151J46595_10002843 | 3300003187 | Bacteria | 9968 |
| 9 | JGI25151J46595_10006202 | 3300003187 | Bacteria | 6050 |
| 10 | JGI25151J46595_10009043 | 3300003187 | Bacteria | 4749 |
| 11 | JGI25404J52841_10002675 | 3300003659 | Bacteria | 3406 |
| 12 | Ga0055532_1000540 | 3300003758 | Bacteria | 16246 |
| 13 | Ga0055535_1000950 | 3300003761 | Bacteria | 19231 |
| 14 | Ga0055535_1000957 | 3300003761 | Bacteria | 19044 |
| 15 | Ga0055542_1000942 | 3300003762 | Bacteria | 19128 |
| 16 | Ga0055542_1000996 | 3300003762 | Bacteria | 18199 |
| 17 | Ga0055529_1000599 | 3300003763 | Bacteria | 28042 |
| 18 | Ga0055528_1007778 | 3300003790 | Bacteria | 4689 |
| 19 | Ga0058692_1000003 | 3300003856 | Bacteria | 435295 |
| 20 | Ga0058692_1000514 | 3300003856 | Bacteria | 17096 |
| 21 | Ga0065703_1000186 | 3300005272 | Bacteria | 19273 |
| 22 | Ga0065715_10006850 | 3300005293 | Bacteria | 2982 |
| 23 | Ga0065715_10126718 | 3300005293 | Bacteria | 2102 |
| 24 | Ga0065707_10092100 | 3300005295 | Bacteria | 3827 |
| 25 | Ga0070658_10014788 | 3300005327 | Bacteria | 6254 |
| 26 | Ga0070658_10066708 | 3300005327 | Bacteria | 2940 |
| 27 | Ga0070676_10008061 | 3300005328 | Bacteria | 5664 |
| 28 | Ga0070676_10025909 | 3300005328 | Bacteria | 3318 |
| 29 | Ga0070683_100214243 | 3300005329 | Bacteria | 1830 |
| 30 | Ga0070670_100002371 | 3300005331 | Bacteria | 15528 |
| 31 | Ga0070670_100013676 | 3300005331 | Bacteria | 6955 |
| 32 | Ga0070677_10010142 | 3300005333 | Bacteria | 3214 |
| 33 | Ga0068869_100028039 | 3300005334 | Bacteria | 3930 |
| 34 | Ga0068869_100029359 | 3300005334 | Bacteria | 3852 |
| 35 | Ga0068869_100155521 | 3300005334 | Bacteria | 1776 |
| 36 | Ga0070666_10007027 | 3300005335 | Bacteria | 6940 |
| 37 | Ga0070666_10020818 | 3300005335 | Bacteria | 4243 |
| 38 | Ga0068868_100028335 | 3300005338 | Bacteria | 4281 |
| 39 | Ga0070660_100000011 | 3300005339 | Bacteria | 133167 |
| 40 | Ga0070660_100001582 | 3300005339 | Bacteria | 15657 |
| 41 | Ga0070689_100002194 | 3300005340 | Bacteria | 12662 |
| 42 | Ga0070689_100028264 | 3300005340 | Bacteria | 4237 |
| 43 | Ga0070689_100143446 | 3300005340 | Bacteria | 1922 |
| 44 | Ga0070687_100004523 | 3300005343 | Bacteria | 5553 |
| 45 | Ga0070687_100031771 | 3300005343 | Bacteria | 2592 |
| 46 | Ga0070661_100011088 | 3300005344 | Bacteria | 6277 |
| 47 | Ga0070668_100012511 | 3300005347 | Bacteria | 6320 |
| 48 | Ga0070668_100029711 | 3300005347 | Bacteria | 4152 |
| 49 | Ga0070669_100007114 | 3300005353 | Bacteria | 8041 |
| 50 | Ga0070669_100041553 | 3300005353 | Bacteria | 3344 |
| 51 | Ga0070675_100009300 | 3300005354 | Bacteria | 7641 |
| 52 | Ga0070675_100033951 | 3300005354 | Bacteria | 4138 |
| 53 | Ga0070675_100133441 | 3300005354 | Bacteria | 2118 |
| 54 | Ga0070671_100004493 | 3300005355 | Bacteria | 11041 |
| 55 | Ga0070671_100008194 | 3300005355 | Bacteria | 8362 |
| 56 | Ga0070671_100025982 | 3300005355 | Bacteria | 4809 |
| 57 | Ga0070671_100026508 | 3300005355 | Bacteria | 4764 |
| 58 | Ga0070671_100045731 | 3300005355 | Bacteria | 3639 |
| 59 | Ga0070674_100007285 | 3300005356 | Bacteria | 6514 |
| 60 | Ga0070674_100073043 | 3300005356 | Bacteria | 2431 |
| 61 | Ga0070674_100106398 | 3300005356 | Bacteria | 2053 |
| 62 | Ga0070674_100108965 | 3300005356 | Bacteria | 2030 |
| 63 | Ga0070673_100056654 | 3300005364 | Bacteria | 3093 |
| 64 | Ga0070673_100101450 | 3300005364 | Bacteria | 2371 |
| 65 | Ga0070673_100158745 | 3300005364 | Bacteria | 1921 |
| 66 | Ga0070673_100180477 | 3300005364 | Bacteria | 1807 |
| 67 | Ga0070688_100012818 | 3300005365 | Bacteria | 4708 |
| 68 | Ga0070688_100079715 | 3300005365 | Bacteria | 2116 |
| 69 | Ga0070659_100000046 | 3300005366 | Bacteria | 101294 |
| 70 | Ga0070667_100019267 | 3300005367 | Bacteria | 5660 |
| 71 | Ga0070667_100020656 | 3300005367 | Bacteria | 5468 |
| 72 | Ga0070667_100078148 | 3300005367 | Bacteria | 2827 |
| 73 | Ga0070714_100004759 | 3300005435 | Bacteria | 10278 |
| 74 | Ga0070714_100051982 | 3300005435 | Bacteria | 3494 |
| 75 | Ga0070713_100006956 | 3300005436 | Bacteria | 7897 |
| 76 | Ga0070710_10003340 | 3300005437 | Bacteria | 7607 |
| 77 | Ga0070701_10023487 | 3300005438 | Bacteria | 2970 |
| 78 | Ga0070701_10061407 | 3300005438 | Bacteria | 1982 |
| 79 | Ga0070663_100000063 | 3300005455 | Bacteria | 45665 |
| 80 | Ga0070663_100020753 | 3300005455 | Bacteria | 4353 |
| 81 | Ga0070663_100024576 | 3300005455 | Bacteria | 4057 |
| 82 | Ga0070678_100001468 | 3300005456 | Bacteria | 12574 |
| 83 | Ga0070678_100039647 | 3300005456 | Bacteria | 3325 |
| 84 | Ga0070678_100065415 | 3300005456 | Bacteria | 2700 |
| 85 | Ga0070678_100115189 | 3300005456 | Bacteria | 2110 |
| 86 | Ga0070662_100000746 | 3300005457 | Bacteria | 19937 |
| 87 | Ga0070662_100009332 | 3300005457 | Bacteria | 6411 |
| 88 | Ga0070662_100078865 | 3300005457 | Bacteria | 2447 |
| 89 | Ga0070698_100036419 | 3300005471 | Bacteria | 5083 |
| 90 | Ga0070699_100017573 | 3300005518 | Bacteria | 6141 |
| 91 | Ga0070684_100044662 | 3300005535 | Bacteria | 3833 |
| 92 | Ga0068853_100005112 | 3300005539 | Bacteria | 10250 |
| 93 | Ga0070672_100006518 | 3300005543 | Bacteria | 7847 |
| 94 | Ga0070672_100018830 | 3300005543 | Bacteria | 5000 |
| 95 | Ga0070672_100020435 | 3300005543 | Bacteria | 4829 |
| 96 | Ga0070672_100025433 | 3300005543 | Bacteria | 4390 |
| 97 | Ga0070672_100079324 | 3300005543 | Bacteria | 2628 |
| 98 | Ga0070693_100014050 | 3300005547 | Bacteria | 4092 |
| 99 | Ga0070665_100000715 | 3300005548 | Bacteria | 44234 |
| 100 | Ga0070665_100006096 | 3300005548 | Bacteria | 12324 |
| 101 | Ga0070665_100112820 | 3300005548 | Bacteria | 2721 |
| 102 | Ga0070704_100025051 | 3300005549 | Bacteria | 3923 |
| 103 | Ga0068855_100002337 | 3300005563 | Bacteria | 23417 |
| 104 | Ga0068855_100121702 | 3300005563 | Bacteria | 2986 |
| 105 | Ga0068855_100346575 | 3300005563 | Bacteria | 1637 |
| 106 | Ga0070664_100003047 | 3300005564 | Bacteria | 13550 |
| 107 | Ga0070664_100009550 | 3300005564 | Bacteria | 7865 |
| 108 | Ga0070664_100074450 | 3300005564 | Bacteria | 2915 |
| 109 | Ga0070664_100100451 | 3300005564 | Bacteria | 2515 |
| 110 | Ga0068857_100152426 | 3300005577 | Bacteria | 2095 |
| 111 | Ga0068854_100016430 | 3300005578 | Bacteria | 4934 |
| 112 | Ga0068854_100083566 | 3300005578 | Bacteria | 2361 |
| 113 | Ga0068856_100009139 | 3300005614 | Bacteria | 9635 |
| 114 | Ga0068856_100009908 | 3300005614 | Bacteria | 9255 |
| 115 | Ga0068852_100002152 | 3300005616 | Bacteria | 13527 |
| 116 | Ga0068852_100019337 | 3300005616 | Bacteria | 5387 |
| 117 | Ga0068852_100039576 | 3300005616 | Bacteria | 3970 |
| 118 | Ga0068852_100068611 | 3300005616 | Bacteria | 3104 |
| 119 | Ga0068864_100032982 | 3300005618 | Bacteria | 4401 |
| 120 | Ga0068864_100075934 | 3300005618 | Bacteria | 2935 |
| 121 | Ga0068864_100090244 | 3300005618 | Bacteria | 2701 |
| 122 | Ga0068866_10004439 | 3300005718 | Bacteria | 5759 |
| 123 | Ga0068866_10010910 | 3300005718 | Bacteria | 3913 |
| 124 | Ga0068861_100018587 | 3300005719 | Bacteria | 4952 |
| 125 | Ga0068861_100032883 | 3300005719 | Bacteria | 3822 |
| 126 | Ga0068861_100086577 | 3300005719 | Bacteria | 2463 |
| 127 | Ga0068861_100087847 | 3300005719 | Bacteria | 2447 |
| 128 | Ga0068861_100100634 | 3300005719 | Bacteria | 2298 |
| 129 | Ga0068851_10001542 | 3300005834 | Bacteria | 10097 |
| 130 | Ga0068870_10042174 | 3300005840 | Bacteria | 2375 |
| 131 | Ga0068858_100001923 | 3300005842 | Bacteria | 21169 |
| 132 | Ga0068858_100012170 | 3300005842 | Bacteria | 8111 |
| 133 | Ga0068858_100017127 | 3300005842 | Bacteria | 6801 |
| 134 | Ga0068858_100195118 | 3300005842 | Bacteria | 1913 |
| 135 | Ga0068860_100011768 | 3300005843 | Bacteria | 8623 |
| 136 | Ga0068862_100033244 | 3300005844 | Bacteria | 4358 |
| 137 | Ga0068862_100076669 | 3300005844 | Bacteria | 2894 |
| 138 | Ga0081455_10007349 | 3300005937 | Bacteria | 11617 |
| 139 | Ga0081455_10008446 | 3300005937 | Bacteria | 10709 |
| 140 | Ga0081455_10016840 | 3300005937 | Bacteria | 7030 |
| 141 | Ga0081540_1000011 | 3300005983 | Bacteria | 191880 |
| 142 | Ga0081540_1000932 | 3300005983 | Bacteria | 26297 |
| 143 | Ga0081540_1001375 | 3300005983 | Bacteria | 21094 |
| 144 | Ga0081540_1002628 | 3300005983 | Bacteria | 14598 |
| 145 | Ga0081540_1009312 | 3300005983 | Bacteria | 6775 |
| 146 | Ga0081540_1009802 | 3300005983 | Bacteria | 6556 |
| 147 | Ga0081539_10049554 | 3300005985 | Bacteria | 2382 |
| 148 | Ga0075365_10015050 | 3300006038 | Bacteria | 4669 |
| 149 | Ga0075365_10031674 | 3300006038 | Bacteria | 3393 |
| 150 | Ga0075363_100004654 | 3300006048 | Bacteria | 6034 |
| 151 | Ga0075364_10021037 | 3300006051 | Bacteria | 4109 |
| 152 | Ga0070715_10000314 | 3300006163 | Bacteria | 11923 |
| 153 | Ga0070716_100035162 | 3300006173 | Bacteria | 2753 |
| 154 | Ga0070712_100008300 | 3300006175 | Bacteria | 6527 |
| 155 | Ga0070712_100138649 | 3300006175 | Bacteria | 1853 |
| 156 | Ga0075362_10018308 | 3300006177 | Bacteria | 2896 |
| 157 | Ga0075367_10000301 | 3300006178 | Bacteria | 17434 |
| 158 | Ga0075367_10040951 | 3300006178 | Bacteria | 2706 |
| 159 | Ga0075369_10008318 | 3300006186 | Bacteria | 3990 |
| 160 | Ga0075366_10004913 | 3300006195 | Bacteria | 7211 |
| 161 | Ga0097621_100005267 | 3300006237 | Bacteria | 9103 |
| 162 | Ga0097621_100021189 | 3300006237 | Bacteria | 5022 |
| 163 | Ga0097621_100093557 | 3300006237 | Bacteria | 2519 |
| 164 | Ga0097621_100180423 | 3300006237 | Bacteria | 1824 |
| 165 | Ga0075370_10004812 | 3300006353 | Bacteria | 6611 |
| 166 | Ga0068871_100002503 | 3300006358 | Bacteria | 12536 |
| 167 | Ga0068871_100030886 | 3300006358 | Bacteria | 4222 |
| 168 | Ga0068871_100078521 | 3300006358 | Bacteria | 2729 |
| 169 | Ga0068871_100094424 | 3300006358 | Bacteria | 2497 |
| 170 | Ga0075428_100041134 | 3300006844 | Bacteria | 5084 |
| 171 | Ga0075428_100259648 | 3300006844 | Bacteria | 1871 |
| 172 | Ga0075431_100016231 | 3300006847 | Bacteria | 7555 |
| 173 | Ga0075434_100005496 | 3300006871 | Bacteria | 11543 |
| 174 | Ga0068865_100001375 | 3300006881 | Bacteria | 14154 |
| 175 | Ga0097620_100033007 | 3300006931 | Bacteria | 5199 |
| 176 | Ga0075435_100092043 | 3300007076 | Bacteria | 2503 |
| 177 | Ga0105251_10014435 | 3300009011 | Bacteria | 4365 |
| 178 | Ga0105244_10000463 | 3300009036 | Bacteria | 37089 |
| 179 | Ga0105244_10008315 | 3300009036 | Bacteria | 6490 |
| 180 | Ga0105244_10009037 | 3300009036 | Bacteria | 6166 |
| 181 | Ga0105244_10011256 | 3300009036 | Bacteria | 5381 |
| 182 | Ga0105244_10018744 | 3300009036 | Bacteria | 3876 |
| 183 | Ga0105244_10040872 | 3300009036 | Bacteria | 2405 |
| 184 | Ga0105250_10000576 | 3300009092 | Bacteria | 24300 |
| 185 | Ga0105250_10007842 | 3300009092 | Bacteria | 4566 |
| 186 | Ga0105250_10012127 | 3300009092 | Bacteria | 3566 |
| 187 | Ga0105250_10014914 | 3300009092 | Bacteria | 3187 |
| 188 | Ga0105240_10003198 | 3300009093 | Bacteria | 25719 |
| 189 | Ga0105240_10071203 | 3300009093 | Bacteria | 4301 |
| 190 | Ga0105240_10079980 | 3300009093 | Bacteria | 4021 |
| 191 | Ga0105240_10173091 | 3300009093 | Bacteria | 2555 |
| 192 | Ga0111539_10021105 | 3300009094 | Bacteria | 8020 |
| 193 | Ga0111539_10039118 | 3300009094 | Bacteria | 5718 |
| 194 | Ga0111539_10093225 | 3300009094 | Bacteria | 3538 |
| 195 | Ga0111539_10098484 | 3300009094 | Bacteria | 3434 |
| 196 | Ga0111539_10126402 | 3300009094 | Bacteria | 2995 |
| 197 | Ga0105245_10012324 | 3300009098 | Bacteria | 7439 |
| 198 | Ga0105247_10003510 | 3300009101 | Bacteria | 10207 |
| 199 | Ga0105247_10029599 | 3300009101 | Bacteria | 3319 |
| 200 | Ga0105247_10046641 | 3300009101 | Bacteria | 2660 |
| 201 | Ga0105247_10072988 | 3300009101 | Bacteria | 2149 |
| 202 | Ga0105243_10000005 | 3300009148 | Bacteria | 576265 |
| 203 | Ga0105243_10035027 | 3300009148 | Bacteria | 3891 |
| 204 | Ga0105243_10061306 | 3300009148 | Bacteria | 3008 |
| 205 | Ga0105241_10037240 | 3300009174 | Bacteria | 3664 |
| 206 | Ga0105242_10061429 | 3300009176 | Bacteria | 3091 |
| 207 | Ga0105248_10014105 | 3300009177 | Bacteria | 8794 |
| 208 | Ga0105248_10035717 | 3300009177 | Bacteria | 5559 |
| 209 | Ga0105248_10080920 | 3300009177 | Bacteria | 3652 |
| 210 | Ga0105248_10087675 | 3300009177 | Bacteria | 3503 |
