F489026
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1049 | 408 | 1046 | 322 |
Family's Representative Sequence
| Representative Sequence | 3300025934|Ga0207686_10017202|Ga0207686_100172024 |
| Length | 355 |
| Sequence | MAVNSLQTSHRSRVAANFFISTNPPVGEIVNGSCPTHPSAESAFCLLFPAWQASAQTYPSHTVRIIVPFGAGGPADTAARVLAQHLSETLKQSFIVENRPGAGSIIGTSEAAKAAPDGYTLLVMSDTHTTNESLMPNKPYQLMRDFVAVAPINYTDLMLVVTPSLAAKNLREFIALAKQNPGKFSYASSGQGTAYHMAAELFKAKSGTDIVHVPHRAAGEMRSSVMGGHVQVMFDAISISAPNVLGGKLTALGVTGGARSPILPDVPTMGEAGLSGFETAGIWGGVVAPAGTPKEIVNLLNIEINKIIAKPEVREGWATQGAVPMVMTVSEFDAMLRKDIQERTELVRTSGLKPQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 4 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 5 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 7 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 9 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 10 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 11 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 12 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 13 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 14 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 15 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 16 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 17 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 18 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 19 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 20 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 21 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 22 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 23 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 24 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 25 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 26 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 28 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 31 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 38 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 42 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 70 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 74 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 81 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 83 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 84 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 85 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 86 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 87 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 88 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 89 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 90 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 91 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 92 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 93 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 94 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 95 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 96 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 97 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 98 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 99 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 101 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 102 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 104 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 106 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 107 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 108 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 110 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 111 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 112 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 113 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 114 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 115 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 116 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 117 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 118 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 119 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 121 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 122 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 123 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 138 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 141 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 156 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 230 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 234 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 235 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 236 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 237 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 238 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 239 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 240 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 241 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 242 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 243 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 244 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 245 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 246 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 247 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 248 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 249 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 250 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 251 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 252 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 253 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 254 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 255 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 256 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 257 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 258 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 259 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 260 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 261 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 262 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 263 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 264 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 266 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 267 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 268 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 269 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 270 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 271 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 272 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 273 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 274 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 275 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 276 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 277 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 278 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 279 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 280 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 