F489026

General Info

Members Datasets Scaffolds Average Seq Length
1049 408 1046 322

Family's Representative Sequence

Representative Sequence 3300025934|Ga0207686_10017202|Ga0207686_100172024
Length 355
Sequence MAVNSLQTSHRSRVAANFFISTNPPVGEIVNGSCPTHPSAESAFCLLFPAWQASAQTYPSHTVRIIVPFGAGGPADTAARVLAQHLSETLKQSFIVENRPGAGSIIGTSEAAKAAPDGYTLLVMSDTHTTNESLMPNKPYQLMRDFVAVAPINYTDLMLVVTPSLAAKNLREFIALAKQNPGKFSYASSGQGTAYHMAAELFKAKSGTDIVHVPHRAAGEMRSSVMGGHVQVMFDAISISAPNVLGGKLTALGVTGGARSPILPDVPTMGEAGLSGFETAGIWGGVVAPAGTPKEIVNLLNIEINKIIAKPEVREGWATQGAVPMVMTVSEFDAMLRKDIQERTELVRTSGLKPQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
4 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
5 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
6 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
7 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
8 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
9 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
10 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
11 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
12 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
13 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
14 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
15 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
16 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
17 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
18 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
19 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
20 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
21 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
22 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
23 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
24 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
25 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
27 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
31 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
44 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
45 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
50 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
51 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
52 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
53 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
54 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
55 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
56 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
57 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
58 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
59 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
60 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
61 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
62 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
63 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
64 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
65 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
66 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
67 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
68 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
71 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
72 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
73 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
74 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
75 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
76 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
77 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
86 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
87 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
88 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
89 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
90 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
91 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
92 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
93 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
94 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
95 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
96 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
97 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
98 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
99 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
100 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
101 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
102 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
103 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
104 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
105 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
106 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
107 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
108 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
110 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
111 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
112 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
113 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
114 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
115 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
116 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
117 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
118 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
119 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
121 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
122 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
123 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
124 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
125 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
126 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
128 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
129 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
131 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
132 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
133 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
134 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
135 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
136 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
137 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
138 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
139 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
140 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
141 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
142 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
143 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
144 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
145 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
146 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
147 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
148 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
149 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
150 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
151 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
152 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
153 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
154 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
155 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
156 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
157 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
159 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
230 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
234 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
235 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
236 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
237 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
238 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
239 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
240 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
241 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
242 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
243 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
244 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
245 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
246 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
247 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
248 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
249 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
250 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
251 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
252 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
253 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
254 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
255 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
256 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
257 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
258 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
259 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
260 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
261 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
262 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
263 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
264 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
265 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
266 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
267 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
268 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
269 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
270 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
271 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
272 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
273 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
274 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
275 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
276 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
277 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
278 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
279 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
280 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
281 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
282 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
283 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
284 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
285 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
286 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
287 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
288 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
289 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
290 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
291 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
292 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
293 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
294 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
295 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
296 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
297 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
298 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
299 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
300 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
301 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
302 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
303 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
304 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
305 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
306 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
307 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
308 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
309 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
310 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
311 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
312 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
313 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
314 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
315 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
316 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
317 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
318 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
319 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
320 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
321 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
322 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
323 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
324 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
325 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
326 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
327 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
328 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
329 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
330 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
331 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
332 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
333 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
334 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
335 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
336 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
337 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
338 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
339 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
340 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
341 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
342 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
343 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
344 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
345 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
346 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
347 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
348 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
349 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
350 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
351 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
352 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
353 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
354 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
355 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
356 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
357 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
358 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
359 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
360 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
361 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
362 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
363 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
364 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
375 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
376 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
377 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
378 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
379 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
380 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
381 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
382 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
383 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
384 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
385 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
386 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
387 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
388 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
389 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
390 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
391 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
392 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
393 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
394 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
395 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
396 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
397 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
398 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
399 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
400 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