| 211 | Ga0105248_10150160 | 3300009177 | Bacteria | 2629 |
| 212 | Ga0105248_10176337 | 3300009177 | Bacteria | 2409 |
| 213 | Ga0105237_10043348 | 3300009545 | Bacteria | 4533 |
| 214 | Ga0105237_10050436 | 3300009545 | Bacteria | 4181 |
| 215 | Ga0105237_10086939 | 3300009545 | Bacteria | 3116 |
| 216 | Ga0105238_10022419 | 3300009551 | Bacteria | 6436 |
| 217 | Ga0105238_10031814 | 3300009551 | Bacteria | 5369 |
| 218 | Ga0105238_10068114 | 3300009551 | Bacteria | 3560 |
| 219 | Ga0105249_10000952 | 3300009553 | Bacteria | 25606 |
| 220 | Ga0105249_10312787 | 3300009553 | Bacteria | 1580 |
| 221 | Ga0105239_10077815 | 3300010375 | Bacteria | 3650 |
| 222 | Ga0105239_10149056 | 3300010375 | Bacteria | 2610 |
| 223 | Ga0105246_10024178 | 3300011119 | Bacteria | 3943 |
| 224 | Ga0105246_10038504 | 3300011119 | Bacteria | 3216 |
| 225 | Ga0157373_10003228 | 3300013100 | Bacteria | 12331 |
| 226 | Ga0157373_10066474 | 3300013100 | Bacteria | 2551 |
| 227 | Ga0157371_10000696 | 3300013102 | Bacteria | 39564 |
| 228 | Ga0157371_10106758 | 3300013102 | Bacteria | 1987 |
| 229 | Ga0157370_10010102 | 3300013104 | Bacteria | 9969 |
| 230 | Ga0157370_10040989 | 3300013104 | Bacteria | 4470 |
| 231 | Ga0157369_10000160 | 3300013105 | Bacteria | 95301 |
| 232 | Ga0157369_10000167 | 3300013105 | Bacteria | 93483 |
| 233 | Ga0157369_10050032 | 3300013105 | Bacteria | 4528 |
| 234 | Ga0157369_10050632 | 3300013105 | Bacteria | 4497 |
| 235 | Ga0157369_10173649 | 3300013105 | Bacteria | 2270 |
| 236 | Ga0157374_10008421 | 3300013296 | Bacteria | 8811 |
| 237 | Ga0157374_10043887 | 3300013296 | Bacteria | 4131 |
| 238 | Ga0157374_10053750 | 3300013296 | Bacteria | 3755 |
| 239 | Ga0157374_10085470 | 3300013296 | Bacteria | 3000 |
| 240 | Ga0157374_10150532 | 3300013296 | Bacteria | 2262 |
| 241 | Ga0157374_10181080 | 3300013296 | Bacteria | 2058 |
| 242 | Ga0157378_10000006 | 3300013297 | Bacteria | 192683 |
| 243 | Ga0157378_10000929 | 3300013297 | Bacteria | 27006 |
| 244 | Ga0157378_10003059 | 3300013297 | Bacteria | 14866 |
| 245 | Ga0157378_10015977 | 3300013297 | Bacteria | 6574 |
| 246 | Ga0157378_10100671 | 3300013297 | Bacteria | 2638 |
| 247 | Ga0157378_10168699 | 3300013297 | Bacteria | 2051 |
| 248 | Ga0157378_10181533 | 3300013297 | Bacteria | 1980 |
| 249 | Ga0163162_10053703 | 3300013306 | Bacteria | 4050 |
| 250 | Ga0163162_10129813 | 3300013306 | Bacteria | 2628 |
| 251 | Ga0163162_10267793 | 3300013306 | Bacteria | 1840 |
| 252 | Ga0157372_10000931 | 3300013307 | Bacteria | 31902 |
| 253 | Ga0157372_10021605 | 3300013307 | Bacteria | 6955 |
| 254 | Ga0157375_10007776 | 3300013308 | Bacteria | 9378 |
| 255 | Ga0157375_10024721 | 3300013308 | Bacteria | 5565 |
| 256 | Ga0157375_10037005 | 3300013308 | Bacteria | 4672 |
| 257 | Ga0157375_10056716 | 3300013308 | Bacteria | 3869 |
| 258 | Ga0157375_10086062 | 3300013308 | Bacteria | 3193 |
| 259 | Ga0157375_10183998 | 3300013308 | Bacteria | 2242 |
| 260 | Ga0163163_10010328 | 3300014325 | Bacteria | 8391 |
| 261 | Ga0163163_10049500 | 3300014325 | Bacteria | 4137 |
| 262 | Ga0163163_10272976 | 3300014325 | Bacteria | 1742 |
| 263 | Ga0157380_10000708 | 3300014326 | Bacteria | 20829 |
| 264 | Ga0157380_10010229 | 3300014326 | Bacteria | 6740 |
| 265 | Ga0157380_10182467 | 3300014326 | Bacteria | 1845 |
| 266 | Ga0157379_10023570 | 3300014968 | Bacteria | 5462 |
| 267 | Ga0157379_10031044 | 3300014968 | Bacteria | 4760 |
| 268 | Ga0157379_10174907 | 3300014968 | Bacteria | 1938 |
| 269 | Ga0157379_10266093 | 3300014968 | Bacteria | 1558 |
| 270 | Ga0157376_10001401 | 3300014969 | Bacteria | 15849 |
| 271 | Ga0157376_10003679 | 3300014969 | Bacteria | 10583 |
| 272 | Ga0157376_10005025 | 3300014969 | Bacteria | 9228 |
| 273 | Ga0157376_10025276 | 3300014969 | Bacteria | 4676 |
| 274 | Ga0157376_10072615 | 3300014969 | Bacteria | 2928 |
| 275 | Ga0157376_10102932 | 3300014969 | Bacteria | 2499 |
| 276 | Ga0163161_10001835 | 3300017792 | Bacteria | 15515 |
| 277 | Ga0163161_10039990 | 3300017792 | Bacteria | 3367 |
| 278 | Ga0163161_10149538 | 3300017792 | Bacteria | 1774 |
| 279 | Ga0213872_10014095 | 3300021361 | Bacteria | 3734 |
| 280 | Ga0224712_10000153 | 3300022467 | Bacteria | 11585 |
| 281 | Ga0209566_100292 | 3300025225 | Bacteria | 45550 |
| 282 | Ga0209674_104908 | 3300025226 | Bacteria | 2079 |
| 283 | Ga0209672_100012 | 3300025228 | Bacteria | 795742 |
| 284 | Ga0209672_100134 | 3300025228 | Bacteria | 73307 |
| 285 | Ga0209147_100007 | 3300025229 | Bacteria | 795684 |
| 286 | Ga0209147_100047 | 3300025229 | Bacteria | 288873 |
| 287 | Ga0209147_100247 | 3300025229 | Bacteria | 52095 |
| 288 | Ga0209147_104188 | 3300025229 | Bacteria | 2481 |
| 289 | Ga0209258_100014 | 3300025242 | Bacteria | 720132 |
| 290 | Ga0209258_100065 | 3300025242 | Bacteria | 288500 |
| 291 | Ga0209148_1000091 | 3300025254 | Bacteria | 250913 |
| 292 | Ga0209148_1000700 | 3300025254 | Bacteria | 27161 |
| 293 | Ga0209565_1010906 | 3300025263 | Bacteria | 2237 |
| 294 | Ga0209455_1000074 | 3300025272 | Bacteria | 289143 |
| 295 | Ga0209455_1000713 | 3300025272 | Bacteria | 19254 |
| 296 | Ga0209673_1000137 | 3300025273 | Bacteria | 158691 |
| 297 | Ga0209130_1000633 | 3300025284 | Bacteria | 33023 |
| 298 | Ga0209130_1002051 | 3300025284 | Bacteria | 10934 |
| 299 | Ga0209130_1006301 | 3300025284 | Bacteria | 3881 |
| 300 | Ga0209025_1000262 | 3300025294 | Bacteria | 123617 |
| 301 | Ga0209025_1000355 | 3300025294 | Bacteria | 98571 |
| 302 | Ga0209025_1001564 | 3300025294 | Bacteria | 29032 |
| 303 | Ga0209025_1002190 | 3300025294 | Bacteria | 21650 |
| 304 | Ga0209025_1002944 | 3300025294 | Bacteria | 16932 |
| 305 | Ga0209025_1003509 | 3300025294 | Bacteria | 14740 |
| 306 | Ga0209025_1006327 | 3300025294 | Bacteria | 9235 |
| 307 | Ga0209025_1008110 | 3300025294 | Bacteria | 7631 |
| 308 | Ga0209025_1012470 | 3300025294 | Bacteria | 5441 |
| 309 | Ga0209564_1003482 | 3300025295 | Bacteria | 10721 |
| 310 | Ga0207697_10005006 | 3300025315 | Bacteria | 6233 |
| 311 | Ga0207656_10015039 | 3300025321 | Bacteria | 2991 |
| 312 | Ga0207696_1003906 | 3300025711 | Bacteria | 6576 |
| 313 | Ga0207696_1006313 | 3300025711 | Bacteria | 4787 |
| 314 | Ga0207696_1010394 | 3300025711 | Bacteria | 3411 |
| 315 | Ga0207696_1012587 | 3300025711 | Bacteria | 2984 |
| 316 | Ga0207655_1000490 | 3300025728 | Bacteria | 50941 |
| 317 | Ga0207655_1001499 | 3300025728 | Bacteria | 21328 |
| 318 | Ga0207655_1001848 | 3300025728 | Bacteria | 18290 |
| 319 | Ga0207682_10000929 | 3300025893 | Bacteria | 13588 |
| 320 | Ga0207682_10004587 | 3300025893 | Bacteria | 5755 |
| 321 | Ga0207682_10028066 | 3300025893 | Bacteria | 2245 |
| 322 | Ga0207692_10004478 | 3300025898 | Bacteria | 5535 |
| 323 | Ga0207692_10061453 | 3300025898 | Bacteria | 1947 |
| 324 | Ga0207642_10033433 | 3300025899 | Bacteria | 2176 |
| 325 | Ga0207710_10003111 | 3300025900 | Bacteria | 7435 |
| 326 | Ga0207710_10009354 | 3300025900 | Bacteria | 4125 |
| 327 | Ga0207688_10002701 | 3300025901 | Bacteria | 9607 |
| 328 | Ga0207688_10117742 | 3300025901 | Bacteria | 1548 |
| 329 | Ga0207680_10066116 | 3300025903 | Bacteria | 2222 |
| 330 | Ga0207647_10000307 | 3300025904 | Bacteria | 40415 |
| 331 | Ga0207647_10001758 | 3300025904 | Bacteria | 16628 |
| 332 | Ga0207645_10018143 | 3300025907 | Bacteria | 4637 |
| 333 | Ga0207645_10024691 | 3300025907 | Bacteria | 3893 |
| 334 | Ga0207645_10031441 | 3300025907 | Bacteria | 3415 |
| 335 | Ga0207645_10043834 | 3300025907 | Bacteria | 2863 |
| 336 | Ga0207654_10023813 | 3300025911 | Bacteria | 3285 |
| 337 | Ga0207654_10087643 | 3300025911 | Bacteria | 1889 |
| 338 | Ga0207695_10002574 | 3300025913 | Bacteria | 26650 |
| 339 | Ga0207695_10022714 | 3300025913 | Bacteria | 7110 |
| 340 | Ga0207695_10039972 | 3300025913 | Bacteria | 5036 |
| 341 | Ga0207695_10175799 | 3300025913 | Bacteria | 2064 |
| 342 | Ga0207671_10019603 | 3300025914 | Bacteria | 5169 |
| 343 | Ga0207671_10051677 | 3300025914 | Bacteria | 3046 |
| 344 | Ga0207671_10123002 | 3300025914 | Bacteria | 1985 |
| 345 | Ga0207693_10001595 | 3300025915 | Bacteria | 20042 |
| 346 | Ga0207663_10000670 | 3300025916 | Bacteria | 15130 |
| 347 | Ga0207663_10043162 | 3300025916 | Bacteria | 2759 |
| 348 | Ga0207662_10030030 | 3300025918 | Bacteria | 3152 |
| 349 | Ga0207657_10000019 | 3300025919 | Bacteria | 159785 |
| 350 | Ga0207657_10000822 | 3300025919 | Bacteria | 32803 |
| 351 | Ga0207657_10057864 | 3300025919 | Bacteria | 3339 |
| 352 | Ga0207649_10097106 | 3300025920 | Bacteria | 1942 |
| 353 | Ga0207681_10013076 | 3300025923 | Bacteria | 5132 |
| 354 | Ga0207681_10029477 | 3300025923 | Bacteria | 3565 |
| 355 | Ga0207694_10020737 | 3300025924 | Bacteria | 4975 |
| 356 | Ga0207650_10001257 | 3300025925 | Bacteria | 18423 |
| 357 | Ga0207650_10010191 | 3300025925 | Bacteria | 6441 |
| 358 | Ga0207650_10069125 | 3300025925 | Bacteria | 2653 |
| 359 | Ga0207650_10181531 | 3300025925 | Bacteria | 1677 |
| 360 | Ga0207659_10006611 | 3300025926 | Bacteria | 7119 |
| 361 | Ga0207659_10008627 | 3300025926 | Bacteria | 6340 |
| 362 | Ga0207659_10032366 | 3300025926 | Bacteria | 3588 |
| 363 | Ga0207659_10144787 | 3300025926 | Bacteria | 1849 |
| 364 | Ga0207664_10004159 | 3300025929 | Bacteria | 9770 |
| 365 | Ga0207644_10005044 | 3300025931 | Bacteria | 8616 |
| 366 | Ga0207644_10005122 | 3300025931 | Bacteria | 8560 |
| 367 | Ga0207644_10023664 | 3300025931 | Bacteria | 4210 |
| 368 | Ga0207690_10000028 | 3300025932 | Bacteria | 160775 |
| 369 | Ga0207690_10001482 | 3300025932 | Bacteria | 14673 |
| 370 | Ga0207690_10121264 | 3300025932 | Bacteria | 1900 |
| 371 | Ga0207706_10000149 | 3300025933 | Bacteria | 76532 |
| 372 | Ga0207706_10006213 | 3300025933 | Bacteria | 11098 |
| 373 | Ga0207706_10042515 | 3300025933 | Bacteria | 4027 |
| 374 | Ga0207709_10000001 | 3300025935 | Bacteria | 2228154 |
| 375 | Ga0207709_10007384 | 3300025935 | Bacteria | 6124 |
| 376 | Ga0207670_10002972 | 3300025936 | Bacteria | 8951 |
| 377 | Ga0207670_10114932 | 3300025936 | Bacteria | 1946 |
| 378 | Ga0207669_10001807 | 3300025937 | Bacteria | 9062 |
| 379 | Ga0207704_10026918 | 3300025938 | Bacteria | 3162 |
| 380 | Ga0207704_10030902 | 3300025938 | Bacteria | 3010 |
| 381 | Ga0207704_10049354 | 3300025938 | Bacteria | 2531 |
| 382 | Ga0207704_10051396 | 3300025938 | Bacteria | 2492 |
| 383 | Ga0207665_10000118 | 3300025939 | Bacteria | 52078 |
| 384 | Ga0207665_10058629 | 3300025939 | Bacteria | 2603 |
| 385 | Ga0207691_10005529 | 3300025940 | Bacteria | 12207 |
| 386 | Ga0207691_10007024 | 3300025940 | Bacteria | 10862 |
| 387 | Ga0207691_10014808 | 3300025940 | Bacteria | 7431 |
| 388 | Ga0207691_10025496 | 3300025940 | Bacteria | 5550 |
| 389 | Ga0207691_10027233 | 3300025940 | Bacteria | 5362 |
| 390 | Ga0207691_10030314 | 3300025940 | Bacteria | 5056 |
| 391 | Ga0207691_10038446 | 3300025940 | Bacteria | 4428 |
| 392 | Ga0207711_10041445 | 3300025941 | Bacteria | 3921 |
| 393 | Ga0207711_10068819 | 3300025941 | Bacteria | 3067 |
| 394 | Ga0207711_10069973 | 3300025941 | Bacteria | 3043 |
| 395 | Ga0207711_10073938 | 3300025941 | Bacteria | 2963 |
| 396 | Ga0207711_10078051 | 3300025941 | Bacteria | 2887 |
| 397 | Ga0207711_10232906 | 3300025941 | Bacteria | 1687 |
| 398 | Ga0207689_10008518 | 3300025942 | Bacteria | 8942 |
| 399 | Ga0207689_10021652 | 3300025942 | Bacteria | 5406 |
| 400 | Ga0207689_10038440 | 3300025942 | Bacteria | 3964 |
| 401 | Ga0207689_10063960 | 3300025942 | Bacteria | 3027 |
| 402 | Ga0207689_10067334 | 3300025942 | Bacteria | 2943 |
| 403 | Ga0207689_10108444 | 3300025942 | Bacteria | 2282 |
| 404 | Ga0207661_10033311 | 3300025944 | Bacteria | 3998 |
| 405 | Ga0207679_10079666 | 3300025945 | Bacteria | 2499 |
| 406 | Ga0207679_10201503 | 3300025945 | Bacteria | 1663 |
| 407 | Ga0207667_10001720 | 3300025949 | Bacteria | 27567 |
| 408 | Ga0207651_10029172 | 3300025960 | Bacteria | 3492 |
| 409 | Ga0207651_10065813 | 3300025960 | Bacteria | 2543 |
| 410 | Ga0207651_10079438 | 3300025960 | Bacteria | 2357 |
| 411 | Ga0207651_10149346 | 3300025960 | Bacteria | 1817 |
| 412 | Ga0207712_10001054 | 3300025961 | Bacteria | 19341 |
| 413 | Ga0207712_10010727 | 3300025961 | Bacteria | 5822 |
