F489027

General Info

Members Datasets Scaffolds Average Seq Length
1049 474 2092 459

Family's Representative Sequence

Representative Sequence 3300026041|Ga0207639_10141064|Ga0207639_101410642
Length 537
Sequence MSLHSESIRMRTKSMQVTSDTIYALSSGGLPSGVAVIRMSGAKALEVTESLAGSLPAARQAVLKTIRTRNGLILDRGLVLIFPGPNSFTGEDCAEIHVHGGKAVVAALLAVLLTNPAWVLPMFSGIFMEKMVGFVKLYFPVFMLGAIFGKVIELSGFSQSIVSAVIKIVGRERAMLSIVLVCAILTYGGVSLFVVVFAVYPFAAEMFRQSDIPKRLIPGTIALGAFTFTMDALPGTPQIQNIIPTTFFNTTAYAAPWLGIIGAVFILVVGLAYLEWRRRQAAAKHEGYGSGHTNEPDPVSEAELPNPVVAIIPLILVGVLNKVFTQAIPAAFGSSFTIPVPDHPVTVQVTPLAAIWAVEGALLVGILSVLAFRFRTVISKFAEGTKAAVAGSLLASMNTASEYGFGGVIAALPGFLVVSDALRAIPNPLFNEAVTVTVLAGITGSASGGMSIALAAMSDTFVQAANAANIPLEVLHRVASMASGGMDTLPHNGAVITLLAVTGLTHRQSYGDVFAITCIKTLAVAVAIGAYYLFGIV

Samples

Sample ID Description Type Environment
1 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
14 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
90 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
91 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
120 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
132 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
193 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
194 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
195 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
196 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
197 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
198 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
199 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
200 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
201 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
202 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
204 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
205 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
206 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
207 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
208 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
209 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
210 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
211 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
212 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
214 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
215 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
218 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
219 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
220 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
221 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
222 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
223 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
224 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
225 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
226 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
227 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
228 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
229 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
230 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
231 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
232 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
233 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
234 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
235 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
236 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
237 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
238 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
239 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
240 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
241 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
242 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
243 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
244 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
245 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
246 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
247 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
248 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
249 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
250 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
251 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
252 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
253 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
254 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
255 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
256 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
257 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
258 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
259 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
260 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
261 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
262 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
263 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
264 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
265 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
266 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
267 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
268 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
269 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
270 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
271 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
272 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
273 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
274 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
275 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
276 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
277 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
278 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
279 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
280 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
281 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
282 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
283 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
284 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
285 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
286 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
287 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
288 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
289 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
290 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
291 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
292 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
293 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
294 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
295 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
296 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
297 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
298 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
299 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
300 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
301 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
302 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
303 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
304 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
305 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
306 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
307 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
308 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
309 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
310 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
311 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
312 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
313 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
314 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
315 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
316 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
317 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
318 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
319 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
320 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
321 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
322 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
323 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
324 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
325 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
326 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
327 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
328 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
329 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
330 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
331 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
332 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
333 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
334 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
335 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
336 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
337 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
338 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
339 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
340 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
341 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
342 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
343 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
344 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
345 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
352 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
353 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
354 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
355 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
356 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
357 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
358 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
359 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
360 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
361 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
362 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
363 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
364 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
365 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
366 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
367 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
368 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
369 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
370 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
371 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
372 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
373 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
374 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
375 2519103095 Burkholderia sp. KJ006 Isolate Nodule
376 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
377 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
378 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
379 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
380 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
381 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
382 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
383 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
384 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
385 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
386 2643221645 Massilia sp. Root351 Isolate Unclassified
387 2643221664 Massilia sp. Root418 Isolate Unclassified
388 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
389 2643221729 Bacillus sp. Root11 Isolate Unclassified
390 2643221730 Bacillus sp. Root131 Isolate Unclassified
391 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
392 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
393 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
394 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
395 2684622632 Bacillus cereus 905 Isolate Unclassified
396 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
397 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
398 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
399 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
400 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
401 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
402 2738541280 Massilia sp. GV090 Isolate Unclassified
403 2738541295 Bacillus sp. OK085 Isolate Unclassified
404 2738541300 Massilia sp. GV016 Isolate Unclassified
405 2738541358 Bacillus sp. OV752 Isolate Unclassified
406 2738543006 Bacillus sp. OK077 Isolate Unclassified
407 2738543017 Bacillus sp. OV186 Isolate Unclassified
408 2738543018 Massilia sp. GV045 Isolate Unclassified
409 2738543030 Massilia sp. GV097 Isolate Unclassified
410 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
411 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
412 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
413 2791355199
414 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
415 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
416 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
417 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
418 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
419 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
420 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
421 2818991452 Burkholderia cepacia 561 Isolate Unclassified
422 2857581216 Bacillus sp. R-71922 Isolate Unclassified
423 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
424 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
425 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
426 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
427 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
428 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
429 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
430 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
431 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
432 2904564687 Burkholderia sp. 571 Isolate Unclassified
433 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
434 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
435 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
436 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
437 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
438 2928163908 Burkholderia sp. 567 Isolate Unclassified
439 2928170801 Burkholderia sp. 572 Isolate Unclassified
440 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
441 2928536128 Burkholderia sola 565 Isolate Unclassified
442 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
443 2938917290 Bacillus sp. CR71 Isolate Unclassified
444 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
445 2965761152 Bacillus sp. COPE52 Isolate Unclassified
446 2969141011 Bacillus velezensis MH25 Isolate Unclassified
447 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
448 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
449 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
450 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
451 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
452 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
453 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
454 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
455 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
456 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
457 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
458 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
459 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
460 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
461 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
462 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
463 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
464 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
465 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
466 8022792930 Bacillus sp. Xin Isolate Rhizosphere
467 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
468 8023438354 Bacillus sp. BH2 Isolate Unclassified
469 8023444577 Bacillus sp. BH32 Isolate Unclassified
470 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
471 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
472 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
473 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
474 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.98
Metatranscriptomes 0.1
Isolates 9.92