281 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 282 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 283 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 284 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 285 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 286 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 287 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 288 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 289 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 290 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 291 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 292 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 293 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 351 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 352 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 353 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 354 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 355 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 356 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 359 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 360 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 361 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 362 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 363 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 364 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 383 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 384 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 385 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 386 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 387 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 388 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 389 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 404 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 405 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 408 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.71 |
| Metatranscriptomes | 0 |
| Isolates | 0.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.48 |
| Nodule | 0 |
| Rhizoplane | 8.48 |
| Rhizosphere | 87.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2195022 | 2162886007 | Bacteria | 1205 |
| 2 | 2214745199 | 2209111006 | Bacteria | 16432 |
| 3 | ARcpr5oldR_c000024 | 3300000041 | Bacteria | 31707 |
| 4 | ARSoilYngRDRAFT_c00084 | 3300000042 | Bacteria | 15691 |
| 5 | ARcpr5yngRDRAFT_c000226 | 3300000043 | Bacteria | 8500 |
| 6 | ARSoilOldRDRAFT_c000027 | 3300000044 | Bacteria | 33288 |
| 7 | ARCol0oldRDRAFT_c00301 | 3300000045 | Bacteria | 4791 |
| 8 | ARCol0yngRDRAFT_1000016 | 3300000652 | Bacteria | 31710 |
| 9 | JGI24032J14994_100052 | 3300001430 | Bacteria | 4643 |
| 10 | JGI24736J21556_1013491 | 3300001904 | Bacteria | 1319 |
| 11 | JGI24747J21853_1000417 | 3300001978 | Bacteria | 2585 |
| 12 | JGI24740J21852_10017965 | 3300001979 | Bacteria | 2519 |
| 13 | JGI24739J22299_10000472 | 3300001989 | Bacteria | 14168 |
| 14 | JGI24737J22298_10000645 | 3300001990 | Bacteria | 12317 |
| 15 | JGI24737J22298_10012061 | 3300001990 | Bacteria | 2821 |
| 16 | JGI24743J22301_10005214 | 3300001991 | Bacteria | 2160 |
| 17 | JGI24743J22301_10022695 | 3300001991 | Bacteria | 1205 |
| 18 | JGI24750J21931_1000292 | 3300002070 | Bacteria | 8588 |
| 19 | JGI24750J21931_1002828 | 3300002070 | Bacteria | 2084 |
| 20 | JGI24745J21846_1000564 | 3300002073 | Bacteria | 3318 |
| 21 | JGI24748J21848_1000222 | 3300002074 | Bacteria | 6971 |
| 22 | JGI24749J21850_1000285 | 3300002076 | Bacteria | 7764 |
| 23 | JGI24749J21850_1001196 | 3300002076 | Bacteria | 3690 |
| 24 | JGI24744J21845_10007239 | 3300002077 | Bacteria | 2293 |
| 25 | JGI24742J22300_10000119 | 3300002244 | Bacteria | 11288 |
| 26 | JGI24751J29686_10003797 | 3300002459 | Bacteria | 3047 |
| 27 | JGI25406J46586_10004753 | 3300003203 | Bacteria | 6315 |
| 28 | JGI25406J46586_10037191 | 3300003203 | Bacteria | 1758 |
| 29 | Ga0055526_1000027 | 3300003771 | Bacteria | 150957 |
| 30 | JGI25405J52794_10005552 | 3300003911 | Bacteria | 2277 |
| 31 | Ga0065716_1002390 | 3300005277 | Bacteria | 1842 |
| 32 | Ga0065704_10009680 | 3300005289 | Bacteria | 2404 |
| 33 | Ga0065712_10001193 | 3300005290 | Bacteria | 8161 |
| 34 | Ga0065712_10092882 | 3300005290 | Unclassified | 2314 |
| 35 | Ga0065715_10000313 | 3300005293 | Bacteria | 16626 |
| 36 | Ga0065715_10005544 | 3300005293 | Bacteria | 8025 |
| 37 | Ga0065715_10125061 | 3300005293 | Unclassified | 2139 |
| 38 | Ga0070676_10001294 | 3300005328 | Bacteria | 12586 |
| 39 | Ga0070676_10070817 | 3300005328 | Bacteria | 2093 |
| 40 | Ga0070676_10113661 | 3300005328 | Bacteria | 1690 |
| 41 | Ga0070683_100000384 | 3300005329 | Bacteria | 30732 |
| 42 | Ga0070690_100017855 | 3300005330 | Bacteria | 4276 |
| 43 | Ga0070690_100031974 | 3300005330 | Bacteria | 3282 |
| 44 | Ga0070670_100006373 | 3300005331 | Bacteria | 9987 |
| 45 | Ga0070670_100046837 | 3300005331 | Bacteria | 3719 |
| 46 | Ga0070670_100069446 | 3300005331 | Bacteria | 3024 |
| 47 | Ga0070670_100104882 | 3300005331 | Bacteria | 2435 |
| 48 | Ga0070677_10000366 | 3300005333 | Bacteria | 15873 |
| 49 | Ga0068869_100000588 | 3300005334 | Bacteria | 20402 |
| 50 | Ga0068869_100099356 | 3300005334 | Bacteria | 2199 |
| 51 | Ga0068869_100185037 | 3300005334 | Bacteria | 1635 |
| 52 | Ga0070666_10046494 | 3300005335 | Bacteria | 2911 |
| 53 | Ga0070666_10181614 | 3300005335 | Bacteria | 1476 |
| 54 | Ga0070680_100003315 | 3300005336 | Bacteria | 12017 |
| 55 | Ga0070680_100017912 | 3300005336 | Bacteria | 5591 |
| 56 | Ga0070680_100212059 | 3300005336 | Bacteria | 1634 |
| 57 | Ga0070680_100213375 | 3300005336 | Bacteria | 1629 |
| 58 | Ga0070680_100313385 | 3300005336 | Bacteria | 1331 |
| 59 | Ga0070682_100001303 | 3300005337 | Bacteria | 14122 |
| 60 | Ga0070682_100011027 | 3300005337 | Bacteria | 5153 |
| 61 | Ga0070682_100157117 | 3300005337 | Bacteria | 1567 |
| 62 | Ga0068868_100007694 | 3300005338 | Bacteria | 7684 |
| 63 | Ga0068868_100010823 | 3300005338 | Bacteria | 6617 |
| 64 | Ga0068868_100031315 | 3300005338 | Bacteria | 4086 |
| 65 | Ga0068868_100051465 | 3300005338 | Bacteria | 3240 |
| 66 | Ga0070660_100006474 | 3300005339 | Bacteria | 8119 |
| 67 | Ga0070660_100113131 | 3300005339 | Bacteria | 2161 |
| 68 | Ga0070660_100170733 | 3300005339 | Bacteria | 1756 |
| 69 | Ga0070689_100001250 | 3300005340 | Bacteria | 16191 |
| 70 | Ga0070689_100022333 | 3300005340 | Bacteria | 4724 |
| 71 | Ga0070689_100056025 | 3300005340 | Bacteria | 3056 |
| 72 | Ga0070689_100108293 | 3300005340 | Bacteria | 2207 |
| 73 | Ga0070691_10000616 | 3300005341 | Bacteria | 13699 |
| 74 | Ga0070691_10028317 | 3300005341 | Bacteria | 2616 |
| 75 | Ga0070691_10080735 | 3300005341 | Bacteria | 1592 |
| 76 | Ga0070687_100002805 | 3300005343 | Bacteria | 6639 |
| 77 | Ga0070687_100022541 | 3300005343 | Bacteria | 2979 |
| 78 | Ga0070687_100161850 | 3300005343 | Unclassified | 1324 |
| 79 | Ga0070661_100001627 | 3300005344 | Bacteria | 15545 |
| 80 | Ga0070661_100034366 | 3300005344 | Bacteria | 3676 |
| 81 | Ga0070661_100082007 | 3300005344 | Bacteria | 2382 |
| 82 | Ga0070692_10000719 | 3300005345 | Bacteria | 10720 |