| 414 | Ga0207712_10039929 | 3300025961 | Bacteria | 3218 |
| 415 | Ga0207668_10026139 | 3300025972 | Bacteria | 3786 |
| 416 | Ga0207668_10051733 | 3300025972 | Bacteria | 2838 |
| 417 | Ga0207640_10049343 | 3300025981 | Bacteria | 2725 |
| 418 | Ga0207640_10079523 | 3300025981 | Bacteria | 2235 |
| 419 | Ga0207658_10091363 | 3300025986 | Bacteria | 2362 |
| 420 | Ga0207703_10000734 | 3300026035 | Bacteria | 32244 |
| 421 | Ga0207703_10012138 | 3300026035 | Bacteria | 6713 |
| 422 | Ga0207703_10016348 | 3300026035 | Bacteria | 5784 |
| 423 | Ga0207639_10004603 | 3300026041 | Bacteria | 9279 |
| 424 | Ga0207639_10166937 | 3300026041 | Bacteria | 1860 |
| 425 | Ga0207678_10012380 | 3300026067 | Bacteria | 7487 |
| 426 | Ga0207678_10019882 | 3300026067 | Bacteria | 5902 |
| 427 | Ga0207678_10025991 | 3300026067 | Bacteria | 5108 |
| 428 | Ga0207678_10041934 | 3300026067 | Bacteria | 3967 |
| 429 | Ga0207678_10047488 | 3300026067 | Bacteria | 3712 |
| 430 | Ga0207678_10060815 | 3300026067 | Bacteria | 3248 |
| 431 | Ga0207678_10098169 | 3300026067 | Bacteria | 2502 |
| 432 | Ga0207708_10005532 | 3300026075 | Bacteria | 9320 |
| 433 | Ga0207702_10049715 | 3300026078 | Bacteria | 3538 |
| 434 | Ga0207641_10074605 | 3300026088 | Bacteria | 2926 |
| 435 | Ga0207641_10098344 | 3300026088 | Bacteria | 2573 |
| 436 | Ga0207648_10006787 | 3300026089 | Bacteria | 11349 |
| 437 | Ga0207648_10008866 | 3300026089 | Bacteria | 9683 |
| 438 | Ga0207648_10018499 | 3300026089 | Bacteria | 6306 |
| 439 | Ga0207648_10119001 | 3300026089 | Bacteria | 2321 |
| 440 | Ga0207676_10010141 | 3300026095 | Bacteria | 6707 |
| 441 | Ga0207676_10016706 | 3300026095 | Bacteria | 5315 |
| 442 | Ga0207676_10040883 | 3300026095 | Bacteria | 3556 |
| 443 | Ga0207676_10047491 | 3300026095 | Bacteria | 3327 |
| 444 | Ga0207676_10126331 | 3300026095 | Bacteria | 2166 |
| 445 | Ga0207676_10132310 | 3300026095 | Bacteria | 2123 |
| 446 | Ga0207674_10022409 | 3300026116 | Bacteria | 6783 |
| 447 | Ga0207675_100016302 | 3300026118 | Bacteria | 6937 |
| 448 | Ga0207675_100026250 | 3300026118 | Bacteria | 5423 |
| 449 | Ga0207675_100034620 | 3300026118 | Bacteria | 4709 |
| 450 | Ga0207675_100052537 | 3300026118 | Bacteria | 3802 |
| 451 | Ga0207675_100062914 | 3300026118 | Bacteria | 3467 |
| 452 | Ga0207675_100111298 | 3300026118 | Bacteria | 2584 |
| 453 | Ga0207683_10001414 | 3300026121 | Bacteria | 21696 |
| 454 | Ga0207683_10005185 | 3300026121 | Bacteria | 11189 |
| 455 | Ga0207683_10038670 | 3300026121 | Bacteria | 4160 |
| 456 | Ga0207683_10051111 | 3300026121 | Bacteria | 3621 |
| 457 | Ga0207683_10100027 | 3300026121 | Bacteria | 2588 |
| 458 | Ga0207683_10144977 | 3300026121 | Bacteria | 2141 |
| 459 | Ga0207698_10003500 | 3300026142 | Bacteria | 9465 |
| 460 | Ga0207698_10055081 | 3300026142 | Bacteria | 3062 |
| 461 | Ga0207698_10158998 | 3300026142 | Bacteria | 1973 |
| 462 | Ga0207698_10221356 | 3300026142 | Bacteria | 1711 |
| 463 | Ga0207698_10264137 | 3300026142 | Bacteria | 1583 |
| 464 | Ga0209371_1000006 | 3300027312 | Bacteria | 1055642 |
| 465 | Ga0209371_1000113 | 3300027312 | Bacteria | 139649 |
| 466 | Ga0268266_10000006 | 3300028379 | Bacteria | 1410021 |
| 467 | Ga0268266_10000807 | 3300028379 | Bacteria | 41568 |
| 468 | Ga0268266_10016489 | 3300028379 | Bacteria | 6315 |
| 469 | Ga0268266_10025228 | 3300028379 | Bacteria | 5060 |
| 470 | Ga0268266_10172553 | 3300028379 | Bacteria | 1963 |
| 471 | Ga0268265_10007492 | 3300028380 | Bacteria | 7370 |
| 472 | Ga0268265_10047733 | 3300028380 | Bacteria | 3210 |
| 473 | Ga0268264_10113588 | 3300028381 | Bacteria | 2376 |
| 474 | Ga0307515_10004656 | 3300028794 | Bacteria | 28166 |
| 475 | Ga0237817_10031 | 3300030083 | Bacteria | 49190 |
| 476 | Ga0268256_1000007 | 3300030500 | Bacteria | 1055326 |
| 477 | Ga0268256_1000575 | 3300030500 | Bacteria | 29639 |
| 478 | Ga0265327_10001312 | 3300031251 | Bacteria | 32428 |
| 479 | Ga0265327_10015647 | 3300031251 | Bacteria | 4879 |
| 480 | Ga0307509_10035086 | 3300031507 | Bacteria | 5508 |
| 481 | Ga0307509_10038464 | 3300031507 | Bacteria | 5218 |
| 482 | Ga0265314_10026985 | 3300031711 | Bacteria | 4307 |
| 483 | Ga0265342_10017660 | 3300031712 | Bacteria | 4636 |
| 484 | Ga0307516_10000678 | 3300031730 | Bacteria | 46164 |
| 485 | Ga0307516_10022231 | 3300031730 | Bacteria | 6517 |
| 486 | Ga0307516_10040714 | 3300031730 | Bacteria | 4623 |
| 487 | Ga0307415_100045575 | 3300032126 | Bacteria | 2941 |
| 488 | Ga0307510_10001063 | 3300033180 | Bacteria | 29201 |
| 489 | Ga0307510_10046375 | 3300033180 | Bacteria | 4674 |
| 490 | Ga0373923_0024380 | 3300035111 | Bacteria | 2387 |
| 491 | Ga0373945_0006415 | 3300035116 | Bacteria | 3795 |
| 492 | Ga0373953_0001434 | 3300035117 | Bacteria | 6904 |
| 493 | Ga0373954_0000261 | 3300035118 | Bacteria | 19044 |
| 494 | Ga0373954_0006034 | 3300035118 | Bacteria | 5270 |
| 495 | Ga0373954_0010774 | 3300035118 | Bacteria | 4043 |
| 496 | Ga0373943_0048798 | 3300035170 | Bacteria | 2075 |
| 497 | Ga0373943_0061380 | 3300035170 | Bacteria | 1879 |
| 498 | Ga0373946_0028153 | 3300035171 | Bacteria | 2227 |
| 499 | Ga0373955_0000455 | 3300035172 | Bacteria | 17320 |
| 500 | Ga0373955_0003182 | 3300035172 | Bacteria | 7189 |
| 501 | Ga0373962_0014177 | 3300035242 | Bacteria | 2029 |
| 502 | Ga0373924_0000696 | 3300035410 | Bacteria | 10458 |
| 503 | Ga0373931_0018884 | 3300035691 | Bacteria | 3433 |
| 504 | Ga0373931_0034017 | 3300035691 | Bacteria | 2643 |
| 505 | Ga0373935_0005538 | 3300035692 | Bacteria | 7440 |
| 506 | Ga0373935_0019087 | 3300035692 | Bacteria | 4181 |
| 507 | Ga0373935_0128888 | 3300035692 | Bacteria | 1698 |
| 508 | Ga0373927_0001649 | 3300035695 | Bacteria | 16726 |
| 509 | Ga0373927_0011264 | 3300035695 | Bacteria | 5953 |
| 510 | Ga0373927_0091523 | 3300035695 | Bacteria | 1975 |
| 511 | Ga0373933_0000346 | 3300035724 | Bacteria | 29613 |
| 512 | Ga0373933_0026643 | 3300035724 | Bacteria | 3321 |
| 513 | Ga0373933_0032878 | 3300035724 | Bacteria | 3015 |
| 514 | Ga0373933_0053088 | 3300035724 | Bacteria | 2427 |
| 515 | Ga0373933_0056528 | 3300035724 | Bacteria | 2356 |
| 516 | Ga0373933_0069336 | 3300035724 | Bacteria | 2143 |
| 517 | Ga0373937_0005546 | 3300036401 | Bacteria | 10823 |
| 518 | Ga0373937_0006983 | 3300036401 | Bacteria | 9745 |
| 519 | Ga0373937_0009266 | 3300036401 | Bacteria | 8548 |
| 520 | Ga0373937_0046347 | 3300036401 | Bacteria | 3975 |
| 521 | Ga0373937_0145678 | 3300036401 | Bacteria | 2217 |
| 522 | Ga0373925_0001973 | 3300037068 | Bacteria | 16990 |
| 523 | Ga0395900_0000053 | 3300037418 | Bacteria | 221135 |
| 524 | Ga0395900_0042134 | 3300037418 | Bacteria | 4703 |
| 525 | Ga0395900_0060066 | 3300037418 | Bacteria | 3913 |
| 526 | Ga0395898_0000264 | 3300037466 | Bacteria | 128758 |
| 527 | Ga0395898_0070973 | 3300037466 | Bacteria | 3366 |
| 528 | Ga0395905_0006009 | 3300037471 | Bacteria | 12291 |
| 529 | Ga0395905_0012988 | 3300037471 | Bacteria | 8004 |
| 530 | Ga0395901_0000009 | 3300038443 | Bacteria | 479396 |
| 531 | Ga0395901_0000012 | 3300038443 | Bacteria | 381361 |
| 532 | Ga0395901_0026845 | 3300038443 | Bacteria | 5912 |
| 533 | Ga0237819_00044 | 3300038705 | Bacteria | 43089 |
| 534 | Ga0237819_00450 | 3300038705 | Bacteria | 14003 |
| 535 | Ga0436365_1076449 | 3300039437 | Bacteria | 3259 |
| 536 | Ga0451802_1782641 | 3300041460 | Bacteria | 2140 |
| 537 | Ga0466969_0000241 | 3300044656 | Bacteria | 29962 |
| 538 | Ga0466973_0045270 | 3300044659 | Bacteria | 4114 |
| 539 | Ga0466965_0000127 | 3300044683 | Bacteria | 21843 |
| 540 | Ga0466966_0000011 | 3300044684 | Bacteria | 136987 |
| 541 | Ga0466966_0023588 | 3300044684 | Bacteria | 4027 |
| 542 | Ga0466966_0026486 | 3300044684 | Bacteria | 3784 |
| 543 | Ga0466961_0000276 | 3300044693 | Bacteria | 34281 |
| 544 | Ga0466963_0000544 | 3300044694 | Bacteria | 17729 |
| 545 | Ga0466963_0042537 | 3300044694 | Bacteria | 2984 |
| 546 | Ga0466971_0000258 | 3300044719 | Bacteria | 20212 |
| 547 | Ga0466971_0003962 | 3300044719 | Bacteria | 6366 |
| 548 | Ga0466970_0017943 | 3300044765 | Bacteria | 3661 |
| 549 | Ga0466957_0034805 | 3300044842 | Bacteria | 3021 |
| 550 | Ga0466959_0005449 | 3300045049 | Bacteria | 8713 |
| 551 | Ga0466967_0000507 | 3300045976 | Bacteria | 19031 |
| 552 | Ga0495617_000786 | 3300046452 | Bacteria | 15345 |
| 553 | Ga0495617_038301 | 3300046452 | Bacteria | 1604 |
| 554 | Ga0495592_0003017 | 3300046454 | Bacteria | 11992 |
| 555 | Ga0495592_0027851 | 3300046454 | Bacteria | 4280 |
| 556 | Ga0495592_0035111 | 3300046454 | Bacteria | 3779 |
| 557 | Ga0495592_0124608 | 3300046454 | Bacteria | 1809 |
| 558 | Ga0495603_0001827 | 3300046455 | Bacteria | 12557 |
| 559 | Ga0495603_0083193 | 3300046455 | Bacteria | 1874 |
| 560 | Ga0495603_0093291 | 3300046455 | Bacteria | 1759 |
| 561 | Ga0495590_0015226 | 3300046457 | Bacteria | 2795 |
| 562 | Ga0495629_0001739 | 3300046459 | Bacteria | 17078 |
| 563 | Ga0495629_0003254 | 3300046459 | Bacteria | 12299 |
| 564 | Ga0495629_0018005 | 3300046459 | Bacteria | 5063 |
| 565 | Ga0495629_0019328 | 3300046459 | Bacteria | 4869 |
| 566 | Ga0495629_0028486 | 3300046459 | Bacteria | 3966 |
| 567 | Ga0495629_0066080 | 3300046459 | Bacteria | 2524 |
| 568 | Ga0495629_0119991 | 3300046459 | Bacteria | 1832 |
| 569 | Ga0495638_0003236 | 3300046460 | Bacteria | 12877 |
| 570 | Ga0495638_0005422 | 3300046460 | Bacteria | 9493 |
| 571 | Ga0495641_0005678 | 3300046461 | Bacteria | 8314 |
| 572 | Ga0495641_0037573 | 3300046461 | Bacteria | 2268 |
| 573 | Ga0495641_0055373 | 3300046461 | Bacteria | 1801 |
| 574 | Ga0495651_0001035 | 3300046462 | Bacteria | 21511 |
| 575 | Ga0495651_0001967 | 3300046462 | Bacteria | 15902 |
| 576 | Ga0495651_0002281 | 3300046462 | Bacteria | 14802 |
| 577 | Ga0495651_0003244 | 3300046462 | Bacteria | 12482 |
| 578 | Ga0495653_0000572 | 3300046463 | Bacteria | 28222 |
| 579 | Ga0495653_0004181 | 3300046463 | Bacteria | 11682 |
| 580 | Ga0495653_0005788 | 3300046463 | Bacteria | 10114 |
| 581 | Ga0495653_0006075 | 3300046463 | Bacteria | 9893 |
| 582 | Ga0495653_0055871 | 3300046463 | Bacteria | 3011 |
| 583 | Ga0495580_0008936 | 3300046472 | Bacteria | 7925 |
| 584 | Ga0495582_0000547 | 3300046473 | Bacteria | 20786 |
| 585 | Ga0495582_0004697 | 3300046473 | Bacteria | 7680 |
| 586 | Ga0495582_0025453 | 3300046473 | Bacteria | 3241 |
| 587 | Ga0495605_0007350 | 3300046474 | Bacteria | 6254 |
| 588 | Ga0495605_0007406 | 3300046474 | Bacteria | 6229 |
| 589 | Ga0495605_0017187 | 3300046474 | Bacteria | 3899 |
| 590 | Ga0495605_0029720 | 3300046474 | Bacteria | 2807 |
| 591 | Ga0495639_0000163 | 3300046475 | Bacteria | 34576 |
| 592 | Ga0495639_0054063 | 3300046475 | Bacteria | 1830 |
| 593 | Ga0495662_0000616 | 3300046476 | Bacteria | 16523 |
| 594 | Ga0495584_0000021 | 3300046491 | Bacteria | 130377 |
| 595 | Ga0495584_0000271 | 3300046491 | Bacteria | 36789 |
| 596 | Ga0495584_0009051 | 3300046491 | Bacteria | 5142 |
| 597 | Ga0495584_0022170 | 3300046491 | Bacteria | 3223 |
| 598 | Ga0495585_0000005 | 3300046492 | Bacteria | 328103 |
| 599 | Ga0495585_0000049 | 3300046492 | Bacteria | 119546 |
| 600 | Ga0495585_0000465 | 3300046492 | Bacteria | 38766 |
| 601 | Ga0495585_0002705 | 3300046492 | Bacteria | 12417 |
| 602 | Ga0495585_0005101 | 3300046492 | Bacteria | 8356 |
| 603 | Ga0495585_0014514 | 3300046492 | Bacteria | 4586 |
| 604 | Ga0495585_0018531 | 3300046492 | Bacteria | 4015 |
| 605 | Ga0495585_0018739 | 3300046492 | Bacteria | 3992 |
| 606 | Ga0495585_0020644 | 3300046492 | Bacteria | 3787 |
| 607 | Ga0495585_0082519 | 3300046492 | Bacteria | 1740 |
| 608 | Ga0495594_0001043 | 3300046499 | Bacteria | 14436 |
| 609 | Ga0495594_0011288 | 3300046499 | Bacteria | 4641 |
| 610 | Ga0495594_0056524 | 3300046499 | Bacteria | 2165 |
| 611 | Ga0495596_0001506 | 3300046500 | Bacteria | 13326 |
| 612 | Ga0495596_0001991 | 3300046500 | Bacteria | 11245 |
| 613 | Ga0495596_0012053 | 3300046500 | Bacteria | 3711 |
| 614 | Ga0495607_0015069 | 3300046501 | Bacteria | 5020 |
| 615 | Ga0495607_0028747 | 3300046501 | Bacteria | 3426 |
| 616 | Ga0495607_0032042 | 3300046501 | Bacteria | 3213 |
| 617 | Ga0495583_0000697 | 3300046506 | Bacteria | 43333 |
| 618 | Ga0495583_0015713 | 3300046506 | Bacteria | 4102 |