Biome Distribution

Category Percentage (%)
Aerial Root 0.1
Bulb 0
Endosphere 6.39
Nodule 0.48
Rhizoplane 7.05
Rhizosphere 78.84
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207639_10141064 3300026041 Bacteria 2008
2 JGI24736J21556_1010749 3300001904 Bacteria 1494
3 JGI24739J22299_10003563 3300001989 Bacteria 5950
4 JGI24735J21928_10023965 3300002067 Bacteria 1849
5 JGI25159J45721_1001328 3300002987 Bacteria 10397
6 JGI25159J45721_1011754 3300002987 Bacteria 2125
7 JGI25151J46595_10000302 3300003187 Bacteria 54102
8 JGI25151J46595_10002843 3300003187 Bacteria 9968
9 JGI25151J46595_10006202 3300003187 Bacteria 6050
10 JGI25151J46595_10009043 3300003187 Bacteria 4749
11 JGI25404J52841_10002675 3300003659 Bacteria 3406
12 Ga0055532_1000540 3300003758 Bacteria 16246
13 Ga0055535_1000950 3300003761 Bacteria 19231
14 Ga0055535_1000957 3300003761 Bacteria 19044
15 Ga0055542_1000942 3300003762 Bacteria 19128
16 Ga0055542_1000996 3300003762 Bacteria 18199
17 Ga0055529_1000599 3300003763 Bacteria 28042
18 Ga0055528_1007778 3300003790 Bacteria 4689
19 Ga0058692_1000003 3300003856 Bacteria 435295
20 Ga0058692_1000514 3300003856 Bacteria 17096
21 Ga0065703_1000186 3300005272 Bacteria 19273
22 Ga0065715_10006850 3300005293 Bacteria 2982
23 Ga0065715_10126718 3300005293 Bacteria 2102
24 Ga0065707_10092100 3300005295 Bacteria 3827
25 Ga0070658_10014788 3300005327 Bacteria 6254
26 Ga0070658_10066708 3300005327 Bacteria 2940
27 Ga0070676_10008061 3300005328 Bacteria 5664
28 Ga0070676_10025909 3300005328 Bacteria 3318
29 Ga0070683_100214243 3300005329 Bacteria 1830
30 Ga0070670_100002371 3300005331 Bacteria 15528
31 Ga0070670_100013676 3300005331 Bacteria 6955
32 Ga0070677_10010142 3300005333 Bacteria 3214
33 Ga0068869_100028039 3300005334 Bacteria 3930
34 Ga0068869_100029359 3300005334 Bacteria 3852
35 Ga0068869_100155521 3300005334 Bacteria 1776
36 Ga0070666_10007027 3300005335 Bacteria 6940
37 Ga0070666_10020818 3300005335 Bacteria 4243
38 Ga0068868_100028335 3300005338 Bacteria 4281
39 Ga0070660_100000011 3300005339 Bacteria 133167
40 Ga0070660_100001582 3300005339 Bacteria 15657
41 Ga0070689_100002194 3300005340 Bacteria 12662
42 Ga0070689_100028264 3300005340 Bacteria 4237
43 Ga0070689_100143446 3300005340 Bacteria 1922
44 Ga0070687_100004523 3300005343 Bacteria 5553
45 Ga0070687_100031771 3300005343 Bacteria 2592
46 Ga0070661_100011088 3300005344 Bacteria 6277
47 Ga0070668_100012511 3300005347 Bacteria 6320
48 Ga0070668_100029711 3300005347 Bacteria 4152
49 Ga0070669_100007114 3300005353 Bacteria 8041
50 Ga0070669_100041553 3300005353 Bacteria 3344
51 Ga0070675_100009300 3300005354 Bacteria 7641
52 Ga0070675_100033951 3300005354 Bacteria 4138
53 Ga0070675_100133441 3300005354 Bacteria 2118
54 Ga0070671_100004493 3300005355 Bacteria 11041
55 Ga0070671_100008194 3300005355 Bacteria 8362
56 Ga0070671_100025982 3300005355 Bacteria 4809
57 Ga0070671_100026508 3300005355 Bacteria 4764
58 Ga0070671_100045731 3300005355 Bacteria 3639
59 Ga0070674_100007285 3300005356 Bacteria 6514
60 Ga0070674_100073043 3300005356 Bacteria 2431
61 Ga0070674_100106398 3300005356 Bacteria 2053
62 Ga0070674_100108965 3300005356 Bacteria 2030
63 Ga0070673_100056654 3300005364 Bacteria 3093
64 Ga0070673_100101450 3300005364 Bacteria 2371
65 Ga0070673_100158745 3300005364 Bacteria 1921
66 Ga0070673_100180477 3300005364 Bacteria 1807
67 Ga0070688_100012818 3300005365 Bacteria 4708
68 Ga0070688_100079715 3300005365 Bacteria 2116
69 Ga0070659_100000046 3300005366 Bacteria 101294
70 Ga0070667_100019267 3300005367 Bacteria 5660
71 Ga0070667_100020656 3300005367 Bacteria 5468
72 Ga0070667_100078148 3300005367 Bacteria 2827
73 Ga0070714_100004759 3300005435 Bacteria 10278
74 Ga0070714_100051982 3300005435 Bacteria 3494
75 Ga0070713_100006956 3300005436 Bacteria 7897
76 Ga0070710_10003340 3300005437 Bacteria 7607
77 Ga0070701_10023487 3300005438 Bacteria 2970
78 Ga0070701_10061407 3300005438 Bacteria 1982
79 Ga0070663_100000063 3300005455 Bacteria 45665
80 Ga0070663_100020753 3300005455 Bacteria 4353
81 Ga0070663_100024576 3300005455 Bacteria 4057
82 Ga0070678_100001468 3300005456 Bacteria 12574
83 Ga0070678_100039647 3300005456 Bacteria 3325
84 Ga0070678_100065415 3300005456 Bacteria 2700
85 Ga0070678_100115189 3300005456 Bacteria 2110
86 Ga0070662_100000746 3300005457 Bacteria 19937
87 Ga0070662_100009332 3300005457 Bacteria 6411
88 Ga0070662_100078865 3300005457 Bacteria 2447
89 Ga0070698_100036419 3300005471 Bacteria 5083
90 Ga0070699_100017573 3300005518 Bacteria 6141
91 Ga0070684_100044662 3300005535 Bacteria 3833
92 Ga0068853_100005112 3300005539 Bacteria 10250
93 Ga0070672_100006518 3300005543 Bacteria 7847
94 Ga0070672_100018830 3300005543 Bacteria 5000
95 Ga0070672_100020435 3300005543 Bacteria 4829
96 Ga0070672_100025433 3300005543 Bacteria 4390
97 Ga0070672_100079324 3300005543 Bacteria 2628
98 Ga0070693_100014050 3300005547 Bacteria 4092
99 Ga0070665_100000715 3300005548 Bacteria 44234
100 Ga0070665_100006096 3300005548 Bacteria 12324
101 Ga0070665_100112820 3300005548 Bacteria 2721
102 Ga0070704_100025051 3300005549 Bacteria 3923
103 Ga0068855_100002337 3300005563 Bacteria 23417
104 Ga0068855_100121702 3300005563 Bacteria 2986
105 Ga0068855_100346575 3300005563 Bacteria 1637
106 Ga0070664_100003047 3300005564 Bacteria 13550
107 Ga0070664_100009550 3300005564 Bacteria 7865
108 Ga0070664_100074450 3300005564 Bacteria 2915
109 Ga0070664_100100451 3300005564 Bacteria 2515
110 Ga0068857_100152426 3300005577 Bacteria 2095
111 Ga0068854_100016430 3300005578 Bacteria 4934
112 Ga0068854_100083566 3300005578 Bacteria 2361
113 Ga0068856_100009139 3300005614 Bacteria 9635
114 Ga0068856_100009908 3300005614 Bacteria 9255
115 Ga0068852_100002152 3300005616 Bacteria 13527
116 Ga0068852_100019337 3300005616 Bacteria 5387
117 Ga0068852_100039576 3300005616 Bacteria 3970
118 Ga0068852_100068611 3300005616 Bacteria 3104
119 Ga0068864_100032982 3300005618 Bacteria 4401
120 Ga0068864_100075934 3300005618 Bacteria 2935
121 Ga0068864_100090244 3300005618 Bacteria 2701
122 Ga0068866_10004439 3300005718 Bacteria 5759
123 Ga0068866_10010910 3300005718 Bacteria 3913
124 Ga0068861_100018587 3300005719 Bacteria 4952
125 Ga0068861_100032883 3300005719 Bacteria 3822
126 Ga0068861_100086577 3300005719 Bacteria 2463
127 Ga0068861_100087847 3300005719 Bacteria 2447
128 Ga0068861_100100634 3300005719 Bacteria 2298
129 Ga0068851_10001542 3300005834 Bacteria 10097
130 Ga0068870_10042174 3300005840 Bacteria 2375
131 Ga0068858_100001923 3300005842 Bacteria 21169
132 Ga0068858_100012170 3300005842 Bacteria 8111
133 Ga0068858_100017127 3300005842 Bacteria 6801
134 Ga0068858_100195118 3300005842 Bacteria 1913
135 Ga0068860_100011768 3300005843 Bacteria 8623
136 Ga0068862_100033244 3300005844 Bacteria 4358
137 Ga0068862_100076669 3300005844 Bacteria 2894
138 Ga0081455_10007349 3300005937 Bacteria 11617
139 Ga0081455_10008446 3300005937 Bacteria 10709
140 Ga0081455_10016840 3300005937 Bacteria 7030
141 Ga0081540_1000011 3300005983 Bacteria 191880
142 Ga0081540_1000932 3300005983 Bacteria 26297
143 Ga0081540_1001375 3300005983 Bacteria 21094
144 Ga0081540_1002628 3300005983 Bacteria 14598
145 Ga0081540_1009312 3300005983 Bacteria 6775
146 Ga0081540_1009802 3300005983 Bacteria 6556
147 Ga0081539_10049554 3300005985 Bacteria 2382
148 Ga0075365_10015050 3300006038 Bacteria 4669
149 Ga0075365_10031674 3300006038 Bacteria 3393
150 Ga0075363_100004654 3300006048 Bacteria 6034
151 Ga0075364_10021037 3300006051 Bacteria 4109
152 Ga0070715_10000314 3300006163 Bacteria 11923
153 Ga0070716_100035162 3300006173 Bacteria 2753
154 Ga0070712_100008300 3300006175 Bacteria 6527
155 Ga0070712_100138649 3300006175 Bacteria 1853
156 Ga0075362_10018308 3300006177 Bacteria 2896
157 Ga0075367_10000301 3300006178 Bacteria 17434
158 Ga0075367_10040951 3300006178 Bacteria 2706
159 Ga0075369_10008318 3300006186 Bacteria 3990
160 Ga0075366_10004913 3300006195 Bacteria 7211
161 Ga0097621_100005267 3300006237 Bacteria 9103
162 Ga0097621_100021189 3300006237 Bacteria 5022
163 Ga0097621_100093557 3300006237 Bacteria 2519
164 Ga0097621_100180423 3300006237 Bacteria 1824
165 Ga0075370_10004812 3300006353 Bacteria 6611
166 Ga0068871_100002503 3300006358 Bacteria 12536
167 Ga0068871_100030886 3300006358 Bacteria 4222
168 Ga0068871_100078521 3300006358 Bacteria 2729
169 Ga0068871_100094424 3300006358 Bacteria 2497
170 Ga0075428_100041134 3300006844 Bacteria 5084
171 Ga0075428_100259648 3300006844 Bacteria 1871
172 Ga0075431_100016231 3300006847 Bacteria 7555
173 Ga0075434_100005496 3300006871 Bacteria 11543
174 Ga0068865_100001375 3300006881 Bacteria 14154
175 Ga0097620_100033007 3300006931 Bacteria 5199
176 Ga0075435_100092043 3300007076 Bacteria 2503
177 Ga0105251_10014435 3300009011 Bacteria 4365
178 Ga0105244_10000463 3300009036 Bacteria 37089
179 Ga0105244_10008315 3300009036 Bacteria 6490
180 Ga0105244_10009037 3300009036 Bacteria 6166
181 Ga0105244_10011256 3300009036 Bacteria 5381
182 Ga0105244_10018744 3300009036 Bacteria 3876
183 Ga0105244_10040872 3300009036 Bacteria 2405
184 Ga0105250_10000576 3300009092 Bacteria 24300
185 Ga0105250_10007842 3300009092 Bacteria 4566
186 Ga0105250_10012127 3300009092 Bacteria 3566
187 Ga0105250_10014914 3300009092 Bacteria 3187
188 Ga0105240_10003198 3300009093 Bacteria 25719
189 Ga0105240_10071203 3300009093 Bacteria 4301
190 Ga0105240_10079980 3300009093 Bacteria 4021
191 Ga0105240_10173091 3300009093 Bacteria 2555
192 Ga0111539_10021105 3300009094 Bacteria 8020
193 Ga0111539_10039118 3300009094 Bacteria 5718
194 Ga0111539_10093225 3300009094 Bacteria 3538
195 Ga0111539_10098484 3300009094 Bacteria 3434
196 Ga0111539_10126402 3300009094 Bacteria 2995
197 Ga0105245_10012324 3300009098 Bacteria 7439
198 Ga0105247_10003510 3300009101 Bacteria 10207
199 Ga0105247_10029599 3300009101 Bacteria 3319
200 Ga0105247_10046641 3300009101 Bacteria 2660
201 Ga0105247_10072988 3300009101 Bacteria 2149
202 Ga0105243_10000005 3300009148 Bacteria 576265
203 Ga0105243_10035027 3300009148 Bacteria 3891
204 Ga0105243_10061306 3300009148 Bacteria 3008
205 Ga0105241_10037240 3300009174 Bacteria 3664
206 Ga0105242_10061429 3300009176 Bacteria 3091
207 Ga0105248_10014105 3300009177 Bacteria 8794
208 Ga0105248_10035717 3300009177 Bacteria 5559
209 Ga0105248_10080920 3300009177 Bacteria 3652
210 Ga0105248_10087675 3300009177 Bacteria 3503
211 Ga0105248_10150160 3300009177 Bacteria 2629
212 Ga0105248_10176337 3300009177 Bacteria 2409
213 Ga0105237_10043348 3300009545 Bacteria 4533
214 Ga0105237_10050436 3300009545 Bacteria 4181
215 Ga0105237_10086939 3300009545 Bacteria 3116
216 Ga0105238_10022419 3300009551 Bacteria 6436
217 Ga0105238_10031814 3300009551 Bacteria 5369
218 Ga0105238_10068114 3300009551 Bacteria 3560
219 Ga0105249_10000952 3300009553 Bacteria 25606
220 Ga0105249_10312787 3300009553 Bacteria 1580
221 Ga0105239_10077815 3300010375 Bacteria 3650
222 Ga0105239_10149056 3300010375 Bacteria 2610
223 Ga0105246_10024178 3300011119 Bacteria 3943
224 Ga0105246_10038504 3300011119 Bacteria 3216
225 Ga0157373_10003228 3300013100 Bacteria 12331
226 Ga0157373_10066474 3300013100 Bacteria 2551
227 Ga0157371_10000696 3300013102 Bacteria 39564
228 Ga0157371_10106758 3300013102 Bacteria 1987
229 Ga0157370_10010102 3300013104 Bacteria 9969
230 Ga0157370_10040989 3300013104 Bacteria 4470
231 Ga0157369_10000160 3300013105 Bacteria 95301
232 Ga0157369_10000167 3300013105 Bacteria 93483
233 Ga0157369_10050032 3300013105 Bacteria 4528
234 Ga0157369_10050632 3300013105 Bacteria 4497
235 Ga0157369_10173649 3300013105 Bacteria 2270
236 Ga0157374_10008421 3300013296 Bacteria 8811
237 Ga0157374_10043887 3300013296 Bacteria 4131
238 Ga0157374_10053750 3300013296 Bacteria 3755
239 Ga0157374_10085470 3300013296 Bacteria 3000
240 Ga0157374_10150532 3300013296 Bacteria 2262
241 Ga0157374_10181080 3300013296 Bacteria 2058
242 Ga0157378_10000006 3300013297 Bacteria 192683
243 Ga0157378_10000929 3300013297 Bacteria 27006
244 Ga0157378_10003059 3300013297 Bacteria 14866
245 Ga0157378_10015977 3300013297 Bacteria 6574
246 Ga0157378_10100671 3300013297 Bacteria 2638
247 Ga0157378_10168699 3300013297 Bacteria 2051
248 Ga0157378_10181533 3300013297 Bacteria 1980
249 Ga0163162_10053703 3300013306 Bacteria 4050
250 Ga0163162_10129813 3300013306 Bacteria 2628