| 83 | Ga0070692_10078659 | 3300005345 | Unclassified | 1771 |
| 84 | Ga0070668_100001772 | 3300005347 | Bacteria | 15701 |
| 85 | Ga0070668_100007916 | 3300005347 | Bacteria | 7891 |
| 86 | Ga0070668_100126854 | 3300005347 | Bacteria | 2044 |
| 87 | Ga0070669_100002584 | 3300005353 | Bacteria | 13089 |
| 88 | Ga0070669_100008715 | 3300005353 | Bacteria | 7236 |
| 89 | Ga0070675_100009313 | 3300005354 | Bacteria | 7636 |
| 90 | Ga0070675_100013013 | 3300005354 | Bacteria | 6533 |
| 91 | Ga0070675_100089854 | 3300005354 | Bacteria | 2572 |
| 92 | Ga0070675_100193666 | 3300005354 | Bacteria | 1762 |
| 93 | Ga0070671_100003610 | 3300005355 | Bacteria | 12107 |
| 94 | Ga0070674_100000598 | 3300005356 | Bacteria | 18253 |
| 95 | Ga0070674_100107301 | 3300005356 | Bacteria | 2044 |
| 96 | Ga0070673_100000255 | 3300005364 | Bacteria | 27161 |
| 97 | Ga0070673_100011342 | 3300005364 | Bacteria | 6080 |
| 98 | Ga0070673_100011912 | 3300005364 | Bacteria | 5956 |
| 99 | Ga0070673_100026950 | 3300005364 | Bacteria | 4254 |
| 100 | Ga0070688_100005214 | 3300005365 | Bacteria | 6823 |
| 101 | Ga0070688_100057375 | 3300005365 | Bacteria | 2447 |
| 102 | Ga0070659_100005703 | 3300005366 | Bacteria | 8962 |
| 103 | Ga0070667_100003947 | 3300005367 | Bacteria | 12593 |
| 104 | Ga0070667_100052781 | 3300005367 | Bacteria | 3431 |
| 105 | Ga0070667_100088218 | 3300005367 | Bacteria | 2663 |
| 106 | Ga0070667_100300005 | 3300005367 | Bacteria | 1446 |
| 107 | Ga0070709_10014657 | 3300005434 | Bacteria | 4437 |
| 108 | Ga0070709_10015858 | 3300005434 | Bacteria | 4290 |
| 109 | Ga0070709_10081081 | 3300005434 | Bacteria | 2117 |
| 110 | Ga0070714_100014498 | 3300005435 | Bacteria | 6332 |
| 111 | Ga0070714_100029784 | 3300005435 | Bacteria | 4540 |
| 112 | Ga0070714_100067295 | 3300005435 | Bacteria | 3087 |
| 113 | Ga0070713_100002318 | 3300005436 | Bacteria | 12400 |
| 114 | Ga0070713_100003244 | 3300005436 | Bacteria | 10726 |
| 115 | Ga0070713_100067968 | 3300005436 | Bacteria | 3002 |
| 116 | Ga0070713_100276308 | 3300005436 | Bacteria | 1540 |
| 117 | Ga0070711_100004584 | 3300005439 | Bacteria | 8177 |
| 118 | Ga0070711_100007766 | 3300005439 | Bacteria | 6533 |
| 119 | Ga0070711_100043251 | 3300005439 | Bacteria | 3050 |
| 120 | Ga0070711_100068223 | 3300005439 | Bacteria | 2498 |
| 121 | Ga0070711_100169787 | 3300005439 | Bacteria | 1661 |
| 122 | Ga0070705_100000971 | 3300005440 | Bacteria | 16064 |
| 123 | Ga0070705_100183681 | 3300005440 | Bacteria | 1419 |
| 124 | Ga0070700_100000495 | 3300005441 | Bacteria | 19766 |
| 125 | Ga0070694_100004679 | 3300005444 | Bacteria | 8237 |
| 126 | Ga0070708_100077192 | 3300005445 | Bacteria | 3010 |
| 127 | Ga0070663_100001070 | 3300005455 | Bacteria | 14986 |
| 128 | Ga0070663_100088958 | 3300005455 | Bacteria | 2284 |
| 129 | Ga0070678_100000552 | 3300005456 | Bacteria | 18245 |
| 130 | Ga0070678_100013095 | 3300005456 | Bacteria | 5186 |
| 131 | Ga0070678_100028784 | 3300005456 | Bacteria | 3794 |
| 132 | Ga0070678_100047267 | 3300005456 | Bacteria | 3091 |
| 133 | Ga0070678_100114528 | 3300005456 | Bacteria | 2115 |
| 134 | Ga0070678_100178175 | 3300005456 | Bacteria | 1737 |
| 135 | Ga0070678_100222051 | 3300005456 | Bacteria | 1571 |
| 136 | Ga0070662_100003388 | 3300005457 | Bacteria | 9939 |
| 137 | Ga0070662_100050332 | 3300005457 | Bacteria | 3005 |
| 138 | Ga0070662_100091451 | 3300005457 | Bacteria | 2285 |
| 139 | Ga0070681_10004188 | 3300005458 | Bacteria | 13661 |
| 140 | Ga0070681_10105385 | 3300005458 | Bacteria | 2761 |
| 141 | Ga0070681_10108821 | 3300005458 | Bacteria | 2712 |
| 142 | Ga0070681_10211860 | 3300005458 | Bacteria | 1853 |
| 143 | Ga0068867_100000587 | 3300005459 | Bacteria | 24119 |
| 144 | Ga0068867_100012780 | 3300005459 | Bacteria | 5939 |
| 145 | Ga0068867_100109962 | 3300005459 | Bacteria | 2116 |
| 146 | Ga0070685_10002610 | 3300005466 | Bacteria | 9228 |
| 147 | Ga0070685_10021537 | 3300005466 | Bacteria | 3504 |
| 148 | Ga0070685_10102274 | 3300005466 | Bacteria | 1752 |
| 149 | Ga0070679_100138184 | 3300005530 | Bacteria | 2417 |
| 150 | Ga0070679_100145489 | 3300005530 | Bacteria | 2348 |
| 151 | Ga0070679_100227573 | 3300005530 | Bacteria | 1825 |
| 152 | Ga0070679_100232037 | 3300005530 | Bacteria | 1805 |
| 153 | Ga0070679_100259105 | 3300005530 | Bacteria | 1694 |
| 154 | Ga0070684_100001501 | 3300005535 | Bacteria | 16841 |
| 155 | Ga0068853_100001914 | 3300005539 | Bacteria | 15339 |
| 156 | Ga0068853_100333703 | 3300005539 | Bacteria | 1408 |
| 157 | Ga0070672_100000442 | 3300005543 | Bacteria | 24210 |
| 158 | Ga0070672_100056051 | 3300005543 | Bacteria | 3089 |
| 159 | Ga0070672_100063856 | 3300005543 | Bacteria | 2908 |
| 160 | Ga0070672_100073889 | 3300005543 | Bacteria | 2718 |
| 161 | Ga0070672_100192255 | 3300005543 | Bacteria | 1704 |
| 162 | Ga0070672_100357396 | 3300005543 | Bacteria | 1246 |
| 163 | Ga0070686_100002692 | 3300005544 | Bacteria | 9784 |
| 164 | Ga0070686_100094725 | 3300005544 | Bacteria | 2004 |
| 165 | Ga0070696_100006734 | 3300005546 | Bacteria | 7675 |
| 166 | Ga0070696_100013242 | 3300005546 | Bacteria | 5534 |
| 167 | Ga0070693_100000492 | 3300005547 | Bacteria | 17662 |
| 168 | Ga0070693_100006083 | 3300005547 | Bacteria | 5846 |
| 169 | Ga0070693_100017245 | 3300005547 | Bacteria | 3751 |
| 170 | Ga0070693_100022943 | 3300005547 | Bacteria | 3328 |
| 171 | Ga0070665_100037138 | 3300005548 | Bacteria | 4899 |
| 172 | Ga0070665_100037390 | 3300005548 | Bacteria | 4882 |
| 173 | Ga0070665_100280783 | 3300005548 | Bacteria | 1667 |
| 174 | Ga0070704_100004657 | 3300005549 | Bacteria | 7938 |
| 175 | Ga0070704_100092172 | 3300005549 | Bacteria | 2261 |
| 176 | Ga0068855_100004881 | 3300005563 | Bacteria | 16365 |
| 177 | Ga0068855_100165810 | 3300005563 | Bacteria | 2504 |
| 178 | Ga0070664_100009800 | 3300005564 | Bacteria | 7763 |
| 179 | Ga0070664_100090475 | 3300005564 | Bacteria | 2648 |
| 180 | Ga0070664_100099406 | 3300005564 | Bacteria | 2528 |
| 181 | Ga0070664_100173256 | 3300005564 | Unclassified | 1915 |
| 182 | Ga0068857_100002803 | 3300005577 | Bacteria | 14334 |
| 183 | Ga0068857_100113891 | 3300005577 | Bacteria | 2432 |
| 184 | Ga0068854_100003844 | 3300005578 | Bacteria | 9409 |
| 185 | Ga0068854_100019418 | 3300005578 | Bacteria | 4579 |
| 186 | Ga0068854_100053390 | 3300005578 | Bacteria | 2902 |
| 187 | Ga0068854_100249853 | 3300005578 | Bacteria | 1416 |
| 188 | Ga0068856_100000863 | 3300005614 | Bacteria | 32525 |
| 189 | Ga0068856_100076202 | 3300005614 | Bacteria | 3323 |
| 190 | Ga0068856_100212529 | 3300005614 | Unclassified | 1950 |
| 191 | Ga0068852_100016931 | 3300005616 | Bacteria | 5702 |
| 192 | Ga0068852_100047119 | 3300005616 | Bacteria | 3675 |
| 193 | Ga0068852_100075492 | 3300005616 | Bacteria | 2973 |
| 194 | Ga0068859_100017372 | 3300005617 | Bacteria | 7228 |
| 195 | Ga0068859_100035958 | 3300005617 | Bacteria | 4969 |
| 196 | Ga0068859_100053230 | 3300005617 | Bacteria | 4070 |
| 197 | Ga0068859_100059495 | 3300005617 | Bacteria | 3849 |
| 198 | Ga0068859_100326418 | 3300005617 | Unclassified | 1629 |
| 199 | Ga0068864_100001441 | 3300005618 | Bacteria | 19620 |