| 619 | Ga0495606_0025201 | 3300046507 | Bacteria | 4266 |
| 620 | Ga0495606_0066905 | 3300046507 | Bacteria | 2277 |
| 621 | Ga0495608_0003175 | 3300046511 | Bacteria | 11759 |
| 622 | Ga0495608_0006286 | 3300046511 | Bacteria | 8425 |
| 623 | Ga0495608_0076226 | 3300046511 | Bacteria | 2185 |
| 624 | Ga0495616_0000280 | 3300046513 | Bacteria | 41320 |
| 625 | Ga0495616_0003309 | 3300046513 | Bacteria | 10352 |
| 626 | Ga0495616_0018617 | 3300046513 | Bacteria | 3807 |
| 627 | Ga0495616_0043097 | 3300046513 | Bacteria | 2293 |
| 628 | Ga0495620_0015317 | 3300046515 | Bacteria | 3875 |
| 629 | Ga0495628_0019843 | 3300046516 | Bacteria | 5553 |
| 630 | Ga0495628_0174465 | 3300046516 | Bacteria | 1629 |
| 631 | Ga0495630_0028859 | 3300046517 | Bacteria | 4123 |
| 632 | Ga0495630_0033608 | 3300046517 | Bacteria | 3825 |
| 633 | Ga0495630_0179541 | 3300046517 | Bacteria | 1614 |
| 634 | Ga0495631_0010085 | 3300046518 | Bacteria | 4692 |
| 635 | Ga0495632_0000098 | 3300046519 | Bacteria | 88691 |
| 636 | Ga0495632_0000143 | 3300046519 | Bacteria | 73460 |
| 637 | Ga0495632_0000153 | 3300046519 | Bacteria | 71012 |
| 638 | Ga0495643_0054146 | 3300046522 | Bacteria | 2149 |
| 639 | Ga0495644_0007890 | 3300046523 | Bacteria | 4100 |
| 640 | Ga0495644_0011526 | 3300046523 | Bacteria | 3403 |
| 641 | Ga0495648_0000033 | 3300046524 | Bacteria | 199184 |
| 642 | Ga0495663_0007011 | 3300046525 | Bacteria | 3110 |
| 643 | Ga0495663_0009985 | 3300046525 | Bacteria | 2634 |
| 644 | Ga0495666_0046786 | 3300046526 | Bacteria | 2085 |
| 645 | Ga0495642_0000236 | 3300046528 | Bacteria | 31451 |
| 646 | Ga0495642_0002915 | 3300046528 | Bacteria | 6816 |
| 647 | Ga0495642_0005608 | 3300046528 | Bacteria | 4823 |
| 648 | Ga0495642_0010476 | 3300046528 | Bacteria | 3551 |
| 649 | Ga0495652_0005447 | 3300046529 | Bacteria | 11989 |
| 650 | Ga0495652_0017982 | 3300046529 | Bacteria | 6306 |
| 651 | Ga0495652_0022047 | 3300046529 | Bacteria | 5657 |
| 652 | Ga0495652_0143898 | 3300046529 | Bacteria | 1872 |
| 653 | Ga0495654_0013039 | 3300046530 | Bacteria | 4453 |
| 654 | Ga0495654_0046828 | 3300046530 | Bacteria | 2128 |
| 655 | Ga0495665_0003016 | 3300046531 | Bacteria | 9100 |
| 656 | Ga0495640_0014858 | 3300046533 | Bacteria | 5874 |
| 657 | Ga0495586_0014286 | 3300046535 | Bacteria | 4218 |
| 658 | Ga0495586_0075469 | 3300046535 | Bacteria | 1845 |
| 659 | Ga0495587_0001243 | 3300046536 | Bacteria | 16921 |
| 660 | Ga0495587_0001343 | 3300046536 | Bacteria | 16342 |
| 661 | Ga0495587_0012337 | 3300046536 | Bacteria | 5383 |
| 662 | Ga0495587_0030037 | 3300046536 | Bacteria | 3297 |
| 663 | Ga0495609_0007139 | 3300046538 | Bacteria | 5616 |
| 664 | Ga0495609_0008775 | 3300046538 | Bacteria | 4922 |
| 665 | Ga0495609_0038585 | 3300046538 | Bacteria | 2153 |
| 666 | Ga0495621_0056724 | 3300046539 | Bacteria | 1413 |
| 667 | Ga0495645_0057061 | 3300046543 | Bacteria | 2835 |
| 668 | Ga0495622_0003321 | 3300046557 | Bacteria | 7597 |
| 669 | Ga0495633_0002449 | 3300046558 | Bacteria | 13105 |
| 670 | Ga0495633_0002561 | 3300046558 | Bacteria | 12742 |
| 671 | Ga0495633_0006093 | 3300046558 | Bacteria | 7223 |
| 672 | Ga0495633_0021652 | 3300046558 | Bacteria | 3212 |
| 673 | Ga0495667_0000593 | 3300046559 | Bacteria | 23047 |
| 674 | Ga0495667_0002429 | 3300046559 | Bacteria | 12441 |
| 675 | Ga0495667_0012388 | 3300046559 | Bacteria | 5779 |
| 676 | Ga0495667_0033062 | 3300046559 | Bacteria | 3461 |
| 677 | Ga0495656_0000474 | 3300046615 | Bacteria | 13044 |
| 678 | Ga0495656_0013343 | 3300046615 | Bacteria | 3055 |
| 679 | Ga0495668_0001839 | 3300046616 | Bacteria | 19134 |
| 680 | Ga0495668_0006812 | 3300046616 | Bacteria | 7418 |
| 681 | Ga0495668_0012306 | 3300046616 | Bacteria | 5075 |
| 682 | Ga0495668_0015405 | 3300046616 | Bacteria | 4466 |
| 683 | Ga0495668_0024779 | 3300046616 | Bacteria | 3411 |
| 684 | Ga0495668_0025241 | 3300046616 | Bacteria | 3377 |
| 685 | Ga0495668_0033278 | 3300046616 | Bacteria | 2897 |
| 686 | Ga0495668_0057661 | 3300046616 | Bacteria | 2143 |
| 687 | Ga0495634_0007414 | 3300046642 | Bacteria | 8246 |
| 688 | Ga0495634_0022347 | 3300046642 | Bacteria | 4458 |
| 689 | Ga0495611_0004328 | 3300046648 | Bacteria | 6160 |
| 690 | Ga0495625_0000897 | 3300046660 | Bacteria | 40203 |
| 691 | Ga0495625_0004030 | 3300046660 | Bacteria | 14051 |
| 692 | Ga0495625_0027780 | 3300046660 | Bacteria | 4253 |
| 693 | Ga0495635_0000241 | 3300046663 | Bacteria | 34839 |
| 694 | Ga0495635_0002402 | 3300046663 | Bacteria | 12759 |
| 695 | Ga0495635_0006833 | 3300046663 | Bacteria | 7970 |
| 696 | Ga0495635_0008016 | 3300046663 | Bacteria | 7379 |
| 697 | Ga0495635_0016174 | 3300046663 | Bacteria | 5208 |
| 698 | Ga0495659_0000129 | 3300046664 | Bacteria | 33093 |
| 699 | Ga0495661_0001219 | 3300046665 | Bacteria | 22320 |
| 700 | Ga0495661_0002280 | 3300046665 | Bacteria | 14840 |
| 701 | Ga0495661_0014885 | 3300046665 | Bacteria | 5201 |
| 702 | Ga0495588_0002151 | 3300046674 | Bacteria | 8428 |
| 703 | Ga0495588_0024316 | 3300046674 | Bacteria | 3008 |
| 704 | Ga0495588_0027592 | 3300046674 | Bacteria | 2837 |
| 705 | Ga0495657_0000637 | 3300046675 | Bacteria | 31781 |
| 706 | Ga0495657_0001501 | 3300046675 | Bacteria | 20104 |
| 707 | Ga0495657_0003700 | 3300046675 | Bacteria | 12383 |
| 708 | Ga0495657_0024543 | 3300046675 | Bacteria | 4292 |
| 709 | Ga0495657_0108067 | 3300046675 | Bacteria | 1765 |
| 710 | Ga0495599_0000148 | 3300046678 | Bacteria | 45714 |
| 711 | Ga0495599_0002232 | 3300046678 | Bacteria | 11280 |
| 712 | Ga0495599_0012230 | 3300046678 | Bacteria | 5286 |
| 713 | Ga0495623_0005748 | 3300046679 | Bacteria | 8094 |
| 714 | Ga0495623_0013967 | 3300046679 | Bacteria | 5203 |
| 715 | Ga0495623_0017622 | 3300046679 | Bacteria | 4612 |
| 716 | Ga0495623_0026067 | 3300046679 | Bacteria | 3765 |
| 717 | Ga0495623_0045795 | 3300046679 | Bacteria | 2777 |
| 718 | Ga0495646_0025543 | 3300046680 | Bacteria | 3715 |
| 719 | Ga0495646_0070046 | 3300046680 | Bacteria | 2067 |
| 720 | Ga0495647_0004539 | 3300046681 | Bacteria | 4518 |
| 721 | Ga0495647_0038287 | 3300046681 | Bacteria | 1813 |
| 722 | Ga0495658_0004596 | 3300046683 | Bacteria | 6794 |
| 723 | Ga0495658_0059342 | 3300046683 | Bacteria | 2190 |
| 724 | Ga0495658_0107492 | 3300046683 | Bacteria | 1673 |
| 725 | Ga0495658_0139228 | 3300046683 | Bacteria | 1483 |
| 726 | Ga0495658_0152381 | 3300046683 | Bacteria | 1421 |
| 727 | Ga0495669_0000190 | 3300046684 | Bacteria | 38101 |
| 728 | Ga0495669_0000986 | 3300046684 | Bacteria | 11894 |
| 729 | Ga0495669_0002903 | 3300046684 | Bacteria | 7039 |
| 730 | Ga0495669_0007359 | 3300046684 | Bacteria | 4613 |
| 731 | Ga0495613_0004558 | 3300046689 | Bacteria | 10393 |
| 732 | Ga0495624_0003121 | 3300046690 | Bacteria | 12384 |
| 733 | Ga0495670_0000693 | 3300046691 | Bacteria | 16033 |
| 734 | Ga0495670_0001566 | 3300046691 | Bacteria | 11181 |
| 735 | Ga0495671_0000053 | 3300046692 | Bacteria | 129715 |
| 736 | Ga0495671_0000792 | 3300046692 | Bacteria | 22664 |
| 737 | Ga0495671_0029998 | 3300046692 | Bacteria | 2788 |
| 738 | Ga0495649_0004954 | 3300046694 | Bacteria | 8579 |
| 739 | Ga0495649_0035256 | 3300046694 | Bacteria | 2752 |
| 740 | Ga0495589_0013026 | 3300046794 | Bacteria | 4296 |
| 741 | Ga0495589_0014310 | 3300046794 | Bacteria | 4087 |
| 742 | Ga0495600_0000157 | 3300046809 | Bacteria | 39158 |
| 743 | Ga0495600_0001685 | 3300046809 | Bacteria | 12349 |
| 744 | Ga0495600_0003815 | 3300046809 | Bacteria | 8928 |
| 745 | Ga0495600_0120189 | 3300046809 | Bacteria | 1709 |
| 746 | Ga0495660_0000479 | 3300046810 | Bacteria | 33262 |
| 747 | Ga0495660_0052736 | 3300046810 | Bacteria | 2209 |
| 748 | Ga0495581_0000979 | 3300047315 | Bacteria | 15353 |
| 749 | Ga0495581_0014601 | 3300047315 | Bacteria | 4554 |
| 750 | Ga0495581_0040994 | 3300047315 | Bacteria | 2679 |
| 751 | Ga0495604_0002433 | 3300047317 | Bacteria | 14892 |
| 752 | Ga0495604_0003832 | 3300047317 | Bacteria | 11979 |
| 753 | Ga0495604_0008415 | 3300047317 | Bacteria | 8152 |
| 754 | Ga0495604_0008510 | 3300047317 | Bacteria | 8101 |
| 755 | Ga0495674_0003964 | 3300047319 | Bacteria | 14356 |
| 756 | Ga0495674_0005950 | 3300047319 | Bacteria | 11703 |
| 757 | Ga0495674_0016830 | 3300047319 | Bacteria | 6818 |
| 758 | Ga0495674_0123862 | 3300047319 | Bacteria | 2182 |
| 759 | Ga0495672_0000502 | 3300047320 | Bacteria | 45063 |
| 760 | Ga0495672_0053993 | 3300047320 | Bacteria | 2351 |
| 761 | Ga0495676_0000177 | 3300047321 | Bacteria | 50096 |
| 762 | Ga0495676_0094530 | 3300047321 | Bacteria | 2226 |
| 763 | Ga0495680_0002928 | 3300047322 | Bacteria | 17140 |
| 764 | Ga0495680_0006343 | 3300047322 | Bacteria | 11008 |
| 765 | Ga0495680_0007799 | 3300047322 | Bacteria | 9775 |
| 766 | Ga0495680_0008955 | 3300047322 | Bacteria | 9045 |
| 767 | Ga0495680_0021389 | 3300047322 | Bacteria | 5417 |
| 768 | Ga0495680_0113335 | 3300047322 | Bacteria | 2008 |
| 769 | Ga0495680_0172873 | 3300047322 | Bacteria | 1563 |
| 770 | Ga0495683_0000072 | 3300047323 | Bacteria | 104027 |
| 771 | Ga0495683_0039055 | 3300047323 | Bacteria | 2400 |
| 772 | Ga0495687_007756 | 3300047443 | Bacteria | 6253 |
| 773 | Ga0495675_0001960 | 3300047444 | Bacteria | 12278 |
| 774 | Ga0495675_0002204 | 3300047444 | Bacteria | 11613 |
| 775 | Ga0495675_0003158 | 3300047444 | Bacteria | 9887 |
| 776 | Ga0495675_0004738 | 3300047444 | Bacteria | 8259 |
| 777 | Ga0495675_0112382 | 3300047444 | Bacteria | 1700 |
| 778 | Ga0495677_0009205 | 3300047445 | Bacteria | 3649 |
| 779 | Ga0495677_0017380 | 3300047445 | Bacteria | 2608 |
| 780 | Ga0495685_052390 | 3300047447 | Bacteria | 1382 |
| 781 | Ga0495681_0001730 | 3300047470 | Bacteria | 16136 |
| 782 | Ga0495681_0001973 | 3300047470 | Bacteria | 14989 |
| 783 | Ga0495681_0004982 | 3300047470 | Bacteria | 8957 |
| 784 | Ga0495681_0007555 | 3300047470 | Bacteria | 6922 |
| 785 | Ga0495684_0001447 | 3300047471 | Bacteria | 18997 |
| 786 | Ga0495684_0001837 | 3300047471 | Bacteria | 17050 |
| 787 | Ga0495684_0003840 | 3300047471 | Bacteria | 11705 |
| 788 | Ga0495684_0004907 | 3300047471 | Bacteria | 10436 |
| 789 | Ga0495684_0015191 | 3300047471 | Bacteria | 5930 |
| 790 | Ga0495684_0033399 | 3300047471 | Bacteria | 3946 |
| 791 | Ga0495684_0248960 | 3300047471 | Bacteria | 1293 |
| 792 | Ga0495593_0006169 | 3300047673 | Bacteria | 7050 |
| 793 | Ga0495593_0006375 | 3300047673 | Bacteria | 6920 |
| 794 | Ga0495593_0008803 | 3300047673 | Bacteria | 5861 |
| 795 | Ga0495593_0015923 | 3300047673 | Bacteria | 4248 |
| 796 | Ga0495593_0030204 | 3300047673 | Bacteria | 2966 |
| 797 | Ga0495602_0007101 | 3300048088 | Bacteria | 11757 |
| 798 | Ga0495602_0007959 | 3300048088 | Bacteria | 11078 |
| 799 | Ga0495602_0015932 | 3300048088 | Bacteria | 7568 |
| 800 | Ga0495602_0016383 | 3300048088 | Bacteria | 7454 |
| 801 | Ga0495602_0122525 | 3300048088 | Bacteria | 2089 |
| 802 | Ga0495614_0007477 | 3300048089 | Bacteria | 4862 |
| 803 | Ga0495614_0015948 | 3300048089 | Bacteria | 3272 |
| 804 | Ga0495614_0066186 | 3300048089 | Bacteria | 1555 |
| 805 | Ga0495614_0072546 | 3300048089 | Bacteria | 1485 |
| 806 | Ga0495614_0075099 | 3300048089 | Bacteria | 1460 |
| 807 | Ga0495626_0067233 | 3300048091 | Bacteria | 1619 |
| 808 | Ga0496100_0044951 | 3300048903 | Bacteria | 2832 |
| 809 | Ga0496100_0059858 | 3300048903 | Bacteria | 2504 |
| 810 | Ga0496100_0212940 | 3300048903 | Bacteria | 1414 |
| 811 | Ga0496101_0001981 | 3300048904 | Bacteria | 12422 |
| 812 | Ga0496101_0073470 | 3300048904 | Bacteria | 2512 |
| 813 | Ga0496101_0085784 | 3300048904 | Bacteria | 2334 |
| 814 | Ga0496101_0148389 | 3300048904 | Bacteria | 1792 |
| 815 | Ga0496101_0162624 | 3300048904 | Bacteria | 1713 |
| 816 | Ga0496101_0193795 | 3300048904 | Bacteria | 1569 |
| 817 | Ga0496102_0000290 | 3300048905 | Bacteria | 64278 |
| 818 | Ga0496102_0015866 | 3300048905 | Bacteria | 6570 |
| 819 | Ga0496102_0046839 | 3300048905 | Bacteria | 3928 |
| 820 | Ga0496102_0065436 | 3300048905 | Bacteria | 3332 |
| 821 | Ga0496102_0096302 | 3300048905 | Bacteria | 2744 |
| 822 | Ga0496102_0135455 | 3300048905 | Bacteria | 2308 |
| 823 | Ga0496103_0001884 | 3300048906 | Bacteria | 13631 |
| 824 | Ga0496103_0032964 | 3300048906 | Bacteria | 3164 |