251 Ga0163162_10267793 3300013306 Bacteria 1840
252 Ga0157372_10000931 3300013307 Bacteria 31902
253 Ga0157372_10021605 3300013307 Bacteria 6955
254 Ga0157375_10007776 3300013308 Bacteria 9378
255 Ga0157375_10024721 3300013308 Bacteria 5565
256 Ga0157375_10037005 3300013308 Bacteria 4672
257 Ga0157375_10056716 3300013308 Bacteria 3869
258 Ga0157375_10086062 3300013308 Bacteria 3193
259 Ga0157375_10183998 3300013308 Bacteria 2242
260 Ga0163163_10010328 3300014325 Bacteria 8391
261 Ga0163163_10049500 3300014325 Bacteria 4137
262 Ga0163163_10272976 3300014325 Bacteria 1742
263 Ga0157380_10000708 3300014326 Bacteria 20829
264 Ga0157380_10010229 3300014326 Bacteria 6740
265 Ga0157380_10182467 3300014326 Bacteria 1845
266 Ga0157379_10023570 3300014968 Bacteria 5462
267 Ga0157379_10031044 3300014968 Bacteria 4760
268 Ga0157379_10174907 3300014968 Bacteria 1938
269 Ga0157379_10266093 3300014968 Bacteria 1558
270 Ga0157376_10001401 3300014969 Bacteria 15849
271 Ga0157376_10003679 3300014969 Bacteria 10583
272 Ga0157376_10005025 3300014969 Bacteria 9228
273 Ga0157376_10025276 3300014969 Bacteria 4676
274 Ga0157376_10072615 3300014969 Bacteria 2928
275 Ga0157376_10102932 3300014969 Bacteria 2499
276 Ga0163161_10001835 3300017792 Bacteria 15515
277 Ga0163161_10039990 3300017792 Bacteria 3367
278 Ga0163161_10149538 3300017792 Bacteria 1774
279 Ga0213872_10014095 3300021361 Bacteria 3734
280 Ga0224712_10000153 3300022467 Bacteria 11585
281 Ga0209566_100292 3300025225 Bacteria 45550
282 Ga0209674_104908 3300025226 Bacteria 2079
283 Ga0209672_100012 3300025228 Bacteria 795742
284 Ga0209672_100134 3300025228 Bacteria 73307
285 Ga0209147_100007 3300025229 Bacteria 795684
286 Ga0209147_100047 3300025229 Bacteria 288873
287 Ga0209147_100247 3300025229 Bacteria 52095
288 Ga0209147_104188 3300025229 Bacteria 2481
289 Ga0209258_100014 3300025242 Bacteria 720132
290 Ga0209258_100065 3300025242 Bacteria 288500
291 Ga0209148_1000091 3300025254 Bacteria 250913
292 Ga0209148_1000700 3300025254 Bacteria 27161
293 Ga0209565_1010906 3300025263 Bacteria 2237
294 Ga0209455_1000074 3300025272 Bacteria 289143
295 Ga0209455_1000713 3300025272 Bacteria 19254
296 Ga0209673_1000137 3300025273 Bacteria 158691
297 Ga0209130_1000633 3300025284 Bacteria 33023
298 Ga0209130_1002051 3300025284 Bacteria 10934
299 Ga0209130_1006301 3300025284 Bacteria 3881
300 Ga0209025_1000262 3300025294 Bacteria 123617
301 Ga0209025_1000355 3300025294 Bacteria 98571
302 Ga0209025_1001564 3300025294 Bacteria 29032
303 Ga0209025_1002190 3300025294 Bacteria 21650
304 Ga0209025_1002944 3300025294 Bacteria 16932
305 Ga0209025_1003509 3300025294 Bacteria 14740
306 Ga0209025_1006327 3300025294 Bacteria 9235
307 Ga0209025_1008110 3300025294 Bacteria 7631
308 Ga0209025_1012470 3300025294 Bacteria 5441
309 Ga0209564_1003482 3300025295 Bacteria 10721
310 Ga0207697_10005006 3300025315 Bacteria 6233
311 Ga0207656_10015039 3300025321 Bacteria 2991
312 Ga0207696_1003906 3300025711 Bacteria 6576
313 Ga0207696_1006313 3300025711 Bacteria 4787
314 Ga0207696_1010394 3300025711 Bacteria 3411
315 Ga0207696_1012587 3300025711 Bacteria 2984
316 Ga0207655_1000490 3300025728 Bacteria 50941
317 Ga0207655_1001499 3300025728 Bacteria 21328
318 Ga0207655_1001848 3300025728 Bacteria 18290
319 Ga0207682_10000929 3300025893 Bacteria 13588
320 Ga0207682_10004587 3300025893 Bacteria 5755
321 Ga0207682_10028066 3300025893 Bacteria 2245
322 Ga0207692_10004478 3300025898 Bacteria 5535
323 Ga0207692_10061453 3300025898 Bacteria 1947
324 Ga0207642_10033433 3300025899 Bacteria 2176
325 Ga0207710_10003111 3300025900 Bacteria 7435
326 Ga0207710_10009354 3300025900 Bacteria 4125
327 Ga0207688_10002701 3300025901 Bacteria 9607
328 Ga0207688_10117742 3300025901 Bacteria 1548
329 Ga0207680_10066116 3300025903 Bacteria 2222
330 Ga0207647_10000307 3300025904 Bacteria 40415
331 Ga0207647_10001758 3300025904 Bacteria 16628
332 Ga0207645_10018143 3300025907 Bacteria 4637
333 Ga0207645_10024691 3300025907 Bacteria 3893
334 Ga0207645_10031441 3300025907 Bacteria 3415
335 Ga0207645_10043834 3300025907 Bacteria 2863
336 Ga0207654_10023813 3300025911 Bacteria 3285
337 Ga0207654_10087643 3300025911 Bacteria 1889
338 Ga0207695_10002574 3300025913 Bacteria 26650
339 Ga0207695_10022714 3300025913 Bacteria 7110
340 Ga0207695_10039972 3300025913 Bacteria 5036
341 Ga0207695_10175799 3300025913 Bacteria 2064
342 Ga0207671_10019603 3300025914 Bacteria 5169
343 Ga0207671_10051677 3300025914 Bacteria 3046
344 Ga0207671_10123002 3300025914 Bacteria 1985
345 Ga0207693_10001595 3300025915 Bacteria 20042
346 Ga0207663_10000670 3300025916 Bacteria 15130
347 Ga0207663_10043162 3300025916 Bacteria 2759
348 Ga0207662_10030030 3300025918 Bacteria 3152
349 Ga0207657_10000019 3300025919 Bacteria 159785
350 Ga0207657_10000822 3300025919 Bacteria 32803
351 Ga0207657_10057864 3300025919 Bacteria 3339
352 Ga0207649_10097106 3300025920 Bacteria 1942
353 Ga0207681_10013076 3300025923 Bacteria 5132
354 Ga0207681_10029477 3300025923 Bacteria 3565
355 Ga0207694_10020737 3300025924 Bacteria 4975
356 Ga0207650_10001257 3300025925 Bacteria 18423
357 Ga0207650_10010191 3300025925 Bacteria 6441
358 Ga0207650_10069125 3300025925 Bacteria 2653
359 Ga0207650_10181531 3300025925 Bacteria 1677
360 Ga0207659_10006611 3300025926 Bacteria 7119
361 Ga0207659_10008627 3300025926 Bacteria 6340
362 Ga0207659_10032366 3300025926 Bacteria 3588
363 Ga0207659_10144787 3300025926 Bacteria 1849
364 Ga0207664_10004159 3300025929 Bacteria 9770
365 Ga0207644_10005044 3300025931 Bacteria 8616
366 Ga0207644_10005122 3300025931 Bacteria 8560
367 Ga0207644_10023664 3300025931 Bacteria 4210
368 Ga0207690_10000028 3300025932 Bacteria 160775
369 Ga0207690_10001482 3300025932 Bacteria 14673
370 Ga0207690_10121264 3300025932 Bacteria 1900
371 Ga0207706_10000149 3300025933 Bacteria 76532
372 Ga0207706_10006213 3300025933 Bacteria 11098
373 Ga0207706_10042515 3300025933 Bacteria 4027
374 Ga0207709_10000001 3300025935 Bacteria 2228154
375 Ga0207709_10007384 3300025935 Bacteria 6124
376 Ga0207670_10002972 3300025936 Bacteria 8951
377 Ga0207670_10114932 3300025936 Bacteria 1946
378 Ga0207669_10001807 3300025937 Bacteria 9062
379 Ga0207704_10026918 3300025938 Bacteria 3162
380 Ga0207704_10030902 3300025938 Bacteria 3010
381 Ga0207704_10049354 3300025938 Bacteria 2531
382 Ga0207704_10051396 3300025938 Bacteria 2492
383 Ga0207665_10000118 3300025939 Bacteria 52078
384 Ga0207665_10058629 3300025939 Bacteria 2603
385 Ga0207691_10005529 3300025940 Bacteria 12207
386 Ga0207691_10007024 3300025940 Bacteria 10862
387 Ga0207691_10014808 3300025940 Bacteria 7431
388 Ga0207691_10025496 3300025940 Bacteria 5550
389 Ga0207691_10027233 3300025940 Bacteria 5362
390 Ga0207691_10030314 3300025940 Bacteria 5056
391 Ga0207691_10038446 3300025940 Bacteria 4428
392 Ga0207711_10041445 3300025941 Bacteria 3921
393 Ga0207711_10068819 3300025941 Bacteria 3067
394 Ga0207711_10069973 3300025941 Bacteria 3043
395 Ga0207711_10073938 3300025941 Bacteria 2963
396 Ga0207711_10078051 3300025941 Bacteria 2887
397 Ga0207711_10232906 3300025941 Bacteria 1687
398 Ga0207689_10008518 3300025942 Bacteria 8942
399 Ga0207689_10021652 3300025942 Bacteria 5406
400 Ga0207689_10038440 3300025942 Bacteria 3964
401 Ga0207689_10063960 3300025942 Bacteria 3027
402 Ga0207689_10067334 3300025942 Bacteria 2943
403 Ga0207689_10108444 3300025942 Bacteria 2282
404 Ga0207661_10033311 3300025944 Bacteria 3998
405 Ga0207679_10079666 3300025945 Bacteria 2499
406 Ga0207679_10201503 3300025945 Bacteria 1663
407 Ga0207667_10001720 3300025949 Bacteria 27567
408 Ga0207651_10029172 3300025960 Bacteria 3492
409 Ga0207651_10065813 3300025960 Bacteria 2543
410 Ga0207651_10079438 3300025960 Bacteria 2357
411 Ga0207651_10149346 3300025960 Bacteria 1817
412 Ga0207712_10001054 3300025961 Bacteria 19341
413 Ga0207712_10010727 3300025961 Bacteria 5822
414 Ga0207712_10039929 3300025961 Bacteria 3218
415 Ga0207668_10026139 3300025972 Bacteria 3786
416 Ga0207668_10051733 3300025972 Bacteria 2838
417 Ga0207640_10049343 3300025981 Bacteria 2725
418 Ga0207640_10079523 3300025981 Bacteria 2235
419 Ga0207658_10091363 3300025986 Bacteria 2362
420 Ga0207703_10000734 3300026035 Bacteria 32244
421 Ga0207703_10012138 3300026035 Bacteria 6713
422 Ga0207703_10016348 3300026035 Bacteria 5784
423 Ga0207639_10004603 3300026041 Bacteria 9279
424 Ga0207639_10166937 3300026041 Bacteria 1860
425 Ga0207678_10012380 3300026067 Bacteria 7487
426 Ga0207678_10019882 3300026067 Bacteria 5902
427 Ga0207678_10025991 3300026067 Bacteria 5108
428 Ga0207678_10041934 3300026067 Bacteria 3967
429 Ga0207678_10047488 3300026067 Bacteria 3712
430 Ga0207678_10060815 3300026067 Bacteria 3248
431 Ga0207678_10098169 3300026067 Bacteria 2502
432 Ga0207708_10005532 3300026075 Bacteria 9320
433 Ga0207702_10049715 3300026078 Bacteria 3538
434 Ga0207641_10074605 3300026088 Bacteria 2926
435 Ga0207641_10098344 3300026088 Bacteria 2573
436 Ga0207648_10006787 3300026089 Bacteria 11349
437 Ga0207648_10008866 3300026089 Bacteria 9683
438 Ga0207648_10018499 3300026089 Bacteria 6306
439 Ga0207648_10119001 3300026089 Bacteria 2321
440 Ga0207676_10010141 3300026095 Bacteria 6707
441 Ga0207676_10016706 3300026095 Bacteria 5315
442 Ga0207676_10040883 3300026095 Bacteria 3556
443 Ga0207676_10047491 3300026095 Bacteria 3327
444 Ga0207676_10126331 3300026095 Bacteria 2166
445 Ga0207676_10132310 3300026095 Bacteria 2123
446 Ga0207674_10022409 3300026116 Bacteria 6783
447 Ga0207675_100016302 3300026118 Bacteria 6937
448 Ga0207675_100026250 3300026118 Bacteria 5423
449 Ga0207675_100034620 3300026118 Bacteria 4709
450 Ga0207675_100052537 3300026118 Bacteria 3802
451 Ga0207675_100062914 3300026118 Bacteria 3467
452 Ga0207675_100111298 3300026118 Bacteria 2584
453 Ga0207683_10001414 3300026121 Bacteria 21696
454 Ga0207683_10005185 3300026121 Bacteria 11189
455 Ga0207683_10038670 3300026121 Bacteria 4160
456 Ga0207683_10051111 3300026121 Bacteria 3621
457 Ga0207683_10100027 3300026121 Bacteria 2588
458 Ga0207683_10144977 3300026121 Bacteria 2141
459 Ga0207698_10003500 3300026142 Bacteria 9465
460 Ga0207698_10055081 3300026142 Bacteria 3062
461 Ga0207698_10158998 3300026142 Bacteria 1973
462 Ga0207698_10221356 3300026142 Bacteria 1711
463 Ga0207698_10264137 3300026142 Bacteria 1583
464 Ga0209371_1000006 3300027312 Bacteria 1055642
465 Ga0209371_1000113 3300027312 Bacteria 139649
466 Ga0268266_10000006 3300028379 Bacteria 1410021
467 Ga0268266_10000807 3300028379 Bacteria 41568
468 Ga0268266_10016489 3300028379 Bacteria 6315
469 Ga0268266_10025228 3300028379 Bacteria 5060
470 Ga0268266_10172553 3300028379 Bacteria 1963
471 Ga0268265_10007492 3300028380 Bacteria 7370
472 Ga0268265_10047733 3300028380 Bacteria 3210
473 Ga0268264_10113588 3300028381 Bacteria 2376
474 Ga0307515_10004656 3300028794 Bacteria 28166
475 Ga0237817_10031 3300030083 Bacteria 49190
476 Ga0268256_1000007 3300030500 Bacteria 1055326
477 Ga0268256_1000575 3300030500 Bacteria 29639
478 Ga0265327_10001312 3300031251 Bacteria 32428
479 Ga0265327_10015647 3300031251 Bacteria 4879
480 Ga0307509_10035086 3300031507 Bacteria 5508
481 Ga0307509_10038464 3300031507 Bacteria 5218
482 Ga0265314_10026985 3300031711 Bacteria 4307
483 Ga0265342_10017660 3300031712 Bacteria 4636
484 Ga0307516_10000678 3300031730 Bacteria 46164
485 Ga0307516_10022231 3300031730 Bacteria 6517
486 Ga0307516_10040714 3300031730 Bacteria 4623
487 Ga0307415_100045575 3300032126 Bacteria 2941
488 Ga0307510_10001063 3300033180 Bacteria 29201
489 Ga0307510_10046375 3300033180 Bacteria 4674
490 Ga0373923_0024380 3300035111 Bacteria 2387
491 Ga0373945_0006415 3300035116 Bacteria 3795
492 Ga0373953_0001434 3300035117 Bacteria 6904
493 Ga0373954_0000261 3300035118 Bacteria 19044
494 Ga0373954_0006034 3300035118 Bacteria 5270
495 Ga0373954_0010774 3300035118 Bacteria 4043
496 Ga0373943_0048798 3300035170 Bacteria 2075
497 Ga0373943_0061380 3300035170 Bacteria 1879
498 Ga0373946_0028153 3300035171 Bacteria 2227
499 Ga0373955_0000455 3300035172 Bacteria 17320
500 Ga0373955_0003182 3300035172 Bacteria 7189
501 Ga0373962_0014177 3300035242 Bacteria 2029
502 Ga0373924_0000696 3300035410 Bacteria 10458
503 Ga0373931_0018884 3300035691 Bacteria 3433
504 Ga0373931_0034017 3300035691 Bacteria 2643
505 Ga0373935_0005538 3300035692 Bacteria 7440
506 Ga0373935_0019087 3300035692 Bacteria 4181