| 200 | Ga0068864_100002660 | 3300005618 | Bacteria | 14760 |
| 201 | Ga0068864_100012607 | 3300005618 | Bacteria | 6989 |
| 202 | Ga0068864_100014014 | 3300005618 | Bacteria | 6647 |
| 203 | Ga0068864_100082925 | 3300005618 | Bacteria | 2814 |
| 204 | Ga0068864_100092895 | 3300005618 | Bacteria | 2664 |
| 205 | Ga0068864_100204144 | 3300005618 | Unclassified | 1817 |
| 206 | Ga0068866_10000723 | 3300005718 | Bacteria | 14981 |
| 207 | Ga0068866_10008361 | 3300005718 | Bacteria | 4357 |
| 208 | Ga0068866_10077224 | 3300005718 | Bacteria | 1778 |
| 209 | Ga0068861_100000840 | 3300005719 | Bacteria | 18583 |
| 210 | Ga0068861_100007748 | 3300005719 | Bacteria | 7376 |
| 211 | Ga0068861_100177197 | 3300005719 | Bacteria | 1771 |
| 212 | Ga0068851_10026372 | 3300005834 | Bacteria | 2855 |
| 213 | Ga0068870_10000302 | 3300005840 | Bacteria | 18321 |
| 214 | Ga0068870_10001054 | 3300005840 | Bacteria | 10914 |
| 215 | Ga0068870_10018269 | 3300005840 | Bacteria | 3382 |
| 216 | Ga0068863_100023141 | 3300005841 | Bacteria | 5937 |
| 217 | Ga0068863_100033650 | 3300005841 | Bacteria | 4882 |
| 218 | Ga0068863_100046329 | 3300005841 | Bacteria | 4126 |
| 219 | Ga0068863_100322454 | 3300005841 | Bacteria | 1501 |
| 220 | Ga0068858_100011645 | 3300005842 | Bacteria | 8296 |
| 221 | Ga0068858_100012780 | 3300005842 | Bacteria | 7913 |
| 222 | Ga0068858_100184407 | 3300005842 | Bacteria | 1971 |
| 223 | Ga0068858_100403408 | 3300005842 | Bacteria | 1314 |
| 224 | Ga0068860_100001400 | 3300005843 | Bacteria | 26146 |
| 225 | Ga0068860_100004558 | 3300005843 | Bacteria | 14140 |
| 226 | Ga0068860_100055279 | 3300005843 | Bacteria | 3773 |
| 227 | Ga0068860_100443607 | 3300005843 | Unclassified | 1290 |
| 228 | Ga0068862_100002629 | 3300005844 | Bacteria | 15820 |
| 229 | Ga0068862_100026786 | 3300005844 | Bacteria | 4848 |
| 230 | Ga0081455_10000009 | 3300005937 | Bacteria | 249885 |
| 231 | Ga0081455_10002005 | 3300005937 | Bacteria | 24324 |
| 232 | Ga0081455_10002521 | 3300005937 | Bacteria | 21748 |
| 233 | Ga0081455_10003750 | 3300005937 | Bacteria | 17364 |
| 234 | Ga0081455_10033784 | 3300005937 | Bacteria | 4591 |
| 235 | Ga0081455_10120639 | 3300005937 | Bacteria | 2066 |
| 236 | Ga0081538_10027111 | 3300005981 | Bacteria | 3982 |
| 237 | Ga0081539_10000169 | 3300005985 | Bacteria | 153327 |
| 238 | Ga0081539_10002225 | 3300005985 | Bacteria | 28285 |
| 239 | Ga0070717_10001787 | 3300006028 | Bacteria | 14987 |
| 240 | Ga0075365_10139823 | 3300006038 | Bacteria | 1680 |
| 241 | Ga0075432_10000952 | 3300006058 | Bacteria | 9139 |
| 242 | Ga0070715_10000335 | 3300006163 | Bacteria | 11724 |
| 243 | Ga0070715_10123590 | 3300006163 | Unclassified | 1237 |
| 244 | Ga0070716_100005101 | 3300006173 | Bacteria | 6341 |
| 245 | Ga0070716_100103591 | 3300006173 | Bacteria | 1750 |
| 246 | Ga0070712_100124450 | 3300006175 | Bacteria | 1945 |
| 247 | Ga0070712_100459540 | 3300006175 | Bacteria | 1061 |
| 248 | Ga0075367_10015558 | 3300006178 | Bacteria | 4140 |
| 249 | Ga0075367_10027997 | 3300006178 | Bacteria | 3211 |
| 250 | Ga0075367_10050287 | 3300006178 | Bacteria | 2460 |
| 251 | Ga0075427_10000004 | 3300006194 | Bacteria | 15321 |
| 252 | Ga0075366_10001747 | 3300006195 | Bacteria | 10932 |
| 253 | Ga0097621_100001589 | 3300006237 | Bacteria | 15534 |
| 254 | Ga0097621_100013414 | 3300006237 | Bacteria | 6108 |
| 255 | Ga0097621_100023262 | 3300006237 | Bacteria | 4821 |
| 256 | Ga0097621_100044633 | 3300006237 | Bacteria | 3576 |
| 257 | Ga0075370_10058571 | 3300006353 | Bacteria | 2191 |
| 258 | Ga0075370_10063596 | 3300006353 | Bacteria | 2104 |
| 259 | Ga0068871_100000821 | 3300006358 | Bacteria | 20820 |
| 260 | Ga0068871_100083192 | 3300006358 | Bacteria | 2654 |
| 261 | Ga0068871_100134265 | 3300006358 | Bacteria | 2100 |
| 262 | Ga0075428_100001565 | 3300006844 | Bacteria | 24533 |
| 263 | Ga0075428_100008326 | 3300006844 | Bacteria | 11493 |
| 264 | Ga0075428_100114044 | 3300006844 | Bacteria | 2944 |
| 265 | Ga0075428_100276708 | 3300006844 | Bacteria | 1806 |
| 266 | Ga0075428_100293266 | 3300006844 | Bacteria | 1749 |
| 267 | Ga0075428_100378678 | 3300006844 | Bacteria | 1517 |
| 268 | Ga0075428_100556231 | 3300006844 | Bacteria | 1226 |
| 269 | Ga0075430_100001186 | 3300006846 | Bacteria | 20900 |
| 270 | Ga0075430_100042149 | 3300006846 | Bacteria | 3860 |
| 271 | Ga0075430_100112812 | 3300006846 | Bacteria | 2266 |
| 272 | Ga0075430_100270664 | 3300006846 | Bacteria | 1406 |
| 273 | Ga0075430_100381924 | 3300006846 | Bacteria | 1162 |
| 274 | Ga0075431_100000584 | 3300006847 | Bacteria | 30912 |
| 275 | Ga0075431_100001446 | 3300006847 | Bacteria | 21870 |
| 276 | Ga0075431_100143647 | 3300006847 | Bacteria | 2459 |
| 277 | Ga0075431_100174601 | 3300006847 | Bacteria | 2207 |
| 278 | Ga0075431_100258581 | 3300006847 | Bacteria | 1767 |
| 279 | Ga0075431_100297265 | 3300006847 | Bacteria | 1632 |
| 280 | Ga0075431_100457943 | 3300006847 | Bacteria | 1270 |
| 281 | Ga0075433_10000215 | 3300006852 | Bacteria | 32818 |
| 282 | Ga0075433_10029127 | 3300006852 | Bacteria | 4702 |
| 283 | Ga0075433_10033704 | 3300006852 | Bacteria | 4392 |
| 284 | Ga0075434_100003016 | 3300006871 | Bacteria | 14968 |
| 285 | Ga0075434_100025301 | 3300006871 | Bacteria | 5807 |
| 286 | Ga0075434_100028038 | 3300006871 | Bacteria | 5530 |
| 287 | Ga0075434_100059633 | 3300006871 | Bacteria | 3793 |
| 288 | Ga0075434_100128389 | 3300006871 | Bacteria | 2553 |
| 289 | Ga0075434_100142282 | 3300006871 | Bacteria | 2419 |
| 290 | Ga0075434_100300829 | 3300006871 | Bacteria | 1625 |
| 291 | Ga0075429_100002095 | 3300006880 | Bacteria | 16649 |
| 292 | Ga0075429_100002098 | 3300006880 | Bacteria | 16630 |
| 293 | Ga0075429_100003512 | 3300006880 | Bacteria | 13367 |
| 294 | Ga0075429_100256367 | 3300006880 | Bacteria | 1531 |
| 295 | Ga0068865_100000904 | 3300006881 | Bacteria | 16845 |
| 296 | Ga0068865_100022470 | 3300006881 | Bacteria | 4115 |
| 297 | Ga0068865_100146644 | 3300006881 | Unclassified | 1786 |
| 298 | Ga0068865_100147550 | 3300006881 | Bacteria | 1781 |
| 299 | Ga0075436_100059046 | 3300006914 | Bacteria | 2650 |
| 300 | Ga0097620_100017372 | 3300006931 | Bacteria | 7228 |
| 301 | Ga0097620_100035960 | 3300006931 | Bacteria | 4969 |
| 302 | Ga0097620_100053232 | 3300006931 | Bacteria | 4070 |
| 303 | Ga0097620_100059497 | 3300006931 | Bacteria | 3849 |
| 304 | Ga0097620_100326411 | 3300006931 | Unclassified | 1629 |
| 305 | Ga0075435_100003952 | 3300007076 | Bacteria | 10129 |
| 306 | Ga0075435_100008222 | 3300007076 | Bacteria | 7473 |
| 307 | Ga0075435_100009478 | 3300007076 | Bacteria | 7053 |
| 308 | Ga0075435_100112730 | 3300007076 | Bacteria | 2263 |
| 309 | Ga0075435_100285608 | 3300007076 | Bacteria | 1409 |
| 310 | Ga0075435_100303690 | 3300007076 | Bacteria | 1365 |
| 311 | Ga0099794_10074346 | 3300007265 | Bacteria | 1669 |
| 312 | Ga0099795_10000065 | 3300007788 | Bacteria | 18517 |
| 313 | Ga0105251_10029534 | 3300009011 | Bacteria | 2761 |
| 314 | Ga0105250_10029855 | 3300009092 | Bacteria | 2192 |
| 315 | Ga0105240_10010852 | 3300009093 | Bacteria | 12759 |
| 316 | Ga0105240_10040215 | 3300009093 | Bacteria | 5984 |
| 317 | Ga0105240_10181925 | 3300009093 | Bacteria | 2480 |