| 825 | Ga0496103_0079475 | 3300048906 | Bacteria | 2061 |
| 826 | Ga0496104_0002774 | 3300048907 | Bacteria | 15090 |
| 827 | Ga0496104_0044290 | 3300048907 | Bacteria | 4182 |
| 828 | Ga0496104_0060879 | 3300048907 | Bacteria | 3577 |
| 829 | Ga0496104_0156987 | 3300048907 | Bacteria | 2183 |
| 830 | Ga0496104_0157211 | 3300048907 | Bacteria | 2181 |
| 831 | Ga0496104_0241900 | 3300048907 | Bacteria | 1717 |
| 832 | Ga0496105_0006708 | 3300048908 | Bacteria | 8860 |
| 833 | Ga0496105_0024487 | 3300048908 | Bacteria | 4904 |
| 834 | Ga0496105_0026618 | 3300048908 | Bacteria | 4721 |
| 835 | Ga0496105_0115445 | 3300048908 | Bacteria | 2215 |
| 836 | Ga0496105_0241480 | 3300048908 | Bacteria | 1466 |
| 837 | Ga0496106_0004649 | 3300048909 | Bacteria | 10178 |
| 838 | Ga0496106_0014892 | 3300048909 | Bacteria | 5752 |
| 839 | Ga0496106_0112976 | 3300048909 | Bacteria | 2117 |
| 840 | Ga0496106_0211283 | 3300048909 | Bacteria | 1546 |
| 841 | Ga0496107_0018337 | 3300048910 | Bacteria | 4928 |
| 842 | Ga0496108_0001200 | 3300048911 | Bacteria | 20310 |
| 843 | Ga0496108_0002055 | 3300048911 | Bacteria | 16126 |
| 844 | Ga0496108_0040264 | 3300048911 | Bacteria | 3894 |
| 845 | Ga0496108_0127121 | 3300048911 | Bacteria | 2189 |
| 846 | Ga0496109_0002191 | 3300048912 | Bacteria | 16218 |
| 847 | Ga0496109_0003922 | 3300048912 | Bacteria | 12432 |
| 848 | Ga0496109_0112286 | 3300048912 | Bacteria | 2534 |
| 849 | Ga0496109_0128766 | 3300048912 | Bacteria | 2361 |
| 850 | Ga0496109_0196390 | 3300048912 | Bacteria | 1897 |
| 851 | Ga0496110_0006543 | 3300048913 | Bacteria | 9247 |
| 852 | Ga0496110_0008434 | 3300048913 | Bacteria | 8295 |
| 853 | Ga0496110_0013698 | 3300048913 | Bacteria | 6718 |
| 854 | Ga0496110_0019705 | 3300048913 | Bacteria | 5683 |
| 855 | Ga0496110_0106931 | 3300048913 | Bacteria | 2511 |
| 856 | Ga0496110_0209337 | 3300048913 | Bacteria | 1773 |
| 857 | Ga0496110_0234606 | 3300048913 | Bacteria | 1669 |
| 858 | Ga0496111_0005231 | 3300048914 | Bacteria | 8272 |
| 859 | Ga0496111_0029693 | 3300048914 | Bacteria | 3884 |
| 860 | Ga0496112_0007549 | 3300048915 | Bacteria | 9657 |
| 861 | Ga0496112_0017894 | 3300048915 | Bacteria | 6669 |
| 862 | Ga0496112_0042466 | 3300048915 | Bacteria | 4448 |
| 863 | Ga0496112_0052188 | 3300048915 | Bacteria | 4013 |
| 864 | Ga0496112_0070600 | 3300048915 | Bacteria | 3452 |
| 865 | Ga0496113_0006427 | 3300048916 | Bacteria | 7447 |
| 866 | Ga0496113_0009206 | 3300048916 | Bacteria | 6478 |
| 867 | Ga0496113_0013367 | 3300048916 | Bacteria | 5558 |
| 868 | Ga0496113_0018802 | 3300048916 | Bacteria | 4819 |
| 869 | Ga0496113_0032510 | 3300048916 | Bacteria | 3792 |
| 870 | Ga0496113_0056591 | 3300048916 | Bacteria | 2945 |
| 871 | Ga0496114_0004557 | 3300048917 | Bacteria | 10763 |
| 872 | Ga0496114_0119002 | 3300048917 | Bacteria | 2270 |
| 873 | Ga0496115_0016923 | 3300048918 | Bacteria | 5562 |
| 874 | Ga0496115_0030394 | 3300048918 | Bacteria | 4249 |
| 875 | Ga0496115_0031522 | 3300048918 | Bacteria | 4178 |
| 876 | Ga0496115_0180606 | 3300048918 | Bacteria | 1744 |
| 877 | Ga0496116_0005939 | 3300048919 | Bacteria | 11197 |
| 878 | Ga0496119_0080276 | 3300048922 | Bacteria | 1882 |
| 879 | Ga0496121_0020595 | 3300048924 | Bacteria | 6514 |
| 880 | Ga0496121_0031111 | 3300048924 | Bacteria | 4885 |
| 881 | Ga0496121_0037452 | 3300048924 | Bacteria | 4308 |
| 882 | Ga0496125_0055788 | 3300048928 | Bacteria | 3215 |
| 883 | Ga0496125_0089314 | 3300048928 | Bacteria | 2318 |
| 884 | Ga0496126_0025817 | 3300048929 | Bacteria | 5644 |
| 885 | Ga0496126_0095503 | 3300048929 | Bacteria | 2607 |
| 886 | Ga0496126_0212174 | 3300048929 | Bacteria | 1629 |
| 887 | Ga0495678_000638 | 3300049459 | Bacteria | 32238 |
| 888 | Ga0495682_0007467 | 3300049460 | Bacteria | 4343 |
| 889 | Ga0501033_0058513 | 3300049570 | Bacteria | 2847 |
| 890 | Ga0501034_0038492 | 3300049571 | Bacteria | 4842 |
| 891 | Ga0501034_0113831 | 3300049571 | Bacteria | 2694 |
| 892 | Ga0501034_0185232 | 3300049571 | Bacteria | 2046 |
| 893 | Ga0501037_0059761 | 3300049573 | Bacteria | 2780 |
| 894 | Ga0501038_0086191 | 3300049574 | Bacteria | 2639 |
| 895 | Ga0501046_0003374 | 3300049580 | Bacteria | 14663 |
| 896 | Ga0501047_0102572 | 3300049581 | Bacteria | 2740 |
| 897 | Ga0501072_0051791 | 3300049588 | Bacteria | 3232 |
| 898 | Ga0501217_005273 | 3300049661 | Bacteria | 2697 |
| 899 | Ga0501079_0040966 | 3300049741 | Bacteria | 3574 |
| 900 | nmdc:mga03n38_7752_c1 | 3300050490 | Bacteria | 3810 |
| 901 | nmdc:mga00v17_14590_c2 | 3300050491 | Bacteria | 4025 |
| 902 | nmdc:mga00v17_19839_c1 | 3300050491 | Bacteria | 3844 |
| 903 | nmdc:mga0yw44_15454_c1 | 3300050492 | Bacteria | 4090 |
| 904 | nmdc:mga0yw44_81299_c1 | 3300050492 | Bacteria | 2031 |
| 905 | nmdc:mga0k408_31326_c1 | 3300050493 | Bacteria | 3036 |
| 906 | nmdc:mga0k408_44407_c1 | 3300050493 | Bacteria | 2563 |
| 907 | nmdc:mga05p37_2263_c1 | 3300050507 | Bacteria | 22436 |
| 908 | nmdc:mga08y16_22844_c1 | 3300050511 | Bacteria | 6601 |
| 909 | nmdc:mga08y16_280643_c1 | 3300050511 | Bacteria | 1718 |
| 910 | nmdc:mga08y16_30816_c1 | 3300050511 | Bacteria | 5641 |
| 911 | nmdc:mga08y16_80679_c1 | 3300050511 | Bacteria | 3392 |
| 912 | nmdc:mga08y16_89123_c1 | 3300050511 | Bacteria | 3215 |
| 913 | nmdc:mga0n895_31943_c1 | 3300050512 | Bacteria | 5048 |
| 914 | nmdc:mga0n895_473942_c1 | 3300050512 | Bacteria | 1263 |
| 915 | nmdc:mga0a205_54053_c1 | 3300050515 | Bacteria | 3877 |
| 916 | nmdc:mga0sz30_52057_c1 | 3300050516 | Bacteria | 1738 |
| 917 | Ga0495601_0007085 | 3300053077 | Bacteria | 6568 |
| 918 | Ga0495601_0010230 | 3300053077 | Bacteria | 5577 |
| 919 | Ga0495601_0022445 | 3300053077 | Bacteria | 3874 |
| 920 | Ga0495612_0001392 | 3300053078 | Bacteria | 9978 |
| 921 | Ga0495612_0014040 | 3300053078 | Bacteria | 3226 |
| 922 | Ga0500635_0001121 | 3300053080 | Bacteria | 6404 |
| 923 | Ga0495595_0000325 | 3300053084 | Bacteria | 18606 |
| 924 | Ga0495595_0001287 | 3300053084 | Bacteria | 9790 |
| 925 | Ga0495595_0003596 | 3300053084 | Bacteria | 6157 |
| 926 | Ga0495595_0008358 | 3300053084 | Bacteria | 4248 |
| 927 | Ga0495595_0022337 | 3300053084 | Bacteria | 2777 |
| 928 | Ga0495595_0066267 | 3300053084 | Bacteria | 1700 |
| 929 | Ga0495619_0000517 | 3300053085 | Bacteria | 25651 |
| 930 | Ga0495619_0000698 | 3300053085 | Bacteria | 21970 |
| 931 | Ga0495619_0000906 | 3300053085 | Bacteria | 19422 |
| 932 | Ga0495619_0002729 | 3300053085 | Bacteria | 11534 |
| 933 | Ga0495619_0004330 | 3300053085 | Bacteria | 9053 |
| 934 | Ga0495619_0018396 | 3300053085 | Bacteria | 4433 |
| 935 | Ga0495619_0023260 | 3300053085 | Bacteria | 3971 |
| 936 | Ga0495619_0030068 | 3300053085 | Bacteria | 3514 |
| 937 | Ga0500595_011310 | 3300053119 | Bacteria | 3500 |
| 938 | Ga0500658_0035070 | 3300053134 | Bacteria | 1984 |
| 939 | Ga0500637_0011579 | 3300053178 | Bacteria | 4569 |
| 940 | Ga0466962_0005345 | 3300061719 | Bacteria | 6174 |
| 941 | Ga0530510_0007515 | 3300061734 | Bacteria | 7590 |
| 942 | 2512037813 | 2511231221 | Bacteria | 6846400 |
| 943 | 2513591604 | 2513237087 | Bacteria | 5817514 |
| 944 | 2519460614 | 2519103095 | Bacteria | 6629912 |
| 945 | 2524535119 | 2524023228 | Bacteria | 10118060 |
| 946 | 2545555820 | 2545555800 | Bacteria | 4222588 |
| 947 | 2552749290 | 2551306352 | Bacteria | 3873115 |
| 948 | 2578929237 | 2576861599 | Bacteria | 4217202 |
| 949 | 2585293098 | 2582581311 | Bacteria | 6763856 |
| 950 | 2599736257 | 2599185239 | Bacteria | 8686614 |
| 951 | 2599746149 | 2599185240 | Bacteria | 7968121 |
| 952 | 2600208017 | 2599185355 | Bacteria | 7968906 |
| 953 | 2631983026 | 2630968484 | Bacteria | 3876276 |
| 954 | 2640734241 | 2639762793 | Bacteria | 3943681 |
| 955 | 2644249876 | 2643221645 | Bacteria | 7207331 |
| 956 | 2644358541 | 2643221664 | Bacteria | 7272945 |
| 957 | 2644362428 | 2643221665 | Bacteria | 4699229 |
| 958 | 2644704630 | 2643221729 | Bacteria | 6621700 |
| 959 | 2644709324 | 2643221730 | Bacteria | 6523787 |
| 960 | 2651533146 | 2648501850 | Bacteria | 3975476 |
| 961 | 2674419426 | 2671180844 | Bacteria | 4164150 |
| 962 | 2676743740 | 2675903129 | Bacteria | 7964495 |
| 963 | 2678231217 | 2675903507 | Bacteria | 3737791 |
| 964 | 2685150121 | 2684622632 | Bacteria | 5380049 |
| 965 | 2695627686 | 2695420354 | Bacteria | 3922431 |
| 966 | 2698323141 | 2695420987 | Bacteria | 6152737 |
| 967 | 2705994095 | 2703719227 | Bacteria | 5631989 |
| 968 | 2717916517 | 2716884898 | Bacteria | 3928789 |
| 969 | 2721505423 | 2718218445 | Bacteria | 5113413 |
| 970 | 2728753168 | 2728368998 | Bacteria | 8720350 |
| 971 | 2738739475 | 2738541280 | Bacteria | 6630198 |
| 972 | 2738815211 | 2738541295 | Bacteria | 5730091 |
| 973 | 2738846048 | 2738541300 | Bacteria | 6675882 |
| 974 | 2739157934 | 2738541358 | Bacteria | 5932299 |
| 975 | 2739210620 | 2738543006 | Bacteria | 5904091 |
| 976 | 2739269069 | 2738543017 | Bacteria | 4271950 |
| 977 | 2739275799 | 2738543018 | Bacteria | 6718814 |
| 978 | 2739344843 | 2738543030 | Bacteria | 6719714 |
| 979 | 2745161341 | 2744054655 | Bacteria | 3552603 |
| 980 | 2774388223 | 2773857761 | Bacteria | 3837365 |
| 981 | 2774437431 | 2773857770 | Bacteria | 3911866 |
| 982 | 2793083827 | |||
| 983 | 2808970582 | 2808606384 | Bacteria | 8474373 |
| 984 | 2809005311 | 2808606390 | Bacteria | 8476311 |
| 985 | 2809012288 | 2808606391 | Bacteria | 8308166 |
| 986 | 2817257602 | 2816332253 | Bacteria | 6764532 |
| 987 | 2817281995 | 2816332256 | Bacteria | 6891714 |
| 988 | 2817451545 | 2816332286 | Bacteria | 6853759 |
| 989 | 2819578796 | 2818991443 | Bacteria | 6598732 |
| 990 | 2819634099 | 2818991452 | Bacteria | 8442785 |
| 991 | 2857583775 | 2857581216 | Bacteria | 5522813 |
| 992 | 2857606615 | 2857604169 | Bacteria | 5111450 |
| 993 | 2858689639 | 2858688981 | Bacteria | 8184122 |
| 994 | 2863423908 | 2863421361 | Bacteria | 7300805 |
| 995 | 2870073949 | 2870068957 | Bacteria | 8925310 |
| 996 | 2877770529 | 2877768649 | Bacteria | 3957164 |
| 997 | 2880171514 | 2880169592 | Bacteria | 3900066 |
| 998 | 2885381802 | 2885374607 | Bacteria | 8927485 |
| 999 | 2885414966 | 2885409591 | Bacteria | 9235467 |
| 1000 | 2897809570 | 2897803580 | Bacteria | 7000062 |
| 1001 | 2904568478 | 2904564687 | Bacteria | 7609577 |
| 1002 | 2904575521 | 2904571731 | Bacteria | 7608790 |
| 1003 | 2916699725 | 2916699645 | Bacteria | 3568996 |
| 1004 | 2919184148 | 2919182534 | Bacteria | 3907101 |
| 1005 | 2919418954 | 2919414237 | Bacteria | 5429133 |
| 1006 | 2928160859 | 2928157003 | Bacteria | 7522202 |
| 1007 | 2928170480 | 2928163908 | Bacteria | 7561269 |
| 1008 | 2928171305 | 2928170801 | Bacteria | 8785406 |
| 1009 | 2928516581 | 2928515477 | Bacteria | 4448421 |
| 1010 | 2928536343 | 2928536128 | Bacteria | 7657547 |
| 1011 | 2936363460 | 2936361878 | Bacteria | 5632809 |
| 1012 | 2938919505 | 2938917290 | Bacteria | 5914775 |
| 1013 | 2947428876 | 2947426588 | Bacteria | 5357194 |
| 1014 | 2965763369 | 2965761152 | Bacteria | 5806513 |
| 1015 | 2969142984 | 2969141011 | Bacteria | 4118468 |
| 1016 | 2971895296 | 2971893375 | Bacteria | 3929648 |
| 1017 | 2979085823 | 2979083700 | Bacteria | 5894929 |
| 1018 | 2981991492 | 2981990288 | Bacteria | 7590678 |
| 1019 | 2984570288 | 2984568884 | Bacteria | 3884413 |
| 1020 | 3001895494 | 3001892409 | Bacteria | 6328293 |
| 1021 | 3001898723 | 3001892409 | Bacteria | 6328293 |
| 1022 | 3006883344 | 3006879489 | Bacteria | 4064221 |
| 1023 | 3006974296 | 3006973921 | Bacteria | 4423788 |
| 1024 | 642418927 | 641736154 | Bacteria | 7689995 |
| 1025 | 8006936540 | 8006933436 | Bacteria | 10410654 |
| 1026 | 8006976506 | 8006973647 | Bacteria | 10679141 |
| 1027 | 8006991366 | 8006984368 | Bacteria | 9651211 |
| 1028 | 8018849413 | 8018845410 | Bacteria | 8933938 |
| 1029 | 8020808572 | 8020807995 | Bacteria | 6801506 |
| 1030 | 8020938516 | 8020938398 | Bacteria | 7472757 |
| 1031 | 8020946241 | 8020945358 | Bacteria | 8467355 |
| 1032 | 8020954930 | 8020953355 | Bacteria | 7439080 |
| 1033 | 8021123466 | 8021120328 | Bacteria | 8782274 |
| 1034 | 8022625676 | 8022621104 | Bacteria | 5241040 |
| 1035 | 8022631139 | 8022630665 | Bacteria | 3886130 |
| 1036 | 8022798574 | 8022792930 | Bacteria | 5693794 |