401 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
402 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
403 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
404 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
405 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
406 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
407 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
408 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.48
Nodule 0
Rhizoplane 8.48
Rhizosphere 87.89
Stem 0
Stem Tuber 0
Unclassified 1.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2195022 2162886007 Bacteria 1205
2 2214745199 2209111006 Bacteria 16432
3 ARcpr5oldR_c000024 3300000041 Bacteria 31707
4 ARSoilYngRDRAFT_c00084 3300000042 Bacteria 15691
5 ARcpr5yngRDRAFT_c000226 3300000043 Bacteria 8500
6 ARSoilOldRDRAFT_c000027 3300000044 Bacteria 33288
7 ARCol0oldRDRAFT_c00301 3300000045 Bacteria 4791
8 ARCol0yngRDRAFT_1000016 3300000652 Bacteria 31710
9 JGI24032J14994_100052 3300001430 Bacteria 4643
10 JGI24736J21556_1013491 3300001904 Bacteria 1319
11 JGI24747J21853_1000417 3300001978 Bacteria 2585
12 JGI24740J21852_10017965 3300001979 Bacteria 2519
13 JGI24739J22299_10000472 3300001989 Bacteria 14168
14 JGI24737J22298_10000645 3300001990 Bacteria 12317
15 JGI24737J22298_10012061 3300001990 Bacteria 2821
16 JGI24743J22301_10005214 3300001991 Bacteria 2160
17 JGI24743J22301_10022695 3300001991 Bacteria 1205
18 JGI24750J21931_1000292 3300002070 Bacteria 8588
19 JGI24750J21931_1002828 3300002070 Bacteria 2084
20 JGI24745J21846_1000564 3300002073 Bacteria 3318
21 JGI24748J21848_1000222 3300002074 Bacteria 6971
22 JGI24749J21850_1000285 3300002076 Bacteria 7764
23 JGI24749J21850_1001196 3300002076 Bacteria 3690
24 JGI24744J21845_10007239 3300002077 Bacteria 2293
25 JGI24742J22300_10000119 3300002244 Bacteria 11288
26 JGI24751J29686_10003797 3300002459 Bacteria 3047
27 JGI25406J46586_10004753 3300003203 Bacteria 6315
28 JGI25406J46586_10037191 3300003203 Bacteria 1758
29 Ga0055526_1000027 3300003771 Bacteria 150957
30 JGI25405J52794_10005552 3300003911 Bacteria 2277
31 Ga0065716_1002390 3300005277 Bacteria 1842
32 Ga0065704_10009680 3300005289 Bacteria 2404
33 Ga0065712_10001193 3300005290 Bacteria 8161
34 Ga0065712_10092882 3300005290 Unclassified 2314
35 Ga0065715_10000313 3300005293 Bacteria 16626
36 Ga0065715_10005544 3300005293 Bacteria 8025
37 Ga0065715_10125061 3300005293 Unclassified 2139
38 Ga0070676_10001294 3300005328 Bacteria 12586
39 Ga0070676_10070817 3300005328 Bacteria 2093
40 Ga0070676_10113661 3300005328 Bacteria 1690
41 Ga0070683_100000384 3300005329 Bacteria 30732
42 Ga0070690_100017855 3300005330 Bacteria 4276
43 Ga0070690_100031974 3300005330 Bacteria 3282
44 Ga0070670_100006373 3300005331 Bacteria 9987
45 Ga0070670_100046837 3300005331 Bacteria 3719
46 Ga0070670_100069446 3300005331 Bacteria 3024
47 Ga0070670_100104882 3300005331 Bacteria 2435
48 Ga0070677_10000366 3300005333 Bacteria 15873
49 Ga0068869_100000588 3300005334 Bacteria 20402
50 Ga0068869_100099356 3300005334 Bacteria 2199
51 Ga0068869_100185037 3300005334 Bacteria 1635
52 Ga0070666_10046494 3300005335 Bacteria 2911
53 Ga0070666_10181614 3300005335 Bacteria 1476
54 Ga0070680_100003315 3300005336 Bacteria 12017
55 Ga0070680_100017912 3300005336 Bacteria 5591
56 Ga0070680_100212059 3300005336 Bacteria 1634
57 Ga0070680_100213375 3300005336 Bacteria 1629
58 Ga0070680_100313385 3300005336 Bacteria 1331
59 Ga0070682_100001303 3300005337 Bacteria 14122
60 Ga0070682_100011027 3300005337 Bacteria 5153
61 Ga0070682_100157117 3300005337 Bacteria 1567
62 Ga0068868_100007694 3300005338 Bacteria 7684
63 Ga0068868_100010823 3300005338 Bacteria 6617
64 Ga0068868_100031315 3300005338 Bacteria 4086
65 Ga0068868_100051465 3300005338 Bacteria 3240
66 Ga0070660_100006474 3300005339 Bacteria 8119
67 Ga0070660_100113131 3300005339 Bacteria 2161
68 Ga0070660_100170733 3300005339 Bacteria 1756
69 Ga0070689_100001250 3300005340 Bacteria 16191
70 Ga0070689_100022333 3300005340 Bacteria 4724
71 Ga0070689_100056025 3300005340 Bacteria 3056
72 Ga0070689_100108293 3300005340 Bacteria 2207
73 Ga0070691_10000616 3300005341 Bacteria 13699
74 Ga0070691_10028317 3300005341 Bacteria 2616
75 Ga0070691_10080735 3300005341 Bacteria 1592
76 Ga0070687_100002805 3300005343 Bacteria 6639
77 Ga0070687_100022541 3300005343 Bacteria 2979
78 Ga0070687_100161850 3300005343 Unclassified 1324
79 Ga0070661_100001627 3300005344 Bacteria 15545
80 Ga0070661_100034366 3300005344 Bacteria 3676
81 Ga0070661_100082007 3300005344 Bacteria 2382
82 Ga0070692_10000719 3300005345 Bacteria 10720
83 Ga0070692_10078659 3300005345 Unclassified 1771
84 Ga0070668_100001772 3300005347 Bacteria 15701
85 Ga0070668_100007916 3300005347 Bacteria 7891
86 Ga0070668_100126854 3300005347 Bacteria 2044
87 Ga0070669_100002584 3300005353 Bacteria 13089
88 Ga0070669_100008715 3300005353 Bacteria 7236
89 Ga0070675_100009313 3300005354 Bacteria 7636
90 Ga0070675_100013013 3300005354 Bacteria 6533
91 Ga0070675_100089854 3300005354 Bacteria 2572
92 Ga0070675_100193666 3300005354 Bacteria 1762
93 Ga0070671_100003610 3300005355 Bacteria 12107
94 Ga0070674_100000598 3300005356 Bacteria 18253
95 Ga0070674_100107301 3300005356 Bacteria 2044
96 Ga0070673_100000255 3300005364 Bacteria 27161
97 Ga0070673_100011342 3300005364 Bacteria 6080
98 Ga0070673_100011912 3300005364 Bacteria 5956
99 Ga0070673_100026950 3300005364 Bacteria 4254
100 Ga0070688_100005214 3300005365 Bacteria 6823
101 Ga0070688_100057375 3300005365 Bacteria 2447
102 Ga0070659_100005703 3300005366 Bacteria 8962
103 Ga0070667_100003947 3300005367 Bacteria 12593
104 Ga0070667_100052781 3300005367 Bacteria 3431
105 Ga0070667_100088218 3300005367 Bacteria 2663
106 Ga0070667_100300005 3300005367 Bacteria 1446
107 Ga0070709_10014657 3300005434 Bacteria 4437
108 Ga0070709_10015858 3300005434 Bacteria 4290
109 Ga0070709_10081081 3300005434 Bacteria 2117
110 Ga0070714_100014498 3300005435 Bacteria 6332
111 Ga0070714_100029784 3300005435 Bacteria 4540
112 Ga0070714_100067295 3300005435 Bacteria 3087
113 Ga0070713_100002318 3300005436 Bacteria 12400
114 Ga0070713_100003244 3300005436 Bacteria 10726
115 Ga0070713_100067968 3300005436 Bacteria 3002
116 Ga0070713_100276308 3300005436 Bacteria 1540
117 Ga0070711_100004584 3300005439 Bacteria 8177
118 Ga0070711_100007766 3300005439 Bacteria 6533
119 Ga0070711_100043251 3300005439 Bacteria 3050
120 Ga0070711_100068223 3300005439 Bacteria 2498
121 Ga0070711_100169787 3300005439 Bacteria 1661
122 Ga0070705_100000971 3300005440 Bacteria 16064
123 Ga0070705_100183681 3300005440 Bacteria 1419
124 Ga0070700_100000495 3300005441 Bacteria 19766
125 Ga0070694_100004679 3300005444 Bacteria 8237
126 Ga0070708_100077192 3300005445 Bacteria 3010
127 Ga0070663_100001070 3300005455 Bacteria 14986
128 Ga0070663_100088958 3300005455 Bacteria 2284
129 Ga0070678_100000552 3300005456 Bacteria 18245
130 Ga0070678_100013095 3300005456 Bacteria 5186
131 Ga0070678_100028784 3300005456 Bacteria 3794
132 Ga0070678_100047267 3300005456 Bacteria 3091
133 Ga0070678_100114528 3300005456 Bacteria 2115
134 Ga0070678_100178175 3300005456 Bacteria 1737
135 Ga0070678_100222051 3300005456 Bacteria 1571
136 Ga0070662_100003388 3300005457 Bacteria 9939
137 Ga0070662_100050332 3300005457 Bacteria 3005
138 Ga0070662_100091451 3300005457 Bacteria 2285
139 Ga0070681_10004188 3300005458 Bacteria 13661
140 Ga0070681_10105385 3300005458 Bacteria 2761
141 Ga0070681_10108821 3300005458 Bacteria 2712
142 Ga0070681_10211860 3300005458 Bacteria 1853
143 Ga0068867_100000587 3300005459 Bacteria 24119
144 Ga0068867_100012780 3300005459 Bacteria 5939
145 Ga0068867_100109962 3300005459 Bacteria 2116
146 Ga0070685_10002610 3300005466 Bacteria 9228
147 Ga0070685_10021537 3300005466 Bacteria 3504
148 Ga0070685_10102274 3300005466 Bacteria 1752
149 Ga0070679_100138184 3300005530 Bacteria 2417
150 Ga0070679_100145489 3300005530 Bacteria 2348
151 Ga0070679_100227573 3300005530 Bacteria 1825
152 Ga0070679_100232037 3300005530 Bacteria 1805
153 Ga0070679_100259105 3300005530 Bacteria 1694
154 Ga0070684_100001501 3300005535 Bacteria 16841
155 Ga0068853_100001914 3300005539 Bacteria 15339
156 Ga0068853_100333703 3300005539 Bacteria 1408
157 Ga0070672_100000442 3300005543 Bacteria 24210
158 Ga0070672_100056051 3300005543 Bacteria 3089
159 Ga0070672_100063856 3300005543 Bacteria 2908
160 Ga0070672_100073889 3300005543 Bacteria 2718
161 Ga0070672_100192255 3300005543 Bacteria 1704
162 Ga0070672_100357396 3300005543 Bacteria 1246
163 Ga0070686_100002692 3300005544 Bacteria 9784
164 Ga0070686_100094725 3300005544 Bacteria 2004
165 Ga0070696_100006734 3300005546 Bacteria 7675
166 Ga0070696_100013242 3300005546 Bacteria 5534
167 Ga0070693_100000492 3300005547 Bacteria 17662
168 Ga0070693_100006083 3300005547 Bacteria 5846
169 Ga0070693_100017245 3300005547 Bacteria 3751
170 Ga0070693_100022943 3300005547 Bacteria 3328
171 Ga0070665_100037138 3300005548 Bacteria 4899
172 Ga0070665_100037390 3300005548 Bacteria 4882
173 Ga0070665_100280783 3300005548 Bacteria 1667
174 Ga0070704_100004657 3300005549 Bacteria 7938
175 Ga0070704_100092172 3300005549 Bacteria 2261
176 Ga0068855_100004881 3300005563 Bacteria 16365
177 Ga0068855_100165810 3300005563 Bacteria 2504
178 Ga0070664_100009800 3300005564 Bacteria 7763
179 Ga0070664_100090475 3300005564 Bacteria 2648
180 Ga0070664_100099406 3300005564 Bacteria 2528
181 Ga0070664_100173256 3300005564 Unclassified 1915
182 Ga0068857_100002803 3300005577 Bacteria 14334
183 Ga0068857_100113891 3300005577 Bacteria 2432
184 Ga0068854_100003844 3300005578 Bacteria 9409
185 Ga0068854_100019418 3300005578 Bacteria 4579
186 Ga0068854_100053390 3300005578 Bacteria 2902
187 Ga0068854_100249853 3300005578 Bacteria 1416
188 Ga0068856_100000863 3300005614 Bacteria 32525
189 Ga0068856_100076202 3300005614 Bacteria 3323
190 Ga0068856_100212529 3300005614 Unclassified 1950
191 Ga0068852_100016931 3300005616 Bacteria 5702
192 Ga0068852_100047119 3300005616 Bacteria 3675
193 Ga0068852_100075492 3300005616 Bacteria 2973
194 Ga0068859_100017372 3300005617 Bacteria 7228
195 Ga0068859_100035958 3300005617 Bacteria 4969
196 Ga0068859_100053230 3300005617 Bacteria 4070
197 Ga0068859_100059495 3300005617 Bacteria 3849
198 Ga0068859_100326418 3300005617 Unclassified 1629
199 Ga0068864_100001441 3300005618 Bacteria 19620
200 Ga0068864_100002660 3300005618 Bacteria 14760
201 Ga0068864_100012607 3300005618 Bacteria 6989
202 Ga0068864_100014014 3300005618 Bacteria 6647
203 Ga0068864_100082925 3300005618 Bacteria 2814
204 Ga0068864_100092895 3300005618 Bacteria 2664
205 Ga0068864_100204144 3300005618 Unclassified 1817
206 Ga0068866_10000723 3300005718 Bacteria 14981
207 Ga0068866_10008361 3300005718 Bacteria 4357
208 Ga0068866_10077224 3300005718 Bacteria 1778
209 Ga0068861_100000840 3300005719 Bacteria 18583
210 Ga0068861_100007748 3300005719 Bacteria 7376
211 Ga0068861_100177197 3300005719 Bacteria 1771
212 Ga0068851_10026372 3300005834 Bacteria 2855
213 Ga0068870_10000302 3300005840 Bacteria 18321
214 Ga0068870_10001054 3300005840 Bacteria 10914
215 Ga0068870_10018269 3300005840 Bacteria 3382
216 Ga0068863_100023141 3300005841 Bacteria 5937
217 Ga0068863_100033650 3300005841 Bacteria 4882
218 Ga0068863_100046329 3300005841 Bacteria 4126
219 Ga0068863_100322454 3300005841 Bacteria 1501
220 Ga0068858_100011645 3300005842 Bacteria 8296
221 Ga0068858_100012780 3300005842 Bacteria 7913
222 Ga0068858_100184407 3300005842 Bacteria 1971
223 Ga0068858_100403408 3300005842 Bacteria 1314
224 Ga0068860_100001400 3300005843 Bacteria 26146
225 Ga0068860_100004558 3300005843 Bacteria 14140
226 Ga0068860_100055279 3300005843 Bacteria 3773
227 Ga0068860_100443607 3300005843 Unclassified 1290
228 Ga0068862_100002629 3300005844 Bacteria 15820
229 Ga0068862_100026786 3300005844 Bacteria 4848
230 Ga0081455_10000009 3300005937 Bacteria 249885
231 Ga0081455_10002005 3300005937 Bacteria 24324
232 Ga0081455_10002521 3300005937 Bacteria 21748
233 Ga0081455_10003750 3300005937 Bacteria 17364
234 Ga0081455_10033784 3300005937 Bacteria 4591
235 Ga0081455_10120639 3300005937 Bacteria 2066
236 Ga0081538_10027111 3300005981 Bacteria 3982
237 Ga0081539_10000169 3300005985 Bacteria 153327
238 Ga0081539_10002225 3300005985 Bacteria 28285
239 Ga0070717_10001787 3300006028 Bacteria 14987
240 Ga0075365_10139823 3300006038 Bacteria 1680
241 Ga0075432_10000952 3300006058 Bacteria 9139
242 Ga0070715_10000335 3300006163 Bacteria 11724
243 Ga0070715_10123590 3300006163 Unclassified 1237
244 Ga0070716_100005101 3300006173 Bacteria 6341
245 Ga0070716_100103591 3300006173 Bacteria 1750
246 Ga0070712_100124450 3300006175 Bacteria 1945
247 Ga0070712_100459540 3300006175 Bacteria 1061
248 Ga0075367_10015558 3300006178 Bacteria 4140
249 Ga0075367_10027997 3300006178 Bacteria 3211
250 Ga0075367_10050287 3300006178 Bacteria 2460
251 Ga0075427_10000004 3300006194 Bacteria 15321
252 Ga0075366_10001747 3300006195 Bacteria 10932
253 Ga0097621_100001589 3300006237 Bacteria 15534
254 Ga0097621_100013414 3300006237 Bacteria 6108
255 Ga0097621_100023262 3300006237 Bacteria 4821
256 Ga0097621_100044633 3300006237 Bacteria 3576
257 Ga0075370_10058571 3300006353 Bacteria 2191
258 Ga0075370_10063596 3300006353 Bacteria 2104
259 Ga0068871_100000821 3300006358 Bacteria 20820
260 Ga0068871_100083192 3300006358 Bacteria 2654
261 Ga0068871_100134265 3300006358 Bacteria 2100
262 Ga0075428_100001565 3300006844 Bacteria 24533
263 Ga0075428_100008326 3300006844 Bacteria 11493
264 Ga0075428_100114044 3300006844 Bacteria 2944
265 Ga0075428_100276708 3300006844 Bacteria 1806
266 Ga0075428_100293266 3300006844 Bacteria 1749
267 Ga0075428_100378678 3300006844 Bacteria 1517
268 Ga0075428_100556231 3300006844 Bacteria 1226
269 Ga0075430_100001186 3300006846 Bacteria 20900
270 Ga0075430_100042149 3300006846 Bacteria 3860
271 Ga0075430_100112812 3300006846 Bacteria 2266
272 Ga0075430_100270664 3300006846 Bacteria 1406
273 Ga0075430_100381924 3300006846 Bacteria 1162
274 Ga0075431_100000584 3300006847 Bacteria 30912
275 Ga0075431_100001446 3300006847 Bacteria 21870
276 Ga0075431_100143647 3300006847 Bacteria 2459
277 Ga0075431_100174601 3300006847 Bacteria 2207
278 Ga0075431_100258581 3300006847 Bacteria 1767
279 Ga0075431_100297265 3300006847 Bacteria 1632
280 Ga0075431_100457943 3300006847 Bacteria 1270
281 Ga0075433_10000215 3300006852 Bacteria 32818
282 Ga0075433_10029127 3300006852 Bacteria 4702
283 Ga0075433_10033704 3300006852 Bacteria 4392
284 Ga0075434_100003016 3300006871 Bacteria 14968
285 Ga0075434_100025301 3300006871 Bacteria 5807
286 Ga0075434_100028038 3300006871 Bacteria 5530
287 Ga0075434_100059633 3300006871 Bacteria 3793
288 Ga0075434_100128389 3300006871 Bacteria 2553
289 Ga0075434_100142282 3300006871 Bacteria 2419
290 Ga0075434_100300829 3300006871 Bacteria 1625
291 Ga0075429_100002095 3300006880 Bacteria 16649
292 Ga0075429_100002098 3300006880 Bacteria 16630
293 Ga0075429_100003512 3300006880 Bacteria 13367
294 Ga0075429_100256367 3300006880 Bacteria 1531
295 Ga0068865_100000904 3300006881 Bacteria 16845
296 Ga0068865_100022470 3300006881 Bacteria 4115
297 Ga0068865_100146644 3300006881 Unclassified 1786
298 Ga0068865_100147550 3300006881 Bacteria 1781
299 Ga0075436_100059046 3300006914 Bacteria 2650
300 Ga0097620_100017372 3300006931 Bacteria 7228
301 Ga0097620_100035960 3300006931 Bacteria 4969
302 Ga0097620_100053232 3300006931 Bacteria 4070
303 Ga0097620_100059497 3300006931 Bacteria 3849
304 Ga0097620_100326411 3300006931 Unclassified 1629
305 Ga0075435_100003952 3300007076 Bacteria 10129
306 Ga0075435_100008222 3300007076 Bacteria 7473
307 Ga0075435_100009478 3300007076 Bacteria 7053
308 Ga0075435_100112730 3300007076 Bacteria 2263
309 Ga0075435_100285608 3300007076 Bacteria 1409
310 Ga0075435_100303690 3300007076 Bacteria 1365
311 Ga0099794_10074346 3300007265 Bacteria 1669
312 Ga0099795_10000065 3300007788 Bacteria 18517
313 Ga0105251_10029534 3300009011 Bacteria 2761
314 Ga0105250_10029855 3300009092 Bacteria 2192
315 Ga0105240_10010852 3300009093 Bacteria 12759
316 Ga0105240_10040215 3300009093 Bacteria 5984
317 Ga0105240_10181925 3300009093 Bacteria 2480
318 Ga0105240_10385327 3300009093 Bacteria 1582
319 Ga0111539_10000705 3300009094 Bacteria 43338
320 Ga0111539_10001590 3300009094 Bacteria 30257
321 Ga0111539_10002796 3300009094 Bacteria 23160
322 Ga0111539_10071163 3300009094 Bacteria 4104
323 Ga0111539_10240122 3300009094 Bacteria 2109
324 Ga0105245_10001399 3300009098 Bacteria 21858
325 Ga0105245_10009709 3300009098 Bacteria 8394
326 Ga0105245_10058969 3300009098 Bacteria 3455
327 Ga0105245_10280158 3300009098 Bacteria 1629
328 Ga0105245_10373271 3300009098 Bacteria 1419
329 Ga0105247_10001106 3300009101 Bacteria 20081