| 318 | Ga0105240_10385327 | 3300009093 | Bacteria | 1582 |
| 319 | Ga0111539_10000705 | 3300009094 | Bacteria | 43338 |
| 320 | Ga0111539_10001590 | 3300009094 | Bacteria | 30257 |
| 321 | Ga0111539_10002796 | 3300009094 | Bacteria | 23160 |
| 322 | Ga0111539_10071163 | 3300009094 | Bacteria | 4104 |
| 323 | Ga0111539_10240122 | 3300009094 | Bacteria | 2109 |
| 324 | Ga0105245_10001399 | 3300009098 | Bacteria | 21858 |
| 325 | Ga0105245_10009709 | 3300009098 | Bacteria | 8394 |
| 326 | Ga0105245_10058969 | 3300009098 | Bacteria | 3455 |
| 327 | Ga0105245_10280158 | 3300009098 | Bacteria | 1629 |
| 328 | Ga0105245_10373271 | 3300009098 | Bacteria | 1419 |
| 329 | Ga0105247_10001106 | 3300009101 | Bacteria | 20081 |
| 330 | Ga0105247_10003221 | 3300009101 | Bacteria | 10741 |
| 331 | Ga0105247_10020381 | 3300009101 | Bacteria | 3986 |
| 332 | Ga0105247_10054881 | 3300009101 | Unclassified | 2459 |
| 333 | Ga0114129_10000057 | 3300009147 | Bacteria | 99258 |
| 334 | Ga0114129_10007384 | 3300009147 | Bacteria | 15644 |
| 335 | Ga0114129_10019783 | 3300009147 | Bacteria | 9583 |
| 336 | Ga0114129_10116731 | 3300009147 | Bacteria | 3678 |
| 337 | Ga0114129_10354510 | 3300009147 | Bacteria | 1943 |
| 338 | Ga0114129_10595896 | 3300009147 | Bacteria | 1432 |
| 339 | Ga0105243_10002518 | 3300009148 | Bacteria | 15298 |
| 340 | Ga0105243_10012299 | 3300009148 | Bacteria | 6473 |
| 341 | Ga0105243_10017699 | 3300009148 | Bacteria | 5389 |
| 342 | Ga0105243_10039541 | 3300009148 | Bacteria | 3678 |
| 343 | Ga0105243_10158683 | 3300009148 | Bacteria | 1948 |
| 344 | Ga0105243_10236804 | 3300009148 | Bacteria | 1622 |
| 345 | Ga0105241_10017190 | 3300009174 | Bacteria | 5313 |
| 346 | Ga0105241_10159404 | 3300009174 | Bacteria | 1853 |
| 347 | Ga0105242_10001979 | 3300009176 | Bacteria | 16110 |
| 348 | Ga0105242_10035113 | 3300009176 | Bacteria | 4021 |
| 349 | Ga0105242_10051405 | 3300009176 | Bacteria | 3358 |
| 350 | Ga0105242_10133137 | 3300009176 | Bacteria | 2149 |
| 351 | Ga0105242_10285819 | 3300009176 | Bacteria | 1500 |
| 352 | Ga0105242_10366270 | 3300009176 | Bacteria | 1335 |
| 353 | Ga0105242_10423821 | 3300009176 | Bacteria | 1248 |
| 354 | Ga0105248_10002761 | 3300009177 | Bacteria | 19508 |
| 355 | Ga0105248_10091263 | 3300009177 | Bacteria | 3431 |
| 356 | Ga0105248_10103224 | 3300009177 | Bacteria | 3214 |
| 357 | Ga0105248_10237313 | 3300009177 | Bacteria | 2052 |
| 358 | Ga0105237_10018759 | 3300009545 | Bacteria | 7153 |
| 359 | Ga0105237_10034574 | 3300009545 | Bacteria | 5117 |
| 360 | Ga0105237_10053856 | 3300009545 | Bacteria | 4034 |
| 361 | Ga0105237_10056173 | 3300009545 | Bacteria | 3941 |
| 362 | Ga0105237_10113907 | 3300009545 | Bacteria | 2696 |
| 363 | Ga0105237_10127937 | 3300009545 | Bacteria | 2534 |
| 364 | Ga0105238_10039159 | 3300009551 | Bacteria | 4808 |
| 365 | Ga0105238_10065285 | 3300009551 | Bacteria | 3640 |
| 366 | Ga0105238_10279920 | 3300009551 | Bacteria | 1649 |
| 367 | Ga0105249_10001607 | 3300009553 | Bacteria | 19768 |
| 368 | Ga0105249_10041870 | 3300009553 | Bacteria | 4164 |
| 369 | Ga0105249_10062903 | 3300009553 | Bacteria | 3408 |
| 370 | Ga0105249_10100649 | 3300009553 | Bacteria | 2718 |
| 371 | Ga0099796_10011509 | 3300010159 | Bacteria | 2470 |
| 372 | Ga0105239_10004906 | 3300010375 | Bacteria | 15826 |
| 373 | Ga0105239_10014477 | 3300010375 | Bacteria | 8753 |
| 374 | Ga0105239_10023767 | 3300010375 | Bacteria | 6749 |
| 375 | Ga0105239_10118946 | 3300010375 | Bacteria | 2932 |
| 376 | Ga0105239_10258298 | 3300010375 | Bacteria | 1957 |
| 377 | Ga0105246_10001743 | 3300011119 | Bacteria | 13011 |
| 378 | Ga0105246_10007183 | 3300011119 | Bacteria | 6821 |
| 379 | Ga0157345_1004578 | 3300012498 | Bacteria | 1042 |
| 380 | Ga0157373_10057488 | 3300013100 | Bacteria | 2759 |
| 381 | Ga0157371_10044904 | 3300013102 | Bacteria | 3145 |
| 382 | Ga0157371_10175200 | 3300013102 | Bacteria | 1533 |
| 383 | Ga0157370_10032704 | 3300013104 | Bacteria | 5077 |
| 384 | Ga0157370_10336763 | 3300013104 | Bacteria | 1391 |
| 385 | Ga0157370_10342441 | 3300013104 | Bacteria | 1378 |
| 386 | Ga0157369_10172905 | 3300013105 | Bacteria | 2275 |
| 387 | Ga0157369_10266901 | 3300013105 | Bacteria | 1784 |
| 388 | Ga0157369_10279705 | 3300013105 | Bacteria | 1738 |
| 389 | Ga0157369_10492777 | 3300013105 | Bacteria | 1268 |
| 390 | Ga0157374_10002463 | 3300013296 | Bacteria | 15633 |
| 391 | Ga0157374_10009285 | 3300013296 | Bacteria | 8435 |
| 392 | Ga0157374_10139785 | 3300013296 | Bacteria | 2350 |
| 393 | Ga0157374_10171180 | 3300013296 | Bacteria | 2118 |
| 394 | Ga0157374_10353689 | 3300013296 | Bacteria | 1460 |
| 395 | Ga0157378_10003278 | 3300013297 | Bacteria | 14389 |
| 396 | Ga0157378_10025519 | 3300013297 | Bacteria | 5203 |
| 397 | Ga0157378_10042152 | 3300013297 | Bacteria | 4050 |
| 398 | Ga0157378_10704818 | 3300013297 | Bacteria | 1029 |
| 399 | Ga0163162_10007479 | 3300013306 | Bacteria | 10627 |
| 400 | Ga0163162_10023461 | 3300013306 | Bacteria | 6088 |
| 401 | Ga0163162_10039558 | 3300013306 | Bacteria | 4713 |
| 402 | Ga0163162_10057610 | 3300013306 | Bacteria | 3913 |
| 403 | Ga0163162_10162786 | 3300013306 | Bacteria | 2353 |
| 404 | Ga0163162_10570830 | 3300013306 | Bacteria | 1258 |
| 405 | Ga0157372_10530880 | 3300013307 | Bacteria | 1372 |
| 406 | Ga0157375_10000974 | 3300013308 | Bacteria | 24784 |
| 407 | Ga0157375_10030322 | 3300013308 | Bacteria | 5098 |
| 408 | Ga0157375_10068633 | 3300013308 | Bacteria | 3548 |
| 409 | Ga0163163_10005044 | 3300014325 | Bacteria | 11380 |
| 410 | Ga0163163_10042234 | 3300014325 | Bacteria | 4465 |
| 411 | Ga0163163_10096542 | 3300014325 | Bacteria | 2976 |
| 412 | Ga0163163_10170686 | 3300014325 | Bacteria | 2222 |
| 413 | Ga0157380_10003351 | 3300014326 | Bacteria | 10986 |
| 414 | Ga0157380_10048023 | 3300014326 | Bacteria | 3360 |
| 415 | Ga0157380_10138947 | 3300014326 | Bacteria | 2084 |
| 416 | Ga0157377_10000240 | 3300014745 | Bacteria | 27908 |
| 417 | Ga0157377_10002728 | 3300014745 | Bacteria | 7853 |
| 418 | Ga0157379_10005829 | 3300014968 | Bacteria | 10591 |
| 419 | Ga0157379_10013664 | 3300014968 | Bacteria | 7116 |
| 420 | Ga0157379_10023314 | 3300014968 | Bacteria | 5492 |
| 421 | Ga0157379_10043364 | 3300014968 | Bacteria | 4016 |
| 422 | Ga0157376_10001267 | 3300014969 | Bacteria | 16614 |
| 423 | Ga0183362_10003 | 3300015683 | Bacteria | 977584 |
| 424 | Ga0163161_10001738 | 3300017792 | Bacteria | 15947 |
| 425 | Ga0163161_10018293 | 3300017792 | Bacteria | 4911 |
| 426 | Ga0163161_10028762 | 3300017792 | Bacteria | 3948 |
| 427 | Ga0163161_10060749 | 3300017792 | Bacteria | 2751 |
| 428 | Ga0163161_10247200 | 3300017792 | Bacteria | 1389 |
| 429 | Ga0207666_1000054 | 3300025271 | Bacteria | 20474 |
| 430 | Ga0207666_1001378 | 3300025271 | Bacteria | 2858 |
| 431 | Ga0207673_1000022 | 3300025290 | Bacteria | 11966 |
| 432 | Ga0209564_1000180 | 3300025295 | Bacteria | 151009 |
| 433 | Ga0207697_10000200 | 3300025315 | Bacteria | 32050 |
| 434 | Ga0207697_10047545 | 3300025315 | Bacteria | 1769 |
| 435 | Ga0207653_10001606 | 3300025885 | Bacteria | 7293 |
| 436 | Ga0207682_10000589 | 3300025893 | Bacteria | 16839 |
| 437 | Ga0207692_10026161 | 3300025898 | Bacteria | 2735 |