| 1037 | 8022798576 | 8022792930 | Bacteria | 5693794 |
| 1038 | 8022949405 | 8022948649 | Bacteria | 5366783 |
| 1039 | 8023444113 | 8023438354 | Bacteria | 5779374 |
| 1040 | 8023449704 | 8023444577 | Bacteria | 5661597 |
| 1041 | 8039103311 | 8039098773 | Bacteria | 6602928 |
| 1042 | 8040168317 | 8040167225 | Bacteria | 6542727 |
| 1043 | 8040175895 | 8040173305 | Bacteria | 6827067 |
| 1044 | 8054284710 | 8054280661 | Bacteria | 4232245 |
| 1045 | 8057584914 | 8057582654 | Bacteria | 5218944 |
| 1046 | 8057584916 | 8057582654 | Bacteria | 5218944 |
| 1047 | Ga0207639_10141064 | |||
| 1048 | JGI24736J21556_1010749 | |||
| 1049 | JGI24739J22299_10003563 | |||
| 1050 | JGI24735J21928_10023965 | |||
| 1051 | JGI25159J45721_1001328 | |||
| 1052 | JGI25159J45721_1011754 | |||
| 1053 | JGI25151J46595_10000302 | |||
| 1054 | JGI25151J46595_10002843 | |||
| 1055 | JGI25151J46595_10006202 | |||
| 1056 | JGI25151J46595_10009043 | |||
| 1057 | JGI25404J52841_10002675 | |||
| 1058 | Ga0055532_1000540 | |||
| 1059 | Ga0055535_1000950 | |||
| 1060 | Ga0055535_1000957 | |||
| 1061 | Ga0055542_1000942 | |||
| 1062 | Ga0055542_1000996 | |||
| 1063 | Ga0055529_1000599 | |||
| 1064 | Ga0055528_1007778 | |||
| 1065 | Ga0058692_1000003 | |||
| 1066 | Ga0058692_1000514 | |||
| 1067 | Ga0065703_1000186 | |||
| 1068 | Ga0065715_10006850 | |||
| 1069 | Ga0065715_10126718 | |||
| 1070 | Ga0065707_10092100 | |||
| 1071 | Ga0070658_10014788 | |||
| 1072 | Ga0070658_10066708 | |||
| 1073 | Ga0070676_10008061 | |||
| 1074 | Ga0070676_10025909 | |||
| 1075 | Ga0070683_100214243 | |||
| 1076 | Ga0070670_100002371 | |||
| 1077 | Ga0070670_100013676 | |||
| 1078 | Ga0070677_10010142 | |||
| 1079 | Ga0068869_100028039 | |||
| 1080 | Ga0068869_100029359 | |||
| 1081 | Ga0068869_100155521 | |||
| 1082 | Ga0070666_10007027 | |||
| 1083 | Ga0070666_10020818 | |||
| 1084 | Ga0068868_100028335 | |||
| 1085 | Ga0070660_100000011 | |||
| 1086 | Ga0070660_100001582 | |||
| 1087 | Ga0070689_100002194 | |||
| 1088 | Ga0070689_100028264 | |||
| 1089 | Ga0070689_100143446 | |||
| 1090 | Ga0070687_100004523 | |||
| 1091 | Ga0070687_100031771 | |||
| 1092 | Ga0070661_100011088 | |||
| 1093 | Ga0070668_100012511 | |||
| 1094 | Ga0070668_100029711 | |||
| 1095 | Ga0070669_100007114 | |||
| 1096 | Ga0070669_100041553 | |||
| 1097 | Ga0070675_100009300 | |||
| 1098 | Ga0070675_100033951 | |||
| 1099 | Ga0070675_100133441 | |||
| 1100 | Ga0070671_100004493 | |||
| 1101 | Ga0070671_100008194 | |||
| 1102 | Ga0070671_100025982 | |||
| 1103 | Ga0070671_100026508 | |||
| 1104 | Ga0070671_100045731 | |||
| 1105 | Ga0070674_100007285 | |||
| 1106 | Ga0070674_100073043 | |||
| 1107 | Ga0070674_100106398 | |||
| 1108 | Ga0070674_100108965 | |||
| 1109 | Ga0070673_100056654 | |||
| 1110 | Ga0070673_100101450 | |||
| 1111 | Ga0070673_100158745 | |||
| 1112 | Ga0070673_100180477 | |||
| 1113 | Ga0070688_100012818 | |||
| 1114 | Ga0070688_100079715 | |||
| 1115 | Ga0070659_100000046 | |||
| 1116 | Ga0070667_100019267 | |||
| 1117 | Ga0070667_100020656 | |||
| 1118 | Ga0070667_100078148 | |||
| 1119 | Ga0070714_100004759 | |||
| 1120 | Ga0070714_100051982 | |||
| 1121 | Ga0070713_100006956 | |||
| 1122 | Ga0070710_10003340 | |||
| 1123 | Ga0070701_10023487 | |||
| 1124 | Ga0070701_10061407 | |||
| 1125 | Ga0070663_100000063 | |||
| 1126 | Ga0070663_100020753 | |||
| 1127 | Ga0070663_100024576 | |||
| 1128 | Ga0070678_100001468 | |||
| 1129 | Ga0070678_100039647 | |||
| 1130 | Ga0070678_100065415 | |||
| 1131 | Ga0070678_100115189 | |||
| 1132 | Ga0070662_100000746 | |||
| 1133 | Ga0070662_100009332 | |||
| 1134 | Ga0070662_100078865 | |||
| 1135 | Ga0070698_100036419 | |||
| 1136 | Ga0070699_100017573 | |||
| 1137 | Ga0070684_100044662 | |||
| 1138 | Ga0068853_100005112 | |||
| 1139 | Ga0070672_100006518 | |||
| 1140 | Ga0070672_100018830 | |||
| 1141 | Ga0070672_100020435 | |||
| 1142 | Ga0070672_100025433 | |||
| 1143 | Ga0070672_100079324 | |||
| 1144 | Ga0070693_100014050 | |||
| 1145 | Ga0070665_100000715 | |||
| 1146 | Ga0070665_100006096 | |||
| 1147 | Ga0070665_100112820 | |||
| 1148 | Ga0070704_100025051 | |||
| 1149 | Ga0068855_100002337 | |||
| 1150 | Ga0068855_100121702 | |||
| 1151 | Ga0068855_100346575 | |||
| 1152 | Ga0070664_100003047 | |||
| 1153 | Ga0070664_100009550 | |||
| 1154 | Ga0070664_100074450 | |||
| 1155 | Ga0070664_100100451 | |||
| 1156 | Ga0068857_100152426 | |||
| 1157 | Ga0068854_100016430 | |||
| 1158 | Ga0068854_100083566 | |||
| 1159 | Ga0068856_100009139 | |||
| 1160 | Ga0068856_100009908 | |||
| 1161 | Ga0068852_100002152 | |||
| 1162 | Ga0068852_100019337 | |||
| 1163 | Ga0068852_100039576 | |||
| 1164 | Ga0068852_100068611 | |||
| 1165 | Ga0068864_100032982 | |||
| 1166 | Ga0068864_100075934 | |||
| 1167 | Ga0068864_100090244 | |||
| 1168 | Ga0068866_10004439 | |||
| 1169 | Ga0068866_10010910 | |||
| 1170 | Ga0068861_100018587 | |||
| 1171 | Ga0068861_100032883 | |||
| 1172 | Ga0068861_100086577 | |||
| 1173 | Ga0068861_100087847 | |||
| 1174 | Ga0068861_100100634 | |||
| 1175 | Ga0068851_10001542 | |||
| 1176 | Ga0068870_10042174 | |||
| 1177 | Ga0068858_100001923 | |||
| 1178 | Ga0068858_100012170 | |||
| 1179 | Ga0068858_100017127 | |||
| 1180 | Ga0068858_100195118 | |||
| 1181 | Ga0068860_100011768 | |||
| 1182 | Ga0068862_100033244 | |||
| 1183 | Ga0068862_100076669 | |||
| 1184 | Ga0081455_10007349 | |||
| 1185 | Ga0081455_10008446 | |||
| 1186 | Ga0081455_10016840 | |||
| 1187 | Ga0081540_1000011 | |||
| 1188 | Ga0081540_1000932 | |||
| 1189 | Ga0081540_1001375 | |||
| 1190 | Ga0081540_1002628 | |||
| 1191 | Ga0081540_1009312 | |||
| 1192 | Ga0081540_1009802 | |||
| 1193 | Ga0081539_10049554 | |||
| 1194 | Ga0075365_10015050 | |||
| 1195 | Ga0075365_10031674 | |||
| 1196 | Ga0075363_100004654 | |||
| 1197 | Ga0075364_10021037 | |||
| 1198 | Ga0070715_10000314 | |||
| 1199 | Ga0070716_100035162 | |||
| 1200 | Ga0070712_100008300 | |||
| 1201 | Ga0070712_100138649 | |||
| 1202 | Ga0075362_10018308 | |||
| 1203 | Ga0075367_10000301 | |||
| 1204 | Ga0075367_10040951 | |||
| 1205 | Ga0075369_10008318 | |||
| 1206 | Ga0075366_10004913 | |||
| 1207 | Ga0097621_100005267 | |||
| 1208 | Ga0097621_100021189 | |||
| 1209 | Ga0097621_100093557 | |||
| 1210 | Ga0097621_100180423 | |||
| 1211 | Ga0075370_10004812 | |||
| 1212 | Ga0068871_100002503 | |||
| 1213 | Ga0068871_100030886 | |||
| 1214 | Ga0068871_100078521 | |||
| 1215 | Ga0068871_100094424 | |||
| 1216 | Ga0075428_100041134 | |||
| 1217 | Ga0075428_100259648 | |||
| 1218 | Ga0075431_100016231 | |||
| 1219 | Ga0075434_100005496 | |||
| 1220 | Ga0068865_100001375 | |||
| 1221 | Ga0097620_100033007 | |||
| 1222 | Ga0075435_100092043 | |||
| 1223 | Ga0105251_10014435 | |||
| 1224 | Ga0105244_10000463 | |||
| 1225 | Ga0105244_10008315 | |||
| 1226 | Ga0105244_10009037 | |||
| 1227 | Ga0105244_10011256 | |||
| 1228 | Ga0105244_10018744 | |||
| 1229 | Ga0105244_10040872 | |||
| 1230 | Ga0105250_10000576 | |||
| 1231 | Ga0105250_10007842 | |||
| 1232 | Ga0105250_10012127 | |||
| 1233 | Ga0105250_10014914 | |||
| 1234 | Ga0105240_10003198 | |||
| 1235 | Ga0105240_10071203 | |||
| 1236 | Ga0105240_10079980 | |||
| 1237 | Ga0105240_10173091 | |||
| 1238 | Ga0111539_10021105 | |||
| 1239 | Ga0111539_10039118 | |||
| 1240 | Ga0111539_10093225 | |||
| 1241 | Ga0111539_10098484 | |||
| 1242 | Ga0111539_10126402 | |||
| 1243 | Ga0105245_10012324 | |||
| 1244 | Ga0105247_10003510 | |||
| 1245 | Ga0105247_10029599 | |||
| 1246 | Ga0105247_10046641 | |||
| 1247 | Ga0105247_10072988 | |||
| 1248 | Ga0105243_10000005 | |||
| 1249 | Ga0105243_10035027 | |||
| 1250 | Ga0105243_10061306 | |||
| 1251 | Ga0105241_10037240 | |||
| 1252 | Ga0105242_10061429 | |||
| 1253 | Ga0105248_10014105 | |||
| 1254 | Ga0105248_10035717 | |||
| 1255 | Ga0105248_10080920 | |||
| 1256 | Ga0105248_10087675 | |||
| 1257 | Ga0105248_10150160 | |||
| 1258 | Ga0105248_10176337 | |||
| 1259 | Ga0105237_10043348 | |||
| 1260 | Ga0105237_10050436 | |||
| 1261 | Ga0105237_10086939 | |||
| 1262 | Ga0105238_10022419 | |||
| 1263 | Ga0105238_10031814 | |||
| 1264 | Ga0105238_10068114 | |||
| 1265 | Ga0105249_10000952 | |||
| 1266 | Ga0105249_10312787 | |||
| 1267 | Ga0105239_10077815 | |||
| 1268 | Ga0105239_10149056 | |||
| 1269 | Ga0105246_10024178 | |||
| 1270 | Ga0105246_10038504 | |||
| 1271 | Ga0157373_10003228 | |||
| 1272 | Ga0157373_10066474 | |||
| 1273 | Ga0157371_10000696 | |||
| 1274 | Ga0157371_10106758 | |||
| 1275 | Ga0157370_10010102 | |||
| 1276 | Ga0157370_10040989 | |||
| 1277 | Ga0157369_10000160 | |||
| 1278 | Ga0157369_10000167 | |||
| 1279 | Ga0157369_10050032 | |||
| 1280 | Ga0157369_10050632 | |||
| 1281 | Ga0157369_10173649 | |||
| 1282 | Ga0157374_10008421 | |||
| 1283 | Ga0157374_10043887 | |||
| 1284 | Ga0157374_10053750 | |||
| 1285 | Ga0157374_10085470 | |||
| 1286 | Ga0157374_10150532 | |||
| 1287 | Ga0157374_10181080 | |||
| 1288 | Ga0157378_10000006 | |||
| 1289 | Ga0157378_10000929 | |||
| 1290 | Ga0157378_10003059 | |||
| 1291 | Ga0157378_10015977 | |||
| 1292 | Ga0157378_10100671 | |||
| 1293 | Ga0157378_10168699 | |||
| 1294 | Ga0157378_10181533 | |||
| 1295 | Ga0163162_10053703 | |||
| 1296 | Ga0163162_10129813 | |||
| 1297 | Ga0163162_10267793 | |||
| 1298 | Ga0157372_10000931 | |||
| 1299 | Ga0157372_10021605 | |||
| 1300 | Ga0157375_10007776 | |||
| 1301 | Ga0157375_10024721 | |||
| 1302 | Ga0157375_10037005 | |||
| 1303 | Ga0157375_10056716 | |||
| 1304 | Ga0157375_10086062 | |||
| 1305 | Ga0157375_10183998 | |||
| 1306 | Ga0163163_10010328 | |||
| 1307 | Ga0163163_10049500 | |||
| 1308 | Ga0163163_10272976 | |||
| 1309 | Ga0157380_10000708 | |||
| 1310 | Ga0157380_10010229 | |||
| 1311 | Ga0157380_10182467 | |||
| 1312 | Ga0157379_10023570 | |||
| 1313 | Ga0157379_10031044 | |||
| 1314 | Ga0157379_10174907 | |||
| 1315 | Ga0157379_10266093 | |||
| 1316 | Ga0157376_10001401 | |||
| 1317 | Ga0157376_10003679 | |||
| 1318 | Ga0157376_10005025 | |||
| 1319 | Ga0157376_10025276 | |||
| 1320 | Ga0157376_10072615 | |||
| 1321 | Ga0157376_10102932 | |||
| 1322 | Ga0163161_10001835 | |||
| 1323 | Ga0163161_10039990 | |||
| 1324 | Ga0163161_10149538 | |||
| 1325 | Ga0213872_10014095 | |||
| 1326 | Ga0224712_10000153 | |||
| 1327 | Ga0209566_100292 | |||
| 1328 | Ga0209674_104908 | |||
| 1329 | Ga0209672_100012 | |||
| 1330 | Ga0209672_100134 | |||
| 1331 | Ga0209147_100007 | |||
| 1332 | Ga0209147_100047 | |||
| 1333 | Ga0209147_100247 | |||
| 1334 | Ga0209147_104188 | |||
| 1335 | Ga0209258_100014 | |||
| 1336 | Ga0209258_100065 | |||
| 1337 | Ga0209148_1000091 | |||
| 1338 | Ga0209148_1000700 | |||
| 1339 | Ga0209565_1010906 | |||
| 1340 | Ga0209455_1000074 | |||
| 1341 | Ga0209455_1000713 | |||
| 1342 | Ga0209673_1000137 | |||
| 1343 | Ga0209130_1000633 | |||
| 1344 | Ga0209130_1002051 | |||
| 1345 | Ga0209130_1006301 | |||
| 1346 | Ga0209025_1000262 | |||
| 1347 | Ga0209025_1000355 | |||
| 1348 | Ga0209025_1001564 | |||
| 1349 | Ga0209025_1002190 | |||
| 1350 | Ga0209025_1002944 | |||
| 1351 | Ga0209025_1003509 | |||
| 1352 | Ga0209025_1006327 | |||
| 1353 | Ga0209025_1008110 | |||
| 1354 | Ga0209025_1012470 | |||
| 1355 | Ga0209564_1003482 | |||
| 1356 | Ga0207697_10005006 | |||
| 1357 | Ga0207656_10015039 | |||
| 1358 | Ga0207696_1003906 | |||
| 1359 | Ga0207696_1006313 | |||
| 1360 | Ga0207696_1010394 | |||
| 1361 | Ga0207696_1012587 | |||
| 1362 | Ga0207655_1000490 | |||
| 1363 | Ga0207655_1001499 | |||
| 1364 | Ga0207655_1001848 | |||
| 1365 | Ga0207682_10000929 | |||
| 1366 | Ga0207682_10004587 | |||
| 1367 | Ga0207682_10028066 | |||
| 1368 | Ga0207692_10004478 | |||
| 1369 | Ga0207692_10061453 | |||
| 1370 | Ga0207642_10033433 | |||
| 1371 | Ga0207710_10003111 | |||
| 1372 | Ga0207710_10009354 | |||
| 1373 | Ga0207688_10002701 | |||
| 1374 | Ga0207688_10117742 | |||
| 1375 | Ga0207680_10066116 | |||
| 1376 | Ga0207647_10000307 | |||
| 1377 | Ga0207647_10001758 | |||
| 1378 | Ga0207645_10018143 | |||
| 1379 | Ga0207645_10024691 | |||
| 1380 | Ga0207645_10031441 | |||
| 1381 | Ga0207645_10043834 | |||
| 1382 | Ga0207654_10023813 | |||
| 1383 | Ga0207654_10087643 | |||
| 1384 | Ga0207695_10002574 | |||
| 1385 | Ga0207695_10022714 | |||
| 1386 | Ga0207695_10039972 | |||