330 Ga0105247_10003221 3300009101 Bacteria 10741
331 Ga0105247_10020381 3300009101 Bacteria 3986
332 Ga0105247_10054881 3300009101 Unclassified 2459
333 Ga0114129_10000057 3300009147 Bacteria 99258
334 Ga0114129_10007384 3300009147 Bacteria 15644
335 Ga0114129_10019783 3300009147 Bacteria 9583
336 Ga0114129_10116731 3300009147 Bacteria 3678
337 Ga0114129_10354510 3300009147 Bacteria 1943
338 Ga0114129_10595896 3300009147 Bacteria 1432
339 Ga0105243_10002518 3300009148 Bacteria 15298
340 Ga0105243_10012299 3300009148 Bacteria 6473
341 Ga0105243_10017699 3300009148 Bacteria 5389
342 Ga0105243_10039541 3300009148 Bacteria 3678
343 Ga0105243_10158683 3300009148 Bacteria 1948
344 Ga0105243_10236804 3300009148 Bacteria 1622
345 Ga0105241_10017190 3300009174 Bacteria 5313
346 Ga0105241_10159404 3300009174 Bacteria 1853
347 Ga0105242_10001979 3300009176 Bacteria 16110
348 Ga0105242_10035113 3300009176 Bacteria 4021
349 Ga0105242_10051405 3300009176 Bacteria 3358
350 Ga0105242_10133137 3300009176 Bacteria 2149
351 Ga0105242_10285819 3300009176 Bacteria 1500
352 Ga0105242_10366270 3300009176 Bacteria 1335
353 Ga0105242_10423821 3300009176 Bacteria 1248
354 Ga0105248_10002761 3300009177 Bacteria 19508
355 Ga0105248_10091263 3300009177 Bacteria 3431
356 Ga0105248_10103224 3300009177 Bacteria 3214
357 Ga0105248_10237313 3300009177 Bacteria 2052
358 Ga0105237_10018759 3300009545 Bacteria 7153
359 Ga0105237_10034574 3300009545 Bacteria 5117
360 Ga0105237_10053856 3300009545 Bacteria 4034
361 Ga0105237_10056173 3300009545 Bacteria 3941
362 Ga0105237_10113907 3300009545 Bacteria 2696
363 Ga0105237_10127937 3300009545 Bacteria 2534
364 Ga0105238_10039159 3300009551 Bacteria 4808
365 Ga0105238_10065285 3300009551 Bacteria 3640
366 Ga0105238_10279920 3300009551 Bacteria 1649
367 Ga0105249_10001607 3300009553 Bacteria 19768
368 Ga0105249_10041870 3300009553 Bacteria 4164
369 Ga0105249_10062903 3300009553 Bacteria 3408
370 Ga0105249_10100649 3300009553 Bacteria 2718
371 Ga0099796_10011509 3300010159 Bacteria 2470
372 Ga0105239_10004906 3300010375 Bacteria 15826
373 Ga0105239_10014477 3300010375 Bacteria 8753
374 Ga0105239_10023767 3300010375 Bacteria 6749
375 Ga0105239_10118946 3300010375 Bacteria 2932
376 Ga0105239_10258298 3300010375 Bacteria 1957
377 Ga0105246_10001743 3300011119 Bacteria 13011
378 Ga0105246_10007183 3300011119 Bacteria 6821
379 Ga0157345_1004578 3300012498 Bacteria 1042
380 Ga0157373_10057488 3300013100 Bacteria 2759
381 Ga0157371_10044904 3300013102 Bacteria 3145
382 Ga0157371_10175200 3300013102 Bacteria 1533
383 Ga0157370_10032704 3300013104 Bacteria 5077
384 Ga0157370_10336763 3300013104 Bacteria 1391
385 Ga0157370_10342441 3300013104 Bacteria 1378
386 Ga0157369_10172905 3300013105 Bacteria 2275
387 Ga0157369_10266901 3300013105 Bacteria 1784
388 Ga0157369_10279705 3300013105 Bacteria 1738
389 Ga0157369_10492777 3300013105 Bacteria 1268
390 Ga0157374_10002463 3300013296 Bacteria 15633
391 Ga0157374_10009285 3300013296 Bacteria 8435
392 Ga0157374_10139785 3300013296 Bacteria 2350
393 Ga0157374_10171180 3300013296 Bacteria 2118
394 Ga0157374_10353689 3300013296 Bacteria 1460
395 Ga0157378_10003278 3300013297 Bacteria 14389
396 Ga0157378_10025519 3300013297 Bacteria 5203
397 Ga0157378_10042152 3300013297 Bacteria 4050
398 Ga0157378_10704818 3300013297 Bacteria 1029
399 Ga0163162_10007479 3300013306 Bacteria 10627
400 Ga0163162_10023461 3300013306 Bacteria 6088
401 Ga0163162_10039558 3300013306 Bacteria 4713
402 Ga0163162_10057610 3300013306 Bacteria 3913
403 Ga0163162_10162786 3300013306 Bacteria 2353
404 Ga0163162_10570830 3300013306 Bacteria 1258
405 Ga0157372_10530880 3300013307 Bacteria 1372
406 Ga0157375_10000974 3300013308 Bacteria 24784
407 Ga0157375_10030322 3300013308 Bacteria 5098
408 Ga0157375_10068633 3300013308 Bacteria 3548
409 Ga0163163_10005044 3300014325 Bacteria 11380
410 Ga0163163_10042234 3300014325 Bacteria 4465
411 Ga0163163_10096542 3300014325 Bacteria 2976
412 Ga0163163_10170686 3300014325 Bacteria 2222
413 Ga0157380_10003351 3300014326 Bacteria 10986
414 Ga0157380_10048023 3300014326 Bacteria 3360
415 Ga0157380_10138947 3300014326 Bacteria 2084
416 Ga0157377_10000240 3300014745 Bacteria 27908
417 Ga0157377_10002728 3300014745 Bacteria 7853
418 Ga0157379_10005829 3300014968 Bacteria 10591
419 Ga0157379_10013664 3300014968 Bacteria 7116
420 Ga0157379_10023314 3300014968 Bacteria 5492
421 Ga0157379_10043364 3300014968 Bacteria 4016
422 Ga0157376_10001267 3300014969 Bacteria 16614
423 Ga0183362_10003 3300015683 Bacteria 977584
424 Ga0163161_10001738 3300017792 Bacteria 15947
425 Ga0163161_10018293 3300017792 Bacteria 4911
426 Ga0163161_10028762 3300017792 Bacteria 3948
427 Ga0163161_10060749 3300017792 Bacteria 2751
428 Ga0163161_10247200 3300017792 Bacteria 1389
429 Ga0207666_1000054 3300025271 Bacteria 20474
430 Ga0207666_1001378 3300025271 Bacteria 2858
431 Ga0207673_1000022 3300025290 Bacteria 11966
432 Ga0209564_1000180 3300025295 Bacteria 151009
433 Ga0207697_10000200 3300025315 Bacteria 32050
434 Ga0207697_10047545 3300025315 Bacteria 1769
435 Ga0207653_10001606 3300025885 Bacteria 7293
436 Ga0207682_10000589 3300025893 Bacteria 16839
437 Ga0207692_10026161 3300025898 Bacteria 2735
438 Ga0207692_10144411 3300025898 Bacteria 1356
439 Ga0207642_10001001 3300025899 Bacteria 8848
440 Ga0207642_10003144 3300025899 Bacteria 5177
441 Ga0207710_10001512 3300025900 Bacteria 11525
442 Ga0207710_10005283 3300025900 Bacteria 5582
443 Ga0207710_10019583 3300025900 Bacteria 2887
444 Ga0207688_10000200 3300025901 Bacteria 26667
445 Ga0207688_10004456 3300025901 Bacteria 7625
446 Ga0207688_10010290 3300025901 Bacteria 5091
447 Ga0207680_10017450 3300025903 Bacteria 3793
448 Ga0207647_10000472 3300025904 Bacteria 32556
449 Ga0207647_10005890 3300025904 Bacteria 8933
450 Ga0207685_10004135 3300025905 Bacteria 3642
451 Ga0207699_10059970 3300025906 Bacteria 2282
452 Ga0207699_10122948 3300025906 Bacteria 1681
453 Ga0207699_10176231 3300025906 Bacteria 1434
454 Ga0207699_10223582 3300025906 Bacteria 1286
455 Ga0207645_10001225 3300025907 Bacteria 21129
456 Ga0207645_10109490 3300025907 Bacteria 1787
457 Ga0207643_10000302 3300025908 Bacteria 34143
458 Ga0207643_10001773 3300025908 Bacteria 12039
459 Ga0207643_10001904 3300025908 Bacteria 11507
460 Ga0207654_10012697 3300025911 Bacteria 4321
461 Ga0207654_10017171 3300025911 Bacteria 3780
462 Ga0207707_10004595 3300025912 Bacteria 12123
463 Ga0207707_10021311 3300025912 Bacteria 5665
464 Ga0207707_10203206 3300025912 Bacteria 1727
465 Ga0207695_10157850 3300025913 Bacteria 2202
466 Ga0207671_10011789 3300025914 Bacteria 7076
467 Ga0207671_10069816 3300025914 Bacteria 2618
468 Ga0207671_10244853 3300025914 Bacteria 1409
469 Ga0207693_10004654 3300025915 Bacteria 11573
470 Ga0207693_10008892 3300025915 Bacteria 8205
471 Ga0207693_10017923 3300025915 Bacteria 5645
472 Ga0207693_10036811 3300025915 Bacteria 3859
473 Ga0207693_10067735 3300025915 Bacteria 2795
474 Ga0207663_10008376 3300025916 Bacteria 5401
475 Ga0207663_10092107 3300025916 Bacteria 2014
476 Ga0207663_10172250 3300025916 Bacteria 1539
477 Ga0207660_10001461 3300025917 Bacteria 15882
478 Ga0207660_10314358 3300025917 Bacteria 1249
479 Ga0207662_10000446 3300025918 Bacteria 18291
480 Ga0207662_10004160 3300025918 Bacteria 7573
481 Ga0207662_10019707 3300025918 Bacteria 3843
482 Ga0207657_10000917 3300025919 Bacteria 31167
483 Ga0207657_10021816 3300025919 Bacteria 6016
484 Ga0207657_10040989 3300025919 Bacteria 4098
485 Ga0207657_10142712 3300025919 Unclassified 1956
486 Ga0207657_10171252 3300025919 Bacteria 1759
487 Ga0207649_10000864 3300025920 Bacteria 19297
488 Ga0207649_10023029 3300025920 Bacteria 3603
489 Ga0207652_10002449 3300025921 Bacteria 15658
490 Ga0207652_10139221 3300025921 Bacteria 2169
491 Ga0207652_10403030 3300025921 Bacteria 1234
492 Ga0207681_10001739 3300025923 Bacteria 13976
493 Ga0207681_10116698 3300025923 Unclassified 1951
494 Ga0207650_10006825 3300025925 Bacteria 7788
495 Ga0207650_10032976 3300025925 Bacteria 3748
496 Ga0207650_10041636 3300025925 Bacteria 3367
497 Ga0207650_10087637 3300025925 Bacteria 2372
498 Ga0207650_10151880 3300025925 Bacteria 1828
499 Ga0207659_10000683 3300025926 Bacteria 20172
500 Ga0207659_10061612 3300025926 Bacteria 2705
501 Ga0207659_10107039 3300025926 Bacteria 2118
502 Ga0207659_10155828 3300025926 Bacteria 1788
503 Ga0207659_10207228 3300025926 Unclassified 1569
504 Ga0207687_10001148 3300025927 Bacteria 18022
505 Ga0207687_10004655 3300025927 Bacteria 9126
506 Ga0207687_10011621 3300025927 Bacteria 5754
507 Ga0207687_10044666 3300025927 Bacteria 3059
508 Ga0207687_10262886 3300025927 Bacteria 1376
509 Ga0207687_10377946 3300025927 Bacteria 1160
510 Ga0207700_10058005 3300025928 Bacteria 2922
511 Ga0207700_10144123 3300025928 Bacteria 1961
512 Ga0207664_10069303 3300025929 Bacteria 2836
513 Ga0207644_10003175 3300025931 Bacteria 10575
514 Ga0207644_10019581 3300025931 Bacteria 4592
515 Ga0207644_10067516 3300025931 Bacteria 2606
516 Ga0207690_10001302 3300025932 Bacteria 15711
517 Ga0207706_10001314 3300025933 Bacteria 24923
518 Ga0207706_10017802 3300025933 Bacteria 6401
519 Ga0207706_10027904 3300025933 Bacteria 5046
520 Ga0207706_10028177 3300025933 Bacteria 5018
521 Ga0207706_10119291 3300025933 Bacteria 2319
522 Ga0207686_10001107 3300025934 Bacteria 15692
523 Ga0207686_10017202 3300025934 Bacteria 4070
524 Ga0207686_10017383 3300025934 Bacteria 4052
525 Ga0207686_10027799 3300025934 Bacteria 3316
526 Ga0207686_10186533 3300025934 Bacteria 1475
527 Ga0207709_10000742 3300025935 Bacteria 25875
528 Ga0207709_10021237 3300025935 Bacteria 3673
529 Ga0207709_10047049 3300025935 Bacteria 2621
530 Ga0207709_10095419 3300025935 Bacteria 1954
531 Ga0207709_10238711 3300025935 Bacteria 1321
532 Ga0207670_10000707 3300025936 Bacteria 17597
533 Ga0207670_10005405 3300025936 Bacteria 7008
534 Ga0207670_10087631 3300025936 Bacteria 2193
535 Ga0207670_10283672 3300025936 Bacteria 1292
536 Ga0207669_10000470 3300025937 Bacteria 17605
537 Ga0207669_10021789 3300025937 Bacteria 3390
538 Ga0207704_10001346 3300025938 Bacteria 10966
539 Ga0207704_10028894 3300025938 Plasmid 3084
540 Ga0207704_10105202 3300025938 Bacteria 1892
541 Ga0207704_10308126 3300025938 Bacteria 1216
542 Ga0207665_10013405 3300025939 Bacteria 5390
543 Ga0207665_10034521 3300025939 Bacteria 3356
544 Ga0207691_10000627 3300025940 Bacteria 34951
545 Ga0207691_10002245 3300025940 Bacteria 18938
546 Ga0207691_10007735 3300025940 Bacteria 10345
547 Ga0207691_10058030 3300025940 Bacteria 3521
548 Ga0207691_10095237 3300025940 Bacteria 2663
549 Ga0207691_10183905 3300025940 Unclassified 1825
550 Ga0207691_10336941 3300025940 Bacteria 1291
551 Ga0207711_10006242 3300025941 Bacteria 10056
552 Ga0207711_10106063 3300025941 Bacteria 2493
553 Ga0207711_10198289 3300025941 Bacteria 1831
554 Ga0207689_10000823 3300025942 Bacteria 29900
555 Ga0207689_10013625 3300025942 Bacteria 6933
556 Ga0207689_10059931 3300025942 Bacteria 3130
557 Ga0207689_10078805 3300025942 Bacteria 2708
558 Ga0207689_10156942 3300025942 Bacteria 1876
559 Ga0207661_10015006 3300025944 Bacteria 5689
560 Ga0207661_10089600 3300025944 Bacteria 2560
561 Ga0207661_10245083 3300025944 Bacteria 1591
562 Ga0207679_10000409 3300025945 Bacteria 30782
563 Ga0207679_10003395 3300025945 Bacteria 9824
564 Ga0207667_10091729 3300025949 Bacteria 3138
565 Ga0207667_10096675 3300025949 Bacteria 3048
566 Ga0207651_10000472 3300025960 Bacteria 16926
567 Ga0207651_10031071 3300025960 Bacteria 3409
568 Ga0207651_10063218 3300025960 Bacteria 2584
569 Ga0207651_10168286 3300025960 Bacteria 1726
570 Ga0207651_10179722 3300025960 Bacteria 1677
571 Ga0207712_10002155 3300025961 Bacteria 12857
572 Ga0207712_10025600 3300025961 Bacteria 3922
573 Ga0207712_10028278 3300025961 Bacteria 3749
574 Ga0207712_10347360 3300025961 Bacteria 1232
575 Ga0207668_10001632 3300025972 Bacteria 13106
576 Ga0207668_10012166 3300025972 Bacteria 5259
577 Ga0207668_10038431 3300025972 Bacteria 3212
578 Ga0207668_10379019 3300025972 Bacteria 1190
579 Ga0207640_10001082 3300025981 Bacteria 15093
580 Ga0207640_10026699 3300025981 Bacteria 3510
581 Ga0207658_10006212 3300025986 Bacteria 8160
582 Ga0207658_10066673 3300025986 Bacteria 2708
583 Ga0207658_10130492 3300025986 Bacteria 2018
584 Ga0207677_10011916 3300026023 Bacteria 4975
585 Ga0207677_10138668 3300026023 Bacteria 1859
586 Ga0207703_10001483 3300026035 Bacteria 21390
587 Ga0207703_10006044 3300026035 Bacteria 9682
588 Ga0207703_10023398 3300026035 Bacteria 4852
589 Ga0207703_10160125 3300026035 Bacteria 1971
590 Ga0207703_10388100 3300026035 Bacteria 1293
591 Ga0207639_10001602 3300026041 Bacteria 15210
592 Ga0207639_10075452 3300026041 Bacteria 2651
593 Ga0207678_10002063 3300026067 Bacteria 18225
594 Ga0207678_10012664 3300026067 Bacteria 7411
595 Ga0207678_10024225 3300026067 Bacteria 5301
596 Ga0207678_10037027 3300026067 Bacteria 4246
597 Ga0207678_10069547 3300026067 Bacteria 3018
598 Ga0207678_10144658 3300026067 Unclassified 2029
599 Ga0207678_10204817 3300026067 Bacteria 1688
600 Ga0207708_10000575 3300026075 Bacteria 28372
601 Ga0207708_10005514 3300026075 Bacteria 9339
602 Ga0207708_10009098 3300026075 Bacteria 7349
603 Ga0207708_10018000 3300026075 Bacteria 5316
604 Ga0207708_10139913 3300026075 Bacteria 1898
605 Ga0207702_10004242 3300026078 Bacteria 12799
606 Ga0207702_10111618 3300026078 Bacteria 2432
607 Ga0207641_10009610 3300026088 Bacteria 7971
608 Ga0207641_10012014 3300026088 Bacteria 7105
609 Ga0207641_10013698 3300026088 Bacteria 6655
610 Ga0207641_10162760 3300026088 Bacteria 2030
611 Ga0207641_10392280 3300026088 Bacteria 1331
612 Ga0207648_10001152 3300026089 Bacteria 29605
613 Ga0207648_10001396 3300026089 Bacteria 26597
614 Ga0207648_10003124 3300026089 Bacteria 17485
615 Ga0207648_10035411 3300026089 Bacteria 4397
616 Ga0207648_10255151 3300026089 Bacteria 1564
617 Ga0207676_10003967 3300026095 Bacteria 10441
618 Ga0207676_10009698 3300026095 Bacteria 6845
619 Ga0207676_10068466 3300026095 Bacteria 2839
620 Ga0207676_10189490 3300026095 Bacteria 1808
621 Ga0207674_10001102 3300026116 Bacteria 35088
622 Ga0207674_10005570 3300026116 Bacteria 14930
623 Ga0207674_10131166 3300026116 Bacteria 2469
624 Ga0207675_100002494 3300026118 Bacteria 18217
625 Ga0207675_100009825 3300026118 Bacteria 8957
626 Ga0207675_100028613 3300026118 Bacteria 5190
627 Ga0207675_100029262 3300026118 Bacteria 5132
628 Ga0207675_100119491 3300026118 Bacteria 2493
629 Ga0207683_10000637 3300026121 Bacteria 32050
630 Ga0207683_10034072 3300026121 Bacteria 4425
631 Ga0207683_10048246 3300026121 Bacteria 3729
632 Ga0207683_10062131 3300026121 Bacteria 3289
633 Ga0207683_10144885 3300026121 Bacteria 2142
634 Ga0207683_10249147 3300026121 Unclassified 1621
635 Ga0207698_10000980 3300026142 Bacteria 16616
636 Ga0207698_10072082 3300026142 Bacteria 2744
637 Ga0207698_10105903 3300026142 Bacteria 2344
638 Ga0209179_1000797 3300027512 Bacteria 3447
639 Ga0210002_1000076 3300027617 Bacteria 15605
640 Ga0209971_1002029 3300027682 Bacteria 4924
641 Ga0209966_1008562 3300027695 Bacteria 1818
642 Ga0209998_10000471 3300027717 Bacteria 11138
643 Ga0209998_10007581 3300027717 Bacteria 2252
644 Ga0209974_10000316 3300027876 Bacteria 15770
645 Ga0209974_10056241 3300027876 Bacteria 1327
646 Ga0207428_10000216 3300027907 Bacteria 79777
647 Ga0207428_10001434 3300027907 Bacteria 25064
648 Ga0207428_10001751 3300027907 Bacteria 22228
649 Ga0207428_10009210 3300027907 Bacteria 8869
650 Ga0207428_10343621 3300027907 Bacteria 1099
651 Ga0268266_10035794 3300028379 Bacteria 4222
652 Ga0268266_10143756 3300028379 Bacteria 2143
653 Ga0268265_10001997 3300028380 Bacteria 16117
654 Ga0268265_10004180 3300028380 Bacteria 10112
655 Ga0268265_10074879 3300028380 Bacteria 2650
656 Ga0268265_10086908 3300028380 Bacteria 2486
657 Ga0268265_10476435 3300028380 Unclassified 1171
658 Ga0268264_10002438 3300028381 Bacteria 16355
659 Ga0268264_10010004 3300028381 Bacteria 7852
660 Ga0268264_10045422 3300028381 Bacteria 3646
661 Ga0265337_1001192 3300028556 Bacteria 13219
662 Ga0307517_10102413 3300028786 Bacteria 2245
663 Ga0307515_10006871 3300028794 Bacteria 22638
664 Ga0307512_10023853 3300030522 Bacteria 5459
665 Ga0265330_10026527 3300031235 Bacteria 2620
666 Ga0265325_10000048 3300031241 Bacteria 82899
667 Ga0265340_10008082 3300031247 Bacteria 5696
668 Ga0265340_10023536 3300031247 Bacteria 3140
669 Ga0265331_10013663 3300031250 Bacteria 4356
670 Ga0307513_10200042 3300031456 Bacteria 1840
671 Ga0307513_10241854 3300031456 Bacteria 1609
672 Ga0307509_10000225 3300031507 Bacteria 90913
673 Ga0265313_10000438 3300031595 Bacteria 44285
674 Ga0265313_10041021 3300031595 Bacteria 2283
675 Ga0307514_10030744 3300031649 Bacteria 4309