507 Ga0373935_0128888 3300035692 Bacteria 1698
508 Ga0373927_0001649 3300035695 Bacteria 16726
509 Ga0373927_0011264 3300035695 Bacteria 5953
510 Ga0373927_0091523 3300035695 Bacteria 1975
511 Ga0373933_0000346 3300035724 Bacteria 29613
512 Ga0373933_0026643 3300035724 Bacteria 3321
513 Ga0373933_0032878 3300035724 Bacteria 3015
514 Ga0373933_0053088 3300035724 Bacteria 2427
515 Ga0373933_0056528 3300035724 Bacteria 2356
516 Ga0373933_0069336 3300035724 Bacteria 2143
517 Ga0373937_0005546 3300036401 Bacteria 10823
518 Ga0373937_0006983 3300036401 Bacteria 9745
519 Ga0373937_0009266 3300036401 Bacteria 8548
520 Ga0373937_0046347 3300036401 Bacteria 3975
521 Ga0373937_0145678 3300036401 Bacteria 2217
522 Ga0373925_0001973 3300037068 Bacteria 16990
523 Ga0395900_0000053 3300037418 Bacteria 221135
524 Ga0395900_0042134 3300037418 Bacteria 4703
525 Ga0395900_0060066 3300037418 Bacteria 3913
526 Ga0395898_0000264 3300037466 Bacteria 128758
527 Ga0395898_0070973 3300037466 Bacteria 3366
528 Ga0395905_0006009 3300037471 Bacteria 12291
529 Ga0395905_0012988 3300037471 Bacteria 8004
530 Ga0395901_0000009 3300038443 Bacteria 479396
531 Ga0395901_0000012 3300038443 Bacteria 381361
532 Ga0395901_0026845 3300038443 Bacteria 5912
533 Ga0237819_00044 3300038705 Bacteria 43089
534 Ga0237819_00450 3300038705 Bacteria 14003
535 Ga0436365_1076449 3300039437 Bacteria 3259
536 Ga0451802_1782641 3300041460 Bacteria 2140
537 Ga0466969_0000241 3300044656 Bacteria 29962
538 Ga0466973_0045270 3300044659 Bacteria 4114
539 Ga0466965_0000127 3300044683 Bacteria 21843
540 Ga0466966_0000011 3300044684 Bacteria 136987
541 Ga0466966_0023588 3300044684 Bacteria 4027
542 Ga0466966_0026486 3300044684 Bacteria 3784
543 Ga0466961_0000276 3300044693 Bacteria 34281
544 Ga0466963_0000544 3300044694 Bacteria 17729
545 Ga0466963_0042537 3300044694 Bacteria 2984
546 Ga0466971_0000258 3300044719 Bacteria 20212
547 Ga0466971_0003962 3300044719 Bacteria 6366
548 Ga0466970_0017943 3300044765 Bacteria 3661
549 Ga0466957_0034805 3300044842 Bacteria 3021
550 Ga0466959_0005449 3300045049 Bacteria 8713
551 Ga0466967_0000507 3300045976 Bacteria 19031
552 Ga0495617_000786 3300046452 Bacteria 15345
553 Ga0495617_038301 3300046452 Bacteria 1604
554 Ga0495592_0003017 3300046454 Bacteria 11992
555 Ga0495592_0027851 3300046454 Bacteria 4280
556 Ga0495592_0035111 3300046454 Bacteria 3779
557 Ga0495592_0124608 3300046454 Bacteria 1809
558 Ga0495603_0001827 3300046455 Bacteria 12557
559 Ga0495603_0083193 3300046455 Bacteria 1874
560 Ga0495603_0093291 3300046455 Bacteria 1759
561 Ga0495590_0015226 3300046457 Bacteria 2795
562 Ga0495629_0001739 3300046459 Bacteria 17078
563 Ga0495629_0003254 3300046459 Bacteria 12299
564 Ga0495629_0018005 3300046459 Bacteria 5063
565 Ga0495629_0019328 3300046459 Bacteria 4869
566 Ga0495629_0028486 3300046459 Bacteria 3966
567 Ga0495629_0066080 3300046459 Bacteria 2524
568 Ga0495629_0119991 3300046459 Bacteria 1832
569 Ga0495638_0003236 3300046460 Bacteria 12877
570 Ga0495638_0005422 3300046460 Bacteria 9493
571 Ga0495641_0005678 3300046461 Bacteria 8314
572 Ga0495641_0037573 3300046461 Bacteria 2268
573 Ga0495641_0055373 3300046461 Bacteria 1801
574 Ga0495651_0001035 3300046462 Bacteria 21511
575 Ga0495651_0001967 3300046462 Bacteria 15902
576 Ga0495651_0002281 3300046462 Bacteria 14802
577 Ga0495651_0003244 3300046462 Bacteria 12482
578 Ga0495653_0000572 3300046463 Bacteria 28222
579 Ga0495653_0004181 3300046463 Bacteria 11682
580 Ga0495653_0005788 3300046463 Bacteria 10114
581 Ga0495653_0006075 3300046463 Bacteria 9893
582 Ga0495653_0055871 3300046463 Bacteria 3011
583 Ga0495580_0008936 3300046472 Bacteria 7925
584 Ga0495582_0000547 3300046473 Bacteria 20786
585 Ga0495582_0004697 3300046473 Bacteria 7680
586 Ga0495582_0025453 3300046473 Bacteria 3241
587 Ga0495605_0007350 3300046474 Bacteria 6254
588 Ga0495605_0007406 3300046474 Bacteria 6229
589 Ga0495605_0017187 3300046474 Bacteria 3899
590 Ga0495605_0029720 3300046474 Bacteria 2807
591 Ga0495639_0000163 3300046475 Bacteria 34576
592 Ga0495639_0054063 3300046475 Bacteria 1830
593 Ga0495662_0000616 3300046476 Bacteria 16523
594 Ga0495584_0000021 3300046491 Bacteria 130377
595 Ga0495584_0000271 3300046491 Bacteria 36789
596 Ga0495584_0009051 3300046491 Bacteria 5142
597 Ga0495584_0022170 3300046491 Bacteria 3223
598 Ga0495585_0000005 3300046492 Bacteria 328103
599 Ga0495585_0000049 3300046492 Bacteria 119546
600 Ga0495585_0000465 3300046492 Bacteria 38766
601 Ga0495585_0002705 3300046492 Bacteria 12417
602 Ga0495585_0005101 3300046492 Bacteria 8356
603 Ga0495585_0014514 3300046492 Bacteria 4586
604 Ga0495585_0018531 3300046492 Bacteria 4015
605 Ga0495585_0018739 3300046492 Bacteria 3992
606 Ga0495585_0020644 3300046492 Bacteria 3787
607 Ga0495585_0082519 3300046492 Bacteria 1740
608 Ga0495594_0001043 3300046499 Bacteria 14436
609 Ga0495594_0011288 3300046499 Bacteria 4641
610 Ga0495594_0056524 3300046499 Bacteria 2165
611 Ga0495596_0001506 3300046500 Bacteria 13326
612 Ga0495596_0001991 3300046500 Bacteria 11245
613 Ga0495596_0012053 3300046500 Bacteria 3711
614 Ga0495607_0015069 3300046501 Bacteria 5020
615 Ga0495607_0028747 3300046501 Bacteria 3426
616 Ga0495607_0032042 3300046501 Bacteria 3213
617 Ga0495583_0000697 3300046506 Bacteria 43333
618 Ga0495583_0015713 3300046506 Bacteria 4102
619 Ga0495606_0025201 3300046507 Bacteria 4266
620 Ga0495606_0066905 3300046507 Bacteria 2277
621 Ga0495608_0003175 3300046511 Bacteria 11759
622 Ga0495608_0006286 3300046511 Bacteria 8425
623 Ga0495608_0076226 3300046511 Bacteria 2185
624 Ga0495616_0000280 3300046513 Bacteria 41320
625 Ga0495616_0003309 3300046513 Bacteria 10352
626 Ga0495616_0018617 3300046513 Bacteria 3807
627 Ga0495616_0043097 3300046513 Bacteria 2293
628 Ga0495620_0015317 3300046515 Bacteria 3875
629 Ga0495628_0019843 3300046516 Bacteria 5553
630 Ga0495628_0174465 3300046516 Bacteria 1629
631 Ga0495630_0028859 3300046517 Bacteria 4123
632 Ga0495630_0033608 3300046517 Bacteria 3825
633 Ga0495630_0179541 3300046517 Bacteria 1614
634 Ga0495631_0010085 3300046518 Bacteria 4692
635 Ga0495632_0000098 3300046519 Bacteria 88691
636 Ga0495632_0000143 3300046519 Bacteria 73460
637 Ga0495632_0000153 3300046519 Bacteria 71012
638 Ga0495643_0054146 3300046522 Bacteria 2149
639 Ga0495644_0007890 3300046523 Bacteria 4100
640 Ga0495644_0011526 3300046523 Bacteria 3403
641 Ga0495648_0000033 3300046524 Bacteria 199184
642 Ga0495663_0007011 3300046525 Bacteria 3110
643 Ga0495663_0009985 3300046525 Bacteria 2634
644 Ga0495666_0046786 3300046526 Bacteria 2085
645 Ga0495642_0000236 3300046528 Bacteria 31451
646 Ga0495642_0002915 3300046528 Bacteria 6816
647 Ga0495642_0005608 3300046528 Bacteria 4823
648 Ga0495642_0010476 3300046528 Bacteria 3551
649 Ga0495652_0005447 3300046529 Bacteria 11989
650 Ga0495652_0017982 3300046529 Bacteria 6306
651 Ga0495652_0022047 3300046529 Bacteria 5657
652 Ga0495652_0143898 3300046529 Bacteria 1872
653 Ga0495654_0013039 3300046530 Bacteria 4453
654 Ga0495654_0046828 3300046530 Bacteria 2128
655 Ga0495665_0003016 3300046531 Bacteria 9100
656 Ga0495640_0014858 3300046533 Bacteria 5874
657 Ga0495586_0014286 3300046535 Bacteria 4218
658 Ga0495586_0075469 3300046535 Bacteria 1845
659 Ga0495587_0001243 3300046536 Bacteria 16921
660 Ga0495587_0001343 3300046536 Bacteria 16342
661 Ga0495587_0012337 3300046536 Bacteria 5383
662 Ga0495587_0030037 3300046536 Bacteria 3297
663 Ga0495609_0007139 3300046538 Bacteria 5616
664 Ga0495609_0008775 3300046538 Bacteria 4922
665 Ga0495609_0038585 3300046538 Bacteria 2153
666 Ga0495621_0056724 3300046539 Bacteria 1413
667 Ga0495645_0057061 3300046543 Bacteria 2835
668 Ga0495622_0003321 3300046557 Bacteria 7597
669 Ga0495633_0002449 3300046558 Bacteria 13105
670 Ga0495633_0002561 3300046558 Bacteria 12742
671 Ga0495633_0006093 3300046558 Bacteria 7223
672 Ga0495633_0021652 3300046558 Bacteria 3212
673 Ga0495667_0000593 3300046559 Bacteria 23047
674 Ga0495667_0002429 3300046559 Bacteria 12441
675 Ga0495667_0012388 3300046559 Bacteria 5779
676 Ga0495667_0033062 3300046559 Bacteria 3461
677 Ga0495656_0000474 3300046615 Bacteria 13044
678 Ga0495656_0013343 3300046615 Bacteria 3055
679 Ga0495668_0001839 3300046616 Bacteria 19134
680 Ga0495668_0006812 3300046616 Bacteria 7418
681 Ga0495668_0012306 3300046616 Bacteria 5075
682 Ga0495668_0015405 3300046616 Bacteria 4466
683 Ga0495668_0024779 3300046616 Bacteria 3411
684 Ga0495668_0025241 3300046616 Bacteria 3377
685 Ga0495668_0033278 3300046616 Bacteria 2897
686 Ga0495668_0057661 3300046616 Bacteria 2143
687 Ga0495634_0007414 3300046642 Bacteria 8246
688 Ga0495634_0022347 3300046642 Bacteria 4458
689 Ga0495611_0004328 3300046648 Bacteria 6160
690 Ga0495625_0000897 3300046660 Bacteria 40203
691 Ga0495625_0004030 3300046660 Bacteria 14051
692 Ga0495625_0027780 3300046660 Bacteria 4253
693 Ga0495635_0000241 3300046663 Bacteria 34839
694 Ga0495635_0002402 3300046663 Bacteria 12759
695 Ga0495635_0006833 3300046663 Bacteria 7970
696 Ga0495635_0008016 3300046663 Bacteria 7379
697 Ga0495635_0016174 3300046663 Bacteria 5208
698 Ga0495659_0000129 3300046664 Bacteria 33093
699 Ga0495661_0001219 3300046665 Bacteria 22320
700 Ga0495661_0002280 3300046665 Bacteria 14840
701 Ga0495661_0014885 3300046665 Bacteria 5201
702 Ga0495588_0002151 3300046674 Bacteria 8428
703 Ga0495588_0024316 3300046674 Bacteria 3008
704 Ga0495588_0027592 3300046674 Bacteria 2837
705 Ga0495657_0000637 3300046675 Bacteria 31781
706 Ga0495657_0001501 3300046675 Bacteria 20104
707 Ga0495657_0003700 3300046675 Bacteria 12383
708 Ga0495657_0024543 3300046675 Bacteria 4292
709 Ga0495657_0108067 3300046675 Bacteria 1765
710 Ga0495599_0000148 3300046678 Bacteria 45714
711 Ga0495599_0002232 3300046678 Bacteria 11280
712 Ga0495599_0012230 3300046678 Bacteria 5286
713 Ga0495623_0005748 3300046679 Bacteria 8094
714 Ga0495623_0013967 3300046679 Bacteria 5203
715 Ga0495623_0017622 3300046679 Bacteria 4612
716 Ga0495623_0026067 3300046679 Bacteria 3765
717 Ga0495623_0045795 3300046679 Bacteria 2777
718 Ga0495646_0025543 3300046680 Bacteria 3715
719 Ga0495646_0070046 3300046680 Bacteria 2067
720 Ga0495647_0004539 3300046681 Bacteria 4518
721 Ga0495647_0038287 3300046681 Bacteria 1813
722 Ga0495658_0004596 3300046683 Bacteria 6794
723 Ga0495658_0059342 3300046683 Bacteria 2190
724 Ga0495658_0107492 3300046683 Bacteria 1673
725 Ga0495658_0139228 3300046683 Bacteria 1483
726 Ga0495658_0152381 3300046683 Bacteria 1421
727 Ga0495669_0000190 3300046684 Bacteria 38101
728 Ga0495669_0000986 3300046684 Bacteria 11894
729 Ga0495669_0002903 3300046684 Bacteria 7039
730 Ga0495669_0007359 3300046684 Bacteria 4613
731 Ga0495613_0004558 3300046689 Bacteria 10393
732 Ga0495624_0003121 3300046690 Bacteria 12384
733 Ga0495670_0000693 3300046691 Bacteria 16033
734 Ga0495670_0001566 3300046691 Bacteria 11181
735 Ga0495671_0000053 3300046692 Bacteria 129715
736 Ga0495671_0000792 3300046692 Bacteria 22664
737 Ga0495671_0029998 3300046692 Bacteria 2788
738 Ga0495649_0004954 3300046694 Bacteria 8579
739 Ga0495649_0035256 3300046694 Bacteria 2752
740 Ga0495589_0013026 3300046794 Bacteria 4296
741 Ga0495589_0014310 3300046794 Bacteria 4087
742 Ga0495600_0000157 3300046809 Bacteria 39158
743 Ga0495600_0001685 3300046809 Bacteria 12349
744 Ga0495600_0003815 3300046809 Bacteria 8928
745 Ga0495600_0120189 3300046809 Bacteria 1709
746 Ga0495660_0000479 3300046810 Bacteria 33262
747 Ga0495660_0052736 3300046810 Bacteria 2209
748 Ga0495581_0000979 3300047315 Bacteria 15353
749 Ga0495581_0014601 3300047315 Bacteria 4554
750 Ga0495581_0040994 3300047315 Bacteria 2679
751 Ga0495604_0002433 3300047317 Bacteria 14892
752 Ga0495604_0003832 3300047317 Bacteria 11979
753 Ga0495604_0008415 3300047317 Bacteria 8152
754 Ga0495604_0008510 3300047317 Bacteria 8101
755 Ga0495674_0003964 3300047319 Bacteria 14356
756 Ga0495674_0005950 3300047319 Bacteria 11703
757 Ga0495674_0016830 3300047319 Bacteria 6818
758 Ga0495674_0123862 3300047319 Bacteria 2182
759 Ga0495672_0000502 3300047320 Bacteria 45063
760 Ga0495672_0053993 3300047320 Bacteria 2351
761 Ga0495676_0000177 3300047321 Bacteria 50096
762 Ga0495676_0094530 3300047321 Bacteria 2226
763 Ga0495680_0002928 3300047322 Bacteria 17140
764 Ga0495680_0006343 3300047322 Bacteria 11008
765 Ga0495680_0007799 3300047322 Bacteria 9775