| 1387 | Ga0207695_10175799 | |||
| 1388 | Ga0207671_10019603 | |||
| 1389 | Ga0207671_10051677 | |||
| 1390 | Ga0207671_10123002 | |||
| 1391 | Ga0207693_10001595 | |||
| 1392 | Ga0207663_10000670 | |||
| 1393 | Ga0207663_10043162 | |||
| 1394 | Ga0207662_10030030 | |||
| 1395 | Ga0207657_10000019 | |||
| 1396 | Ga0207657_10000822 | |||
| 1397 | Ga0207657_10057864 | |||
| 1398 | Ga0207649_10097106 | |||
| 1399 | Ga0207681_10013076 | |||
| 1400 | Ga0207681_10029477 | |||
| 1401 | Ga0207694_10020737 | |||
| 1402 | Ga0207650_10001257 | |||
| 1403 | Ga0207650_10010191 | |||
| 1404 | Ga0207650_10069125 | |||
| 1405 | Ga0207650_10181531 | |||
| 1406 | Ga0207659_10006611 | |||
| 1407 | Ga0207659_10008627 | |||
| 1408 | Ga0207659_10032366 | |||
| 1409 | Ga0207659_10144787 | |||
| 1410 | Ga0207664_10004159 | |||
| 1411 | Ga0207644_10005044 | |||
| 1412 | Ga0207644_10005122 | |||
| 1413 | Ga0207644_10023664 | |||
| 1414 | Ga0207690_10000028 | |||
| 1415 | Ga0207690_10001482 | |||
| 1416 | Ga0207690_10121264 | |||
| 1417 | Ga0207706_10000149 | |||
| 1418 | Ga0207706_10006213 | |||
| 1419 | Ga0207706_10042515 | |||
| 1420 | Ga0207709_10000001 | |||
| 1421 | Ga0207709_10007384 | |||
| 1422 | Ga0207670_10002972 | |||
| 1423 | Ga0207670_10114932 | |||
| 1424 | Ga0207669_10001807 | |||
| 1425 | Ga0207704_10026918 | |||
| 1426 | Ga0207704_10030902 | |||
| 1427 | Ga0207704_10049354 | |||
| 1428 | Ga0207704_10051396 | |||
| 1429 | Ga0207665_10000118 | |||
| 1430 | Ga0207665_10058629 | |||
| 1431 | Ga0207691_10005529 | |||
| 1432 | Ga0207691_10007024 | |||
| 1433 | Ga0207691_10014808 | |||
| 1434 | Ga0207691_10025496 | |||
| 1435 | Ga0207691_10027233 | |||
| 1436 | Ga0207691_10030314 | |||
| 1437 | Ga0207691_10038446 | |||
| 1438 | Ga0207711_10041445 | |||
| 1439 | Ga0207711_10068819 | |||
| 1440 | Ga0207711_10069973 | |||
| 1441 | Ga0207711_10073938 | |||
| 1442 | Ga0207711_10078051 | |||
| 1443 | Ga0207711_10232906 | |||
| 1444 | Ga0207689_10008518 | |||
| 1445 | Ga0207689_10021652 | |||
| 1446 | Ga0207689_10038440 | |||
| 1447 | Ga0207689_10063960 | |||
| 1448 | Ga0207689_10067334 | |||
| 1449 | Ga0207689_10108444 | |||
| 1450 | Ga0207661_10033311 | |||
| 1451 | Ga0207679_10079666 | |||
| 1452 | Ga0207679_10201503 | |||
| 1453 | Ga0207667_10001720 | |||
| 1454 | Ga0207651_10029172 | |||
| 1455 | Ga0207651_10065813 | |||
| 1456 | Ga0207651_10079438 | |||
| 1457 | Ga0207651_10149346 | |||
| 1458 | Ga0207712_10001054 | |||
| 1459 | Ga0207712_10010727 | |||
| 1460 | Ga0207712_10039929 | |||
| 1461 | Ga0207668_10026139 | |||
| 1462 | Ga0207668_10051733 | |||
| 1463 | Ga0207640_10049343 | |||
| 1464 | Ga0207640_10079523 | |||
| 1465 | Ga0207658_10091363 | |||
| 1466 | Ga0207703_10000734 | |||
| 1467 | Ga0207703_10012138 | |||
| 1468 | Ga0207703_10016348 | |||
| 1469 | Ga0207639_10004603 | |||
| 1470 | Ga0207639_10166937 | |||
| 1471 | Ga0207678_10012380 | |||
| 1472 | Ga0207678_10019882 | |||
| 1473 | Ga0207678_10025991 | |||
| 1474 | Ga0207678_10041934 | |||
| 1475 | Ga0207678_10047488 | |||
| 1476 | Ga0207678_10060815 | |||
| 1477 | Ga0207678_10098169 | |||
| 1478 | Ga0207708_10005532 | |||
| 1479 | Ga0207702_10049715 | |||
| 1480 | Ga0207641_10074605 | |||
| 1481 | Ga0207641_10098344 | |||
| 1482 | Ga0207648_10006787 | |||
| 1483 | Ga0207648_10008866 | |||
| 1484 | Ga0207648_10018499 | |||
| 1485 | Ga0207648_10119001 | |||
| 1486 | Ga0207676_10010141 | |||
| 1487 | Ga0207676_10016706 | |||
| 1488 | Ga0207676_10040883 | |||
| 1489 | Ga0207676_10047491 | |||
| 1490 | Ga0207676_10126331 | |||
| 1491 | Ga0207676_10132310 | |||
| 1492 | Ga0207674_10022409 | |||
| 1493 | Ga0207675_100016302 | |||
| 1494 | Ga0207675_100026250 | |||
| 1495 | Ga0207675_100034620 | |||
| 1496 | Ga0207675_100052537 | |||
| 1497 | Ga0207675_100062914 | |||
| 1498 | Ga0207675_100111298 | |||
| 1499 | Ga0207683_10001414 | |||
| 1500 | Ga0207683_10005185 | |||
| 1501 | Ga0207683_10038670 | |||
| 1502 | Ga0207683_10051111 | |||
| 1503 | Ga0207683_10100027 | |||
| 1504 | Ga0207683_10144977 | |||
| 1505 | Ga0207698_10003500 | |||
| 1506 | Ga0207698_10055081 | |||
| 1507 | Ga0207698_10158998 | |||
| 1508 | Ga0207698_10221356 | |||
| 1509 | Ga0207698_10264137 | |||
| 1510 | Ga0209371_1000006 | |||
| 1511 | Ga0209371_1000113 | |||
| 1512 | Ga0268266_10000006 | |||
| 1513 | Ga0268266_10000807 | |||
| 1514 | Ga0268266_10016489 | |||
| 1515 | Ga0268266_10025228 | |||
| 1516 | Ga0268266_10172553 | |||
| 1517 | Ga0268265_10007492 | |||
| 1518 | Ga0268265_10047733 | |||
| 1519 | Ga0268264_10113588 | |||
| 1520 | Ga0307515_10004656 | |||
| 1521 | Ga0237817_10031 | |||
| 1522 | Ga0268256_1000007 | |||
| 1523 | Ga0268256_1000575 | |||
| 1524 | Ga0265327_10001312 | |||
| 1525 | Ga0265327_10015647 | |||
| 1526 | Ga0307509_10035086 | |||
| 1527 | Ga0307509_10038464 | |||
| 1528 | Ga0265314_10026985 | |||
| 1529 | Ga0265342_10017660 | |||
| 1530 | Ga0307516_10000678 | |||
| 1531 | Ga0307516_10022231 | |||
| 1532 | Ga0307516_10040714 | |||
| 1533 | Ga0307415_100045575 | |||
| 1534 | Ga0307510_10001063 | |||
| 1535 | Ga0307510_10046375 | |||
| 1536 | Ga0373923_0024380 | |||
| 1537 | Ga0373945_0006415 | |||
| 1538 | Ga0373953_0001434 | |||
| 1539 | Ga0373954_0000261 | |||
| 1540 | Ga0373954_0006034 | |||
| 1541 | Ga0373954_0010774 | |||
| 1542 | Ga0373943_0048798 | |||
| 1543 | Ga0373943_0061380 | |||
| 1544 | Ga0373946_0028153 | |||
| 1545 | Ga0373955_0000455 | |||
| 1546 | Ga0373955_0003182 | |||
| 1547 | Ga0373962_0014177 | |||
| 1548 | Ga0373924_0000696 | |||
| 1549 | Ga0373931_0018884 | |||
| 1550 | Ga0373931_0034017 | |||
| 1551 | Ga0373935_0005538 | |||
| 1552 | Ga0373935_0019087 | |||
| 1553 | Ga0373935_0128888 | |||
| 1554 | Ga0373927_0001649 | |||
| 1555 | Ga0373927_0011264 | |||
| 1556 | Ga0373927_0091523 | |||
| 1557 | Ga0373933_0000346 | |||
| 1558 | Ga0373933_0026643 | |||
| 1559 | Ga0373933_0032878 | |||
| 1560 | Ga0373933_0053088 | |||
| 1561 | Ga0373933_0056528 | |||
| 1562 | Ga0373933_0069336 | |||
| 1563 | Ga0373937_0005546 | |||
| 1564 | Ga0373937_0006983 | |||
| 1565 | Ga0373937_0009266 | |||
| 1566 | Ga0373937_0046347 | |||
| 1567 | Ga0373937_0145678 | |||
| 1568 | Ga0373925_0001973 | |||
| 1569 | Ga0395900_0000053 | |||
| 1570 | Ga0395900_0042134 | |||
| 1571 | Ga0395900_0060066 | |||
| 1572 | Ga0395898_0000264 | |||
| 1573 | Ga0395898_0070973 | |||
| 1574 | Ga0395905_0006009 | |||
| 1575 | Ga0395905_0012988 | |||
| 1576 | Ga0395901_0000009 | |||
| 1577 | Ga0395901_0000012 | |||
| 1578 | Ga0395901_0026845 | |||
| 1579 | Ga0237819_00044 | |||
| 1580 | Ga0237819_00450 | |||
| 1581 | Ga0436365_1076449 | |||
| 1582 | Ga0451802_1782641 | |||
| 1583 | Ga0466969_0000241 | |||
| 1584 | Ga0466973_0045270 | |||
| 1585 | Ga0466965_0000127 | |||
| 1586 | Ga0466966_0000011 | |||
| 1587 | Ga0466966_0023588 | |||
| 1588 | Ga0466966_0026486 | |||
| 1589 | Ga0466961_0000276 | |||
| 1590 | Ga0466963_0000544 | |||
| 1591 | Ga0466963_0042537 | |||
| 1592 | Ga0466971_0000258 | |||
| 1593 | Ga0466971_0003962 | |||
| 1594 | Ga0466970_0017943 | |||
| 1595 | Ga0466957_0034805 | |||
| 1596 | Ga0466959_0005449 | |||
| 1597 | Ga0466967_0000507 | |||
| 1598 | Ga0495617_000786 | |||
| 1599 | Ga0495617_038301 | |||
| 1600 | Ga0495592_0003017 | |||
| 1601 | Ga0495592_0027851 | |||
| 1602 | Ga0495592_0035111 | |||
| 1603 | Ga0495592_0124608 | |||
| 1604 | Ga0495603_0001827 | |||
| 1605 | Ga0495603_0083193 | |||
| 1606 | Ga0495603_0093291 | |||
| 1607 | Ga0495590_0015226 | |||
| 1608 | Ga0495629_0001739 | |||
| 1609 | Ga0495629_0003254 | |||
| 1610 | Ga0495629_0018005 | |||
| 1611 | Ga0495629_0019328 | |||
| 1612 | Ga0495629_0028486 | |||
| 1613 | Ga0495629_0066080 | |||
| 1614 | Ga0495629_0119991 | |||
| 1615 | Ga0495638_0003236 | |||
| 1616 | Ga0495638_0005422 | |||
| 1617 | Ga0495641_0005678 | |||
| 1618 | Ga0495641_0037573 | |||
| 1619 | Ga0495641_0055373 | |||
| 1620 | Ga0495651_0001035 | |||
| 1621 | Ga0495651_0001967 | |||
| 1622 | Ga0495651_0002281 | |||
| 1623 | Ga0495651_0003244 | |||
| 1624 | Ga0495653_0000572 | |||
| 1625 | Ga0495653_0004181 | |||
| 1626 | Ga0495653_0005788 | |||
| 1627 | Ga0495653_0006075 | |||
| 1628 | Ga0495653_0055871 | |||
| 1629 | Ga0495580_0008936 | |||
| 1630 | Ga0495582_0000547 | |||
| 1631 | Ga0495582_0004697 | |||
| 1632 | Ga0495582_0025453 | |||
| 1633 | Ga0495605_0007350 | |||
| 1634 | Ga0495605_0007406 | |||
| 1635 | Ga0495605_0017187 | |||
| 1636 | Ga0495605_0029720 | |||
| 1637 | Ga0495639_0000163 | |||
| 1638 | Ga0495639_0054063 | |||
| 1639 | Ga0495662_0000616 | |||
| 1640 | Ga0495584_0000021 | |||
| 1641 | Ga0495584_0000271 | |||
| 1642 | Ga0495584_0009051 | |||
| 1643 | Ga0495584_0022170 | |||
| 1644 | Ga0495585_0000005 | |||
| 1645 | Ga0495585_0000049 | |||
| 1646 | Ga0495585_0000465 | |||
| 1647 | Ga0495585_0002705 | |||
| 1648 | Ga0495585_0005101 | |||
| 1649 | Ga0495585_0014514 | |||
| 1650 | Ga0495585_0018531 | |||
| 1651 | Ga0495585_0018739 | |||
| 1652 | Ga0495585_0020644 | |||
| 1653 | Ga0495585_0082519 | |||
| 1654 | Ga0495594_0001043 | |||
| 1655 | Ga0495594_0011288 | |||
| 1656 | Ga0495594_0056524 | |||
| 1657 | Ga0495596_0001506 | |||
| 1658 | Ga0495596_0001991 | |||
| 1659 | Ga0495596_0012053 | |||
| 1660 | Ga0495607_0015069 | |||
| 1661 | Ga0495607_0028747 | |||
| 1662 | Ga0495607_0032042 | |||
| 1663 | Ga0495583_0000697 | |||
| 1664 | Ga0495583_0015713 | |||
| 1665 | Ga0495606_0025201 | |||
| 1666 | Ga0495606_0066905 | |||
| 1667 | Ga0495608_0003175 | |||
| 1668 | Ga0495608_0006286 | |||
| 1669 | Ga0495608_0076226 | |||
| 1670 | Ga0495616_0000280 | |||
| 1671 | Ga0495616_0003309 | |||
| 1672 | Ga0495616_0018617 | |||
| 1673 | Ga0495616_0043097 | |||
| 1674 | Ga0495620_0015317 | |||
| 1675 | Ga0495628_0019843 | |||
| 1676 | Ga0495628_0174465 | |||
| 1677 | Ga0495630_0028859 | |||
| 1678 | Ga0495630_0033608 | |||
| 1679 | Ga0495630_0179541 | |||
| 1680 | Ga0495631_0010085 | |||
| 1681 | Ga0495632_0000098 | |||
| 1682 | Ga0495632_0000143 | |||
| 1683 | Ga0495632_0000153 | |||
| 1684 | Ga0495643_0054146 | |||
| 1685 | Ga0495644_0007890 | |||
| 1686 | Ga0495644_0011526 | |||
| 1687 | Ga0495648_0000033 | |||
| 1688 | Ga0495663_0007011 | |||
| 1689 | Ga0495663_0009985 | |||
| 1690 | Ga0495666_0046786 | |||
| 1691 | Ga0495642_0000236 | |||
| 1692 | Ga0495642_0002915 | |||
| 1693 | Ga0495642_0005608 | |||
| 1694 | Ga0495642_0010476 | |||
| 1695 | Ga0495652_0005447 | |||
| 1696 | Ga0495652_0017982 | |||
| 1697 | Ga0495652_0022047 | |||
| 1698 | Ga0495652_0143898 | |||
| 1699 | Ga0495654_0013039 | |||
| 1700 | Ga0495654_0046828 | |||
| 1701 | Ga0495665_0003016 | |||
| 1702 | Ga0495640_0014858 | |||
| 1703 | Ga0495586_0014286 | |||
| 1704 | Ga0495586_0075469 | |||
| 1705 | Ga0495587_0001243 | |||
| 1706 | Ga0495587_0001343 | |||
| 1707 | Ga0495587_0012337 | |||
| 1708 | Ga0495587_0030037 | |||
| 1709 | Ga0495609_0007139 | |||
| 1710 | Ga0495609_0008775 | |||
| 1711 | Ga0495609_0038585 | |||
| 1712 | Ga0495621_0056724 | |||
| 1713 | Ga0495645_0057061 | |||
| 1714 | Ga0495622_0003321 | |||
| 1715 | Ga0495633_0002449 | |||
| 1716 | Ga0495633_0002561 | |||
| 1717 | Ga0495633_0006093 | |||
| 1718 | Ga0495633_0021652 | |||
| 1719 | Ga0495667_0000593 | |||
| 1720 | Ga0495667_0002429 | |||
| 1721 | Ga0495667_0012388 | |||
| 1722 | Ga0495667_0033062 | |||
| 1723 | Ga0495656_0000474 | |||
| 1724 | Ga0495656_0013343 | |||
| 1725 | Ga0495668_0001839 | |||
| 1726 | Ga0495668_0006812 | |||
| 1727 | Ga0495668_0012306 | |||
| 1728 | Ga0495668_0015405 | |||
| 1729 | Ga0495668_0024779 | |||
| 1730 | Ga0495668_0025241 | |||
| 1731 | Ga0495668_0033278 | |||
| 1732 | Ga0495668_0057661 | |||
| 1733 | Ga0495634_0007414 | |||
| 1734 | Ga0495634_0022347 | |||
| 1735 | Ga0495611_0004328 | |||
| 1736 | Ga0495625_0000897 | |||
| 1737 | Ga0495625_0004030 | |||
| 1738 | Ga0495625_0027780 | |||
| 1739 | Ga0495635_0000241 | |||
| 1740 | Ga0495635_0002402 | |||
| 1741 | Ga0495635_0006833 | |||
| 1742 | Ga0495635_0008016 | |||
| 1743 | Ga0495635_0016174 | |||
| 1744 | Ga0495659_0000129 | |||
| 1745 | Ga0495661_0001219 | |||
| 1746 | Ga0495661_0002280 | |||
| 1747 | Ga0495661_0014885 | |||
| 1748 | Ga0495588_0002151 | |||
| 1749 | Ga0495588_0024316 | |||
| 1750 | Ga0495588_0027592 | |||
| 1751 | Ga0495657_0000637 | |||
| 1752 | Ga0495657_0001501 | |||