676 Ga0265342_10096067 3300031712 Bacteria 1694
677 Ga0307410_10327580 3300031852 Bacteria 1217
678 Ga0307409_100009307 3300031995 Bacteria 6030
679 Ga0307416_100043851 3300032002 Bacteria 3507
680 Ga0373930_0000307 3300034816 Bacteria 6344
681 Ga0373930_0013015 3300034816 Bacteria 1527
682 Ga0373948_0002119 3300034817 Bacteria 2890
683 Ga0373950_0001201 3300034818 Bacteria 3339
684 Ga0373958_0000322 3300034819 Bacteria 5796
685 Ga0373958_0003692 3300034819 Bacteria 2226
686 Ga0373959_0007371 3300034820 Bacteria 1848
687 Ga0373926_0005698 3300035083 Bacteria 4111
688 Ga0373926_0009376 3300035083 Bacteria 3271
689 Ga0373928_0012069 3300035084 Bacteria 1718
690 Ga0373929_0000143 3300035085 Bacteria 12292
691 Ga0373929_0015524 3300035085 Bacteria 1482
692 Ga0373934_0021268 3300035086 Bacteria 2498
693 Ga0373940_0011892 3300035088 Bacteria 2077
694 Ga0373944_0038993 3300035089 Bacteria 1461
695 Ga0373949_0001165 3300035090 Bacteria 7825
696 Ga0373949_0008747 3300035090 Bacteria 2216
697 Ga0373951_0000777 3300035091 Bacteria 8726
698 Ga0373951_0004528 3300035091 Bacteria 3293
699 Ga0373951_0027103 3300035091 Unclassified 1337
700 Ga0373951_0034299 3300035091 Bacteria 1205
701 Ga0373952_0001954 3300035092 Bacteria 3731
702 Ga0373952_0004393 3300035092 Bacteria 2558
703 Ga0373923_0009412 3300035111 Bacteria 3526
704 Ga0373932_0000870 3300035112 Bacteria 8925
705 Ga0373932_0003101 3300035112 Bacteria 4050
706 Ga0373936_0006749 3300035113 Bacteria 4320
707 Ga0373939_0001316 3300035114 Bacteria 6030
708 Ga0373939_0002013 3300035114 Bacteria 4852
709 Ga0373941_0001795 3300035115 Bacteria 4622
710 Ga0373941_0005143 3300035115 Bacteria 3059
711 Ga0373945_0005139 3300035116 Bacteria 4178
712 Ga0373945_0020719 3300035116 Bacteria 2253
713 Ga0373954_0016689 3300035118 Bacteria 3290
714 Ga0373956_0005731 3300035119 Bacteria 4967
715 Ga0373956_0026502 3300035119 Bacteria 2511
716 Ga0373956_0038409 3300035119 Bacteria 2118
717 Ga0373957_0002589 3300035120 Bacteria 5190
718 Ga0373960_0000059 3300035121 Bacteria 15169
719 Ga0373960_0004733 3300035121 Bacteria 3131
720 Ga0373960_0005883 3300035121 Bacteria 2854
721 Ga0373943_0009773 3300035170 Bacteria 4296
722 Ga0373943_0179214 3300035170 Bacteria 1164
723 Ga0373946_0017923 3300035171 Bacteria 2712
724 Ga0373955_0004501 3300035172 Bacteria 6171
725 Ga0373955_0004659 3300035172 Bacteria 6083
726 Ga0373955_0033246 3300035172 Bacteria 2715
727 Ga0373942_0001389 3300035207 Bacteria 6261
728 Ga0373961_0005506 3300035241 Bacteria 3043
729 Ga0373962_0000585 3300035242 Bacteria 8258
730 Ga0373931_0004620 3300035691 Bacteria 6296
731 Ga0373931_0017840 3300035691 Bacteria 3518
732 Ga0373931_0030162 3300035691 Bacteria 2790
733 Ga0373935_0018177 3300035692 Bacteria 4273
734 Ga0373935_0029643 3300035692 Bacteria 3387
735 Ga0373935_0088090 3300035692 Bacteria 2028
736 Ga0373935_0324781 3300035692 Unclassified 1092
737 Ga0373927_0032493 3300035695 Bacteria 3398
738 Ga0373927_0085628 3300035695 Bacteria 2045
739 Ga0373927_0142822 3300035695 Bacteria 1566
740 Ga0373927_0149038 3300035695 Bacteria 1532
741 Ga0373933_0002274 3300035724 Bacteria 10955
742 Ga0373933_0003001 3300035724 Bacteria 9408
743 Ga0373933_0012239 3300035724 Bacteria 4739
744 Ga0373933_0036242 3300035724 Bacteria 2886
745 Ga0373933_0118759 3300035724 Bacteria 1655
746 Ga0373947_0020225 3300035725 Bacteria 3842
747 Ga0373937_0010837 3300036401 Bacteria 7980
748 Ga0373937_0019262 3300036401 Bacteria 6108
749 Ga0373937_0023232 3300036401 Bacteria 5582
750 Ga0373937_0097894 3300036401 Bacteria 2721
751 Ga0373937_0477059 3300036401 Bacteria 1185
752 Ga0373925_0036705 3300037068 Bacteria 3616
753 Ga0373925_0038021 3300037068 Bacteria 3555
754 Ga0373925_0061959 3300037068 Bacteria 2811
755 Ga0373925_0061989 3300037068 Bacteria 2811
756 Ga0373925_0280354 3300037068 Bacteria 1342
757 Ga0436364_0928179 3300037853 Bacteria 2023
758 Ga0436365_0314634 3300039437 Bacteria 7046
759 Ga0436365_1628126 3300039437 Bacteria 4425
760 Ga0451791_1369153 3300041451 Bacteria 1164
761 Ga0439460_0045514 3300042461 Bacteria 1301
762 Ga0466963_0001958 3300044694 Bacteria 11296
763 Ga0451576_0072236 3300045051 Bacteria 3591
764 Ga0466967_0004256 3300045976 Bacteria 9613
765 Ga0495592_0039015 3300046454 Bacteria 3570
766 Ga0495592_0041402 3300046454 Bacteria 3452
767 Ga0495592_0116908 3300046454 Bacteria 1881
768 Ga0495603_0034013 3300046455 Bacteria 3066
769 Ga0495629_0001000 3300046459 Bacteria 22680
770 Ga0495629_0030399 3300046459 Bacteria 3829
771 Ga0495641_0094093 3300046461 Bacteria 1338
772 Ga0495651_0040850 3300046462 Bacteria 3604
773 Ga0495651_0060876 3300046462 Bacteria 2890
774 Ga0495653_0084967 3300046463 Bacteria 2329
775 Ga0495580_0030435 3300046472 Bacteria 3908
776 Ga0495580_0059109 3300046472 Bacteria 2694
777 Ga0495582_0003989 3300046473 Bacteria 8293
778 Ga0495582_0098827 3300046473 Bacteria 1633
779 Ga0495639_0040360 3300046475 Bacteria 2099
780 Ga0495662_0083361 3300046476 Bacteria 1556
781 Ga0495664_0010075 3300046477 Bacteria 5302
782 Ga0495664_0014802 3300046477 Bacteria 4428
783 Ga0495584_0056499 3300046491 Bacteria 1975
784 Ga0495585_0034434 3300046492 Bacteria 2863
785 Ga0495585_0118049 3300046492 Bacteria 1405
786 Ga0495594_0005856 3300046499 Bacteria 6316
787 Ga0495594_0031869 3300046499 Bacteria 2860
788 Ga0495594_0131019 3300046499 Bacteria 1420
789 Ga0495608_0041702 3300046511 Bacteria 3070
790 Ga0495618_0110789 3300046514 Bacteria 1757
791 Ga0495628_0434381 3300046516 Bacteria 955
792 Ga0495630_0027271 3300046517 Bacteria 4235
793 Ga0495644_0002236 3300046523 Bacteria 7740
794 Ga0495644_0054986 3300046523 Bacteria 1495
795 Ga0495666_0028309 3300046526 Bacteria 2756
796 Ga0495666_0149938 3300046526 Unclassified 1084
797 Ga0495652_0101319 3300046529 Bacteria 2335
798 Ga0495652_0236254 3300046529 Bacteria 1363
799 Ga0495665_0036088 3300046531 Bacteria 2639
800 Ga0495587_0001853 3300046536 Bacteria 14067
801 Ga0495587_0079163 3300046536 Bacteria 1906
802 Ga0495598_0003223 3300046537 Bacteria 3445
803 Ga0495609_0080695 3300046538 Bacteria 1422
804 Ga0495597_0022818 3300046542 Bacteria 2899
805 Ga0495645_0001729 3300046543 Bacteria 14827
806 Ga0495645_0008295 3300046543 Bacteria 7250
807 Ga0495645_0230209 3300046543 Bacteria 1242
808 Ga0495622_0021157 3300046557 Bacteria 3031
809 Ga0495633_0016888 3300046558 Bacteria 3746
810 Ga0495667_0009963 3300046559 Bacteria 6437
811 Ga0495667_0034800 3300046559 Bacteria 3368
812 Ga0495656_0000398 3300046615 Bacteria 14416
813 Ga0495656_0007656 3300046615 Bacteria 3828
814 Ga0495656_0185563 3300046615 Bacteria 1025
815 Ga0495611_0034364 3300046648 Bacteria 2241
816 Ga0495635_0016669 3300046663 Bacteria 5132
817 Ga0495635_0067515 3300046663 Bacteria 2453
818 Ga0495635_0197624 3300046663 Bacteria 1365
819 Ga0495659_0003411 3300046664 Bacteria 5079
820 Ga0495659_0029178 3300046664 Bacteria 1914
821 Ga0495657_0017371 3300046675 Bacteria 5225
822 Ga0495599_0025961 3300046678 Bacteria 3669
823 Ga0495623_0014430 3300046679 Bacteria 5113
824 Ga0495646_0093505 3300046680 Bacteria 1732
825 Ga0495647_0051266 3300046681 Bacteria 1603
826 Ga0495658_0004053 3300046683 Bacteria 7219
827 Ga0495658_0010561 3300046683 Bacteria 4621
828 Ga0495658_0080063 3300046683 Bacteria 1915
829 Ga0495658_0147524 3300046683 Bacteria 1443
830 Ga0495613_0013909 3300046689 Bacteria 5971
831 Ga0495600_0015719 3300046809 Bacteria 4791
832 Ga0495600_0041655 3300046809 Bacteria 2993
833 Ga0495600_0046760 3300046809 Bacteria 2822
834 Ga0495604_0051363 3300047317 Bacteria 3196
835 Ga0495604_0057558 3300047317 Bacteria 2988
836 Ga0495674_0002982 3300047319 Bacteria 16480
837 Ga0495674_0021258 3300047319 Bacteria 6003
838 Ga0495674_0091194 3300047319 Bacteria 2603
839 Ga0495674_0129671 3300047319 Bacteria 2125
840 Ga0495676_0085716 3300047321 Bacteria 2372
841 Ga0495680_0008240 3300047322 Bacteria 9495
842 Ga0495680_0019482 3300047322 Bacteria 5724
843 Ga0495680_0082408 3300047322 Bacteria 2427
844 Ga0495687_002565 3300047443 Bacteria 14333
845 Ga0495675_0047109 3300047444 Bacteria 2743
846 Ga0495677_0030178 3300047445 Bacteria 1973
847 Ga0495679_039183 3300047446 Bacteria 1479
848 Ga0495684_0000749 3300047471 Bacteria 26152
849 Ga0495593_0148398 3300047673 Bacteria 1186
850 Ga0495602_0004715 3300048088 Bacteria 14255
851 Ga0495614_0045975 3300048089 Unclassified 1872
852 Ga0495615_0004243 3300048090 Bacteria 2484
853 Ga0496100_0001128 3300048903 Bacteria 12970
854 Ga0496100_0002875 3300048903 Bacteria 8828
855 Ga0496100_0009197 3300048903 Bacteria 5544
856 Ga0496101_0002858 3300048904 Bacteria 10609
857 Ga0496101_0014471 3300048904 Bacteria 5303
858 Ga0496101_0024431 3300048904 Bacteria 4182
859 Ga0496101_0046816 3300048904 Bacteria 3102
860 Ga0496101_0388388 3300048904 Bacteria 1098
861 Ga0496102_0010044 3300048905 Bacteria 8140
862 Ga0496102_0085854 3300048905 Bacteria 2906
863 Ga0496102_0199374 3300048905 Bacteria 1886
864 Ga0496102_0342164 3300048905 Bacteria 1408
865 Ga0496102_0378334 3300048905 Bacteria 1332
866 Ga0496103_0001913 3300048906 Bacteria 13529
867 Ga0496103_0002261 3300048906 Bacteria 12177
868 Ga0496103_0041171 3300048906 Bacteria 2839
869 Ga0496103_0070530 3300048906 Bacteria 2186
870 Ga0496103_0073942 3300048906 Bacteria 2135
871 Ga0496104_0000196 3300048907 Bacteria 53901
872 Ga0496104_0000629 3300048907 Bacteria 30223
873 Ga0496104_0074710 3300048907 Bacteria 3227
874 Ga0496104_0095263 3300048907 Bacteria 2848
875 Ga0496104_0245738 3300048907 Bacteria 1702
876 Ga0496105_0002162 3300048908 Bacteria 14234
877 Ga0496105_0002424 3300048908 Bacteria 13516
878 Ga0496105_0004080 3300048908 Bacteria 10934
879 Ga0496105_0010975 3300048908 Bacteria 7138
880 Ga0496105_0069166 3300048908 Bacteria 2918
881 Ga0496105_0186187 3300048908 Unclassified 1699
882 Ga0496105_0199409 3300048908 Bacteria 1634
883 Ga0496105_0284799 3300048908 Bacteria 1331
884 Ga0496106_0012626 3300048909 Bacteria 6240
885 Ga0496106_0018460 3300048909 Bacteria 5157
886 Ga0496106_0019469 3300048909 Bacteria 5035
887 Ga0496106_0025671 3300048909 Bacteria 4386
888 Ga0496106_0080436 3300048909 Bacteria 2502
889 Ga0496107_0000646 3300048910 Bacteria 19609
890 Ga0496107_0002792 3300048910 Bacteria 11521
891 Ga0496107_0005465 3300048910 Bacteria 8697
892 Ga0496107_0006701 3300048910 Bacteria 7930
893 Ga0496107_0100206 3300048910 Bacteria 2123
894 Ga0496107_0306942 3300048910 Unclassified 1181
895 Ga0496108_0031303 3300048911 Bacteria 4413
896 Ga0496108_0050893 3300048911 Bacteria 3470
897 Ga0496108_0055390 3300048911 Bacteria 3329
898 Ga0496108_0093445 3300048911 Plasmid 2559
899 Ga0496108_0103396 3300048911 Bacteria 2430
900 Ga0496108_0255359 3300048911 Bacteria 1525
901 Ga0496108_0271534 3300048911 Bacteria 1476
902 Ga0496108_0296325 3300048911 Bacteria 1408
903 Ga0496108_0370744 3300048911 Bacteria 1250
904 Ga0496109_0001395 3300048912 Bacteria 20044
905 Ga0496109_0003734 3300048912 Bacteria 12724
906 Ga0496109_0005620 3300048912 Bacteria 10492
907 Ga0496109_0031840 3300048912 Bacteria 4737
908 Ga0496109_0069949 3300048912 Bacteria 3220
909 Ga0496109_0074118 3300048912 Plasmid 3128
910 Ga0496109_0240292 3300048912 Bacteria 1704
911 Ga0496109_0308748 3300048912 Bacteria 1492
912 Ga0496110_0009821 3300048913 Bacteria 7753
913 Ga0496110_0032183 3300048913 Bacteria 4528
914 Ga0496110_0230548 3300048913 Bacteria 1684
915 Ga0496110_0275365 3300048913 Bacteria 1532
916 Ga0496110_0424193 3300048913 Bacteria 1212
917 Ga0496111_0002390 3300048914 Bacteria 11313
918 Ga0496111_0007504 3300048914 Bacteria 7155
919 Ga0496112_0029993 3300048915 Bacteria 5263
920 Ga0496112_0032426 3300048915 Bacteria 5072
921 Ga0496112_0055338 3300048915 Bacteria 3901
922 Ga0496112_0099124 3300048915 Bacteria 2883
923 Ga0496112_0255877 3300048915 Bacteria 1701
924 Ga0496112_0323818 3300048915 Bacteria 1485
925 Ga0496113_0000682 3300048916 Bacteria 17292
926 Ga0496113_0004427 3300048916 Bacteria 8632
927 Ga0496113_0019709 3300048916 Bacteria 4726
928 Ga0496113_0100665 3300048916 Unclassified 2239
929 Ga0496114_0001441 3300048917 Bacteria 18044
930 Ga0496114_0003348 3300048917 Bacteria 12320
931 Ga0496114_0013130 3300048917 Bacteria 6637
932 Ga0496114_0091828 3300048917 Bacteria 2579
933 Ga0496114_0397014 3300048917 Bacteria 1221
934 Ga0496115_0001413 3300048918 Bacteria 17185
935 Ga0496115_0003796 3300048918 Bacteria 10872
936 Ga0496115_0023816 3300048918 Bacteria 4753
937 Ga0496115_0032902 3300048918 Bacteria 4093
938 Ga0496115_0079051 3300048918 Bacteria 2677
939 Ga0496115_0179139 3300048918 Bacteria 1752
940 Ga0496115_0204142 3300048918 Bacteria 1632
941 Ga0501031_0028596 3300049568 Bacteria 3634
942 Ga0501032_0049277 3300049569 Bacteria 2841
943 Ga0501033_0024328 3300049570 Bacteria 4569
944 Ga0501034_0062100 3300049571 Bacteria 3751
945 Ga0501034_0356044 3300049571 Bacteria 1391
946 Ga0501037_0020559 3300049573 Bacteria 4874
947 Ga0501037_0056054 3300049573 Bacteria 2880
948 Ga0501039_0124918 3300049575 Bacteria 2018
949 Ga0501040_0230506 3300049576 Bacteria 1319
950 Ga0501042_0278548 3300049578 Bacteria 1208
951 Ga0501043_0034799 3300049579 Bacteria 3962
952 Ga0501043_0116965 3300049579 Bacteria 2092
953 Ga0501047_0132154 3300049581 Bacteria 2376
954 Ga0501067_0127125 3300049583 Bacteria 1418
955 Ga0501070_0036441 3300049586 Bacteria 4107
956 Ga0501070_0191640 3300049586 Bacteria 1680
957 Ga0501072_0155913 3300049588 Bacteria 1821
958 Ga0501072_0239576 3300049588 Bacteria 1445
959 Ga0501072_0330196 3300049588 Bacteria 1212
960 Ga0501076_0120804 3300049592 Bacteria 2122
961 Ga0501077_0055262 3300049593 Bacteria 2521
962 Ga0501080_0168623 3300049742 Bacteria 2020
963 Ga0501081_0046735 3300049743 Bacteria 2977
964 Ga0501035_0016634 3300049822 Bacteria 6782
965 nmdc:mga03683_10383_c1 3300050489 Bacteria 3338
966 nmdc:mga03n38_117176_c1 3300050490 Bacteria 1304
967 nmdc:mga00v17_179610_c1 3300050491 Bacteria 1365
968 nmdc:mga00v17_97392_c1 3300050491 Bacteria 1854
969 nmdc:mga0yw44_918_c1 3300050492 Bacteria 11147
970 nmdc:mga0k408_108548_c1 3300050493 Bacteria 1639
971 nmdc:mga0k408_20733_c1 3300050493 Bacteria 3687
972 nmdc:mga0k408_2957_c1 3300050493 Bacteria 9007
973 nmdc:mga0k408_83588_c1 3300050493 Bacteria 1871
974 nmdc:mga06z11_181717_c1 3300050494 Bacteria 1213
975 nmdc:mga06z11_24174_c1 3300050494 Bacteria 2863
976 nmdc:mga06z11_40913_c1 3300050494 Bacteria 2316
977 nmdc:mga07m45_121801_c1 3300050496 Bacteria 1506
978 nmdc:mga07m45_12419_c1 3300050496 Bacteria 4502
979 nmdc:mga07m45_93059_c1 3300050496 Unclassified 1728
980 nmdc:mga05p37_13288_c1 3300050507 Bacteria 9859
981 nmdc:mga05p37_2463_c1 3300050507 Bacteria 21532
982 nmdc:mga05p37_267242_c1 3300050507 Bacteria 2045
983 nmdc:mga05p37_368_c1 3300050507 Bacteria 48338
984 nmdc:mga05p37_48824_c1 3300050507 Bacteria 5204
985 nmdc:mga09592_38885_c1 3300050508 Bacteria 3995
986 nmdc:mga09592_5152_c1 3300050508 Bacteria 10621
987 nmdc:mga09592_7356_c1 3300050508 Bacteria 8951
988 nmdc:mga09592_83007_c1 3300050508 Bacteria 2731
989 nmdc:mga0qj67_120882_c1 3300050509 Bacteria 2119
990 nmdc:mga0qj67_26463_c1 3300050509 Bacteria 4491
991 nmdc:mga0qj67_37243_c1 3300050509 Bacteria 3809
992 nmdc:mga0qj67_9055_c1 3300050509 Bacteria 7389
993 nmdc:mga06r32_14230_c1 3300050510 Bacteria 7216
994 nmdc:mga06r32_2531_c1 3300050510 Bacteria 16356
995 nmdc:mga06r32_75337_c1 3300050510 Bacteria 3274
996 nmdc:mga06r32_931_c1 3300050510 Bacteria 26013
997 nmdc:mga06r32_9987_c1 3300050510 Bacteria 8565
998 nmdc:mga08y16_107_c1 3300050511 Bacteria 69847
999 nmdc:mga08y16_1865_c1 3300050511 Bacteria 21428
1000 nmdc:mga08y16_2031_c1 3300050511 Bacteria 20733
1001 nmdc:mga08y16_246771_c1 3300050511 Unclassified 1845
1002 nmdc:mga08y16_30420_c1 3300050511 Bacteria 5683
1003 nmdc:mga08y16_61288_c1 3300050511 Bacteria 3928
1004 nmdc:mga0n895_171934_c1 3300050512 Bacteria 2199
1005 nmdc:mga0n895_359242_c1 3300050512 Bacteria 1475
1006 nmdc:mga0n895_5417_c1 3300050512 Bacteria 10661
1007 nmdc:mga0n895_8059_c1 3300050512 Bacteria 9092
1008 nmdc:mga0n895_9034_c1 3300050512 Bacteria 8692
1009 nmdc:mga0rr50_102381_c1 3300050513 Bacteria 2253
1010 nmdc:mga0rr50_10240_c1 3300050513 Bacteria 5939
1011 nmdc:mga0rr50_1332_c1 3300050513 Bacteria 13470
1012 nmdc:mga0rr50_141010_c1 3300050513 Bacteria 1939
1013 nmdc:mga0rr50_158703_c1 3300050513 Bacteria 1834
1014 nmdc:mga0rr50_317415_c1 3300050513 Bacteria 1306
1015 nmdc:mga08x19_385_c1 3300050514 Bacteria 31031
1016 nmdc:mga08x19_58692_c1 3300050514 Bacteria 2490
1017 nmdc:mga0a205_2168_c1 3300050515 Bacteria 17263
1018 nmdc:mga0a205_30759_c1 3300050515 Bacteria 5142
1019 nmdc:mga0a205_66835_c1 3300050515 Bacteria 3473
1020 nmdc:mga0a205_72932_c1 3300050515 Bacteria 3317
1021 Ga0495601_0003707 3300053077 Bacteria 8793
1022 Ga0495601_0038284 3300053077 Bacteria 2998
1023 Ga0495601_0041622 3300053077 Bacteria 2881