766 Ga0495680_0008955 3300047322 Bacteria 9045
767 Ga0495680_0021389 3300047322 Bacteria 5417
768 Ga0495680_0113335 3300047322 Bacteria 2008
769 Ga0495680_0172873 3300047322 Bacteria 1563
770 Ga0495683_0000072 3300047323 Bacteria 104027
771 Ga0495683_0039055 3300047323 Bacteria 2400
772 Ga0495687_007756 3300047443 Bacteria 6253
773 Ga0495675_0001960 3300047444 Bacteria 12278
774 Ga0495675_0002204 3300047444 Bacteria 11613
775 Ga0495675_0003158 3300047444 Bacteria 9887
776 Ga0495675_0004738 3300047444 Bacteria 8259
777 Ga0495675_0112382 3300047444 Bacteria 1700
778 Ga0495677_0009205 3300047445 Bacteria 3649
779 Ga0495677_0017380 3300047445 Bacteria 2608
780 Ga0495685_052390 3300047447 Bacteria 1382
781 Ga0495681_0001730 3300047470 Bacteria 16136
782 Ga0495681_0001973 3300047470 Bacteria 14989
783 Ga0495681_0004982 3300047470 Bacteria 8957
784 Ga0495681_0007555 3300047470 Bacteria 6922
785 Ga0495684_0001447 3300047471 Bacteria 18997
786 Ga0495684_0001837 3300047471 Bacteria 17050
787 Ga0495684_0003840 3300047471 Bacteria 11705
788 Ga0495684_0004907 3300047471 Bacteria 10436
789 Ga0495684_0015191 3300047471 Bacteria 5930
790 Ga0495684_0033399 3300047471 Bacteria 3946
791 Ga0495684_0248960 3300047471 Bacteria 1293
792 Ga0495593_0006169 3300047673 Bacteria 7050
793 Ga0495593_0006375 3300047673 Bacteria 6920
794 Ga0495593_0008803 3300047673 Bacteria 5861
795 Ga0495593_0015923 3300047673 Bacteria 4248
796 Ga0495593_0030204 3300047673 Bacteria 2966
797 Ga0495602_0007101 3300048088 Bacteria 11757
798 Ga0495602_0007959 3300048088 Bacteria 11078
799 Ga0495602_0015932 3300048088 Bacteria 7568
800 Ga0495602_0016383 3300048088 Bacteria 7454
801 Ga0495602_0122525 3300048088 Bacteria 2089
802 Ga0495614_0007477 3300048089 Bacteria 4862
803 Ga0495614_0015948 3300048089 Bacteria 3272
804 Ga0495614_0066186 3300048089 Bacteria 1555
805 Ga0495614_0072546 3300048089 Bacteria 1485
806 Ga0495614_0075099 3300048089 Bacteria 1460
807 Ga0495626_0067233 3300048091 Bacteria 1619
808 Ga0496100_0044951 3300048903 Bacteria 2832
809 Ga0496100_0059858 3300048903 Bacteria 2504
810 Ga0496100_0212940 3300048903 Bacteria 1414
811 Ga0496101_0001981 3300048904 Bacteria 12422
812 Ga0496101_0073470 3300048904 Bacteria 2512
813 Ga0496101_0085784 3300048904 Bacteria 2334
814 Ga0496101_0148389 3300048904 Bacteria 1792
815 Ga0496101_0162624 3300048904 Bacteria 1713
816 Ga0496101_0193795 3300048904 Bacteria 1569
817 Ga0496102_0000290 3300048905 Bacteria 64278
818 Ga0496102_0015866 3300048905 Bacteria 6570
819 Ga0496102_0046839 3300048905 Bacteria 3928
820 Ga0496102_0065436 3300048905 Bacteria 3332
821 Ga0496102_0096302 3300048905 Bacteria 2744
822 Ga0496102_0135455 3300048905 Bacteria 2308
823 Ga0496103_0001884 3300048906 Bacteria 13631
824 Ga0496103_0032964 3300048906 Bacteria 3164
825 Ga0496103_0079475 3300048906 Bacteria 2061
826 Ga0496104_0002774 3300048907 Bacteria 15090
827 Ga0496104_0044290 3300048907 Bacteria 4182
828 Ga0496104_0060879 3300048907 Bacteria 3577
829 Ga0496104_0156987 3300048907 Bacteria 2183
830 Ga0496104_0157211 3300048907 Bacteria 2181
831 Ga0496104_0241900 3300048907 Bacteria 1717
832 Ga0496105_0006708 3300048908 Bacteria 8860
833 Ga0496105_0024487 3300048908 Bacteria 4904
834 Ga0496105_0026618 3300048908 Bacteria 4721
835 Ga0496105_0115445 3300048908 Bacteria 2215
836 Ga0496105_0241480 3300048908 Bacteria 1466
837 Ga0496106_0004649 3300048909 Bacteria 10178
838 Ga0496106_0014892 3300048909 Bacteria 5752
839 Ga0496106_0112976 3300048909 Bacteria 2117
840 Ga0496106_0211283 3300048909 Bacteria 1546
841 Ga0496107_0018337 3300048910 Bacteria 4928
842 Ga0496108_0001200 3300048911 Bacteria 20310
843 Ga0496108_0002055 3300048911 Bacteria 16126
844 Ga0496108_0040264 3300048911 Bacteria 3894
845 Ga0496108_0127121 3300048911 Bacteria 2189
846 Ga0496109_0002191 3300048912 Bacteria 16218
847 Ga0496109_0003922 3300048912 Bacteria 12432
848 Ga0496109_0112286 3300048912 Bacteria 2534
849 Ga0496109_0128766 3300048912 Bacteria 2361
850 Ga0496109_0196390 3300048912 Bacteria 1897
851 Ga0496110_0006543 3300048913 Bacteria 9247
852 Ga0496110_0008434 3300048913 Bacteria 8295
853 Ga0496110_0013698 3300048913 Bacteria 6718
854 Ga0496110_0019705 3300048913 Bacteria 5683
855 Ga0496110_0106931 3300048913 Bacteria 2511
856 Ga0496110_0209337 3300048913 Bacteria 1773
857 Ga0496110_0234606 3300048913 Bacteria 1669
858 Ga0496111_0005231 3300048914 Bacteria 8272
859 Ga0496111_0029693 3300048914 Bacteria 3884
860 Ga0496112_0007549 3300048915 Bacteria 9657
861 Ga0496112_0017894 3300048915 Bacteria 6669
862 Ga0496112_0042466 3300048915 Bacteria 4448
863 Ga0496112_0052188 3300048915 Bacteria 4013
864 Ga0496112_0070600 3300048915 Bacteria 3452
865 Ga0496113_0006427 3300048916 Bacteria 7447
866 Ga0496113_0009206 3300048916 Bacteria 6478
867 Ga0496113_0013367 3300048916 Bacteria 5558
868 Ga0496113_0018802 3300048916 Bacteria 4819
869 Ga0496113_0032510 3300048916 Bacteria 3792
870 Ga0496113_0056591 3300048916 Bacteria 2945
871 Ga0496114_0004557 3300048917 Bacteria 10763
872 Ga0496114_0119002 3300048917 Bacteria 2270
873 Ga0496115_0016923 3300048918 Bacteria 5562
874 Ga0496115_0030394 3300048918 Bacteria 4249
875 Ga0496115_0031522 3300048918 Bacteria 4178
876 Ga0496115_0180606 3300048918 Bacteria 1744
877 Ga0496116_0005939 3300048919 Bacteria 11197
878 Ga0496119_0080276 3300048922 Bacteria 1882
879 Ga0496121_0020595 3300048924 Bacteria 6514
880 Ga0496121_0031111 3300048924 Bacteria 4885
881 Ga0496121_0037452 3300048924 Bacteria 4308
882 Ga0496125_0055788 3300048928 Bacteria 3215
883 Ga0496125_0089314 3300048928 Bacteria 2318
884 Ga0496126_0025817 3300048929 Bacteria 5644
885 Ga0496126_0095503 3300048929 Bacteria 2607
886 Ga0496126_0212174 3300048929 Bacteria 1629
887 Ga0495678_000638 3300049459 Bacteria 32238
888 Ga0495682_0007467 3300049460 Bacteria 4343
889 Ga0501033_0058513 3300049570 Bacteria 2847
890 Ga0501034_0038492 3300049571 Bacteria 4842
891 Ga0501034_0113831 3300049571 Bacteria 2694
892 Ga0501034_0185232 3300049571 Bacteria 2046
893 Ga0501037_0059761 3300049573 Bacteria 2780
894 Ga0501038_0086191 3300049574 Bacteria 2639
895 Ga0501046_0003374 3300049580 Bacteria 14663
896 Ga0501047_0102572 3300049581 Bacteria 2740
897 Ga0501072_0051791 3300049588 Bacteria 3232
898 Ga0501217_005273 3300049661 Bacteria 2697
899 Ga0501079_0040966 3300049741 Bacteria 3574
900 nmdc:mga03n38_7752_c1 3300050490 Bacteria 3810
901 nmdc:mga00v17_14590_c2 3300050491 Bacteria 4025
902 nmdc:mga00v17_19839_c1 3300050491 Bacteria 3844
903 nmdc:mga0yw44_15454_c1 3300050492 Bacteria 4090
904 nmdc:mga0yw44_81299_c1 3300050492 Bacteria 2031
905 nmdc:mga0k408_31326_c1 3300050493 Bacteria 3036
906 nmdc:mga0k408_44407_c1 3300050493 Bacteria 2563
907 nmdc:mga05p37_2263_c1 3300050507 Bacteria 22436
908 nmdc:mga08y16_22844_c1 3300050511 Bacteria 6601
909 nmdc:mga08y16_280643_c1 3300050511 Bacteria 1718
910 nmdc:mga08y16_30816_c1 3300050511 Bacteria 5641
911 nmdc:mga08y16_80679_c1 3300050511 Bacteria 3392
912 nmdc:mga08y16_89123_c1 3300050511 Bacteria 3215
913 nmdc:mga0n895_31943_c1 3300050512 Bacteria 5048
914 nmdc:mga0n895_473942_c1 3300050512 Bacteria 1263
915 nmdc:mga0a205_54053_c1 3300050515 Bacteria 3877
916 nmdc:mga0sz30_52057_c1 3300050516 Bacteria 1738
917 Ga0495601_0007085 3300053077 Bacteria 6568
918 Ga0495601_0010230 3300053077 Bacteria 5577
919 Ga0495601_0022445 3300053077 Bacteria 3874
920 Ga0495612_0001392 3300053078 Bacteria 9978
921 Ga0495612_0014040 3300053078 Bacteria 3226
922 Ga0500635_0001121 3300053080 Bacteria 6404
923 Ga0495595_0000325 3300053084 Bacteria 18606
924 Ga0495595_0001287 3300053084 Bacteria 9790
925 Ga0495595_0003596 3300053084 Bacteria 6157
926 Ga0495595_0008358 3300053084 Bacteria 4248
927 Ga0495595_0022337 3300053084 Bacteria 2777
928 Ga0495595_0066267 3300053084 Bacteria 1700
929 Ga0495619_0000517 3300053085 Bacteria 25651
930 Ga0495619_0000698 3300053085 Bacteria 21970
931 Ga0495619_0000906 3300053085 Bacteria 19422
932 Ga0495619_0002729 3300053085 Bacteria 11534
933 Ga0495619_0004330 3300053085 Bacteria 9053
934 Ga0495619_0018396 3300053085 Bacteria 4433
935 Ga0495619_0023260 3300053085 Bacteria 3971
936 Ga0495619_0030068 3300053085 Bacteria 3514
937 Ga0500595_011310 3300053119 Bacteria 3500
938 Ga0500658_0035070 3300053134 Bacteria 1984
939 Ga0500637_0011579 3300053178 Bacteria 4569
940 Ga0466962_0005345 3300061719 Bacteria 6174
941 Ga0530510_0007515 3300061734 Bacteria 7590
942 2512037813 2511231221 Bacteria 6846400
943 2513591604 2513237087 Bacteria 5817514
944 2519460614 2519103095 Bacteria 6629912
945 2524535119 2524023228 Bacteria 10118060
946 2545555820 2545555800 Bacteria 4222588
947 2552749290 2551306352 Bacteria 3873115
948 2578929237 2576861599 Bacteria 4217202
949 2585293098 2582581311 Bacteria 6763856
950 2599736257 2599185239 Bacteria 8686614
951 2599746149 2599185240 Bacteria 7968121
952 2600208017 2599185355 Bacteria 7968906
953 2631983026 2630968484 Bacteria 3876276
954 2640734241 2639762793 Bacteria 3943681
955 2644249876 2643221645 Bacteria 7207331
956 2644358541 2643221664 Bacteria 7272945
957 2644362428 2643221665 Bacteria 4699229
958 2644704630 2643221729 Bacteria 6621700
959 2644709324 2643221730 Bacteria 6523787
960 2651533146 2648501850 Bacteria 3975476
961 2674419426 2671180844 Bacteria 4164150
962 2676743740 2675903129 Bacteria 7964495
963 2678231217 2675903507 Bacteria 3737791
964 2685150121 2684622632 Bacteria 5380049
965 2695627686 2695420354 Bacteria 3922431
966 2698323141 2695420987 Bacteria 6152737
967 2705994095 2703719227 Bacteria 5631989
968 2717916517 2716884898 Bacteria 3928789
969 2721505423 2718218445 Bacteria 5113413
970 2728753168 2728368998 Bacteria 8720350
971 2738739475 2738541280 Bacteria 6630198
972 2738815211 2738541295 Bacteria 5730091
973 2738846048 2738541300 Bacteria 6675882
974 2739157934 2738541358 Bacteria 5932299
975 2739210620 2738543006 Bacteria 5904091
976 2739269069 2738543017 Bacteria 4271950
977 2739275799 2738543018 Bacteria 6718814
978 2739344843 2738543030 Bacteria 6719714
979 2745161341 2744054655 Bacteria 3552603
980 2774388223 2773857761 Bacteria 3837365
981 2774437431 2773857770 Bacteria 3911866
982 2793083827
983 2808970582 2808606384 Bacteria 8474373
984 2809005311 2808606390 Bacteria 8476311
985 2809012288 2808606391 Bacteria 8308166
986 2817257602 2816332253 Bacteria 6764532
987 2817281995 2816332256 Bacteria 6891714
988 2817451545 2816332286 Bacteria 6853759
989 2819578796 2818991443 Bacteria 6598732
990 2819634099 2818991452 Bacteria 8442785
991 2857583775 2857581216 Bacteria 5522813
992 2857606615 2857604169 Bacteria 5111450
993 2858689639 2858688981 Bacteria 8184122
994 2863423908 2863421361 Bacteria 7300805
995 2870073949 2870068957 Bacteria 8925310
996 2877770529 2877768649 Bacteria 3957164
997 2880171514 2880169592 Bacteria 3900066
998 2885381802 2885374607 Bacteria 8927485
999 2885414966 2885409591 Bacteria 9235467
1000 2897809570 2897803580 Bacteria 7000062
1001 2904568478 2904564687 Bacteria 7609577
1002 2904575521 2904571731 Bacteria 7608790
1003 2916699725 2916699645 Bacteria 3568996
1004 2919184148 2919182534 Bacteria 3907101
1005 2919418954 2919414237 Bacteria 5429133
1006 2928160859 2928157003 Bacteria 7522202
1007 2928170480 2928163908 Bacteria 7561269
1008 2928171305 2928170801 Bacteria 8785406
1009 2928516581 2928515477 Bacteria 4448421
1010 2928536343 2928536128 Bacteria 7657547
1011 2936363460 2936361878 Bacteria 5632809
1012 2938919505 2938917290 Bacteria 5914775
1013 2947428876 2947426588 Bacteria 5357194
1014 2965763369 2965761152 Bacteria 5806513
1015 2969142984 2969141011 Bacteria 4118468
1016 2971895296 2971893375 Bacteria 3929648
1017 2979085823 2979083700 Bacteria 5894929
1018 2981991492 2981990288 Bacteria 7590678
1019 2984570288 2984568884 Bacteria 3884413
1020 3001895494 3001892409 Bacteria 6328293
1021 3001898723 3001892409 Bacteria 6328293
1022 3006883344 3006879489 Bacteria 4064221
1023 3006974296 3006973921 Bacteria 4423788
1024 642418927 641736154 Bacteria 7689995
1025 8006936540 8006933436 Bacteria 10410654
1026 8006976506 8006973647 Bacteria 10679141
1027 8006991366 8006984368 Bacteria 9651211
1028 8018849413 8018845410 Bacteria 8933938
1029 8020808572 8020807995 Bacteria 6801506
1030 8020938516 8020938398 Bacteria 7472757
1031 8020946241 8020945358 Bacteria 8467355
1032 8020954930 8020953355 Bacteria 7439080