| 438 | Ga0207692_10144411 | 3300025898 | Bacteria | 1356 |
| 439 | Ga0207642_10001001 | 3300025899 | Bacteria | 8848 |
| 440 | Ga0207642_10003144 | 3300025899 | Bacteria | 5177 |
| 441 | Ga0207710_10001512 | 3300025900 | Bacteria | 11525 |
| 442 | Ga0207710_10005283 | 3300025900 | Bacteria | 5582 |
| 443 | Ga0207710_10019583 | 3300025900 | Bacteria | 2887 |
| 444 | Ga0207688_10000200 | 3300025901 | Bacteria | 26667 |
| 445 | Ga0207688_10004456 | 3300025901 | Bacteria | 7625 |
| 446 | Ga0207688_10010290 | 3300025901 | Bacteria | 5091 |
| 447 | Ga0207680_10017450 | 3300025903 | Bacteria | 3793 |
| 448 | Ga0207647_10000472 | 3300025904 | Bacteria | 32556 |
| 449 | Ga0207647_10005890 | 3300025904 | Bacteria | 8933 |
| 450 | Ga0207685_10004135 | 3300025905 | Bacteria | 3642 |
| 451 | Ga0207699_10059970 | 3300025906 | Bacteria | 2282 |
| 452 | Ga0207699_10122948 | 3300025906 | Bacteria | 1681 |
| 453 | Ga0207699_10176231 | 3300025906 | Bacteria | 1434 |
| 454 | Ga0207699_10223582 | 3300025906 | Bacteria | 1286 |
| 455 | Ga0207645_10001225 | 3300025907 | Bacteria | 21129 |
| 456 | Ga0207645_10109490 | 3300025907 | Bacteria | 1787 |
| 457 | Ga0207643_10000302 | 3300025908 | Bacteria | 34143 |
| 458 | Ga0207643_10001773 | 3300025908 | Bacteria | 12039 |
| 459 | Ga0207643_10001904 | 3300025908 | Bacteria | 11507 |
| 460 | Ga0207654_10012697 | 3300025911 | Bacteria | 4321 |
| 461 | Ga0207654_10017171 | 3300025911 | Bacteria | 3780 |
| 462 | Ga0207707_10004595 | 3300025912 | Bacteria | 12123 |
| 463 | Ga0207707_10021311 | 3300025912 | Bacteria | 5665 |
| 464 | Ga0207707_10203206 | 3300025912 | Bacteria | 1727 |
| 465 | Ga0207695_10157850 | 3300025913 | Bacteria | 2202 |
| 466 | Ga0207671_10011789 | 3300025914 | Bacteria | 7076 |
| 467 | Ga0207671_10069816 | 3300025914 | Bacteria | 2618 |
| 468 | Ga0207671_10244853 | 3300025914 | Bacteria | 1409 |
| 469 | Ga0207693_10004654 | 3300025915 | Bacteria | 11573 |
| 470 | Ga0207693_10008892 | 3300025915 | Bacteria | 8205 |
| 471 | Ga0207693_10017923 | 3300025915 | Bacteria | 5645 |
| 472 | Ga0207693_10036811 | 3300025915 | Bacteria | 3859 |
| 473 | Ga0207693_10067735 | 3300025915 | Bacteria | 2795 |
| 474 | Ga0207663_10008376 | 3300025916 | Bacteria | 5401 |
| 475 | Ga0207663_10092107 | 3300025916 | Bacteria | 2014 |
| 476 | Ga0207663_10172250 | 3300025916 | Bacteria | 1539 |
| 477 | Ga0207660_10001461 | 3300025917 | Bacteria | 15882 |
| 478 | Ga0207660_10314358 | 3300025917 | Bacteria | 1249 |
| 479 | Ga0207662_10000446 | 3300025918 | Bacteria | 18291 |
| 480 | Ga0207662_10004160 | 3300025918 | Bacteria | 7573 |
| 481 | Ga0207662_10019707 | 3300025918 | Bacteria | 3843 |
| 482 | Ga0207657_10000917 | 3300025919 | Bacteria | 31167 |
| 483 | Ga0207657_10021816 | 3300025919 | Bacteria | 6016 |
| 484 | Ga0207657_10040989 | 3300025919 | Bacteria | 4098 |
| 485 | Ga0207657_10142712 | 3300025919 | Unclassified | 1956 |
| 486 | Ga0207657_10171252 | 3300025919 | Bacteria | 1759 |
| 487 | Ga0207649_10000864 | 3300025920 | Bacteria | 19297 |
| 488 | Ga0207649_10023029 | 3300025920 | Bacteria | 3603 |
| 489 | Ga0207652_10002449 | 3300025921 | Bacteria | 15658 |
| 490 | Ga0207652_10139221 | 3300025921 | Bacteria | 2169 |
| 491 | Ga0207652_10403030 | 3300025921 | Bacteria | 1234 |
| 492 | Ga0207681_10001739 | 3300025923 | Bacteria | 13976 |
| 493 | Ga0207681_10116698 | 3300025923 | Unclassified | 1951 |
| 494 | Ga0207650_10006825 | 3300025925 | Bacteria | 7788 |
| 495 | Ga0207650_10032976 | 3300025925 | Bacteria | 3748 |
| 496 | Ga0207650_10041636 | 3300025925 | Bacteria | 3367 |
| 497 | Ga0207650_10087637 | 3300025925 | Bacteria | 2372 |
| 498 | Ga0207650_10151880 | 3300025925 | Bacteria | 1828 |
| 499 | Ga0207659_10000683 | 3300025926 | Bacteria | 20172 |
| 500 | Ga0207659_10061612 | 3300025926 | Bacteria | 2705 |
| 501 | Ga0207659_10107039 | 3300025926 | Bacteria | 2118 |
| 502 | Ga0207659_10155828 | 3300025926 | Bacteria | 1788 |
| 503 | Ga0207659_10207228 | 3300025926 | Unclassified | 1569 |
| 504 | Ga0207687_10001148 | 3300025927 | Bacteria | 18022 |
| 505 | Ga0207687_10004655 | 3300025927 | Bacteria | 9126 |
| 506 | Ga0207687_10011621 | 3300025927 | Bacteria | 5754 |
| 507 | Ga0207687_10044666 | 3300025927 | Bacteria | 3059 |
| 508 | Ga0207687_10262886 | 3300025927 | Bacteria | 1376 |
| 509 | Ga0207687_10377946 | 3300025927 | Bacteria | 1160 |
| 510 | Ga0207700_10058005 | 3300025928 | Bacteria | 2922 |
| 511 | Ga0207700_10144123 | 3300025928 | Bacteria | 1961 |
| 512 | Ga0207664_10069303 | 3300025929 | Bacteria | 2836 |
| 513 | Ga0207644_10003175 | 3300025931 | Bacteria | 10575 |
| 514 | Ga0207644_10019581 | 3300025931 | Bacteria | 4592 |
| 515 | Ga0207644_10067516 | 3300025931 | Bacteria | 2606 |
| 516 | Ga0207690_10001302 | 3300025932 | Bacteria | 15711 |
| 517 | Ga0207706_10001314 | 3300025933 | Bacteria | 24923 |
| 518 | Ga0207706_10017802 | 3300025933 | Bacteria | 6401 |
| 519 | Ga0207706_10027904 | 3300025933 | Bacteria | 5046 |
| 520 | Ga0207706_10028177 | 3300025933 | Bacteria | 5018 |
| 521 | Ga0207706_10119291 | 3300025933 | Bacteria | 2319 |
| 522 | Ga0207686_10001107 | 3300025934 | Bacteria | 15692 |
| 523 | Ga0207686_10017202 | 3300025934 | Bacteria | 4070 |
| 524 | Ga0207686_10017383 | 3300025934 | Bacteria | 4052 |
| 525 | Ga0207686_10027799 | 3300025934 | Bacteria | 3316 |
| 526 | Ga0207686_10186533 | 3300025934 | Bacteria | 1475 |
| 527 | Ga0207709_10000742 | 3300025935 | Bacteria | 25875 |
| 528 | Ga0207709_10021237 | 3300025935 | Bacteria | 3673 |
| 529 | Ga0207709_10047049 | 3300025935 | Bacteria | 2621 |
| 530 | Ga0207709_10095419 | 3300025935 | Bacteria | 1954 |
| 531 | Ga0207709_10238711 | 3300025935 | Bacteria | 1321 |
| 532 | Ga0207670_10000707 | 3300025936 | Bacteria | 17597 |
| 533 | Ga0207670_10005405 | 3300025936 | Bacteria | 7008 |
| 534 | Ga0207670_10087631 | 3300025936 | Bacteria | 2193 |
| 535 | Ga0207670_10283672 | 3300025936 | Bacteria | 1292 |
| 536 | Ga0207669_10000470 | 3300025937 | Bacteria | 17605 |
| 537 | Ga0207669_10021789 | 3300025937 | Bacteria | 3390 |
| 538 | Ga0207704_10001346 | 3300025938 | Bacteria | 10966 |
| 539 | Ga0207704_10028894 | 3300025938 | Plasmid | 3084 |
| 540 | Ga0207704_10105202 | 3300025938 | Bacteria | 1892 |
| 541 | Ga0207704_10308126 | 3300025938 | Bacteria | 1216 |
| 542 | Ga0207665_10013405 | 3300025939 | Bacteria | 5390 |
| 543 | Ga0207665_10034521 | 3300025939 | Bacteria | 3356 |
| 544 | Ga0207691_10000627 | 3300025940 | Bacteria | 34951 |
| 545 | Ga0207691_10002245 | 3300025940 | Bacteria | 18938 |
| 546 | Ga0207691_10007735 | 3300025940 | Bacteria | 10345 |
| 547 | Ga0207691_10058030 | 3300025940 | Bacteria | 3521 |
| 548 | Ga0207691_10095237 | 3300025940 | Bacteria | 2663 |
| 549 | Ga0207691_10183905 | 3300025940 | Unclassified | 1825 |
| 550 | Ga0207691_10336941 | 3300025940 | Bacteria | 1291 |
| 551 | Ga0207711_10006242 | 3300025941 | Bacteria | 10056 |
| 552 | Ga0207711_10106063 | 3300025941 | Bacteria | 2493 |
| 553 | Ga0207711_10198289 | 3300025941 | Bacteria | 1831 |
| 554 | Ga0207689_10000823 | 3300025942 | Bacteria | 29900 |
| 555 | Ga0207689_10013625 | 3300025942 | Bacteria | 6933 |
| 556 | Ga0207689_10059931 | 3300025942 | Bacteria | 3130 |