| 1753 | Ga0495657_0003700 | |||
| 1754 | Ga0495657_0024543 | |||
| 1755 | Ga0495657_0108067 | |||
| 1756 | Ga0495599_0000148 | |||
| 1757 | Ga0495599_0002232 | |||
| 1758 | Ga0495599_0012230 | |||
| 1759 | Ga0495623_0005748 | |||
| 1760 | Ga0495623_0013967 | |||
| 1761 | Ga0495623_0017622 | |||
| 1762 | Ga0495623_0026067 | |||
| 1763 | Ga0495623_0045795 | |||
| 1764 | Ga0495646_0025543 | |||
| 1765 | Ga0495646_0070046 | |||
| 1766 | Ga0495647_0004539 | |||
| 1767 | Ga0495647_0038287 | |||
| 1768 | Ga0495658_0004596 | |||
| 1769 | Ga0495658_0059342 | |||
| 1770 | Ga0495658_0107492 | |||
| 1771 | Ga0495658_0139228 | |||
| 1772 | Ga0495658_0152381 | |||
| 1773 | Ga0495669_0000190 | |||
| 1774 | Ga0495669_0000986 | |||
| 1775 | Ga0495669_0002903 | |||
| 1776 | Ga0495669_0007359 | |||
| 1777 | Ga0495613_0004558 | |||
| 1778 | Ga0495624_0003121 | |||
| 1779 | Ga0495670_0000693 | |||
| 1780 | Ga0495670_0001566 | |||
| 1781 | Ga0495671_0000053 | |||
| 1782 | Ga0495671_0000792 | |||
| 1783 | Ga0495671_0029998 | |||
| 1784 | Ga0495649_0004954 | |||
| 1785 | Ga0495649_0035256 | |||
| 1786 | Ga0495589_0013026 | |||
| 1787 | Ga0495589_0014310 | |||
| 1788 | Ga0495600_0000157 | |||
| 1789 | Ga0495600_0001685 | |||
| 1790 | Ga0495600_0003815 | |||
| 1791 | Ga0495600_0120189 | |||
| 1792 | Ga0495660_0000479 | |||
| 1793 | Ga0495660_0052736 | |||
| 1794 | Ga0495581_0000979 | |||
| 1795 | Ga0495581_0014601 | |||
| 1796 | Ga0495581_0040994 | |||
| 1797 | Ga0495604_0002433 | |||
| 1798 | Ga0495604_0003832 | |||
| 1799 | Ga0495604_0008415 | |||
| 1800 | Ga0495604_0008510 | |||
| 1801 | Ga0495674_0003964 | |||
| 1802 | Ga0495674_0005950 | |||
| 1803 | Ga0495674_0016830 | |||
| 1804 | Ga0495674_0123862 | |||
| 1805 | Ga0495672_0000502 | |||
| 1806 | Ga0495672_0053993 | |||
| 1807 | Ga0495676_0000177 | |||
| 1808 | Ga0495676_0094530 | |||
| 1809 | Ga0495680_0002928 | |||
| 1810 | Ga0495680_0006343 | |||
| 1811 | Ga0495680_0007799 | |||
| 1812 | Ga0495680_0008955 | |||
| 1813 | Ga0495680_0021389 | |||
| 1814 | Ga0495680_0113335 | |||
| 1815 | Ga0495680_0172873 | |||
| 1816 | Ga0495683_0000072 | |||
| 1817 | Ga0495683_0039055 | |||
| 1818 | Ga0495687_007756 | |||
| 1819 | Ga0495675_0001960 | |||
| 1820 | Ga0495675_0002204 | |||
| 1821 | Ga0495675_0003158 | |||
| 1822 | Ga0495675_0004738 | |||
| 1823 | Ga0495675_0112382 | |||
| 1824 | Ga0495677_0009205 | |||
| 1825 | Ga0495677_0017380 | |||
| 1826 | Ga0495685_052390 | |||
| 1827 | Ga0495681_0001730 | |||
| 1828 | Ga0495681_0001973 | |||
| 1829 | Ga0495681_0004982 | |||
| 1830 | Ga0495681_0007555 | |||
| 1831 | Ga0495684_0001447 | |||
| 1832 | Ga0495684_0001837 | |||
| 1833 | Ga0495684_0003840 | |||
| 1834 | Ga0495684_0004907 | |||
| 1835 | Ga0495684_0015191 | |||
| 1836 | Ga0495684_0033399 | |||
| 1837 | Ga0495684_0248960 | |||
| 1838 | Ga0495593_0006169 | |||
| 1839 | Ga0495593_0006375 | |||
| 1840 | Ga0495593_0008803 | |||
| 1841 | Ga0495593_0015923 | |||
| 1842 | Ga0495593_0030204 | |||
| 1843 | Ga0495602_0007101 | |||
| 1844 | Ga0495602_0007959 | |||
| 1845 | Ga0495602_0015932 | |||
| 1846 | Ga0495602_0016383 | |||
| 1847 | Ga0495602_0122525 | |||
| 1848 | Ga0495614_0007477 | |||
| 1849 | Ga0495614_0015948 | |||
| 1850 | Ga0495614_0066186 | |||
| 1851 | Ga0495614_0072546 | |||
| 1852 | Ga0495614_0075099 | |||
| 1853 | Ga0495626_0067233 | |||
| 1854 | Ga0496100_0044951 | |||
| 1855 | Ga0496100_0059858 | |||
| 1856 | Ga0496100_0212940 | |||
| 1857 | Ga0496101_0001981 | |||
| 1858 | Ga0496101_0073470 | |||
| 1859 | Ga0496101_0085784 | |||
| 1860 | Ga0496101_0148389 | |||
| 1861 | Ga0496101_0162624 | |||
| 1862 | Ga0496101_0193795 | |||
| 1863 | Ga0496102_0000290 | |||
| 1864 | Ga0496102_0015866 | |||
| 1865 | Ga0496102_0046839 | |||
| 1866 | Ga0496102_0065436 | |||
| 1867 | Ga0496102_0096302 | |||
| 1868 | Ga0496102_0135455 | |||
| 1869 | Ga0496103_0001884 | |||
| 1870 | Ga0496103_0032964 | |||
| 1871 | Ga0496103_0079475 | |||
| 1872 | Ga0496104_0002774 | |||
| 1873 | Ga0496104_0044290 | |||
| 1874 | Ga0496104_0060879 | |||
| 1875 | Ga0496104_0156987 | |||
| 1876 | Ga0496104_0157211 | |||
| 1877 | Ga0496104_0241900 | |||
| 1878 | Ga0496105_0006708 | |||
| 1879 | Ga0496105_0024487 | |||
| 1880 | Ga0496105_0026618 | |||
| 1881 | Ga0496105_0115445 | |||
| 1882 | Ga0496105_0241480 | |||
| 1883 | Ga0496106_0004649 | |||
| 1884 | Ga0496106_0014892 | |||
| 1885 | Ga0496106_0112976 | |||
| 1886 | Ga0496106_0211283 | |||
| 1887 | Ga0496107_0018337 | |||
| 1888 | Ga0496108_0001200 | |||
| 1889 | Ga0496108_0002055 | |||
| 1890 | Ga0496108_0040264 | |||
| 1891 | Ga0496108_0127121 | |||
| 1892 | Ga0496109_0002191 | |||
| 1893 | Ga0496109_0003922 | |||
| 1894 | Ga0496109_0112286 | |||
| 1895 | Ga0496109_0128766 | |||
| 1896 | Ga0496109_0196390 | |||
| 1897 | Ga0496110_0006543 | |||
| 1898 | Ga0496110_0008434 | |||
| 1899 | Ga0496110_0013698 | |||
| 1900 | Ga0496110_0019705 | |||
| 1901 | Ga0496110_0106931 | |||
| 1902 | Ga0496110_0209337 | |||
| 1903 | Ga0496110_0234606 | |||
| 1904 | Ga0496111_0005231 | |||
| 1905 | Ga0496111_0029693 | |||
| 1906 | Ga0496112_0007549 | |||
| 1907 | Ga0496112_0017894 | |||
| 1908 | Ga0496112_0042466 | |||
| 1909 | Ga0496112_0052188 | |||
| 1910 | Ga0496112_0070600 | |||
| 1911 | Ga0496113_0006427 | |||
| 1912 | Ga0496113_0009206 | |||
| 1913 | Ga0496113_0013367 | |||
| 1914 | Ga0496113_0018802 | |||
| 1915 | Ga0496113_0032510 | |||
| 1916 | Ga0496113_0056591 | |||
| 1917 | Ga0496114_0004557 | |||
| 1918 | Ga0496114_0119002 | |||
| 1919 | Ga0496115_0016923 | |||
| 1920 | Ga0496115_0030394 | |||
| 1921 | Ga0496115_0031522 | |||
| 1922 | Ga0496115_0180606 | |||
| 1923 | Ga0496116_0005939 | |||
| 1924 | Ga0496119_0080276 | |||
| 1925 | Ga0496121_0020595 | |||
| 1926 | Ga0496121_0031111 | |||
| 1927 | Ga0496121_0037452 | |||
| 1928 | Ga0496125_0055788 | |||
| 1929 | Ga0496125_0089314 | |||
| 1930 | Ga0496126_0025817 | |||
| 1931 | Ga0496126_0095503 | |||
| 1932 | Ga0496126_0212174 | |||
| 1933 | Ga0495678_000638 | |||
| 1934 | Ga0495682_0007467 | |||
| 1935 | Ga0501033_0058513 | |||
| 1936 | Ga0501034_0038492 | |||
| 1937 | Ga0501034_0113831 | |||
| 1938 | Ga0501034_0185232 | |||
| 1939 | Ga0501037_0059761 | |||
| 1940 | Ga0501038_0086191 | |||
| 1941 | Ga0501046_0003374 | |||
| 1942 | Ga0501047_0102572 | |||
| 1943 | Ga0501072_0051791 | |||
| 1944 | Ga0501217_005273 | |||
| 1945 | Ga0501079_0040966 | |||
| 1946 | nmdc:mga03n38_7752_c1 | |||
| 1947 | nmdc:mga00v17_14590_c2 | |||
| 1948 | nmdc:mga00v17_19839_c1 | |||
| 1949 | nmdc:mga0yw44_15454_c1 | |||
| 1950 | nmdc:mga0yw44_81299_c1 | |||
| 1951 | nmdc:mga0k408_31326_c1 | |||
| 1952 | nmdc:mga0k408_44407_c1 | |||
| 1953 | nmdc:mga05p37_2263_c1 | |||
| 1954 | nmdc:mga08y16_22844_c1 | |||
| 1955 | nmdc:mga08y16_280643_c1 | |||
| 1956 | nmdc:mga08y16_30816_c1 | |||
| 1957 | nmdc:mga08y16_80679_c1 | |||
| 1958 | nmdc:mga08y16_89123_c1 | |||
| 1959 | nmdc:mga0n895_31943_c1 | |||
| 1960 | nmdc:mga0n895_473942_c1 | |||
| 1961 | nmdc:mga0a205_54053_c1 | |||
| 1962 | nmdc:mga0sz30_52057_c1 | |||
| 1963 | Ga0495601_0007085 | |||
| 1964 | Ga0495601_0010230 | |||
| 1965 | Ga0495601_0022445 | |||
| 1966 | Ga0495612_0001392 | |||
| 1967 | Ga0495612_0014040 | |||
| 1968 | Ga0500635_0001121 | |||
| 1969 | Ga0495595_0000325 | |||
| 1970 | Ga0495595_0001287 | |||
| 1971 | Ga0495595_0003596 | |||
| 1972 | Ga0495595_0008358 | |||
| 1973 | Ga0495595_0022337 | |||
| 1974 | Ga0495595_0066267 | |||
| 1975 | Ga0495619_0000517 | |||
| 1976 | Ga0495619_0000698 | |||
| 1977 | Ga0495619_0000906 | |||
| 1978 | Ga0495619_0002729 | |||
| 1979 | Ga0495619_0004330 | |||
| 1980 | Ga0495619_0018396 | |||
| 1981 | Ga0495619_0023260 | |||
| 1982 | Ga0495619_0030068 | |||
| 1983 | Ga0500595_011310 | |||
| 1984 | Ga0500658_0035070 | |||
| 1985 | Ga0500637_0011579 | |||
| 1986 | Ga0466962_0005345 | |||
| 1987 | Ga0530510_0007515 | |||
| 1988 | 2512037813 | |||
| 1989 | 2513591604 | |||
| 1990 | 2519460614 | |||
| 1991 | 2524535119 | |||
| 1992 | 2545555820 | |||
| 1993 | 2552749290 | |||
| 1994 | 2578929237 | |||
| 1995 | 2585293098 | |||
| 1996 | 2599736257 | |||
| 1997 | 2599746149 | |||
| 1998 | 2600208017 | |||
| 1999 | 2631983026 | |||
| 2000 | 2640734241 | |||
| 2001 | 2644249876 | |||
| 2002 | 2644358541 | |||
| 2003 | 2644362428 | |||
| 2004 | 2644704630 | |||
| 2005 | 2644709324 | |||
| 2006 | 2651533146 | |||
| 2007 | 2674419426 | |||
| 2008 | 2676743740 | |||
| 2009 | 2678231217 | |||
| 2010 | 2685150121 | |||
| 2011 | 2695627686 | |||
| 2012 | 2698323141 | |||
| 2013 | 2705994095 | |||
| 2014 | 2717916517 | |||
| 2015 | 2721505423 | |||
| 2016 | 2728753168 | |||
| 2017 | 2738739475 | |||
| 2018 | 2738815211 | |||
| 2019 | 2738846048 | |||
| 2020 | 2739157934 | |||
| 2021 | 2739210620 | |||
| 2022 | 2739269069 | |||
| 2023 | 2739275799 | |||
| 2024 | 2739344843 | |||
| 2025 | 2745161341 | |||
| 2026 | 2774388223 | |||
| 2027 | 2774437431 | |||
| 2028 | 2793083827 | |||
| 2029 | 2808970582 | |||
| 2030 | 2809005311 | |||
| 2031 | 2809012288 | |||
| 2032 | 2817257602 | |||
| 2033 | 2817281995 | |||
| 2034 | 2817451545 | |||
| 2035 | 2819578796 | |||
| 2036 | 2819634099 | |||
| 2037 | 2857583775 | |||
| 2038 | 2857606615 | |||
| 2039 | 2858689639 | |||
| 2040 | 2863423908 | |||
| 2041 | 2870073949 | |||
| 2042 | 2877770529 | |||
| 2043 | 2880171514 | |||
| 2044 | 2885381802 | |||
| 2045 | 2885414966 | |||
| 2046 | 2897809570 | |||
| 2047 | 2904568478 | |||
| 2048 | 2904575521 | |||
| 2049 | 2916699725 | |||
| 2050 | 2919184148 | |||
| 2051 | 2919418954 | |||
| 2052 | 2928160859 | |||
| 2053 | 2928170480 | |||
| 2054 | 2928171305 | |||
| 2055 | 2928516581 | |||
| 2056 | 2928536343 | |||
| 2057 | 2936363460 | |||
| 2058 | 2938919505 | |||
| 2059 | 2947428876 | |||
| 2060 | 2965763369 | |||
| 2061 | 2969142984 | |||
| 2062 | 2971895296 | |||
| 2063 | 2979085823 | |||
| 2064 | 2981991492 | |||
| 2065 | 2984570288 | |||
| 2066 | 3001895494 | |||
| 2067 | 3001898723 | |||
| 2068 | 3006883344 | |||
| 2069 | 3006974296 | |||
| 2070 | 642418927 | |||
| 2071 | 8006936540 | |||
| 2072 | 8006976506 | |||
| 2073 | 8006991366 | |||
| 2074 | 8018849413 | |||
| 2075 | 8020808572 | |||
| 2076 | 8020938516 | |||
| 2077 | 8020946241 | |||
| 2078 | 8020954930 | |||
| 2079 | 8021123466 | |||
| 2080 | 8022625676 | |||
| 2081 | 8022631139 | |||
| 2082 | 8022798574 | |||
| 2083 | 8022798576 | |||
| 2084 | 8022949405 | |||
| 2085 | 8023444113 | |||
| 2086 | 8023449704 | |||
| 2087 | 8039103311 | |||
| 2088 | 8040168317 | |||
| 2089 | 8040175895 | |||
| 2090 | 8054284710 | |||
| 2091 | 8057584914 | |||
| 2092 | 8057584916 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7qha-assembly1.cif.gz_B | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol | 0.4913 | 7 | 458 |
| 7qha-assembly1.cif.gz_B | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol | 0.4741 | 7 | 458 |
| 4f35-assembly2.cif.gz_B | crystal structure of a bacterial dicarboxylate/sodium symporter | 0.4712 | 2 | 460 |
| 8thj-assembly1.cif.gz_B | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) | 0.4694 | 28 | 464 |
| 4r0c-assembly1.cif.gz_D | crystal structure of the alcanivorax borkumensis ydah transporter reveals an unusual topology | 0.4647 | 52 | 464 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6YCG9_3_406_1.20.1530.20 | Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; | 0.5262 | 4 | 453 | 1.20.1530.20 |
| af_I6YCG9_3_406_1.20.1530.20 | Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; | 0.5226 | 4 | 453 | 1.20.1530.20 |
| af_Q59SR3_303_495_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3441 | 319 | 464 | 1.20.1250.20 |
| af_Q03455_384_584_1.20.1510.10 | Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain | 0.3079 | 94 | 313 | 1.20.1510.10 |
| af_Q03455_384_584_1.20.1510.10 | Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain | 0.2981 | 94 | 313 | 1.20.1510.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0H3CMZ5-F1-model_v4 | Citrate transporter | 0.9912 | 1 | 466 |
GO:0005886
GO:0015128 |
| AF-A0A443XGG5-F1-model_v4 | deleted | 0.9903 | 1 | 466 |
|
| AF-A0A0H3CMZ5-F1-model_v4 | Citrate transporter | 0.9891 | 1 | 466 |
GO:0005886
GO:0015128 |
| AF-A0A443XGG5-F1-model_v4 | deleted | 0.9882 | 1 | 466 |
|
| AF-A0A6N4U2X1-F1-model_v4 | deleted | 0.984 | 1 | 334 |
|