1024 Ga0495601_0072682 3300053077 Bacteria 2197
1025 Ga0495612_0000762 3300053078 Bacteria 13137
1026 Ga0495612_0010430 3300053078 Bacteria 3758
1027 Ga0495612_0013611 3300053078 Bacteria 3276
1028 Ga0495612_0030805 3300053078 Bacteria 2161
1029 Ga0495612_0046974 3300053078 Bacteria 1768
1030 Ga0495655_0009026 3300053083 Bacteria 1917
1031 Ga0495655_0014475 3300053083 Bacteria 1655
1032 Ga0495595_0000429 3300053084 Bacteria 15919
1033 Ga0495595_0001679 3300053084 Bacteria 8666
1034 Ga0495595_0002216 3300053084 Bacteria 7554
1035 Ga0495595_0005618 3300053084 Bacteria 5076
1036 Ga0495595_0061915 3300053084 Bacteria 1753
1037 Ga0495619_0000043 3300053085 Bacteria 109865
1038 Ga0495619_0000551 3300053085 Bacteria 24828
1039 Ga0495619_0068872 3300053085 Bacteria 2365
1040 Ga0495619_0071319 3300053085 Bacteria 2324
1041 Ga0495619_0138389 3300053085 Bacteria 1675
1042 Ga0500650_0003295 3300053098 Bacteria 5578
1043 Ga0500658_0003937 3300053134 Bacteria 5578
1044 Ga0501084_0177498 3300054114 Bacteria 1798
1045 Ga0501082_0227397 3300060353 Bacteria 1624
1046 Ga0466962_0121814 3300061719 Bacteria 1259

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300007265 Ga0099794_10074346 Ga0099794_100743462 288
2 3300035695 Ga0373927_0149038 Ga0373927_0149038_216_1184 289
3 3300006194 Ga0075427_10000004 Ga0075427_100000045 300
4 3300006844 Ga0075428_100008326 Ga0075428_10000832611 300
5 3300006846 Ga0075430_100001186 Ga0075430_10000118612 300
6 3300006847 Ga0075431_100001446 Ga0075431_10000144611 300
7 3300006871 Ga0075434_100003016 Ga0075434_10000301612 300
8 3300006880 Ga0075429_100002098 Ga0075429_10000209817 300
9 3300009094 Ga0111539_10002796 Ga0111539_1000279620 300
10 3300050507 nmdc:mga05p37_2463_c1 nmdc:mga05p37_2463_c1_10220_11194 300
11 3300050509 nmdc:mga0qj67_9055_c1 nmdc:mga0qj67_9055_c1_1088_2062 300
12 3300050510 nmdc:mga06r32_2531_c1 nmdc:mga06r32_2531_c1_11368_12342 300
13 3300050512 nmdc:mga0n895_9034_c1 nmdc:mga0n895_9034_c1_3180_4154 300
14 3300050515 nmdc:mga0a205_2168_c1 nmdc:mga0a205_2168_c1_15074_16048 300
15 3300009553 Ga0105249_10062903 Ga0105249_100629034 303
16 3300013297 Ga0157378_10025519 Ga0157378_100255194 303
17 3300013306 Ga0163162_10039558 Ga0163162_100395582 303
18 3300014968 Ga0157379_10023314 Ga0157379_100233144 303
19 3300049571 Ga0501034_0356044 Ga0501034_0356044_336_1313 303
20 3300035119 Ga0373956_0026502 Ga0373956_0026502_842_1762 304
21 3300046683 Ga0495658_0147524 Ga0495658_0147524_135_1103 304
22 3300028794 Ga0307515_10006871 Ga0307515_1000687119 305
23 3300031456 Ga0307513_10241854 Ga0307513_102418542 305
24 3300046615 Ga0495656_0000398 Ga0495656_0000398_2702_3634 305
25 3300048090 Ga0495615_0004243 Ga0495615_0004243_281_1213 305
26 3300046516 Ga0495628_0434381 Ga0495628_0434381_18_938 306
27 3300048906 Ga0496103_0070530 Ga0496103_0070530_11_931 306
28 3300049743 Ga0501081_0046735 Ga0501081_0046735_1676_2605 306
29 3300006844 Ga0075428_100114044 Ga0075428_1001140442 307
30 3300009147 Ga0114129_10595896 Ga0114129_105958961 307
31 3300035692 Ga0373935_0088090 Ga0373935_0088090_956_1924 307
32 3300037068 Ga0373925_0280354 Ga0373925_0280354_308_1276 307
33 3300047319 Ga0495674_0129671 Ga0495674_0129671_895_1863 307
34 3300050507 nmdc:mga05p37_267242_c1 nmdc:mga05p37_267242_c1_688_1617 307
35 3300050509 nmdc:mga0qj67_26463_c1 nmdc:mga0qj67_26463_c1_3505_4434 307
36 3300050510 nmdc:mga06r32_9987_c1 nmdc:mga06r32_9987_c1_6032_6961 307
37 3300050493 nmdc:mga0k408_83588_c1 nmdc:mga0k408_83588_c1_193_1182 308
38 3300053098 Ga0500650_0003295 Ga0500650_0003295_2802_3767 309
39 3300006880 Ga0075429_100002095 Ga0075429_10000209516 310
40 3300009148 Ga0105243_10017699 Ga0105243_100176992 310
41 3300047445 Ga0495677_0030178 Ga0495677_0030178_1026_1958 310
42 3300050493 nmdc:mga0k408_108548_c1 nmdc:mga0k408_108548_c1_659_1600 310
43 3300050508 nmdc:mga09592_7356_c1 nmdc:mga09592_7356_c1_5437_6435 310
44 3300013104 Ga0157370_10342441 Ga0157370_103424412 311
45 3300041451 Ga0451791_1369153 Ga0451791_1369153_147_1103 311
46 3300046663 Ga0495635_0067515 Ga0495635_0067515_543_1499 311
47 3300049588 Ga0501072_0155913 Ga0501072_0155913_306_1280 311
48 3300050489 nmdc:mga03683_10383_c1 nmdc:mga03683_10383_c1_753_1706 311
49 3300050496 nmdc:mga07m45_121801_c1 nmdc:mga07m45_121801_c1_163_1119 311
50 3300053134 Ga0500658_0003937 Ga0500658_0003937_4389_5342 311
51 3300028786 Ga0307517_10102413 Ga0307517_101024132 312
52 3300005436 Ga0070713_100276308 Ga0070713_1002763082 313
53 3300005578 Ga0068854_100249853 Ga0068854_1002498532 313
54 3300009545 Ga0105237_10034574 Ga0105237_100345744 313
55 3300025901 Ga0207688_10004456 Ga0207688_100044565 313
56 3300046536 Ga0495587_0079163 Ga0495587_0079163_799_1785 313
57 3300050493 nmdc:mga0k408_2957_c1 nmdc:mga0k408_2957_c1_2985_4091 313
58 3300050494 nmdc:mga06z11_181717_c1 nmdc:mga06z11_181717_c1_58_1164 313
59 3300053083 Ga0495655_0009026 Ga0495655_0009026_144_1130 313
60 3300053085 Ga0495619_0068872 Ga0495619_0068872_321_1307 313
61 3300003771 Ga0055526_1000027 Ga0055526_100002712 314
62 3300005434 Ga0070709_10081081 Ga0070709_100810812 314
63 3300006871 Ga0075434_100128389 Ga0075434_1001283893 314
64 3300007076 Ga0075435_100112730 Ga0075435_1001127301 314
65 3300015683 Ga0183362_10003 Ga0183362_10003256 314
66 3300025295 Ga0209564_1000180 Ga0209564_1000180131 314
67 3300025906 Ga0207699_10176231 Ga0207699_101762312 314
68 3300048907 Ga0496104_0095263 Ga0496104_0095263_1727_2704 314
69 3300048911 Ga0496108_0050893 Ga0496108_0050893_1817_2794 314
70 3300048912 Ga0496109_0031840 Ga0496109_0031840_923_1900 314
71 3300048913 Ga0496110_0032183 Ga0496110_0032183_1717_2694 314
72 3300048914 Ga0496111_0007504 Ga0496111_0007504_4459_5436 314
73 3300050512 nmdc:mga0n895_359242_c1 nmdc:mga0n895_359242_c1_144_1109 314
74 3300050513 nmdc:mga0rr50_141010_c1 nmdc:mga0rr50_141010_c1_826_1791 314
75 iso_pu_bacteria 2929199973 2929203833 314
76 iso_pu_bacteria 8055909800 8055912852 314
77 3300005459 Ga0068867_100000587 Ga0068867_10000058722 315
78 3300005842 Ga0068858_100184407 Ga0068858_1001844071 315
79 3300005843 Ga0068860_100001400 Ga0068860_10000140012 315
80 3300005937 Ga0081455_10120639 Ga0081455_101206392 315
81 3300014968 Ga0157379_10043364 Ga0157379_100433643 315
82 3300025961 Ga0207712_10028278 Ga0207712_100282782 315
83 3300025972 Ga0207668_10379019 Ga0207668_103790192 315
84 3300026035 Ga0207703_10160125 Ga0207703_101601253 315
85 3300026089 Ga0207648_10001396 Ga0207648_100013966 315
86 3300028380 Ga0268265_10004180 Ga0268265_1000418010 315
87 3300028380 Ga0268265_10086908 Ga0268265_100869082 315
88 3300028381 Ga0268264_10002438 Ga0268264_1000243815 315
89 3300035118 Ga0373954_0016689 Ga0373954_0016689_946_1914 315
90 3300035170 Ga0373943_0179214 Ga0373943_0179214_94_1056 315
91 3300035695 Ga0373927_0142822 Ga0373927_0142822_384_1346 315
92 3300046542 Ga0495597_0022818 Ga0495597_0022818_1690_2658 315
93 3300046683 Ga0495658_0080063 Ga0495658_0080063_871_1833 315
94 3300047443 Ga0495687_002565 Ga0495687_002565_10868_11836 315
95 3300049583 Ga0501067_0127125 Ga0501067_0127125_118_1080 315
96 3300050493 nmdc:mga0k408_20733_c1 nmdc:mga0k408_20733_c1_1677_2639 315
97 3300050514 nmdc:mga08x19_385_c1 nmdc:mga08x19_385_c1_26151_27134 315
98 iso_pu_bacteria 2894772417 2894772972 315
99 3300005334 Ga0068869_100185037 Ga0068869_1001850372 316
100 3300005354 Ga0070675_100009313 Ga0070675_1000093132 316
101 3300005364 Ga0070673_100011912 Ga0070673_1000119122 316
102 3300005578 Ga0068854_100053390 Ga0068854_1000533901 316
103 3300005616 Ga0068852_100047119 Ga0068852_1000471192 316
104 3300006178 Ga0075367_10050287 Ga0075367_100502872 316
105 3300006353 Ga0075370_10058571 Ga0075370_100585712 316
106 3300006871 Ga0075434_100300829 Ga0075434_1003008292 316
107 3300009098 Ga0105245_10373271 Ga0105245_103732712 316
108 3300009148 Ga0105243_10039541 Ga0105243_100395411 316
109 3300009545 Ga0105237_10018759 Ga0105237_100187594 316
110 3300010375 Ga0105239_10004906 Ga0105239_100049064 316
111 3300025926 Ga0207659_10061612 Ga0207659_100616123 316
112 3300025927 Ga0207687_10262886 Ga0207687_102628862 316
113 3300025933 Ga0207706_10027904 Ga0207706_100279045 316
114 3300025940 Ga0207691_10336941 Ga0207691_103369411 316
115 3300025942 Ga0207689_10156942 Ga0207689_101569422 316
116 3300025960 Ga0207651_10031071 Ga0207651_100310713 316
117 3300025960 Ga0207651_10168286 Ga0207651_101682862 316
118 3300026089 Ga0207648_10255151 Ga0207648_102551512 316
119 3300026116 Ga0207674_10005570 Ga0207674_1000557011 316
120 3300036401 Ga0373937_0097894 Ga0373937_0097894_285_1256 316
121 3300037068 Ga0373925_0036705 Ga0373925_0036705_1325_2293 316
122 3300046683 Ga0495658_0010561 Ga0495658_0010561_1812_2780 316
123 3300050491 nmdc:mga00v17_97392_c1 nmdc:mga00v17_97392_c1_556_1527 316
124 3300050496 nmdc:mga07m45_12419_c1 nmdc:mga07m45_12419_c1_1637_2608 316
125 3300003203 JGI25406J46586_10004753 JGI25406J46586_100047534 317
126 3300005331 Ga0070670_100069446 Ga0070670_1000694462 317
127 3300005347 Ga0070668_100007916 Ga0070668_1000079161 317
128 3300005353 Ga0070669_100008715 Ga0070669_1000087158 317
129 3300005364 Ga0070673_100011342 Ga0070673_1000113422 317
130 3300005367 Ga0070667_100088218 Ga0070667_1000882182 317
131 3300005456 Ga0070678_100222051 Ga0070678_1002220511 317
132 3300005457 Ga0070662_100050332 Ga0070662_1000503322 317
133 3300005543 Ga0070672_100056051 Ga0070672_1000560512 317
134 3300005618 Ga0068864_100002660 Ga0068864_1000026604 317
135 3300005841 Ga0068863_100023141 Ga0068863_1000231414 317
136 3300005841 Ga0068863_100322454 Ga0068863_1003224542 317
137 3300005985 Ga0081539_10000169 Ga0081539_10000169145 317
138 3300006844 Ga0075428_100378678 Ga0075428_1003786782 317
139 3300006852 Ga0075433_10033704 Ga0075433_100337043 317
140 3300006871 Ga0075434_100142282 Ga0075434_1001422824 317
141 3300009147 Ga0114129_10116731 Ga0114129_101167314 317
142 3300013296 Ga0157374_10171180 Ga0157374_101711802 317
143 3300014325 Ga0163163_10096542 Ga0163163_100965423 317
144 3300014326 Ga0157380_10048023 Ga0157380_100480233 317
145 3300017792 Ga0163161_10247200 Ga0163161_102472002 317
146 3300025925 Ga0207650_10032976 Ga0207650_100329763 317
147 3300025925 Ga0207650_10087637 Ga0207650_100876372 317
148 3300025926 Ga0207659_10155828 Ga0207659_101558281 317
149 3300025933 Ga0207706_10017802 Ga0207706_100178023 317
150 3300025940 Ga0207691_10002245 Ga0207691_1000224510 317
151 3300025960 Ga0207651_10179722 Ga0207651_101797222 317
152 3300025972 Ga0207668_10012166 Ga0207668_100121664 317
153 3300025986 Ga0207658_10066673 Ga0207658_100666732 317
154 3300026088 Ga0207641_10392280 Ga0207641_103922801 317
155 3300026095 Ga0207676_10003967 Ga0207676_100039673 317
156 3300048915 Ga0496112_0255877 Ga0496112_0255877_420_1439 317
157 3300049576 Ga0501040_0230506 Ga0501040_0230506_114_1118 317
158 3300049588 Ga0501072_0239576 Ga0501072_0239576_221_1225 317
159 3300050508 nmdc:mga09592_83007_c1 nmdc:mga09592_83007_c1_687_1658 317
160 3300050510 nmdc:mga06r32_75337_c1 nmdc:mga06r32_75337_c1_1693_2664 317
161 3300054114 Ga0501084_0177498 Ga0501084_0177498_405_1409 317
162 3300060353 Ga0501082_0227397 Ga0501082_0227397_221_1225 317
163 3300005937 Ga0081455_10002005 Ga0081455_100020054 318
164 3300005981 Ga0081538_10027111 Ga0081538_100271113 318
165 3300007788 Ga0099795_10000065 Ga0099795_100000653 318
166 3300010159 Ga0099796_10011509 Ga0099796_100115092 318
167 3300013105 Ga0157369_10279705 Ga0157369_102797053 318
168 3300025940 Ga0207691_10095237 Ga0207691_100952372 318
169 3300027512 Ga0209179_1000797 Ga0209179_10007972 318
170 3300030522 Ga0307512_10023853 Ga0307512_100238533 318
171 3300031247 Ga0265340_10008082 Ga0265340_100080825 318
172 3300031507 Ga0307509_10000225 Ga0307509_1000022586 318
173 3300031649 Ga0307514_10030744 Ga0307514_100307444 318
174 3300031712 Ga0265342_10096067 Ga0265342_100960672 318
175 3300031852 Ga0307410_10327580 Ga0307410_103275802 318
176 3300031995 Ga0307409_100009307 Ga0307409_1000093074 318
177 3300032002 Ga0307416_100043851 Ga0307416_1000438514 318
178 3300042461 Ga0439460_0045514 Ga0439460_0045514_194_1159 318
179 3300048907 Ga0496104_0000629 Ga0496104_0000629_27420_28397 318
180 3300048911 Ga0496108_0370744 Ga0496108_0370744_89_1057 318
181 3300048918 Ga0496115_0204142 Ga0496115_0204142_246_1223 318
182 3300049578 Ga0501042_0278548 Ga0501042_0278548_99_1088 318
183 3300050511 nmdc:mga08y16_30420_c1 nmdc:mga08y16_30420_c1_3748_4713 318
184 3300003203 JGI25406J46586_10037191 JGI25406J46586_100371911 319
185 3300005937 Ga0081455_10033784 Ga0081455_100337845 319
186 3300005985 Ga0081539_10002225 Ga0081539_1000222527 319
187 3300006844 Ga0075428_100001565 Ga0075428_10000156519 319
188 3300006844 Ga0075428_100276708 Ga0075428_1002767082 319
189 3300006844 Ga0075428_100293266 Ga0075428_1002932662 319
190 3300006846 Ga0075430_100042149 Ga0075430_1000421494 319
191 3300006846 Ga0075430_100112812 Ga0075430_1001128122 319
192 3300006846 Ga0075430_100270664 Ga0075430_1002706642 319
193 3300006847 Ga0075431_100000584 Ga0075431_1000005849 319
194 3300006847 Ga0075431_100258581 Ga0075431_1002585812 319
195 3300006847 Ga0075431_100457943 Ga0075431_1004579432 319
196 3300006880 Ga0075429_100003512 Ga0075429_1000035124 319
197 3300006880 Ga0075429_100256367 Ga0075429_1002563671 319
198 3300009094 Ga0111539_10000705 Ga0111539_1000070514 319
199 3300009147 Ga0114129_10000057 Ga0114129_1000005753 319
200 3300009551 Ga0105238_10039159 Ga0105238_100391593 319
201 3300013307 Ga0157372_10530880 Ga0157372_105308801 319
202 3300025944 Ga0207661_10245083 Ga0207661_102450832 319
203 3300027907 Ga0207428_10009210 Ga0207428_100092104 319
204 3300028379 Ga0268266_10143756 Ga0268266_101437562 319
205 3300031247 Ga0265340_10023536 Ga0265340_100235363 319
206 3300031456 Ga0307513_10200042 Ga0307513_102000422 319
207 3300035724 Ga0373933_0012239 Ga0373933_0012239_625_1590 319
208 3300037853 Ga0436364_0928179 Ga0436364_0928179_741_1709 319
209 3300039437 Ga0436365_0314634 Ga0436365_0314634_3920_4888 319
210 3300039437 Ga0436365_1628126 Ga0436365_1628126_3022_3990 319
211 3300044694 Ga0466963_0001958 Ga0466963_0001958_2255_3214 319
212 3300045976 Ga0466967_0004256 Ga0466967_0004256_385_1344 319
213 3300046663 Ga0495635_0197624 Ga0495635_0197624_258_1223 319
214 3300048907 Ga0496104_0245738 Ga0496104_0245738_246_1214 319
215 3300048908 Ga0496105_0199409 Ga0496105_0199409_505_1473 319
216 3300050507 nmdc:mga05p37_368_c1 nmdc:mga05p37_368_c1_12925_13899 319
217 3300050508 nmdc:mga09592_5152_c1 nmdc:mga09592_5152_c1_2584_3558 319
218 3300050509 nmdc:mga0qj67_37243_c1 nmdc:mga0qj67_37243_c1_581_1555 319
219 3300050510 nmdc:mga06r32_931_c1 nmdc:mga06r32_931_c1_23121_24095 319
220 3300050511 nmdc:mga08y16_107_c1 nmdc:mga08y16_107_c1_44268_45242 319
221 3300053077 Ga0495601_0072682 Ga0495601_0072682_82_1047 319
222 3300053078 Ga0495612_0010430 Ga0495612_0010430_1243_2208 319
223 3300053084 Ga0495595_0061915 Ga0495595_0061915_678_1643 319
224 3300053085 Ga0495619_0138389 Ga0495619_0138389_639_1607 319
225 2162886007 SwRhRL2b_contig_2195022 SwRhRL2b_0032.00001900 320
226 2209111006 2214745199 2213754594 320
227 3300000041 ARcpr5oldR_c000024 ARcpr5oldR_0000249 320
228 3300000042 ARSoilYngRDRAFT_c00084 ARSoilYngRDRAFT_000849 320
229 3300000043 ARcpr5yngRDRAFT_c000226 ARcpr5yngRDRAFT_0002263 320
230 3300000044 ARSoilOldRDRAFT_c000027 ARSoilOldRDRAFT_0000279 320
231 3300000045 ARCol0oldRDRAFT_c00301 ARCol0oldRDRAFT_003015 320
232 3300000652 ARCol0yngRDRAFT_1000016 ARCol0yngRDRAFT_10000169 320
233 3300001430 JGI24032J14994_100052 JGI24032J14994_1000522 320
234 3300001904 JGI24736J21556_1013491 JGI24736J21556_10134912 320
235 3300001978 JGI24747J21853_1000417 JGI24747J21853_10004172 320
236 3300001979 JGI24740J21852_10017965 JGI24740J21852_100179654 320
237 3300001989 JGI24739J22299_10000472 JGI24739J22299_100004729 320
238 3300001990 JGI24737J22298_10000645 JGI24737J22298_1000064510 320
239 3300001990 JGI24737J22298_10012061 JGI24737J22298_100120612 320
240 3300001991 JGI24743J22301_10005214 JGI24743J22301_100052143 320
241 3300001991 JGI24743J22301_10022695 JGI24743J22301_100226951 320
242 3300002070 JGI24750J21931_1000292 JGI24750J21931_10002923 320
243 3300002070 JGI24750J21931_1002828 JGI24750J21931_10028281 320
244 3300002073 JGI24745J21846_1000564 JGI24745J21846_10005644 320
245 3300002074 JGI24748J21848_1000222 JGI24748J21848_10002226 320
246 3300002076 JGI24749J21850_1000285 JGI24749J21850_10002858 320
247 3300002076 JGI24749J21850_1001196 JGI24749J21850_10011963 320
248 3300002077 JGI24744J21845_10007239 JGI24744J21845_100072392 320
249 3300002244 JGI24742J22300_10000119 JGI24742J22300_100001198 320
250 3300002459 JGI24751J29686_10003797 JGI24751J29686_100037973 320
251 3300003911 JGI25405J52794_10005552 JGI25405J52794_100055522 320