1033 8021123466 8021120328 Bacteria 8782274
1034 8022625676 8022621104 Bacteria 5241040
1035 8022631139 8022630665 Bacteria 3886130
1036 8022798574 8022792930 Bacteria 5693794
1037 8022798576 8022792930 Bacteria 5693794
1038 8022949405 8022948649 Bacteria 5366783
1039 8023444113 8023438354 Bacteria 5779374
1040 8023449704 8023444577 Bacteria 5661597
1041 8039103311 8039098773 Bacteria 6602928
1042 8040168317 8040167225 Bacteria 6542727
1043 8040175895 8040173305 Bacteria 6827067
1044 8054284710 8054280661 Bacteria 4232245
1045 8057584914 8057582654 Bacteria 5218944
1046 8057584916 8057582654 Bacteria 5218944
1047 Ga0207639_10141064
1048 JGI24736J21556_1010749
1049 JGI24739J22299_10003563
1050 JGI24735J21928_10023965
1051 JGI25159J45721_1001328
1052 JGI25159J45721_1011754
1053 JGI25151J46595_10000302
1054 JGI25151J46595_10002843
1055 JGI25151J46595_10006202
1056 JGI25151J46595_10009043
1057 JGI25404J52841_10002675
1058 Ga0055532_1000540
1059 Ga0055535_1000950
1060 Ga0055535_1000957
1061 Ga0055542_1000942
1062 Ga0055542_1000996
1063 Ga0055529_1000599
1064 Ga0055528_1007778
1065 Ga0058692_1000003
1066 Ga0058692_1000514
1067 Ga0065703_1000186
1068 Ga0065715_10006850
1069 Ga0065715_10126718
1070 Ga0065707_10092100
1071 Ga0070658_10014788
1072 Ga0070658_10066708
1073 Ga0070676_10008061
1074 Ga0070676_10025909
1075 Ga0070683_100214243
1076 Ga0070670_100002371
1077 Ga0070670_100013676
1078 Ga0070677_10010142
1079 Ga0068869_100028039
1080 Ga0068869_100029359
1081 Ga0068869_100155521
1082 Ga0070666_10007027
1083 Ga0070666_10020818
1084 Ga0068868_100028335
1085 Ga0070660_100000011
1086 Ga0070660_100001582
1087 Ga0070689_100002194
1088 Ga0070689_100028264
1089 Ga0070689_100143446
1090 Ga0070687_100004523
1091 Ga0070687_100031771
1092 Ga0070661_100011088
1093 Ga0070668_100012511
1094 Ga0070668_100029711
1095 Ga0070669_100007114
1096 Ga0070669_100041553
1097 Ga0070675_100009300
1098 Ga0070675_100033951
1099 Ga0070675_100133441
1100 Ga0070671_100004493
1101 Ga0070671_100008194
1102 Ga0070671_100025982
1103 Ga0070671_100026508
1104 Ga0070671_100045731
1105 Ga0070674_100007285
1106 Ga0070674_100073043
1107 Ga0070674_100106398
1108 Ga0070674_100108965
1109 Ga0070673_100056654
1110 Ga0070673_100101450
1111 Ga0070673_100158745
1112 Ga0070673_100180477
1113 Ga0070688_100012818
1114 Ga0070688_100079715
1115 Ga0070659_100000046
1116 Ga0070667_100019267
1117 Ga0070667_100020656
1118 Ga0070667_100078148
1119 Ga0070714_100004759
1120 Ga0070714_100051982
1121 Ga0070713_100006956
1122 Ga0070710_10003340
1123 Ga0070701_10023487
1124 Ga0070701_10061407
1125 Ga0070663_100000063
1126 Ga0070663_100020753
1127 Ga0070663_100024576
1128 Ga0070678_100001468
1129 Ga0070678_100039647
1130 Ga0070678_100065415
1131 Ga0070678_100115189
1132 Ga0070662_100000746
1133 Ga0070662_100009332
1134 Ga0070662_100078865
1135 Ga0070698_100036419
1136 Ga0070699_100017573
1137 Ga0070684_100044662
1138 Ga0068853_100005112
1139 Ga0070672_100006518
1140 Ga0070672_100018830
1141 Ga0070672_100020435
1142 Ga0070672_100025433
1143 Ga0070672_100079324
1144 Ga0070693_100014050
1145 Ga0070665_100000715
1146 Ga0070665_100006096
1147 Ga0070665_100112820
1148 Ga0070704_100025051
1149 Ga0068855_100002337
1150 Ga0068855_100121702
1151 Ga0068855_100346575
1152 Ga0070664_100003047
1153 Ga0070664_100009550
1154 Ga0070664_100074450
1155 Ga0070664_100100451
1156 Ga0068857_100152426
1157 Ga0068854_100016430
1158 Ga0068854_100083566
1159 Ga0068856_100009139
1160 Ga0068856_100009908
1161 Ga0068852_100002152
1162 Ga0068852_100019337
1163 Ga0068852_100039576
1164 Ga0068852_100068611
1165 Ga0068864_100032982
1166 Ga0068864_100075934
1167 Ga0068864_100090244
1168 Ga0068866_10004439
1169 Ga0068866_10010910
1170 Ga0068861_100018587
1171 Ga0068861_100032883
1172 Ga0068861_100086577
1173 Ga0068861_100087847
1174 Ga0068861_100100634
1175 Ga0068851_10001542
1176 Ga0068870_10042174
1177 Ga0068858_100001923
1178 Ga0068858_100012170
1179 Ga0068858_100017127
1180 Ga0068858_100195118
1181 Ga0068860_100011768
1182 Ga0068862_100033244
1183 Ga0068862_100076669
1184 Ga0081455_10007349
1185 Ga0081455_10008446
1186 Ga0081455_10016840
1187 Ga0081540_1000011
1188 Ga0081540_1000932
1189 Ga0081540_1001375
1190 Ga0081540_1002628
1191 Ga0081540_1009312
1192 Ga0081540_1009802
1193 Ga0081539_10049554
1194 Ga0075365_10015050
1195 Ga0075365_10031674
1196 Ga0075363_100004654
1197 Ga0075364_10021037
1198 Ga0070715_10000314
1199 Ga0070716_100035162
1200 Ga0070712_100008300
1201 Ga0070712_100138649
1202 Ga0075362_10018308
1203 Ga0075367_10000301
1204 Ga0075367_10040951
1205 Ga0075369_10008318
1206 Ga0075366_10004913
1207 Ga0097621_100005267
1208 Ga0097621_100021189
1209 Ga0097621_100093557
1210 Ga0097621_100180423
1211 Ga0075370_10004812
1212 Ga0068871_100002503
1213 Ga0068871_100030886
1214 Ga0068871_100078521
1215 Ga0068871_100094424
1216 Ga0075428_100041134
1217 Ga0075428_100259648
1218 Ga0075431_100016231
1219 Ga0075434_100005496
1220 Ga0068865_100001375
1221 Ga0097620_100033007
1222 Ga0075435_100092043
1223 Ga0105251_10014435
1224 Ga0105244_10000463
1225 Ga0105244_10008315
1226 Ga0105244_10009037
1227 Ga0105244_10011256
1228 Ga0105244_10018744
1229 Ga0105244_10040872
1230 Ga0105250_10000576
1231 Ga0105250_10007842
1232 Ga0105250_10012127
1233 Ga0105250_10014914
1234 Ga0105240_10003198
1235 Ga0105240_10071203
1236 Ga0105240_10079980
1237 Ga0105240_10173091
1238 Ga0111539_10021105
1239 Ga0111539_10039118
1240 Ga0111539_10093225
1241 Ga0111539_10098484
1242 Ga0111539_10126402
1243 Ga0105245_10012324
1244 Ga0105247_10003510
1245 Ga0105247_10029599
1246 Ga0105247_10046641
1247 Ga0105247_10072988
1248 Ga0105243_10000005
1249 Ga0105243_10035027
1250 Ga0105243_10061306
1251 Ga0105241_10037240
1252 Ga0105242_10061429
1253 Ga0105248_10014105
1254 Ga0105248_10035717
1255 Ga0105248_10080920
1256 Ga0105248_10087675
1257 Ga0105248_10150160
1258 Ga0105248_10176337
1259 Ga0105237_10043348
1260 Ga0105237_10050436
1261 Ga0105237_10086939
1262 Ga0105238_10022419
1263 Ga0105238_10031814
1264 Ga0105238_10068114
1265 Ga0105249_10000952
1266 Ga0105249_10312787
1267 Ga0105239_10077815
1268 Ga0105239_10149056
1269 Ga0105246_10024178
1270 Ga0105246_10038504
1271 Ga0157373_10003228
1272 Ga0157373_10066474
1273 Ga0157371_10000696
1274 Ga0157371_10106758
1275 Ga0157370_10010102
1276 Ga0157370_10040989
1277 Ga0157369_10000160
1278 Ga0157369_10000167
1279 Ga0157369_10050032
1280 Ga0157369_10050632
1281 Ga0157369_10173649
1282 Ga0157374_10008421
1283 Ga0157374_10043887
1284 Ga0157374_10053750
1285 Ga0157374_10085470
1286 Ga0157374_10150532
1287 Ga0157374_10181080
1288 Ga0157378_10000006
1289 Ga0157378_10000929
1290 Ga0157378_10003059
1291 Ga0157378_10015977
1292 Ga0157378_10100671
1293 Ga0157378_10168699
1294 Ga0157378_10181533
1295 Ga0163162_10053703
1296 Ga0163162_10129813
1297 Ga0163162_10267793
1298 Ga0157372_10000931
1299 Ga0157372_10021605
1300 Ga0157375_10007776
1301 Ga0157375_10024721
1302 Ga0157375_10037005
1303 Ga0157375_10056716
1304 Ga0157375_10086062
1305 Ga0157375_10183998
1306 Ga0163163_10010328
1307 Ga0163163_10049500
1308 Ga0163163_10272976
1309 Ga0157380_10000708
1310 Ga0157380_10010229
1311 Ga0157380_10182467
1312 Ga0157379_10023570
1313 Ga0157379_10031044
1314 Ga0157379_10174907
1315 Ga0157379_10266093
1316 Ga0157376_10001401
1317 Ga0157376_10003679
1318 Ga0157376_10005025
1319 Ga0157376_10025276
1320 Ga0157376_10072615
1321 Ga0157376_10102932
1322 Ga0163161_10001835
1323 Ga0163161_10039990
1324 Ga0163161_10149538
1325 Ga0213872_10014095
1326 Ga0224712_10000153
1327 Ga0209566_100292
1328 Ga0209674_104908
1329 Ga0209672_100012
1330 Ga0209672_100134
1331 Ga0209147_100007
1332 Ga0209147_100047
1333 Ga0209147_100247
1334 Ga0209147_104188
1335 Ga0209258_100014
1336 Ga0209258_100065
1337 Ga0209148_1000091
1338 Ga0209148_1000700
1339 Ga0209565_1010906
1340 Ga0209455_1000074
1341 Ga0209455_1000713
1342 Ga0209673_1000137
1343 Ga0209130_1000633
1344 Ga0209130_1002051
1345 Ga0209130_1006301
1346 Ga0209025_1000262
1347 Ga0209025_1000355
1348 Ga0209025_1001564
1349 Ga0209025_1002190
1350 Ga0209025_1002944
1351 Ga0209025_1003509
1352 Ga0209025_1006327
1353 Ga0209025_1008110
1354 Ga0209025_1012470
1355 Ga0209564_1003482
1356 Ga0207697_10005006
1357 Ga0207656_10015039
1358 Ga0207696_1003906
1359 Ga0207696_1006313
1360 Ga0207696_1010394
1361 Ga0207696_1012587
1362 Ga0207655_1000490
1363 Ga0207655_1001499
1364 Ga0207655_1001848
1365 Ga0207682_10000929
1366 Ga0207682_10004587
1367 Ga0207682_10028066
1368 Ga0207692_10004478
1369 Ga0207692_10061453
1370 Ga0207642_10033433
1371 Ga0207710_10003111
1372 Ga0207710_10009354
1373 Ga0207688_10002701
1374 Ga0207688_10117742
1375 Ga0207680_10066116
1376 Ga0207647_10000307
1377 Ga0207647_10001758
1378 Ga0207645_10018143
1379 Ga0207645_10024691
1380 Ga0207645_10031441
1381 Ga0207645_10043834
1382 Ga0207654_10023813
1383 Ga0207654_10087643
1384 Ga0207695_10002574
1385 Ga0207695_10022714
1386 Ga0207695_10039972
1387 Ga0207695_10175799
1388 Ga0207671_10019603
1389 Ga0207671_10051677
1390 Ga0207671_10123002
1391 Ga0207693_10001595
1392 Ga0207663_10000670
1393 Ga0207663_10043162
1394 Ga0207662_10030030
1395 Ga0207657_10000019
1396 Ga0207657_10000822
1397 Ga0207657_10057864
1398 Ga0207649_10097106
1399 Ga0207681_10013076
1400 Ga0207681_10029477
1401 Ga0207694_10020737
1402 Ga0207650_10001257
1403 Ga0207650_10010191
1404 Ga0207650_10069125
1405 Ga0207650_10181531
1406 Ga0207659_10006611
1407 Ga0207659_10008627
1408 Ga0207659_10032366
1409 Ga0207659_10144787
1410 Ga0207664_10004159
1411 Ga0207644_10005044
1412 Ga0207644_10005122
1413 Ga0207644_10023664
1414 Ga0207690_10000028
1415 Ga0207690_10001482
1416 Ga0207690_10121264
1417 Ga0207706_10000149
1418 Ga0207706_10006213
1419 Ga0207706_10042515
1420 Ga0207709_10000001
1421 Ga0207709_10007384
1422 Ga0207670_10002972
1423 Ga0207670_10114932
1424 Ga0207669_10001807
1425 Ga0207704_10026918
1426 Ga0207704_10030902
1427 Ga0207704_10049354
1428 Ga0207704_10051396
1429 Ga0207665_10000118
1430 Ga0207665_10058629
1431 Ga0207691_10005529
1432 Ga0207691_10007024
1433 Ga0207691_10014808
1434 Ga0207691_10025496
1435 Ga0207691_10027233
1436 Ga0207691_10030314
1437 Ga0207691_10038446
1438 Ga0207711_10041445
1439 Ga0207711_10068819
1440 Ga0207711_10069973
1441 Ga0207711_10073938
1442 Ga0207711_10078051
1443 Ga0207711_10232906
1444 Ga0207689_10008518
1445 Ga0207689_10021652
1446 Ga0207689_10038440
1447 Ga0207689_10063960
1448 Ga0207689_10067334
1449 Ga0207689_10108444
1450 Ga0207661_10033311
1451 Ga0207679_10079666
1452 Ga0207679_10201503
1453 Ga0207667_10001720
1454 Ga0207651_10029172
1455 Ga0207651_10065813
1456 Ga0207651_10079438
1457 Ga0207651_10149346
1458 Ga0207712_10001054
1459 Ga0207712_10010727
1460 Ga0207712_10039929
1461 Ga0207668_10026139
1462 Ga0207668_10051733
1463 Ga0207640_10049343
1464 Ga0207640_10079523
1465 Ga0207658_10091363
1466 Ga0207703_10000734
1467 Ga0207703_10012138
1468 Ga0207703_10016348
1469 Ga0207639_10004603
1470 Ga0207639_10166937
1471 Ga0207678_10012380
1472 Ga0207678_10019882
1473 Ga0207678_10025991
1474 Ga0207678_10041934
1475 Ga0207678_10047488
1476 Ga0207678_10060815
1477 Ga0207678_10098169
1478 Ga0207708_10005532
1479 Ga0207702_10049715
1480 Ga0207641_10074605
1481 Ga0207641_10098344
1482 Ga0207648_10006787
1483 Ga0207648_10008866
1484 Ga0207648_10018499
1485 Ga0207648_10119001
1486 Ga0207676_10010141
1487 Ga0207676_10016706
1488 Ga0207676_10040883
1489 Ga0207676_10047491
1490 Ga0207676_10126331
1491 Ga0207676_10132310
1492 Ga0207674_10022409
1493 Ga0207675_100016302
1494 Ga0207675_100026250
1495 Ga0207675_100034620
1496 Ga0207675_100052537
1497 Ga0207675_100062914
1498 Ga0207675_100111298
1499 Ga0207683_10001414
1500 Ga0207683_10005185
1501 Ga0207683_10038670
1502 Ga0207683_10051111
1503 Ga0207683_10100027
1504 Ga0207683_10144977
1505 Ga0207698_10003500
1506 Ga0207698_10055081
1507 Ga0207698_10158998
1508 Ga0207698_10221356
1509 Ga0207698_10264137
1510 Ga0209371_1000006
1511 Ga0209371_1000113
1512 Ga0268266_10000006
1513 Ga0268266_10000807
1514 Ga0268266_10016489
1515 Ga0268266_10025228
1516 Ga0268266_10172553
1517 Ga0268265_10007492
1518 Ga0268265_10047733
1519 Ga0268264_10113588
1520 Ga0307515_10004656
1521 Ga0237817_10031
1522 Ga0268256_1000007
1523 Ga0268256_1000575
1524 Ga0265327_10001312
1525 Ga0265327_10015647
1526 Ga0307509_10035086
1527 Ga0307509_10038464
1528 Ga0265314_10026985
1529 Ga0265342_10017660