| 557 | Ga0207689_10078805 | 3300025942 | Bacteria | 2708 |
| 558 | Ga0207689_10156942 | 3300025942 | Bacteria | 1876 |
| 559 | Ga0207661_10015006 | 3300025944 | Bacteria | 5689 |
| 560 | Ga0207661_10089600 | 3300025944 | Bacteria | 2560 |
| 561 | Ga0207661_10245083 | 3300025944 | Bacteria | 1591 |
| 562 | Ga0207679_10000409 | 3300025945 | Bacteria | 30782 |
| 563 | Ga0207679_10003395 | 3300025945 | Bacteria | 9824 |
| 564 | Ga0207667_10091729 | 3300025949 | Bacteria | 3138 |
| 565 | Ga0207667_10096675 | 3300025949 | Bacteria | 3048 |
| 566 | Ga0207651_10000472 | 3300025960 | Bacteria | 16926 |
| 567 | Ga0207651_10031071 | 3300025960 | Bacteria | 3409 |
| 568 | Ga0207651_10063218 | 3300025960 | Bacteria | 2584 |
| 569 | Ga0207651_10168286 | 3300025960 | Bacteria | 1726 |
| 570 | Ga0207651_10179722 | 3300025960 | Bacteria | 1677 |
| 571 | Ga0207712_10002155 | 3300025961 | Bacteria | 12857 |
| 572 | Ga0207712_10025600 | 3300025961 | Bacteria | 3922 |
| 573 | Ga0207712_10028278 | 3300025961 | Bacteria | 3749 |
| 574 | Ga0207712_10347360 | 3300025961 | Bacteria | 1232 |
| 575 | Ga0207668_10001632 | 3300025972 | Bacteria | 13106 |
| 576 | Ga0207668_10012166 | 3300025972 | Bacteria | 5259 |
| 577 | Ga0207668_10038431 | 3300025972 | Bacteria | 3212 |
| 578 | Ga0207668_10379019 | 3300025972 | Bacteria | 1190 |
| 579 | Ga0207640_10001082 | 3300025981 | Bacteria | 15093 |
| 580 | Ga0207640_10026699 | 3300025981 | Bacteria | 3510 |
| 581 | Ga0207658_10006212 | 3300025986 | Bacteria | 8160 |
| 582 | Ga0207658_10066673 | 3300025986 | Bacteria | 2708 |
| 583 | Ga0207658_10130492 | 3300025986 | Bacteria | 2018 |
| 584 | Ga0207677_10011916 | 3300026023 | Bacteria | 4975 |
| 585 | Ga0207677_10138668 | 3300026023 | Bacteria | 1859 |
| 586 | Ga0207703_10001483 | 3300026035 | Bacteria | 21390 |
| 587 | Ga0207703_10006044 | 3300026035 | Bacteria | 9682 |
| 588 | Ga0207703_10023398 | 3300026035 | Bacteria | 4852 |
| 589 | Ga0207703_10160125 | 3300026035 | Bacteria | 1971 |
| 590 | Ga0207703_10388100 | 3300026035 | Bacteria | 1293 |
| 591 | Ga0207639_10001602 | 3300026041 | Bacteria | 15210 |
| 592 | Ga0207639_10075452 | 3300026041 | Bacteria | 2651 |
| 593 | Ga0207678_10002063 | 3300026067 | Bacteria | 18225 |
| 594 | Ga0207678_10012664 | 3300026067 | Bacteria | 7411 |
| 595 | Ga0207678_10024225 | 3300026067 | Bacteria | 5301 |
| 596 | Ga0207678_10037027 | 3300026067 | Bacteria | 4246 |
| 597 | Ga0207678_10069547 | 3300026067 | Bacteria | 3018 |
| 598 | Ga0207678_10144658 | 3300026067 | Unclassified | 2029 |
| 599 | Ga0207678_10204817 | 3300026067 | Bacteria | 1688 |
| 600 | Ga0207708_10000575 | 3300026075 | Bacteria | 28372 |
| 601 | Ga0207708_10005514 | 3300026075 | Bacteria | 9339 |
| 602 | Ga0207708_10009098 | 3300026075 | Bacteria | 7349 |
| 603 | Ga0207708_10018000 | 3300026075 | Bacteria | 5316 |
| 604 | Ga0207708_10139913 | 3300026075 | Bacteria | 1898 |
| 605 | Ga0207702_10004242 | 3300026078 | Bacteria | 12799 |
| 606 | Ga0207702_10111618 | 3300026078 | Bacteria | 2432 |
| 607 | Ga0207641_10009610 | 3300026088 | Bacteria | 7971 |
| 608 | Ga0207641_10012014 | 3300026088 | Bacteria | 7105 |
| 609 | Ga0207641_10013698 | 3300026088 | Bacteria | 6655 |
| 610 | Ga0207641_10162760 | 3300026088 | Bacteria | 2030 |
| 611 | Ga0207641_10392280 | 3300026088 | Bacteria | 1331 |
| 612 | Ga0207648_10001152 | 3300026089 | Bacteria | 29605 |
| 613 | Ga0207648_10001396 | 3300026089 | Bacteria | 26597 |
| 614 | Ga0207648_10003124 | 3300026089 | Bacteria | 17485 |
| 615 | Ga0207648_10035411 | 3300026089 | Bacteria | 4397 |
| 616 | Ga0207648_10255151 | 3300026089 | Bacteria | 1564 |
| 617 | Ga0207676_10003967 | 3300026095 | Bacteria | 10441 |
| 618 | Ga0207676_10009698 | 3300026095 | Bacteria | 6845 |
| 619 | Ga0207676_10068466 | 3300026095 | Bacteria | 2839 |
| 620 | Ga0207676_10189490 | 3300026095 | Bacteria | 1808 |
| 621 | Ga0207674_10001102 | 3300026116 | Bacteria | 35088 |
| 622 | Ga0207674_10005570 | 3300026116 | Bacteria | 14930 |
| 623 | Ga0207674_10131166 | 3300026116 | Bacteria | 2469 |
| 624 | Ga0207675_100002494 | 3300026118 | Bacteria | 18217 |
| 625 | Ga0207675_100009825 | 3300026118 | Bacteria | 8957 |
| 626 | Ga0207675_100028613 | 3300026118 | Bacteria | 5190 |
| 627 | Ga0207675_100029262 | 3300026118 | Bacteria | 5132 |
| 628 | Ga0207675_100119491 | 3300026118 | Bacteria | 2493 |
| 629 | Ga0207683_10000637 | 3300026121 | Bacteria | 32050 |
| 630 | Ga0207683_10034072 | 3300026121 | Bacteria | 4425 |
| 631 | Ga0207683_10048246 | 3300026121 | Bacteria | 3729 |
| 632 | Ga0207683_10062131 | 3300026121 | Bacteria | 3289 |
| 633 | Ga0207683_10144885 | 3300026121 | Bacteria | 2142 |
| 634 | Ga0207683_10249147 | 3300026121 | Unclassified | 1621 |
| 635 | Ga0207698_10000980 | 3300026142 | Bacteria | 16616 |
| 636 | Ga0207698_10072082 | 3300026142 | Bacteria | 2744 |
| 637 | Ga0207698_10105903 | 3300026142 | Bacteria | 2344 |
| 638 | Ga0209179_1000797 | 3300027512 | Bacteria | 3447 |
| 639 | Ga0210002_1000076 | 3300027617 | Bacteria | 15605 |
| 640 | Ga0209971_1002029 | 3300027682 | Bacteria | 4924 |
| 641 | Ga0209966_1008562 | 3300027695 | Bacteria | 1818 |
| 642 | Ga0209998_10000471 | 3300027717 | Bacteria | 11138 |
| 643 | Ga0209998_10007581 | 3300027717 | Bacteria | 2252 |
| 644 | Ga0209974_10000316 | 3300027876 | Bacteria | 15770 |
| 645 | Ga0209974_10056241 | 3300027876 | Bacteria | 1327 |
| 646 | Ga0207428_10000216 | 3300027907 | Bacteria | 79777 |
| 647 | Ga0207428_10001434 | 3300027907 | Bacteria | 25064 |
| 648 | Ga0207428_10001751 | 3300027907 | Bacteria | 22228 |
| 649 | Ga0207428_10009210 | 3300027907 | Bacteria | 8869 |
| 650 | Ga0207428_10343621 | 3300027907 | Bacteria | 1099 |
| 651 | Ga0268266_10035794 | 3300028379 | Bacteria | 4222 |
| 652 | Ga0268266_10143756 | 3300028379 | Bacteria | 2143 |
| 653 | Ga0268265_10001997 | 3300028380 | Bacteria | 16117 |
| 654 | Ga0268265_10004180 | 3300028380 | Bacteria | 10112 |
| 655 | Ga0268265_10074879 | 3300028380 | Bacteria | 2650 |
| 656 | Ga0268265_10086908 | 3300028380 | Bacteria | 2486 |
| 657 | Ga0268265_10476435 | 3300028380 | Unclassified | 1171 |
| 658 | Ga0268264_10002438 | 3300028381 | Bacteria | 16355 |
| 659 | Ga0268264_10010004 | 3300028381 | Bacteria | 7852 |
| 660 | Ga0268264_10045422 | 3300028381 | Bacteria | 3646 |
| 661 | Ga0265337_1001192 | 3300028556 | Bacteria | 13219 |
| 662 | Ga0307517_10102413 | 3300028786 | Bacteria | 2245 |
| 663 | Ga0307515_10006871 | 3300028794 | Bacteria | 22638 |
| 664 | Ga0307512_10023853 | 3300030522 | Bacteria | 5459 |
| 665 | Ga0265330_10026527 | 3300031235 | Bacteria | 2620 |
| 666 | Ga0265325_10000048 | 3300031241 | Bacteria | 82899 |
| 667 | Ga0265340_10008082 | 3300031247 | Bacteria | 5696 |
| 668 | Ga0265340_10023536 | 3300031247 | Bacteria | 3140 |
| 669 | Ga0265331_10013663 | 3300031250 | Bacteria | 4356 |
| 670 | Ga0307513_10200042 | 3300031456 | Bacteria | 1840 |
| 671 | Ga0307513_10241854 | 3300031456 | Bacteria | 1609 |
| 672 | Ga0307509_10000225 | 3300031507 | Bacteria | 90913 |
| 673 | Ga0265313_10000438 | 3300031595 | Bacteria | 44285 |
| 674 | Ga0265313_10041021 | 3300031595 | Bacteria | 2283 |
| 675 | Ga0307514_10030744 | 3300031649 | Bacteria | 4309 |