252 3300005277 Ga0065716_1002390 Ga0065716_10023902 320
253 3300005289 Ga0065704_10009680 Ga0065704_100096802 320
254 3300005290 Ga0065712_10001193 Ga0065712_100011932 320
255 3300005290 Ga0065712_10092882 Ga0065712_100928821 320
256 3300005293 Ga0065715_10000313 Ga0065715_100003137 320
257 3300005293 Ga0065715_10005544 Ga0065715_100055442 320
258 3300005293 Ga0065715_10125061 Ga0065715_101250611 320
259 3300005328 Ga0070676_10001294 Ga0070676_100012945 320
260 3300005328 Ga0070676_10070817 Ga0070676_100708172 320
261 3300005328 Ga0070676_10113661 Ga0070676_101136612 320
262 3300005329 Ga0070683_100000384 Ga0070683_10000038419 320
263 3300005330 Ga0070690_100017855 Ga0070690_1000178553 320
264 3300005330 Ga0070690_100031974 Ga0070690_1000319742 320
265 3300005331 Ga0070670_100006373 Ga0070670_1000063738 320
266 3300005331 Ga0070670_100046837 Ga0070670_1000468373 320
267 3300005331 Ga0070670_100104882 Ga0070670_1001048822 320
268 3300005333 Ga0070677_10000366 Ga0070677_100003666 320
269 3300005334 Ga0068869_100000588 Ga0068869_10000058811 320
270 3300005334 Ga0068869_100099356 Ga0068869_1000993563 320
271 3300005335 Ga0070666_10046494 Ga0070666_100464942 320
272 3300005335 Ga0070666_10181614 Ga0070666_101816141 320
273 3300005336 Ga0070680_100003315 Ga0070680_1000033154 320
274 3300005336 Ga0070680_100017912 Ga0070680_1000179125 320
275 3300005336 Ga0070680_100212059 Ga0070680_1002120592 320
276 3300005336 Ga0070680_100213375 Ga0070680_1002133752 320
277 3300005336 Ga0070680_100313385 Ga0070680_1003133852 320
278 3300005337 Ga0070682_100001303 Ga0070682_10000130312 320
279 3300005337 Ga0070682_100011027 Ga0070682_1000110275 320
280 3300005337 Ga0070682_100157117 Ga0070682_1001571171 320
281 3300005338 Ga0068868_100007694 Ga0068868_1000076947 320
282 3300005338 Ga0068868_100010823 Ga0068868_1000108236 320
283 3300005338 Ga0068868_100031315 Ga0068868_1000313153 320
284 3300005338 Ga0068868_100051465 Ga0068868_1000514653 320
285 3300005339 Ga0070660_100006474 Ga0070660_1000064746 320
286 3300005339 Ga0070660_100113131 Ga0070660_1001131312 320
287 3300005339 Ga0070660_100170733 Ga0070660_1001707332 320
288 3300005340 Ga0070689_100001250 Ga0070689_10000125016 320
289 3300005340 Ga0070689_100022333 Ga0070689_1000223332 320
290 3300005340 Ga0070689_100056025 Ga0070689_1000560252 320
291 3300005340 Ga0070689_100108293 Ga0070689_1001082933 320
292 3300005341 Ga0070691_10000616 Ga0070691_100006165 320
293 3300005341 Ga0070691_10028317 Ga0070691_100283172 320
294 3300005341 Ga0070691_10080735 Ga0070691_100807352 320
295 3300005343 Ga0070687_100002805 Ga0070687_1000028055 320
296 3300005343 Ga0070687_100022541 Ga0070687_1000225412 320
297 3300005343 Ga0070687_100161850 Ga0070687_1001618501 320
298 3300005344 Ga0070661_100001627 Ga0070661_1000016276 320
299 3300005344 Ga0070661_100034366 Ga0070661_1000343663 320
300 3300005344 Ga0070661_100082007 Ga0070661_1000820071 320
301 3300005345 Ga0070692_10000719 Ga0070692_100007197 320
302 3300005345 Ga0070692_10078659 Ga0070692_100786593 320
303 3300005347 Ga0070668_100001772 Ga0070668_10000177215 320
304 3300005347 Ga0070668_100126854 Ga0070668_1001268543 320
305 3300005353 Ga0070669_100002584 Ga0070669_10000258412 320
306 3300005354 Ga0070675_100013013 Ga0070675_1000130134 320
307 3300005354 Ga0070675_100089854 Ga0070675_1000898544 320
308 3300005354 Ga0070675_100193666 Ga0070675_1001936662 320
309 3300005355 Ga0070671_100003610 Ga0070671_1000036108 320
310 3300005356 Ga0070674_100000598 Ga0070674_1000005987 320
311 3300005356 Ga0070674_100107301 Ga0070674_1001073013 320
312 3300005364 Ga0070673_100000255 Ga0070673_10000025524 320
313 3300005364 Ga0070673_100026950 Ga0070673_1000269504 320
314 3300005365 Ga0070688_100005214 Ga0070688_1000052144 320
315 3300005365 Ga0070688_100057375 Ga0070688_1000573753 320
316 3300005366 Ga0070659_100005703 Ga0070659_1000057035 320
317 3300005367 Ga0070667_100003947 Ga0070667_1000039473 320
318 3300005367 Ga0070667_100052781 Ga0070667_1000527812 320
319 3300005367 Ga0070667_100300005 Ga0070667_1003000052 320
320 3300005434 Ga0070709_10014657 Ga0070709_100146573 320
321 3300005434 Ga0070709_10015858 Ga0070709_100158587 320
322 3300005435 Ga0070714_100014498 Ga0070714_1000144986 320
323 3300005435 Ga0070714_100029784 Ga0070714_1000297846 320
324 3300005435 Ga0070714_100067295 Ga0070714_1000672954 320
325 3300005436 Ga0070713_100002318 Ga0070713_1000023185 320
326 3300005436 Ga0070713_100003244 Ga0070713_10000324411 320
327 3300005436 Ga0070713_100067968 Ga0070713_1000679682 320
328 3300005439 Ga0070711_100004584 Ga0070711_1000045848 320
329 3300005439 Ga0070711_100007766 Ga0070711_1000077668 320
330 3300005439 Ga0070711_100043251 Ga0070711_1000432516 320
331 3300005439 Ga0070711_100068223 Ga0070711_1000682232 320
332 3300005439 Ga0070711_100169787 Ga0070711_1001697873 320
333 3300005440 Ga0070705_100000971 Ga0070705_10000097116 320
334 3300005440 Ga0070705_100183681 Ga0070705_1001836812 320
335 3300005441 Ga0070700_100000495 Ga0070700_10000049512 320
336 3300005444 Ga0070694_100004679 Ga0070694_1000046796 320
337 3300005445 Ga0070708_100077192 Ga0070708_1000771923 320
338 3300005455 Ga0070663_100001070 Ga0070663_10000107013 320
339 3300005455 Ga0070663_100088958 Ga0070663_1000889583 320
340 3300005456 Ga0070678_100000552 Ga0070678_1000005524 320
341 3300005456 Ga0070678_100013095 Ga0070678_1000130953 320
342 3300005456 Ga0070678_100028784 Ga0070678_1000287842 320
343 3300005456 Ga0070678_100047267 Ga0070678_1000472672 320
344 3300005456 Ga0070678_100114528 Ga0070678_1001145282 320
345 3300005456 Ga0070678_100178175 Ga0070678_1001781752 320
346 3300005457 Ga0070662_100003388 Ga0070662_1000033885 320
347 3300005457 Ga0070662_100091451 Ga0070662_1000914511 320
348 3300005458 Ga0070681_10004188 Ga0070681_1000418812 320
349 3300005458 Ga0070681_10105385 Ga0070681_101053852 320
350 3300005458 Ga0070681_10108821 Ga0070681_101088212 320
351 3300005458 Ga0070681_10211860 Ga0070681_102118602 320
352 3300005459 Ga0068867_100012780 Ga0068867_1000127804 320
353 3300005459 Ga0068867_100109962 Ga0068867_1001099622 320
354 3300005466 Ga0070685_10002610 Ga0070685_1000261010 320
355 3300005466 Ga0070685_10021537 Ga0070685_100215372 320
356 3300005466 Ga0070685_10102274 Ga0070685_101022742 320
357 3300005530 Ga0070679_100138184 Ga0070679_1001381841 320
358 3300005530 Ga0070679_100145489 Ga0070679_1001454892 320
359 3300005530 Ga0070679_100227573 Ga0070679_1002275731 320
360 3300005530 Ga0070679_100232037 Ga0070679_1002320371 320
361 3300005530 Ga0070679_100259105 Ga0070679_1002591051 320
362 3300005535 Ga0070684_100001501 Ga0070684_1000015016 320
363 3300005539 Ga0068853_100001914 Ga0068853_10000191411 320
364 3300005539 Ga0068853_100333703 Ga0068853_1003337032 320
365 3300005543 Ga0070672_100000442 Ga0070672_10000044215 320
366 3300005543 Ga0070672_100063856 Ga0070672_1000638565 320
367 3300005543 Ga0070672_100073889 Ga0070672_1000738895 320
368 3300005543 Ga0070672_100192255 Ga0070672_1001922551 320
369 3300005543 Ga0070672_100357396 Ga0070672_1003573962 320
370 3300005544 Ga0070686_100002692 Ga0070686_1000026926 320
371 3300005544 Ga0070686_100094725 Ga0070686_1000947252 320
372 3300005546 Ga0070696_100006734 Ga0070696_1000067344 320
373 3300005546 Ga0070696_100013242 Ga0070696_1000132426 320
374 3300005547 Ga0070693_100000492 Ga0070693_1000004927 320
375 3300005547 Ga0070693_100006083 Ga0070693_1000060832 320
376 3300005547 Ga0070693_100017245 Ga0070693_1000172453 320
377 3300005547 Ga0070693_100022943 Ga0070693_1000229432 320
378 3300005548 Ga0070665_100037138 Ga0070665_1000371383 320
379 3300005548 Ga0070665_100037390 Ga0070665_1000373907 320
380 3300005548 Ga0070665_100280783 Ga0070665_1002807832 320
381 3300005549 Ga0070704_100004657 Ga0070704_1000046573 320
382 3300005549 Ga0070704_100092172 Ga0070704_1000921723 320
383 3300005563 Ga0068855_100004881 Ga0068855_10000488113 320
384 3300005563 Ga0068855_100165810 Ga0068855_1001658102 320
385 3300005564 Ga0070664_100009800 Ga0070664_1000098004 320
386 3300005564 Ga0070664_100090475 Ga0070664_1000904752 320
387 3300005564 Ga0070664_100099406 Ga0070664_1000994064 320
388 3300005564 Ga0070664_100173256 Ga0070664_1001732563 320
389 3300005577 Ga0068857_100002803 Ga0068857_1000028036 320
390 3300005577 Ga0068857_100113891 Ga0068857_1001138912 320
391 3300005578 Ga0068854_100003844 Ga0068854_1000038447 320
392 3300005578 Ga0068854_100019418 Ga0068854_1000194184 320
393 3300005614 Ga0068856_100000863 Ga0068856_10000086312 320
394 3300005614 Ga0068856_100076202 Ga0068856_1000762024 320
395 3300005614 Ga0068856_100212529 Ga0068856_1002125292 320
396 3300005616 Ga0068852_100016931 Ga0068852_1000169316 320
397 3300005616 Ga0068852_100075492 Ga0068852_1000754922 320
398 3300005617 Ga0068859_100017372 Ga0068859_1000173725 320
399 3300005617 Ga0068859_100035958 Ga0068859_1000359584 320
400 3300005617 Ga0068859_100053230 Ga0068859_1000532306 320
401 3300005617 Ga0068859_100059495 Ga0068859_1000594952 320
402 3300005617 Ga0068859_100326418 Ga0068859_1003264181 320
403 3300005618 Ga0068864_100001441 Ga0068864_1000014417 320
404 3300005618 Ga0068864_100012607 Ga0068864_1000126072 320
405 3300005618 Ga0068864_100014014 Ga0068864_1000140147 320
406 3300005618 Ga0068864_100082925 Ga0068864_1000829253 320
407 3300005618 Ga0068864_100092895 Ga0068864_1000928952 320
408 3300005618 Ga0068864_100204144 Ga0068864_1002041442 320
409 3300005718 Ga0068866_10000723 Ga0068866_1000072313 320
410 3300005718 Ga0068866_10008361 Ga0068866_100083614 320
411 3300005718 Ga0068866_10077224 Ga0068866_100772242 320
412 3300005719 Ga0068861_100000840 Ga0068861_10000084018 320
413 3300005719 Ga0068861_100007748 Ga0068861_1000077488 320
414 3300005719 Ga0068861_100177197 Ga0068861_1001771972 320
415 3300005834 Ga0068851_10026372 Ga0068851_100263722 320
416 3300005840 Ga0068870_10000302 Ga0068870_1000030218 320
417 3300005840 Ga0068870_10001054 Ga0068870_100010546 320
418 3300005840 Ga0068870_10018269 Ga0068870_100182692 320
419 3300005841 Ga0068863_100033650 Ga0068863_1000336504 320
420 3300005841 Ga0068863_100046329 Ga0068863_1000463295 320
421 3300005842 Ga0068858_100011645 Ga0068858_1000116455 320
422 3300005842 Ga0068858_100012780 Ga0068858_1000127807 320
423 3300005842 Ga0068858_100403408 Ga0068858_1004034081 320
424 3300005843 Ga0068860_100004558 Ga0068860_1000045584 320
425 3300005843 Ga0068860_100055279 Ga0068860_1000552793 320
426 3300005843 Ga0068860_100443607 Ga0068860_1004436072 320
427 3300005844 Ga0068862_100002629 Ga0068862_1000026296 320
428 3300005844 Ga0068862_100026786 Ga0068862_1000267861 320
429 3300005937 Ga0081455_10000009 Ga0081455_10000009203 320
430 3300005937 Ga0081455_10002521 Ga0081455_1000252123 320
431 3300005937 Ga0081455_10003750 Ga0081455_100037502 320
432 3300006028 Ga0070717_10001787 Ga0070717_1000178719 320
433 3300006038 Ga0075365_10139823 Ga0075365_101398231 320
434 3300006058 Ga0075432_10000952 Ga0075432_1000095214 320
435 3300006163 Ga0070715_10000335 Ga0070715_100003353 320
436 3300006163 Ga0070715_10123590 Ga0070715_101235902 320
437 3300006173 Ga0070716_100005101 Ga0070716_1000051013 320
438 3300006173 Ga0070716_100103591 Ga0070716_1001035912 320
439 3300006175 Ga0070712_100124450 Ga0070712_1001244501 320
440 3300006175 Ga0070712_100459540 Ga0070712_1004595401 320
441 3300006178 Ga0075367_10015558 Ga0075367_100155582 320
442 3300006178 Ga0075367_10027997 Ga0075367_100279972 320
443 3300006195 Ga0075366_10001747 Ga0075366_100017474 320
444 3300006237 Ga0097621_100001589 Ga0097621_1000015896 320
445 3300006237 Ga0097621_100013414 Ga0097621_1000134144 320
446 3300006237 Ga0097621_100023262 Ga0097621_1000232626 320
447 3300006237 Ga0097621_100044633 Ga0097621_1000446334 320
448 3300006353 Ga0075370_10063596 Ga0075370_100635963 320
449 3300006358 Ga0068871_100000821 Ga0068871_1000008216 320
450 3300006358 Ga0068871_100083192 Ga0068871_1000831922 320
451 3300006358 Ga0068871_100134265 Ga0068871_1001342651 320
452 3300006844 Ga0075428_100556231 Ga0075428_1005562311 320
453 3300006846 Ga0075430_100381924 Ga0075430_1003819241 320
454 3300006847 Ga0075431_100143647 Ga0075431_1001436471 320
455 3300006847 Ga0075431_100174601 Ga0075431_1001746013 320
456 3300006847 Ga0075431_100297265 Ga0075431_1002972652 320
457 3300006852 Ga0075433_10000215 Ga0075433_1000021532 320
458 3300006852 Ga0075433_10029127 Ga0075433_100291274 320
459 3300006871 Ga0075434_100025301 Ga0075434_1000253013 320
460 3300006871 Ga0075434_100028038 Ga0075434_1000280385 320
461 3300006871 Ga0075434_100059633 Ga0075434_1000596332 320
462 3300006881 Ga0068865_100000904 Ga0068865_1000009046 320
463 3300006881 Ga0068865_100022470 Ga0068865_1000224703 320
464 3300006881 Ga0068865_100146644 Ga0068865_1001466442 320
465 3300006881 Ga0068865_100147550 Ga0068865_1001475501 320
466 3300006914 Ga0075436_100059046 Ga0075436_1000590462 320
467 3300006931 Ga0097620_100017372 Ga0097620_1000173725 320
468 3300006931 Ga0097620_100035960 Ga0097620_1000359603 320
469 3300006931 Ga0097620_100053232 Ga0097620_1000532322 320
470 3300006931 Ga0097620_100059497 Ga0097620_1000594974 320
471 3300006931 Ga0097620_100326411 Ga0097620_1003264112 320
472 3300007076 Ga0075435_100003952 Ga0075435_1000039525 320
473 3300007076 Ga0075435_100008222 Ga0075435_1000082227 320
474 3300007076 Ga0075435_100009478 Ga0075435_1000094786 320
475 3300007076 Ga0075435_100285608 Ga0075435_1002856081 320
476 3300007076 Ga0075435_100303690 Ga0075435_1003036902 320
477 3300009011 Ga0105251_10029534 Ga0105251_100295342 320
478 3300009092 Ga0105250_10029855 Ga0105250_100298552 320
479 3300009093 Ga0105240_10010852 Ga0105240_100108529 320
480 3300009093 Ga0105240_10040215 Ga0105240_100402153 320
481 3300009093 Ga0105240_10181925 Ga0105240_101819252 320
482 3300009093 Ga0105240_10385327 Ga0105240_103853272 320
483 3300009094 Ga0111539_10001590 Ga0111539_1000159021 320
484 3300009094 Ga0111539_10071163 Ga0111539_100711633 320
485 3300009094 Ga0111539_10240122 Ga0111539_102401222 320
486 3300009098 Ga0105245_10001399 Ga0105245_1000139913 320
487 3300009098 Ga0105245_10009709 Ga0105245_100097096 320
488 3300009098 Ga0105245_10058969 Ga0105245_100589692 320
489 3300009098 Ga0105245_10280158 Ga0105245_102801582 320
490 3300009101 Ga0105247_10001106 Ga0105247_1000110611 320
491 3300009101 Ga0105247_10003221 Ga0105247_100032219 320
492 3300009101 Ga0105247_10020381 Ga0105247_100203813 320
493 3300009101 Ga0105247_10054881 Ga0105247_100548813 320
494 3300009147 Ga0114129_10007384 Ga0114129_100073848 320
495 3300009147 Ga0114129_10019783 Ga0114129_100197837 320
496 3300009147 Ga0114129_10354510 Ga0114129_103545102 320
497 3300009148 Ga0105243_10002518 Ga0105243_100025187 320
498 3300009148 Ga0105243_10012299 Ga0105243_100122995 320
499 3300009148 Ga0105243_10158683 Ga0105243_101586832 320
500 3300009148 Ga0105243_10236804 Ga0105243_102368042 320
501 3300009174 Ga0105241_10017190 Ga0105241_100171902 320
502 3300009174 Ga0105241_10159404 Ga0105241_101594042 320
503 3300009176 Ga0105242_10001979 Ga0105242_1000197915 320
504 3300009176 Ga0105242_10035113 Ga0105242_100351133 320
505 3300009176 Ga0105242_10051405 Ga0105242_100514052 320
506 3300009176 Ga0105242_10133137 Ga0105242_101331372 320
507 3300009176 Ga0105242_10285819 Ga0105242_102858191 320
508 3300009176 Ga0105242_10366270 Ga0105242_103662701 320
509 3300009176 Ga0105242_10423821 Ga0105242_104238211 320
510 3300009177 Ga0105248_10002761 Ga0105248_100027618 320
511 3300009177 Ga0105248_10091263 Ga0105248_100912632 320
512 3300009177 Ga0105248_10103224 Ga0105248_101032242 320
513 3300009177 Ga0105248_10237313 Ga0105248_102373132 320
514 3300009545 Ga0105237_10053856 Ga0105237_100538565 320
515 3300009545 Ga0105237_10056173 Ga0105237_100561736 320
516 3300009545 Ga0105237_10113907 Ga0105237_101139072 320
517 3300009545 Ga0105237_10127937 Ga0105237_101279372 320
518 3300009551 Ga0105238_10065285 Ga0105238_100652856 320
519 3300009551 Ga0105238_10279920 Ga0105238_102799203 320
520 3300009553 Ga0105249_10001607 Ga0105249_1000160711 320
521 3300009553 Ga0105249_10041870 Ga0105249_100418704 320
522 3300009553 Ga0105249_10100649 Ga0105249_101006492 320
523 3300010375 Ga0105239_10014477 Ga0105239_1001447710 320
524 3300010375 Ga0105239_10023767 Ga0105239_100237678 320
525 3300010375 Ga0105239_10118946 Ga0105239_101189462 320
526 3300010375 Ga0105239_10258298 Ga0105239_102582982 320
527 3300011119 Ga0105246_10001743 Ga0105246_100017433 320
528 3300011119 Ga0105246_10007183 Ga0105246_100071832 320
529 3300012498 Ga0157345_1004578 Ga0157345_10045781 320
530 3300013100 Ga0157373_10057488 Ga0157373_100574881 320
531 3300013102 Ga0157371_10044904 Ga0157371_100449043 320
532 3300013102 Ga0157371_10175200 Ga0157371_101752001 320
533 3300013104 Ga0157370_10032704 Ga0157370_100327043 320