1530 Ga0307516_10000678
1531 Ga0307516_10022231
1532 Ga0307516_10040714
1533 Ga0307415_100045575
1534 Ga0307510_10001063
1535 Ga0307510_10046375
1536 Ga0373923_0024380
1537 Ga0373945_0006415
1538 Ga0373953_0001434
1539 Ga0373954_0000261
1540 Ga0373954_0006034
1541 Ga0373954_0010774
1542 Ga0373943_0048798
1543 Ga0373943_0061380
1544 Ga0373946_0028153
1545 Ga0373955_0000455
1546 Ga0373955_0003182
1547 Ga0373962_0014177
1548 Ga0373924_0000696
1549 Ga0373931_0018884
1550 Ga0373931_0034017
1551 Ga0373935_0005538
1552 Ga0373935_0019087
1553 Ga0373935_0128888
1554 Ga0373927_0001649
1555 Ga0373927_0011264
1556 Ga0373927_0091523
1557 Ga0373933_0000346
1558 Ga0373933_0026643
1559 Ga0373933_0032878
1560 Ga0373933_0053088
1561 Ga0373933_0056528
1562 Ga0373933_0069336
1563 Ga0373937_0005546
1564 Ga0373937_0006983
1565 Ga0373937_0009266
1566 Ga0373937_0046347
1567 Ga0373937_0145678
1568 Ga0373925_0001973
1569 Ga0395900_0000053
1570 Ga0395900_0042134
1571 Ga0395900_0060066
1572 Ga0395898_0000264
1573 Ga0395898_0070973
1574 Ga0395905_0006009
1575 Ga0395905_0012988
1576 Ga0395901_0000009
1577 Ga0395901_0000012
1578 Ga0395901_0026845
1579 Ga0237819_00044
1580 Ga0237819_00450
1581 Ga0436365_1076449
1582 Ga0451802_1782641
1583 Ga0466969_0000241
1584 Ga0466973_0045270
1585 Ga0466965_0000127
1586 Ga0466966_0000011
1587 Ga0466966_0023588
1588 Ga0466966_0026486
1589 Ga0466961_0000276
1590 Ga0466963_0000544
1591 Ga0466963_0042537
1592 Ga0466971_0000258
1593 Ga0466971_0003962
1594 Ga0466970_0017943
1595 Ga0466957_0034805
1596 Ga0466959_0005449
1597 Ga0466967_0000507
1598 Ga0495617_000786
1599 Ga0495617_038301
1600 Ga0495592_0003017
1601 Ga0495592_0027851
1602 Ga0495592_0035111
1603 Ga0495592_0124608
1604 Ga0495603_0001827
1605 Ga0495603_0083193
1606 Ga0495603_0093291
1607 Ga0495590_0015226
1608 Ga0495629_0001739
1609 Ga0495629_0003254
1610 Ga0495629_0018005
1611 Ga0495629_0019328
1612 Ga0495629_0028486
1613 Ga0495629_0066080
1614 Ga0495629_0119991
1615 Ga0495638_0003236
1616 Ga0495638_0005422
1617 Ga0495641_0005678
1618 Ga0495641_0037573
1619 Ga0495641_0055373
1620 Ga0495651_0001035
1621 Ga0495651_0001967
1622 Ga0495651_0002281
1623 Ga0495651_0003244
1624 Ga0495653_0000572
1625 Ga0495653_0004181
1626 Ga0495653_0005788
1627 Ga0495653_0006075
1628 Ga0495653_0055871
1629 Ga0495580_0008936
1630 Ga0495582_0000547
1631 Ga0495582_0004697
1632 Ga0495582_0025453
1633 Ga0495605_0007350
1634 Ga0495605_0007406
1635 Ga0495605_0017187
1636 Ga0495605_0029720
1637 Ga0495639_0000163
1638 Ga0495639_0054063
1639 Ga0495662_0000616
1640 Ga0495584_0000021
1641 Ga0495584_0000271
1642 Ga0495584_0009051
1643 Ga0495584_0022170
1644 Ga0495585_0000005
1645 Ga0495585_0000049
1646 Ga0495585_0000465
1647 Ga0495585_0002705
1648 Ga0495585_0005101
1649 Ga0495585_0014514
1650 Ga0495585_0018531
1651 Ga0495585_0018739
1652 Ga0495585_0020644
1653 Ga0495585_0082519
1654 Ga0495594_0001043
1655 Ga0495594_0011288
1656 Ga0495594_0056524
1657 Ga0495596_0001506
1658 Ga0495596_0001991
1659 Ga0495596_0012053
1660 Ga0495607_0015069
1661 Ga0495607_0028747
1662 Ga0495607_0032042
1663 Ga0495583_0000697
1664 Ga0495583_0015713
1665 Ga0495606_0025201
1666 Ga0495606_0066905
1667 Ga0495608_0003175
1668 Ga0495608_0006286
1669 Ga0495608_0076226
1670 Ga0495616_0000280
1671 Ga0495616_0003309
1672 Ga0495616_0018617
1673 Ga0495616_0043097
1674 Ga0495620_0015317
1675 Ga0495628_0019843
1676 Ga0495628_0174465
1677 Ga0495630_0028859
1678 Ga0495630_0033608
1679 Ga0495630_0179541
1680 Ga0495631_0010085
1681 Ga0495632_0000098
1682 Ga0495632_0000143
1683 Ga0495632_0000153
1684 Ga0495643_0054146
1685 Ga0495644_0007890
1686 Ga0495644_0011526
1687 Ga0495648_0000033
1688 Ga0495663_0007011
1689 Ga0495663_0009985
1690 Ga0495666_0046786
1691 Ga0495642_0000236
1692 Ga0495642_0002915
1693 Ga0495642_0005608
1694 Ga0495642_0010476
1695 Ga0495652_0005447
1696 Ga0495652_0017982
1697 Ga0495652_0022047
1698 Ga0495652_0143898
1699 Ga0495654_0013039
1700 Ga0495654_0046828
1701 Ga0495665_0003016
1702 Ga0495640_0014858
1703 Ga0495586_0014286
1704 Ga0495586_0075469
1705 Ga0495587_0001243
1706 Ga0495587_0001343
1707 Ga0495587_0012337
1708 Ga0495587_0030037
1709 Ga0495609_0007139
1710 Ga0495609_0008775
1711 Ga0495609_0038585
1712 Ga0495621_0056724
1713 Ga0495645_0057061
1714 Ga0495622_0003321
1715 Ga0495633_0002449
1716 Ga0495633_0002561
1717 Ga0495633_0006093
1718 Ga0495633_0021652
1719 Ga0495667_0000593
1720 Ga0495667_0002429
1721 Ga0495667_0012388
1722 Ga0495667_0033062
1723 Ga0495656_0000474
1724 Ga0495656_0013343
1725 Ga0495668_0001839
1726 Ga0495668_0006812
1727 Ga0495668_0012306
1728 Ga0495668_0015405
1729 Ga0495668_0024779
1730 Ga0495668_0025241
1731 Ga0495668_0033278
1732 Ga0495668_0057661
1733 Ga0495634_0007414
1734 Ga0495634_0022347
1735 Ga0495611_0004328
1736 Ga0495625_0000897
1737 Ga0495625_0004030
1738 Ga0495625_0027780
1739 Ga0495635_0000241
1740 Ga0495635_0002402
1741 Ga0495635_0006833
1742 Ga0495635_0008016
1743 Ga0495635_0016174
1744 Ga0495659_0000129
1745 Ga0495661_0001219
1746 Ga0495661_0002280
1747 Ga0495661_0014885
1748 Ga0495588_0002151
1749 Ga0495588_0024316
1750 Ga0495588_0027592
1751 Ga0495657_0000637
1752 Ga0495657_0001501
1753 Ga0495657_0003700
1754 Ga0495657_0024543
1755 Ga0495657_0108067
1756 Ga0495599_0000148
1757 Ga0495599_0002232
1758 Ga0495599_0012230
1759 Ga0495623_0005748
1760 Ga0495623_0013967
1761 Ga0495623_0017622
1762 Ga0495623_0026067
1763 Ga0495623_0045795
1764 Ga0495646_0025543
1765 Ga0495646_0070046
1766 Ga0495647_0004539
1767 Ga0495647_0038287
1768 Ga0495658_0004596
1769 Ga0495658_0059342
1770 Ga0495658_0107492
1771 Ga0495658_0139228
1772 Ga0495658_0152381
1773 Ga0495669_0000190
1774 Ga0495669_0000986
1775 Ga0495669_0002903
1776 Ga0495669_0007359
1777 Ga0495613_0004558
1778 Ga0495624_0003121
1779 Ga0495670_0000693
1780 Ga0495670_0001566
1781 Ga0495671_0000053
1782 Ga0495671_0000792
1783 Ga0495671_0029998
1784 Ga0495649_0004954
1785 Ga0495649_0035256
1786 Ga0495589_0013026
1787 Ga0495589_0014310
1788 Ga0495600_0000157
1789 Ga0495600_0001685
1790 Ga0495600_0003815
1791 Ga0495600_0120189
1792 Ga0495660_0000479
1793 Ga0495660_0052736
1794 Ga0495581_0000979
1795 Ga0495581_0014601
1796 Ga0495581_0040994
1797 Ga0495604_0002433
1798 Ga0495604_0003832
1799 Ga0495604_0008415
1800 Ga0495604_0008510
1801 Ga0495674_0003964
1802 Ga0495674_0005950
1803 Ga0495674_0016830
1804 Ga0495674_0123862
1805 Ga0495672_0000502
1806 Ga0495672_0053993
1807 Ga0495676_0000177
1808 Ga0495676_0094530
1809 Ga0495680_0002928
1810 Ga0495680_0006343
1811 Ga0495680_0007799
1812 Ga0495680_0008955
1813 Ga0495680_0021389
1814 Ga0495680_0113335
1815 Ga0495680_0172873
1816 Ga0495683_0000072
1817 Ga0495683_0039055
1818 Ga0495687_007756
1819 Ga0495675_0001960
1820 Ga0495675_0002204
1821 Ga0495675_0003158
1822 Ga0495675_0004738
1823 Ga0495675_0112382
1824 Ga0495677_0009205
1825 Ga0495677_0017380
1826 Ga0495685_052390
1827 Ga0495681_0001730
1828 Ga0495681_0001973
1829 Ga0495681_0004982
1830 Ga0495681_0007555
1831 Ga0495684_0001447
1832 Ga0495684_0001837
1833 Ga0495684_0003840
1834 Ga0495684_0004907
1835 Ga0495684_0015191
1836 Ga0495684_0033399
1837 Ga0495684_0248960
1838 Ga0495593_0006169
1839 Ga0495593_0006375
1840 Ga0495593_0008803
1841 Ga0495593_0015923
1842 Ga0495593_0030204
1843 Ga0495602_0007101
1844 Ga0495602_0007959
1845 Ga0495602_0015932
1846 Ga0495602_0016383
1847 Ga0495602_0122525
1848 Ga0495614_0007477
1849 Ga0495614_0015948
1850 Ga0495614_0066186
1851 Ga0495614_0072546
1852 Ga0495614_0075099
1853 Ga0495626_0067233
1854 Ga0496100_0044951
1855 Ga0496100_0059858
1856 Ga0496100_0212940
1857 Ga0496101_0001981
1858 Ga0496101_0073470
1859 Ga0496101_0085784
1860 Ga0496101_0148389
1861 Ga0496101_0162624
1862 Ga0496101_0193795
1863 Ga0496102_0000290
1864 Ga0496102_0015866
1865 Ga0496102_0046839
1866 Ga0496102_0065436
1867 Ga0496102_0096302
1868 Ga0496102_0135455
1869 Ga0496103_0001884
1870 Ga0496103_0032964
1871 Ga0496103_0079475
1872 Ga0496104_0002774
1873 Ga0496104_0044290
1874 Ga0496104_0060879
1875 Ga0496104_0156987
1876 Ga0496104_0157211
1877 Ga0496104_0241900
1878 Ga0496105_0006708
1879 Ga0496105_0024487
1880 Ga0496105_0026618
1881 Ga0496105_0115445
1882 Ga0496105_0241480
1883 Ga0496106_0004649
1884 Ga0496106_0014892
1885 Ga0496106_0112976
1886 Ga0496106_0211283
1887 Ga0496107_0018337
1888 Ga0496108_0001200
1889 Ga0496108_0002055
1890 Ga0496108_0040264
1891 Ga0496108_0127121
1892 Ga0496109_0002191
1893 Ga0496109_0003922
1894 Ga0496109_0112286
1895 Ga0496109_0128766
1896 Ga0496109_0196390
1897 Ga0496110_0006543
1898 Ga0496110_0008434
1899 Ga0496110_0013698
1900 Ga0496110_0019705
1901 Ga0496110_0106931
1902 Ga0496110_0209337
1903 Ga0496110_0234606
1904 Ga0496111_0005231
1905 Ga0496111_0029693
1906 Ga0496112_0007549
1907 Ga0496112_0017894
1908 Ga0496112_0042466
1909 Ga0496112_0052188
1910 Ga0496112_0070600
1911 Ga0496113_0006427
1912 Ga0496113_0009206
1913 Ga0496113_0013367
1914 Ga0496113_0018802
1915 Ga0496113_0032510
1916 Ga0496113_0056591
1917 Ga0496114_0004557
1918 Ga0496114_0119002
1919 Ga0496115_0016923
1920 Ga0496115_0030394
1921 Ga0496115_0031522
1922 Ga0496115_0180606
1923 Ga0496116_0005939
1924 Ga0496119_0080276
1925 Ga0496121_0020595
1926 Ga0496121_0031111
1927 Ga0496121_0037452
1928 Ga0496125_0055788
1929 Ga0496125_0089314
1930 Ga0496126_0025817
1931 Ga0496126_0095503
1932 Ga0496126_0212174
1933 Ga0495678_000638
1934 Ga0495682_0007467
1935 Ga0501033_0058513
1936 Ga0501034_0038492
1937 Ga0501034_0113831
1938 Ga0501034_0185232
1939 Ga0501037_0059761
1940 Ga0501038_0086191
1941 Ga0501046_0003374
1942 Ga0501047_0102572
1943 Ga0501072_0051791
1944 Ga0501217_005273
1945 Ga0501079_0040966
1946 nmdc:mga03n38_7752_c1
1947 nmdc:mga00v17_14590_c2
1948 nmdc:mga00v17_19839_c1
1949 nmdc:mga0yw44_15454_c1
1950 nmdc:mga0yw44_81299_c1
1951 nmdc:mga0k408_31326_c1
1952 nmdc:mga0k408_44407_c1
1953 nmdc:mga05p37_2263_c1
1954 nmdc:mga08y16_22844_c1
1955 nmdc:mga08y16_280643_c1
1956 nmdc:mga08y16_30816_c1
1957 nmdc:mga08y16_80679_c1
1958 nmdc:mga08y16_89123_c1
1959 nmdc:mga0n895_31943_c1
1960 nmdc:mga0n895_473942_c1
1961 nmdc:mga0a205_54053_c1
1962 nmdc:mga0sz30_52057_c1
1963 Ga0495601_0007085
1964 Ga0495601_0010230
1965 Ga0495601_0022445
1966 Ga0495612_0001392
1967 Ga0495612_0014040
1968 Ga0500635_0001121
1969 Ga0495595_0000325
1970 Ga0495595_0001287
1971 Ga0495595_0003596
1972 Ga0495595_0008358
1973 Ga0495595_0022337
1974 Ga0495595_0066267
1975 Ga0495619_0000517
1976 Ga0495619_0000698
1977 Ga0495619_0000906
1978 Ga0495619_0002729
1979 Ga0495619_0004330
1980 Ga0495619_0018396
1981 Ga0495619_0023260
1982 Ga0495619_0030068
1983 Ga0500595_011310
1984 Ga0500658_0035070
1985 Ga0500637_0011579
1986 Ga0466962_0005345
1987 Ga0530510_0007515
1988 2512037813
1989 2513591604
1990 2519460614
1991 2524535119
1992 2545555820
1993 2552749290
1994 2578929237
1995 2585293098
1996 2599736257
1997 2599746149
1998 2600208017
1999 2631983026
2000 2640734241
2001 2644249876
2002 2644358541
2003 2644362428
2004 2644704630
2005 2644709324
2006 2651533146
2007 2674419426
2008 2676743740
2009 2678231217
2010 2685150121
2011 2695627686
2012 2698323141
2013 2705994095
2014 2717916517
2015 2721505423
2016 2728753168
2017 2738739475
2018 2738815211
2019 2738846048
2020 2739157934
2021 2739210620
2022 2739269069
2023 2739275799
2024 2739344843
2025 2745161341
2026 2774388223
2027 2774437431
2028 2793083827
2029 2808970582
2030 2809005311
2031 2809012288
2032 2817257602
2033 2817281995
2034 2817451545
2035 2819578796
2036 2819634099
2037 2857583775
2038 2857606615
2039 2858689639
2040 2863423908
2041 2870073949
2042 2877770529
2043 2880171514
2044 2885381802
2045 2885414966
2046 2897809570
2047 2904568478
2048 2904575521
2049 2916699725
2050 2919184148
2051 2919418954
2052 2928160859
2053 2928170480
2054 2928171305
2055 2928516581
2056 2928536343
2057 2936363460
2058 2938919505
2059 2947428876
2060 2965763369
2061 2969142984
2062 2971895296
2063 2979085823
2064 2981991492
2065 2984570288
2066 3001895494
2067 3001898723
2068 3006883344
2069 3006974296
2070 642418927
2071 8006936540
2072 8006976506
2073 8006991366
2074 8018849413
2075 8020808572
2076 8020938516
2077 8020946241
2078 8020954930
2079 8021123466
2080 8022625676
2081 8022631139
2082 8022798574
2083 8022798576
2084 8022949405
2085 8023444113
2086 8023449704
2087 8039103311
2088 8040168317
2089 8040175895
2090 8054284710
2091 8057584914
2092 8057584916

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10396

TrmE_N

GTP-binding protein TrmE N-terminus

21

122

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qha-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.4913 7 458
7qha-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.4741 7 458
4f35-assembly2.cif.gz_B crystal structure of a bacterial dicarboxylate/sodium symporter 0.4712 2 460
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.4694 28 464
4r0c-assembly1.cif.gz_D crystal structure of the alcanivorax borkumensis ydah transporter reveals an unusual topology 0.4647 52 464
ID Description Score Start End Superfamily
af_I6YCG9_3_406_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.5262 4 453 1.20.1530.20
af_I6YCG9_3_406_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.5226 4 453 1.20.1530.20
af_Q59SR3_303_495_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3441 319 464 1.20.1250.20
af_Q03455_384_584_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.3079 94 313 1.20.1510.10
af_Q03455_384_584_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.2981 94 313 1.20.1510.10
ID Description Score Start End GO Terms
AF-A0A0H3CMZ5-F1-model_v4 Citrate transporter 0.9912 1 466 GO:0005886
GO:0015128
AF-A0A443XGG5-F1-model_v4 deleted 0.9903 1 466
AF-A0A0H3CMZ5-F1-model_v4 Citrate transporter 0.9891 1 466 GO:0005886
GO:0015128
AF-A0A443XGG5-F1-model_v4 deleted 0.9882 1 466
AF-A0A6N4U2X1-F1-model_v4 deleted 0.984 1 334

Map