534 3300013104 Ga0157370_10336763 Ga0157370_103367632 320
535 3300013105 Ga0157369_10172905 Ga0157369_101729053 320
536 3300013105 Ga0157369_10266901 Ga0157369_102669012 320
537 3300013105 Ga0157369_10492777 Ga0157369_104927772 320
538 3300013296 Ga0157374_10002463 Ga0157374_100024632 320
539 3300013296 Ga0157374_10009285 Ga0157374_100092856 320
540 3300013296 Ga0157374_10139785 Ga0157374_101397852 320
541 3300013296 Ga0157374_10353689 Ga0157374_103536892 320
542 3300013297 Ga0157378_10003278 Ga0157378_100032784 320
543 3300013297 Ga0157378_10042152 Ga0157378_100421523 320
544 3300013297 Ga0157378_10704818 Ga0157378_107048181 320
545 3300013306 Ga0163162_10007479 Ga0163162_100074798 320
546 3300013306 Ga0163162_10023461 Ga0163162_100234612 320
547 3300013306 Ga0163162_10057610 Ga0163162_100576107 320
548 3300013306 Ga0163162_10162786 Ga0163162_101627863 320
549 3300013306 Ga0163162_10570830 Ga0163162_105708301 320
550 3300013308 Ga0157375_10000974 Ga0157375_100009746 320
551 3300013308 Ga0157375_10030322 Ga0157375_100303225 320
552 3300013308 Ga0157375_10068633 Ga0157375_100686333 320
553 3300014325 Ga0163163_10005044 Ga0163163_1000504413 320
554 3300014325 Ga0163163_10042234 Ga0163163_100422343 320
555 3300014325 Ga0163163_10170686 Ga0163163_101706861 320
556 3300014326 Ga0157380_10003351 Ga0157380_1000335112 320
557 3300014326 Ga0157380_10138947 Ga0157380_101389473 320
558 3300014745 Ga0157377_10000240 Ga0157377_1000024025 320
559 3300014745 Ga0157377_10002728 Ga0157377_100027284 320
560 3300014968 Ga0157379_10005829 Ga0157379_100058299 320
561 3300014968 Ga0157379_10013664 Ga0157379_100136642 320
562 3300014969 Ga0157376_10001267 Ga0157376_1000126716 320
563 3300017792 Ga0163161_10001738 Ga0163161_1000173816 320
564 3300017792 Ga0163161_10018293 Ga0163161_100182933 320
565 3300017792 Ga0163161_10028762 Ga0163161_100287623 320
566 3300017792 Ga0163161_10060749 Ga0163161_100607492 320
567 3300025271 Ga0207666_1000054 Ga0207666_10000544 320
568 3300025271 Ga0207666_1001378 Ga0207666_10013783 320
569 3300025290 Ga0207673_1000022 Ga0207673_100002210 320
570 3300025315 Ga0207697_10000200 Ga0207697_1000020025 320
571 3300025315 Ga0207697_10047545 Ga0207697_100475452 320
572 3300025885 Ga0207653_10001606 Ga0207653_100016063 320
573 3300025893 Ga0207682_10000589 Ga0207682_1000058913 320
574 3300025898 Ga0207692_10026161 Ga0207692_100261611 320
575 3300025898 Ga0207692_10144411 Ga0207692_101444112 320
576 3300025899 Ga0207642_10001001 Ga0207642_100010014 320
577 3300025899 Ga0207642_10003144 Ga0207642_100031446 320
578 3300025900 Ga0207710_10001512 Ga0207710_100015128 320
579 3300025900 Ga0207710_10005283 Ga0207710_100052836 320
580 3300025900 Ga0207710_10019583 Ga0207710_100195833 320
581 3300025901 Ga0207688_10000200 Ga0207688_100002008 320
582 3300025901 Ga0207688_10010290 Ga0207688_100102905 320
583 3300025903 Ga0207680_10017450 Ga0207680_100174502 320
584 3300025904 Ga0207647_10000472 Ga0207647_100004728 320
585 3300025904 Ga0207647_10005890 Ga0207647_100058909 320
586 3300025905 Ga0207685_10004135 Ga0207685_100041352 320
587 3300025906 Ga0207699_10059970 Ga0207699_100599704 320
588 3300025906 Ga0207699_10122948 Ga0207699_101229481 320
589 3300025906 Ga0207699_10223582 Ga0207699_102235822 320
590 3300025907 Ga0207645_10001225 Ga0207645_1000122516 320
591 3300025907 Ga0207645_10109490 Ga0207645_101094902 320
592 3300025908 Ga0207643_10000302 Ga0207643_1000030212 320
593 3300025908 Ga0207643_10001773 Ga0207643_100017736 320
594 3300025908 Ga0207643_10001904 Ga0207643_1000190411 320
595 3300025911 Ga0207654_10012697 Ga0207654_100126976 320
596 3300025911 Ga0207654_10017171 Ga0207654_100171713 320
597 3300025912 Ga0207707_10004595 Ga0207707_1000459514 320
598 3300025912 Ga0207707_10021311 Ga0207707_100213112 320
599 3300025912 Ga0207707_10203206 Ga0207707_102032062 320
600 3300025913 Ga0207695_10157850 Ga0207695_101578503 320
601 3300025914 Ga0207671_10011789 Ga0207671_100117894 320
602 3300025914 Ga0207671_10069816 Ga0207671_100698162 320
603 3300025914 Ga0207671_10244853 Ga0207671_102448531 320
604 3300025915 Ga0207693_10004654 Ga0207693_1000465415 320
605 3300025915 Ga0207693_10008892 Ga0207693_100088926 320
606 3300025915 Ga0207693_10017923 Ga0207693_100179237 320
607 3300025915 Ga0207693_10036811 Ga0207693_100368113 320
608 3300025915 Ga0207693_10067735 Ga0207693_100677353 320
609 3300025916 Ga0207663_10008376 Ga0207663_100083766 320
610 3300025916 Ga0207663_10092107 Ga0207663_100921072 320
611 3300025916 Ga0207663_10172250 Ga0207663_101722501 320
612 3300025917 Ga0207660_10001461 Ga0207660_100014615 320
613 3300025917 Ga0207660_10314358 Ga0207660_103143581 320
614 3300025918 Ga0207662_10000446 Ga0207662_100004467 320
615 3300025918 Ga0207662_10004160 Ga0207662_100041603 320
616 3300025918 Ga0207662_10019707 Ga0207662_100197071 320
617 3300025919 Ga0207657_10000917 Ga0207657_100009178 320
618 3300025919 Ga0207657_10021816 Ga0207657_100218163 320
619 3300025919 Ga0207657_10040989 Ga0207657_100409892 320
620 3300025919 Ga0207657_10142712 Ga0207657_101427122 320
621 3300025919 Ga0207657_10171252 Ga0207657_101712522 320
622 3300025920 Ga0207649_10000864 Ga0207649_100008643 320
623 3300025920 Ga0207649_10023029 Ga0207649_100230292 320
624 3300025921 Ga0207652_10002449 Ga0207652_100024499 320
625 3300025921 Ga0207652_10139221 Ga0207652_101392212 320
626 3300025921 Ga0207652_10403030 Ga0207652_104030301 320
627 3300025923 Ga0207681_10001739 Ga0207681_1000173910 320
628 3300025923 Ga0207681_10116698 Ga0207681_101166982 320
629 3300025925 Ga0207650_10006825 Ga0207650_100068253 320
630 3300025925 Ga0207650_10041636 Ga0207650_100416363 320
631 3300025925 Ga0207650_10151880 Ga0207650_101518803 320
632 3300025926 Ga0207659_10000683 Ga0207659_1000068318 320
633 3300025926 Ga0207659_10107039 Ga0207659_101070391 320
634 3300025926 Ga0207659_10207228 Ga0207659_102072282 320
635 3300025927 Ga0207687_10001148 Ga0207687_100011483 320
636 3300025927 Ga0207687_10004655 Ga0207687_100046558 320
637 3300025927 Ga0207687_10011621 Ga0207687_100116213 320
638 3300025927 Ga0207687_10044666 Ga0207687_100446664 320
639 3300025927 Ga0207687_10377946 Ga0207687_103779462 320
640 3300025928 Ga0207700_10058005 Ga0207700_100580051 320
641 3300025928 Ga0207700_10144123 Ga0207700_101441232 320
642 3300025929 Ga0207664_10069303 Ga0207664_100693032 320
643 3300025931 Ga0207644_10003175 Ga0207644_100031758 320
644 3300025931 Ga0207644_10019581 Ga0207644_100195813 320
645 3300025931 Ga0207644_10067516 Ga0207644_100675163 320
646 3300025932 Ga0207690_10001302 Ga0207690_1000130215 320
647 3300025933 Ga0207706_10001314 Ga0207706_100013144 320
648 3300025933 Ga0207706_10028177 Ga0207706_100281772 320
649 3300025933 Ga0207706_10119291 Ga0207706_101192912 320
650 3300025934 Ga0207686_10001107 Ga0207686_1000110718 320
651 3300025934 Ga0207686_10017202 Ga0207686_100172024 320
652 3300025934 Ga0207686_10017383 Ga0207686_100173834 320
653 3300025934 Ga0207686_10027799 Ga0207686_100277992 320
654 3300025934 Ga0207686_10186533 Ga0207686_101865332 320
655 3300025935 Ga0207709_10000742 Ga0207709_1000074213 320
656 3300025935 Ga0207709_10021237 Ga0207709_100212372 320
657 3300025935 Ga0207709_10047049 Ga0207709_100470493 320
658 3300025935 Ga0207709_10095419 Ga0207709_100954192 320
659 3300025935 Ga0207709_10238711 Ga0207709_102387112 320
660 3300025936 Ga0207670_10000707 Ga0207670_100007074 320
661 3300025936 Ga0207670_10005405 Ga0207670_100054055 320
662 3300025936 Ga0207670_10087631 Ga0207670_100876313 320
663 3300025936 Ga0207670_10283672 Ga0207670_102836722 320
664 3300025937 Ga0207669_10000470 Ga0207669_100004708 320
665 3300025937 Ga0207669_10021789 Ga0207669_100217894 320
666 3300025938 Ga0207704_10001346 Ga0207704_100013463 320
667 3300025938 Ga0207704_10028894 Ga0207704_100288944 320
668 3300025938 Ga0207704_10105202 Ga0207704_101052022 320
669 3300025938 Ga0207704_10308126 Ga0207704_103081262 320
670 3300025939 Ga0207665_10013405 Ga0207665_100134052 320
671 3300025939 Ga0207665_10034521 Ga0207665_100345212 320
672 3300025940 Ga0207691_10000627 Ga0207691_1000062727 320
673 3300025940 Ga0207691_10007735 Ga0207691_100077359 320
674 3300025940 Ga0207691_10058030 Ga0207691_100580302 320
675 3300025940 Ga0207691_10183905 Ga0207691_101839052 320
676 3300025941 Ga0207711_10006242 Ga0207711_100062423 320
677 3300025941 Ga0207711_10106063 Ga0207711_101060631 320
678 3300025941 Ga0207711_10198289 Ga0207711_101982893 320
679 3300025942 Ga0207689_10000823 Ga0207689_100008236 320
680 3300025942 Ga0207689_10013625 Ga0207689_100136253 320
681 3300025942 Ga0207689_10059931 Ga0207689_100599316 320
682 3300025942 Ga0207689_10078805 Ga0207689_100788052 320
683 3300025944 Ga0207661_10015006 Ga0207661_100150063 320
684 3300025944 Ga0207661_10089600 Ga0207661_100896002 320
685 3300025945 Ga0207679_10000409 Ga0207679_100004096 320
686 3300025945 Ga0207679_10003395 Ga0207679_1000339510 320
687 3300025949 Ga0207667_10091729 Ga0207667_100917291 320
688 3300025949 Ga0207667_10096675 Ga0207667_100966753 320
689 3300025960 Ga0207651_10000472 Ga0207651_100004727 320
690 3300025960 Ga0207651_10063218 Ga0207651_100632183 320
691 3300025961 Ga0207712_10002155 Ga0207712_100021553 320
692 3300025961 Ga0207712_10025600 Ga0207712_100256003 320
693 3300025961 Ga0207712_10347360 Ga0207712_103473602 320
694 3300025972 Ga0207668_10001632 Ga0207668_100016326 320
695 3300025972 Ga0207668_10038431 Ga0207668_100384312 320
696 3300025981 Ga0207640_10001082 Ga0207640_1000108217 320
697 3300025981 Ga0207640_10026699 Ga0207640_100266993 320
698 3300025986 Ga0207658_10006212 Ga0207658_100062125 320
699 3300025986 Ga0207658_10130492 Ga0207658_101304922 320
700 3300026023 Ga0207677_10011916 Ga0207677_100119163 320
701 3300026023 Ga0207677_10138668 Ga0207677_101386682 320
702 3300026035 Ga0207703_10001483 Ga0207703_100014836 320
703 3300026035 Ga0207703_10006044 Ga0207703_100060444 320
704 3300026035 Ga0207703_10023398 Ga0207703_100233983 320
705 3300026035 Ga0207703_10388100 Ga0207703_103881002 320
706 3300026041 Ga0207639_10001602 Ga0207639_1000160218 320
707 3300026041 Ga0207639_10075452 Ga0207639_100754522 320
708 3300026067 Ga0207678_10002063 Ga0207678_100020638 320
709 3300026067 Ga0207678_10012664 Ga0207678_100126644 320
710 3300026067 Ga0207678_10024225 Ga0207678_100242258 320
711 3300026067 Ga0207678_10037027 Ga0207678_100370272 320
712 3300026067 Ga0207678_10069547 Ga0207678_100695475 320
713 3300026067 Ga0207678_10144658 Ga0207678_101446583 320
714 3300026067 Ga0207678_10204817 Ga0207678_102048171 320
715 3300026075 Ga0207708_10000575 Ga0207708_100005758 320
716 3300026075 Ga0207708_10005514 Ga0207708_100055143 320
717 3300026075 Ga0207708_10009098 Ga0207708_100090985 320
718 3300026075 Ga0207708_10018000 Ga0207708_100180005 320
719 3300026075 Ga0207708_10139913 Ga0207708_101399132 320
720 3300026078 Ga0207702_10004242 Ga0207702_100042423 320
721 3300026078 Ga0207702_10111618 Ga0207702_101116182 320
722 3300026088 Ga0207641_10009610 Ga0207641_100096104 320
723 3300026088 Ga0207641_10012014 Ga0207641_100120142 320
724 3300026088 Ga0207641_10013698 Ga0207641_100136982 320
725 3300026088 Ga0207641_10162760 Ga0207641_101627602 320
726 3300026089 Ga0207648_10001152 Ga0207648_100011528 320
727 3300026089 Ga0207648_10003124 Ga0207648_1000312417 320
728 3300026089 Ga0207648_10035411 Ga0207648_100354112 320
729 3300026095 Ga0207676_10009698 Ga0207676_100096982 320
730 3300026095 Ga0207676_10068466 Ga0207676_100684662 320
731 3300026095 Ga0207676_10189490 Ga0207676_101894903 320
732 3300026116 Ga0207674_10001102 Ga0207674_100011028 320
733 3300026116 Ga0207674_10131166 Ga0207674_101311662 320
734 3300026118 Ga0207675_100002494 Ga0207675_10000249416 320
735 3300026118 Ga0207675_100009825 Ga0207675_1000098252 320
736 3300026118 Ga0207675_100028613 Ga0207675_1000286133 320
737 3300026118 Ga0207675_100029262 Ga0207675_1000292626 320
738 3300026118 Ga0207675_100119491 Ga0207675_1001194911 320
739 3300026121 Ga0207683_10000637 Ga0207683_1000063725 320
740 3300026121 Ga0207683_10034072 Ga0207683_100340725 320
741 3300026121 Ga0207683_10048246 Ga0207683_100482462 320
742 3300026121 Ga0207683_10062131 Ga0207683_100621311 320
743 3300026121 Ga0207683_10144885 Ga0207683_101448852 320
744 3300026121 Ga0207683_10249147 Ga0207683_102491471 320
745 3300026142 Ga0207698_10000980 Ga0207698_100009809 320
746 3300026142 Ga0207698_10072082 Ga0207698_100720822 320
747 3300026142 Ga0207698_10105903 Ga0207698_101059032 320
748 3300027617 Ga0210002_1000076 Ga0210002_100007616 320
749 3300027682 Ga0209971_1002029 Ga0209971_10020294 320
750 3300027695 Ga0209966_1008562 Ga0209966_10085622 320
751 3300027717 Ga0209998_10000471 Ga0209998_100004717 320
752 3300027717 Ga0209998_10007581 Ga0209998_100075812 320
753 3300027876 Ga0209974_10000316 Ga0209974_1000031614 320
754 3300027876 Ga0209974_10056241 Ga0209974_100562412 320
755 3300027907 Ga0207428_10000216 Ga0207428_1000021652 320
756 3300027907 Ga0207428_10001434 Ga0207428_1000143424 320
757 3300027907 Ga0207428_10001751 Ga0207428_1000175115 320
758 3300027907 Ga0207428_10343621 Ga0207428_103436211 320
759 3300028379 Ga0268266_10035794 Ga0268266_100357945 320
760 3300028380 Ga0268265_10001997 Ga0268265_1000199714 320
761 3300028380 Ga0268265_10074879 Ga0268265_100748791 320
762 3300028380 Ga0268265_10476435 Ga0268265_104764351 320
763 3300028381 Ga0268264_10010004 Ga0268264_100100046 320
764 3300028381 Ga0268264_10045422 Ga0268264_100454223 320
765 3300028556 Ga0265337_1001192 Ga0265337_10011927 320
766 3300031235 Ga0265330_10026527 Ga0265330_100265273 320
767 3300031241 Ga0265325_10000048 Ga0265325_1000004869 320
768 3300031250 Ga0265331_10013663 Ga0265331_100136636 320
769 3300031595 Ga0265313_10000438 Ga0265313_100004383 320
770 3300031595 Ga0265313_10041021 Ga0265313_100410211 320
771 3300034816 Ga0373930_0000307 Ga0373930_0000307_4405_5367 320
772 3300034816 Ga0373930_0013015 Ga0373930_0013015_528_1490 320
773 3300034817 Ga0373948_0002119 Ga0373948_0002119_1028_1990 320
774 3300034818 Ga0373950_0001201 Ga0373950_0001201_431_1402 320
775 3300034819 Ga0373958_0000322 Ga0373958_0000322_817_1779 320
776 3300034819 Ga0373958_0003692 Ga0373958_0003692_975_1937 320
777 3300034820 Ga0373959_0007371 Ga0373959_0007371_603_1565 320
778 3300035083 Ga0373926_0005698 Ga0373926_0005698_1673_2635 320
779 3300035083 Ga0373926_0009376 Ga0373926_0009376_909_1871 320
780 3300035084 Ga0373928_0012069 Ga0373928_0012069_148_1110 320
781 3300035085 Ga0373929_0000143 Ga0373929_0000143_7452_8414 320
782 3300035085 Ga0373929_0015524 Ga0373929_0015524_14_976 320
783 3300035086 Ga0373934_0021268 Ga0373934_0021268_532_1494 320
784 3300035088 Ga0373940_0011892 Ga0373940_0011892_485_1447 320
785 3300035089 Ga0373944_0038993 Ga0373944_0038993_120_1082 320
786 3300035090 Ga0373949_0001165 Ga0373949_0001165_1092_2054 320
787 3300035090 Ga0373949_0008747 Ga0373949_0008747_578_1540 320
788 3300035091 Ga0373951_0000777 Ga0373951_0000777_326_1288 320
789 3300035091 Ga0373951_0004528 Ga0373951_0004528_1713_2675 320
790 3300035091 Ga0373951_0027103 Ga0373951_0027103_35_997 320
791 3300035091 Ga0373951_0034299 Ga0373951_0034299_14_976 320
792 3300035092 Ga0373952_0001954 Ga0373952_0001954_2230_3192 320
793 3300035092 Ga0373952_0004393 Ga0373952_0004393_1301_2263 320
794 3300035111 Ga0373923_0009412 Ga0373923_0009412_1656_2618 320
795 3300035112 Ga0373932_0000870 Ga0373932_0000870_896_1858 320
796 3300035112 Ga0373932_0003101 Ga0373932_0003101_1782_2744 320
797 3300035113 Ga0373936_0006749 Ga0373936_0006749_2465_3427 320
798 3300035114 Ga0373939_0001316 Ga0373939_0001316_1547_2509 320
799 3300035114 Ga0373939_0002013 Ga0373939_0002013_3513_4475 320
800 3300035115 Ga0373941_0001795 Ga0373941_0001795_803_1765 320
801 3300035115 Ga0373941_0005143 Ga0373941_0005143_1381_2343 320
802 3300035116 Ga0373945_0005139 Ga0373945_0005139_1083_2045 320
803 3300035116 Ga0373945_0020719 Ga0373945_0020719_66_1028 320
804 3300035119 Ga0373956_0005731 Ga0373956_0005731_1810_2772 320
805 3300035119 Ga0373956_0038409 Ga0373956_0038409_69_1190 320
806 3300035120 Ga0373957_0002589 Ga0373957_0002589_3702_4664 320
807 3300035121 Ga0373960_0000059 Ga0373960_0000059_7428_8390 320
808 3300035121 Ga0373960_0004733 Ga0373960_0004733_1741_2703 320
809 3300035121 Ga0373960_0005883 Ga0373960_0005883_321_1283 320
810 3300035170 Ga0373943_0009773 Ga0373943_0009773_916_1878 320
811 3300035171 Ga0373946_0017923 Ga0373946_0017923_1082_2044 320
812 3300035172 Ga0373955_0004501 Ga0373955_0004501_2082_3044 320
813 3300035172 Ga0373955_0004659 Ga0373955_0004659_1338_2300 320
814 3300035172 Ga0373955_0033246 Ga0373955_0033246_246_1208 320
815 3300035207 Ga0373942_0001389 Ga0373942_0001389_2474_3436 320
816 3300035241 Ga0373961_0005506 Ga0373961_0005506_74_1036 320
817 3300035242 Ga0373962_0000585 Ga0373962_0000585_3780_4742 320
818 3300035691 Ga0373931_0004620 Ga0373931_0004620_387_1349 320
819 3300035691 Ga0373931_0017840 Ga0373931_0017840_1684_2646 320
820 3300035691 Ga0373931_0030162 Ga0373931_0030162_708_1670 320
821 3300035692 Ga0373935_0018177 Ga0373935_0018177_2156_3118 320
822 3300035692 Ga0373935_0029643 Ga0373935_0029643_1743_2705 320
823 3300035692 Ga0373935_0324781 Ga0373935_0324781_27_989 320
824 3300035695 Ga0373927_0032493 Ga0373927_0032493_2108_3070 320
825 3300035695 Ga0373927_0085628 Ga0373927_0085628_18_980 320
826 3300035724 Ga0373933_0002274 Ga0373933_0002274_8356_9318 320
827 3300035724 Ga0373933_0003001 Ga0373933_0003001_5213_6175 320
828 3300035724 Ga0373933_0036242 Ga0373933_0036242_805_1767 320
829 3300035724 Ga0373933_0118759 Ga0373933_0118759_153_1118 320
830 3300035725 Ga0373947_0020225 Ga0373947_0020225_2306_3268 320
831 3300036401 Ga0373937_0010837 Ga0373937_0010837_1747_2868 320
832 3300036401 Ga0373937_0019262 Ga0373937_0019262_643_1605 320
833 3300036401 Ga0373937_0023232 Ga0373937_0023232_1349_2311 320
834 3300036401 Ga0373937_0477059 Ga0373937_0477059_173_1135 320
835 3300037068 Ga0373925_0038021 Ga0373925_0038021_942_1904 320
836 3300037068 Ga0373925_0061959 Ga0373925_0061959_743_1705 320
837 3300037068 Ga0373925_0061989 Ga0373925_0061989_1070_2032 320
838 3300045051 Ga0451576_0072236 Ga0451576_0072236_2602_3564 320
839 3300046454 Ga0495592_0039015 Ga0495592_0039015_1495_2457 320
840 3300046454 Ga0495592_0041402 Ga0495592_0041402_1581_2543 320
841 3300046454 Ga0495592_0116908 Ga0495592_0116908_359_1321 320
842 3300046455 Ga0495603_0034013 Ga0495603_0034013_1699_2661 320
843 3300046459 Ga0495629_0001000 Ga0495629_0001000_3474_4436 320
844 3300046459 Ga0495629_0030399 Ga0495629_0030399_1899_2861 320
845 3300046461 Ga0495641_0094093 Ga0495641_0094093_69_1031 320
846 3300046462 Ga0495651_0040850 Ga0495651_0040850_42_1004 320
847 3300046462 Ga0495651_0060876 Ga0495651_0060876_799_1761 320
848 3300046463 Ga0495653_0084967 Ga0495653_0084967_656_1618 320
849 3300046472 Ga0495580_0030435 Ga0495580_0030435_1384_2346 320
850 3300046472 Ga0495580_0059109 Ga0495580_0059109_565_1527 320
851 3300046473 Ga0495582_0003989 Ga0495582_0003989_2822_3784 320
852 3300046473 Ga0495582_0098827 Ga0495582_0098827_625_1587 320
853 3300046475 Ga0495639_0040360 Ga0495639_0040360_873_1835 320
854 3300046476 Ga0495662_0083361 Ga0495662_0083361_22_984 320
855 3300046477 Ga0495664_0010075 Ga0495664_0010075_3402_4364 320
856 3300046477 Ga0495664_0014802 Ga0495664_0014802_1036_1998 320
857 3300046491 Ga0495584_0056499 Ga0495584_0056499_732_1694 320
858 3300046492 Ga0495585_0034434 Ga0495585_0034434_196_1182 320
859 3300046492 Ga0495585_0118049 Ga0495585_0118049_406_1368 320
860 3300046499 Ga0495594_0005856 Ga0495594_0005856_1778_2740 320
861 3300046499 Ga0495594_0031869 Ga0495594_0031869_1334_2296 320
862 3300046499 Ga0495594_0131019 Ga0495594_0131019_65_1027 320
863 3300046511 Ga0495608_0041702 Ga0495608_0041702_656_1618 320
864 3300046514 Ga0495618_0110789 Ga0495618_0110789_422_1384 320
865 3300046517 Ga0495630_0027271 Ga0495630_0027271_675_1637 320
866 3300046523 Ga0495644_0002236 Ga0495644_0002236_4928_5890 320
867 3300046523 Ga0495644_0054986 Ga0495644_0054986_310_1296 320
868 3300046526 Ga0495666_0028309 Ga0495666_0028309_396_1358 320
869 3300046526 Ga0495666_0149938 Ga0495666_0149938_70_1032 320
870 3300046529 Ga0495652_0101319 Ga0495652_0101319_1304_2290 320
871 3300046529 Ga0495652_0236254 Ga0495652_0236254_159_1121 320
872 3300046531 Ga0495665_0036088 Ga0495665_0036088_755_1717 320
873 3300046536 Ga0495587_0001853 Ga0495587_0001853_8940_9902 320
874 3300046537 Ga0495598_0003223 Ga0495598_0003223_943_1929 320
875 3300046538 Ga0495609_0080695 Ga0495609_0080695_349_1311 320
876 3300046543 Ga0495645_0001729 Ga0495645_0001729_1842_2804 320
877 3300046543 Ga0495645_0008295 Ga0495645_0008295_5616_6578 320
878 3300046543 Ga0495645_0230209 Ga0495645_0230209_17_979 320
879 3300046557 Ga0495622_0021157 Ga0495622_0021157_447_1409 320
880 3300046558 Ga0495633_0016888 Ga0495633_0016888_240_1202 320
881 3300046559 Ga0495667_0009963 Ga0495667_0009963_1865_2827 320
882 3300046559 Ga0495667_0034800 Ga0495667_0034800_768_1730 320
883 3300046615 Ga0495656_0007656 Ga0495656_0007656_768_1730 320
884 3300046615 Ga0495656_0185563 Ga0495656_0185563_31_1011 320
885 3300046648 Ga0495611_0034364 Ga0495611_0034364_1263_2225 320
886 3300046663 Ga0495635_0016669 Ga0495635_0016669_99_1061 320
887 3300046664 Ga0495659_0003411 Ga0495659_0003411_1363_2325 320
888 3300046664 Ga0495659_0029178 Ga0495659_0029178_899_1885 320
889 3300046675 Ga0495657_0017371 Ga0495657_0017371_2804_3766 320
890 3300046678 Ga0495599_0025961 Ga0495599_0025961_1581_2543 320
891 3300046679 Ga0495623_0014430 Ga0495623_0014430_3459_4421 320
892 3300046680 Ga0495646_0093505 Ga0495646_0093505_501_1463 320
893 3300046681 Ga0495647_0051266 Ga0495647_0051266_248_1210 320
894 3300046683 Ga0495658_0004053 Ga0495658_0004053_1051_2013 320
895 3300046689 Ga0495613_0013909 Ga0495613_0013909_4116_5078 320
896 3300046809 Ga0495600_0015719 Ga0495600_0015719_3124_4086 320
897 3300046809 Ga0495600_0041655 Ga0495600_0041655_295_1257 320
898 3300046809 Ga0495600_0046760 Ga0495600_0046760_393_1355 320
899 3300047317 Ga0495604_0051363 Ga0495604_0051363_782_1744 320
900 3300047317 Ga0495604_0057558 Ga0495604_0057558_1494_2456 320
901 3300047319 Ga0495674_0002982 Ga0495674_0002982_5903_6865 320
902 3300047319 Ga0495674_0021258 Ga0495674_0021258_459_1421 320
903 3300047319 Ga0495674_0091194 Ga0495674_0091194_567_1529 320
904 3300047321 Ga0495676_0085716 Ga0495676_0085716_1333_2295 320
905 3300047322 Ga0495680_0008240 Ga0495680_0008240_7081_8043 320
906 3300047322 Ga0495680_0019482 Ga0495680_0019482_1651_2613 320
907 3300047322 Ga0495680_0082408 Ga0495680_0082408_1009_1971 320
908 3300047444 Ga0495675_0047109 Ga0495675_0047109_101_1063 320
909 3300047446 Ga0495679_039183 Ga0495679_039183_408_1370 320
910 3300047471 Ga0495684_0000749 Ga0495684_0000749_4343_5305 320
911 3300047673 Ga0495593_0148398 Ga0495593_0148398_29_991 320
912 3300048088 Ga0495602_0004715 Ga0495602_0004715_3500_4462 320
913 3300048089 Ga0495614_0045975 Ga0495614_0045975_448_1410 320
914 3300048903 Ga0496100_0001128 Ga0496100_0001128_8968_9930 320
915 3300048903 Ga0496100_0002875 Ga0496100_0002875_3360_4337 320
916 3300048903 Ga0496100_0009197 Ga0496100_0009197_4111_5073 320
917 3300048904 Ga0496101_0002858 Ga0496101_0002858_390_1352 320
918 3300048904 Ga0496101_0014471 Ga0496101_0014471_685_1671 320
919 3300048904 Ga0496101_0024431 Ga0496101_0024431_2840_3817 320
920 3300048904 Ga0496101_0046816 Ga0496101_0046816_1564_2526 320
921 3300048904 Ga0496101_0388388 Ga0496101_0388388_40_1002 320
922 3300048905 Ga0496102_0010044 Ga0496102_0010044_5631_6593 320
923 3300048905 Ga0496102_0085854 Ga0496102_0085854_1608_2594 320
924 3300048905 Ga0496102_0199374 Ga0496102_0199374_234_1196 320
925 3300048905 Ga0496102_0342164 Ga0496102_0342164_249_1211 320
926 3300048905 Ga0496102_0378334 Ga0496102_0378334_267_1229 320
927 3300048906 Ga0496103_0001913 Ga0496103_0001913_10024_10986 320
928 3300048906 Ga0496103_0002261 Ga0496103_0002261_3292_4269 320
929 3300048906 Ga0496103_0041171 Ga0496103_0041171_298_1284 320
930 3300048906 Ga0496103_0073942 Ga0496103_0073942_607_1569 320
931 3300048907 Ga0496104_0000196 Ga0496104_0000196_46541_47503 320
932 3300048907 Ga0496104_0074710 Ga0496104_0074710_760_1722 320
933 3300048908 Ga0496105_0002162 Ga0496105_0002162_1345_2307 320
934 3300048908 Ga0496105_0002424 Ga0496105_0002424_9945_10988 320
935 3300048908 Ga0496105_0004080 Ga0496105_0004080_5929_6906 320
936 3300048908 Ga0496105_0010975 Ga0496105_0010975_4554_5516 320
937 3300048908 Ga0496105_0069166 Ga0496105_0069166_871_1833 320
938 3300048908 Ga0496105_0186187 Ga0496105_0186187_548_1528 320
939 3300048908 Ga0496105_0284799 Ga0496105_0284799_176_1138 320
940 3300048909 Ga0496106_0012626 Ga0496106_0012626_1054_2031 320
941 3300048909 Ga0496106_0018460 Ga0496106_0018460_390_1352 320
942 3300048909 Ga0496106_0019469 Ga0496106_0019469_3424_4386 320
943 3300048909 Ga0496106_0025671 Ga0496106_0025671_1303_2265 320
944 3300048909 Ga0496106_0080436 Ga0496106_0080436_900_1886 320
945 3300048910 Ga0496107_0000646 Ga0496107_0000646_15510_16496 320
946 3300048910 Ga0496107_0002792 Ga0496107_0002792_6704_7681 320
947 3300048910 Ga0496107_0005465 Ga0496107_0005465_2558_3520 320
948 3300048910 Ga0496107_0006701 Ga0496107_0006701_3714_4676 320
949 3300048910 Ga0496107_0100206 Ga0496107_0100206_450_1412 320
950 3300048910 Ga0496107_0306942 Ga0496107_0306942_36_1016 320
951 3300048911 Ga0496108_0031303 Ga0496108_0031303_720_1706 320
952 3300048911 Ga0496108_0055390 Ga0496108_0055390_1968_2930 320
953 3300048911 Ga0496108_0093445 Ga0496108_0093445_1010_1990 320
954 3300048911 Ga0496108_0103396 Ga0496108_0103396_920_1882 320
955 3300048911 Ga0496108_0255359 Ga0496108_0255359_28_990 320
956 3300048911 Ga0496108_0271534 Ga0496108_0271534_229_1191 320
957 3300048911 Ga0496108_0296325 Ga0496108_0296325_176_1138 320
958 3300048912 Ga0496109_0001395 Ga0496109_0001395_8987_9949 320
959 3300048912 Ga0496109_0003734 Ga0496109_0003734_10378_11355 320
960 3300048912 Ga0496109_0005620 Ga0496109_0005620_8623_9609 320
961 3300048912 Ga0496109_0069949 Ga0496109_0069949_1038_2081 320
962 3300048912 Ga0496109_0074118 Ga0496109_0074118_1312_2292 320
963 3300048912 Ga0496109_0240292 Ga0496109_0240292_384_1346 320
964 3300048912 Ga0496109_0308748 Ga0496109_0308748_161_1123 320
965 3300048913 Ga0496110_0009821 Ga0496110_0009821_1440_2402 320
966 3300048913 Ga0496110_0230548 Ga0496110_0230548_93_1055 320
967 3300048913 Ga0496110_0275365 Ga0496110_0275365_160_1122 320
968 3300048913 Ga0496110_0424193 Ga0496110_0424193_91_1053 320
969 3300048914 Ga0496111_0002390 Ga0496111_0002390_6622_7599 320
970 3300048915 Ga0496112_0029993 Ga0496112_0029993_2800_3786 320
971 3300048915 Ga0496112_0032426 Ga0496112_0032426_494_1471 320
972 3300048915 Ga0496112_0055338 Ga0496112_0055338_710_1672 320
973 3300048915 Ga0496112_0099124 Ga0496112_0099124_237_1217 320
974 3300048915 Ga0496112_0323818 Ga0496112_0323818_160_1122 320
975 3300048916 Ga0496113_0000682 Ga0496113_0000682_1211_2197 320
976 3300048916 Ga0496113_0004427 Ga0496113_0004427_7497_8474 320
977 3300048916 Ga0496113_0019709 Ga0496113_0019709_2674_3636 320
978 3300048916 Ga0496113_0100665 Ga0496113_0100665_440_1420 320
979 3300048917 Ga0496114_0001441 Ga0496114_0001441_11801_12763 320
980 3300048917 Ga0496114_0003348 Ga0496114_0003348_4497_5474 320
981 3300048917 Ga0496114_0013130 Ga0496114_0013130_2531_3493 320
982 3300048917 Ga0496114_0091828 Ga0496114_0091828_480_1457 320
983 3300048917 Ga0496114_0397014 Ga0496114_0397014_27_989 320
984 3300048918 Ga0496115_0001413 Ga0496115_0001413_15556_16542 320
985 3300048918 Ga0496115_0003796 Ga0496115_0003796_6229_7191 320
986 3300048918 Ga0496115_0023816 Ga0496115_0023816_1250_2227 320
987 3300048918 Ga0496115_0032902 Ga0496115_0032902_683_1726 320
988 3300048918 Ga0496115_0079051 Ga0496115_0079051_1619_2596 320
989 3300048918 Ga0496115_0179139 Ga0496115_0179139_768_1730 320
990 3300049568 Ga0501031_0028596 Ga0501031_0028596_1279_2250 320
991 3300049569 Ga0501032_0049277 Ga0501032_0049277_1431_2402 320
992 3300049570 Ga0501033_0024328 Ga0501033_0024328_2341_3312 320
993 3300049571 Ga0501034_0062100 Ga0501034_0062100_2136_3107 320
994 3300049573 Ga0501037_0020559 Ga0501037_0020559_2558_3529 320
995 3300049573 Ga0501037_0056054 Ga0501037_0056054_677_1648 320
996 3300049575 Ga0501039_0124918 Ga0501039_0124918_308_1279 320
997 3300049579 Ga0501043_0034799 Ga0501043_0034799_1250_2221 320
998 3300049579 Ga0501043_0116965 Ga0501043_0116965_1079_2050 320
999 3300049581 Ga0501047_0132154 Ga0501047_0132154_755_1726 320
1000 3300049586 Ga0501070_0036441 Ga0501070_0036441_1831_2802 320
1001 3300049586 Ga0501070_0191640 Ga0501070_0191640_524_1495 320
1002 3300049588 Ga0501072_0330196 Ga0501072_0330196_218_1180 320
1003 3300049592 Ga0501076_0120804 Ga0501076_0120804_449_1411 320
1004 3300049593 Ga0501077_0055262 Ga0501077_0055262_284_1246 320
1005 3300049742 Ga0501080_0168623 Ga0501080_0168623_177_1139 320
1006 3300049822 Ga0501035_0016634 Ga0501035_0016634_1528_2499 320
1007 3300050490 nmdc:mga03n38_117176_c1 nmdc:mga03n38_117176_c1_269_1282 320
1008 3300050491 nmdc:mga00v17_179610_c1 nmdc:mga00v17_179610_c1_151_1122 320
1009 3300050492 nmdc:mga0yw44_918_c1 nmdc:mga0yw44_918_c1_501_1487 320
1010 3300050494 nmdc:mga06z11_24174_c1 nmdc:mga06z11_24174_c1_1559_2545 320
1011 3300050494 nmdc:mga06z11_40913_c1 nmdc:mga06z11_40913_c1_1215_2177 320
1012 3300050496 nmdc:mga07m45_93059_c1 nmdc:mga07m45_93059_c1_64_1026 320
1013 3300050507 nmdc:mga05p37_13288_c1 nmdc:mga05p37_13288_c1_49_1023 320
1014 3300050507 nmdc:mga05p37_48824_c1 nmdc:mga05p37_48824_c1_1390_2370 320
1015 3300050508 nmdc:mga09592_38885_c1 nmdc:mga09592_38885_c1_2680_3651 320
1016 3300050509 nmdc:mga0qj67_120882_c1 nmdc:mga0qj67_120882_c1_1061_2032 320
1017 3300050510 nmdc:mga06r32_14230_c1 nmdc:mga06r32_14230_c1_2773_3744 320
1018 3300050511 nmdc:mga08y16_1865_c1 nmdc:mga08y16_1865_c1_17872_18834 320
1019 3300050511 nmdc:mga08y16_2031_c1 nmdc:mga08y16_2031_c1_1008_1970 320
1020 3300050511 nmdc:mga08y16_246771_c1 nmdc:mga08y16_246771_c1_734_1711 320
1021 3300050511 nmdc:mga08y16_61288_c1 nmdc:mga08y16_61288_c1_2628_3590 320
1022 3300050512 nmdc:mga0n895_171934_c1 nmdc:mga0n895_171934_c1_432_1394 320
1023 3300050512 nmdc:mga0n895_5417_c1 nmdc:mga0n895_5417_c1_1750_2724 320
1024 3300050512 nmdc:mga0n895_8059_c1 nmdc:mga0n895_8059_c1_379_1341 320
1025 3300050513 nmdc:mga0rr50_102381_c1 nmdc:mga0rr50_102381_c1_1093_2055 320
1026 3300050513 nmdc:mga0rr50_10240_c1 nmdc:mga0rr50_10240_c1_3974_4948 320
1027 3300050513 nmdc:mga0rr50_1332_c1 nmdc:mga0rr50_1332_c1_4338_5312 320
1028 3300050513 nmdc:mga0rr50_158703_c1 nmdc:mga0rr50_158703_c1_249_1211 320
1029 3300050513 nmdc:mga0rr50_317415_c1 nmdc:mga0rr50_317415_c1_84_1046 320
1030 3300050514 nmdc:mga08x19_58692_c1 nmdc:mga08x19_58692_c1_649_1611 320
1031 3300050515 nmdc:mga0a205_30759_c1 nmdc:mga0a205_30759_c1_650_1624 320
1032 3300050515 nmdc:mga0a205_66835_c1 nmdc:mga0a205_66835_c1_1943_2989 320
1033 3300050515 nmdc:mga0a205_72932_c1 nmdc:mga0a205_72932_c1_2105_3067 320
1034 3300053077 Ga0495601_0003707 Ga0495601_0003707_4235_5197 320
1035 3300053077 Ga0495601_0038284 Ga0495601_0038284_529_1491 320
1036 3300053077 Ga0495601_0041622 Ga0495601_0041622_1874_2836 320
1037 3300053078 Ga0495612_0000762 Ga0495612_0000762_8580_9542 320
1038 3300053078 Ga0495612_0013611 Ga0495612_0013611_1656_2618 320
1039 3300053078 Ga0495612_0030805 Ga0495612_0030805_312_1274 320
1040 3300053078 Ga0495612_0046974 Ga0495612_0046974_537_1499 320
1041 3300053083 Ga0495655_0014475 Ga0495655_0014475_291_1277 320
1042 3300053084 Ga0495595_0000429 Ga0495595_0000429_12_974 320
1043 3300053084 Ga0495595_0001679 Ga0495595_0001679_4010_4972 320
1044 3300053084 Ga0495595_0002216 Ga0495595_0002216_3773_4735 320
1045 3300053084 Ga0495595_0005618 Ga0495595_0005618_3764_4726 320
1046 3300053085 Ga0495619_0000043 Ga0495619_0000043_54524_55486 320
1047 3300053085 Ga0495619_0000551 Ga0495619_0000551_23833_24795 320
1048 3300053085 Ga0495619_0071319 Ga0495619_0071319_99_1061 320
1049 3300061719 Ga0466962_0121814 Ga0466962_0121814_181_1146 320

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

78

352

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9694 28 320
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9669 25 319
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9564 25 320
6hke-assembly1.cif.gz_A matc (rpa3494) from rhodopseudomonas palustris with bound malate 0.9514 25 312
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9512 25 319
ID Description Score Start End Superfamily
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9382 124 244 3.40.190.10
2dvzA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9336 124 239 3.40.190.10
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9329 25 320 3.40.190.150
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9323 124 239 3.40.190.10
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9272 25 320 3.40.190.150
ID Description Score Start End GO Terms
AF-A0A1J5PQ67-F1-model_v4 Tripartite tricarboxylate transporter family receptor 0.9889 62 319
AF-A0A1J5PQ67-F1-model_v4 Tripartite tricarboxylate transporter family receptor 0.9813 62 319
AF-A0A2T7SUP8-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9771 11 320
AF-A0A5C8CF86-F1-model_v4 deleted 0.9764 35 320
AF-A0A1R0HGB9-F1-model_v4 deleted 0.9743 22 320

Feature Viewer

pLDDT pTM Quality
91.54 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map