| 676 | Ga0265342_10096067 | 3300031712 | Bacteria | 1694 |
| 677 | Ga0307410_10327580 | 3300031852 | Bacteria | 1217 |
| 678 | Ga0307409_100009307 | 3300031995 | Bacteria | 6030 |
| 679 | Ga0307416_100043851 | 3300032002 | Bacteria | 3507 |
| 680 | Ga0373930_0000307 | 3300034816 | Bacteria | 6344 |
| 681 | Ga0373930_0013015 | 3300034816 | Bacteria | 1527 |
| 682 | Ga0373948_0002119 | 3300034817 | Bacteria | 2890 |
| 683 | Ga0373950_0001201 | 3300034818 | Bacteria | 3339 |
| 684 | Ga0373958_0000322 | 3300034819 | Bacteria | 5796 |
| 685 | Ga0373958_0003692 | 3300034819 | Bacteria | 2226 |
| 686 | Ga0373959_0007371 | 3300034820 | Bacteria | 1848 |
| 687 | Ga0373926_0005698 | 3300035083 | Bacteria | 4111 |
| 688 | Ga0373926_0009376 | 3300035083 | Bacteria | 3271 |
| 689 | Ga0373928_0012069 | 3300035084 | Bacteria | 1718 |
| 690 | Ga0373929_0000143 | 3300035085 | Bacteria | 12292 |
| 691 | Ga0373929_0015524 | 3300035085 | Bacteria | 1482 |
| 692 | Ga0373934_0021268 | 3300035086 | Bacteria | 2498 |
| 693 | Ga0373940_0011892 | 3300035088 | Bacteria | 2077 |
| 694 | Ga0373944_0038993 | 3300035089 | Bacteria | 1461 |
| 695 | Ga0373949_0001165 | 3300035090 | Bacteria | 7825 |
| 696 | Ga0373949_0008747 | 3300035090 | Bacteria | 2216 |
| 697 | Ga0373951_0000777 | 3300035091 | Bacteria | 8726 |
| 698 | Ga0373951_0004528 | 3300035091 | Bacteria | 3293 |
| 699 | Ga0373951_0027103 | 3300035091 | Unclassified | 1337 |
| 700 | Ga0373951_0034299 | 3300035091 | Bacteria | 1205 |
| 701 | Ga0373952_0001954 | 3300035092 | Bacteria | 3731 |
| 702 | Ga0373952_0004393 | 3300035092 | Bacteria | 2558 |
| 703 | Ga0373923_0009412 | 3300035111 | Bacteria | 3526 |
| 704 | Ga0373932_0000870 | 3300035112 | Bacteria | 8925 |
| 705 | Ga0373932_0003101 | 3300035112 | Bacteria | 4050 |
| 706 | Ga0373936_0006749 | 3300035113 | Bacteria | 4320 |
| 707 | Ga0373939_0001316 | 3300035114 | Bacteria | 6030 |
| 708 | Ga0373939_0002013 | 3300035114 | Bacteria | 4852 |
| 709 | Ga0373941_0001795 | 3300035115 | Bacteria | 4622 |
| 710 | Ga0373941_0005143 | 3300035115 | Bacteria | 3059 |
| 711 | Ga0373945_0005139 | 3300035116 | Bacteria | 4178 |
| 712 | Ga0373945_0020719 | 3300035116 | Bacteria | 2253 |
| 713 | Ga0373954_0016689 | 3300035118 | Bacteria | 3290 |
| 714 | Ga0373956_0005731 | 3300035119 | Bacteria | 4967 |
| 715 | Ga0373956_0026502 | 3300035119 | Bacteria | 2511 |
| 716 | Ga0373956_0038409 | 3300035119 | Bacteria | 2118 |
| 717 | Ga0373957_0002589 | 3300035120 | Bacteria | 5190 |
| 718 | Ga0373960_0000059 | 3300035121 | Bacteria | 15169 |
| 719 | Ga0373960_0004733 | 3300035121 | Bacteria | 3131 |
| 720 | Ga0373960_0005883 | 3300035121 | Bacteria | 2854 |
| 721 | Ga0373943_0009773 | 3300035170 | Bacteria | 4296 |
| 722 | Ga0373943_0179214 | 3300035170 | Bacteria | 1164 |
| 723 | Ga0373946_0017923 | 3300035171 | Bacteria | 2712 |
| 724 | Ga0373955_0004501 | 3300035172 | Bacteria | 6171 |
| 725 | Ga0373955_0004659 | 3300035172 | Bacteria | 6083 |
| 726 | Ga0373955_0033246 | 3300035172 | Bacteria | 2715 |
| 727 | Ga0373942_0001389 | 3300035207 | Bacteria | 6261 |
| 728 | Ga0373961_0005506 | 3300035241 | Bacteria | 3043 |
| 729 | Ga0373962_0000585 | 3300035242 | Bacteria | 8258 |
| 730 | Ga0373931_0004620 | 3300035691 | Bacteria | 6296 |
| 731 | Ga0373931_0017840 | 3300035691 | Bacteria | 3518 |
| 732 | Ga0373931_0030162 | 3300035691 | Bacteria | 2790 |
| 733 | Ga0373935_0018177 | 3300035692 | Bacteria | 4273 |
| 734 | Ga0373935_0029643 | 3300035692 | Bacteria | 3387 |
| 735 | Ga0373935_0088090 | 3300035692 | Bacteria | 2028 |
| 736 | Ga0373935_0324781 | 3300035692 | Unclassified | 1092 |
| 737 | Ga0373927_0032493 | 3300035695 | Bacteria | 3398 |
| 738 | Ga0373927_0085628 | 3300035695 | Bacteria | 2045 |
| 739 | Ga0373927_0142822 | 3300035695 | Bacteria | 1566 |
| 740 | Ga0373927_0149038 | 3300035695 | Bacteria | 1532 |
| 741 | Ga0373933_0002274 | 3300035724 | Bacteria | 10955 |
| 742 | Ga0373933_0003001 | 3300035724 | Bacteria | 9408 |
| 743 | Ga0373933_0012239 | 3300035724 | Bacteria | 4739 |
| 744 | Ga0373933_0036242 | 3300035724 | Bacteria | 2886 |
| 745 | Ga0373933_0118759 | 3300035724 | Bacteria | 1655 |
| 746 | Ga0373947_0020225 | 3300035725 | Bacteria | 3842 |
| 747 | Ga0373937_0010837 | 3300036401 | Bacteria | 7980 |
| 748 | Ga0373937_0019262 | 3300036401 | Bacteria | 6108 |
| 749 | Ga0373937_0023232 | 3300036401 | Bacteria | 5582 |
| 750 | Ga0373937_0097894 | 3300036401 | Bacteria | 2721 |
| 751 | Ga0373937_0477059 | 3300036401 | Bacteria | 1185 |
| 752 | Ga0373925_0036705 | 3300037068 | Bacteria | 3616 |
| 753 | Ga0373925_0038021 | 3300037068 | Bacteria | 3555 |
| 754 | Ga0373925_0061959 | 3300037068 | Bacteria | 2811 |
| 755 | Ga0373925_0061989 | 3300037068 | Bacteria | 2811 |
| 756 | Ga0373925_0280354 | 3300037068 | Bacteria | 1342 |
| 757 | Ga0436364_0928179 | 3300037853 | Bacteria | 2023 |
| 758 | Ga0436365_0314634 | 3300039437 | Bacteria | 7046 |
| 759 | Ga0436365_1628126 | 3300039437 | Bacteria | 4425 |
| 760 | Ga0451791_1369153 | 3300041451 | Bacteria | 1164 |
| 761 | Ga0439460_0045514 | 3300042461 | Bacteria | 1301 |
| 762 | Ga0466963_0001958 | 3300044694 | Bacteria | 11296 |
| 763 | Ga0451576_0072236 | 3300045051 | Bacteria | 3591 |
| 764 | Ga0466967_0004256 | 3300045976 | Bacteria | 9613 |
| 765 | Ga0495592_0039015 | 3300046454 | Bacteria | 3570 |
| 766 | Ga0495592_0041402 | 3300046454 | Bacteria | 3452 |
| 767 | Ga0495592_0116908 | 3300046454 | Bacteria | 1881 |
| 768 | Ga0495603_0034013 | 3300046455 | Bacteria | 3066 |
| 769 | Ga0495629_0001000 | 3300046459 | Bacteria | 22680 |
| 770 | Ga0495629_0030399 | 3300046459 | Bacteria | 3829 |
| 771 | Ga0495641_0094093 | 3300046461 | Bacteria | 1338 |
| 772 | Ga0495651_0040850 | 3300046462 | Bacteria | 3604 |
| 773 | Ga0495651_0060876 | 3300046462 | Bacteria | 2890 |
| 774 | Ga0495653_0084967 | 3300046463 | Bacteria | 2329 |
| 775 | Ga0495580_0030435 | 3300046472 | Bacteria | 3908 |
| 776 | Ga0495580_0059109 | 3300046472 | Bacteria | 2694 |
| 777 | Ga0495582_0003989 | 3300046473 | Bacteria | 8293 |
| 778 | Ga0495582_0098827 | 3300046473 | Bacteria | 1633 |
| 779 | Ga0495639_0040360 | 3300046475 | Bacteria | 2099 |
| 780 | Ga0495662_0083361 | 3300046476 | Bacteria | 1556 |
| 781 | Ga0495664_0010075 | 3300046477 | Bacteria | 5302 |
| 782 | Ga0495664_0014802 | 3300046477 | Bacteria | 4428 |
| 783 | Ga0495584_0056499 | 3300046491 | Bacteria | 1975 |
| 784 | Ga0495585_0034434 | 3300046492 | Bacteria | 2863 |
| 785 | Ga0495585_0118049 | 3300046492 | Bacteria | 1405 |
| 786 | Ga0495594_0005856 | 3300046499 | Bacteria | 6316 |
| 787 | Ga0495594_0031869 | 3300046499 | Bacteria | 2860 |
| 788 | Ga0495594_0131019 | 3300046499 | Bacteria | 1420 |
| 789 | Ga0495608_0041702 | 3300046511 | Bacteria | 3070 |
| 790 | Ga0495618_0110789 | 3300046514 | Bacteria | 1757 |
| 791 | Ga0495628_0434381 | 3300046516 | Bacteria | 955 |
| 792 | Ga0495630_0027271 | 3300046517 | Bacteria | 4235 |
| 793 | Ga0495644_0002236 | 3300046523 | Bacteria | 7740 |
| 794 | Ga0495644_0054986 | 3300046523 | Bacteria | 1495 |
| 795 | Ga0495666_0028309 | 3300046526 | Bacteria | 2756 |
| 796 | Ga0495666_0149938 | 3300046526 | Unclassified | 1084 |
| 797 | Ga0495652_0101319 | 3300046529 | Bacteria | 2335 |
| 798 | Ga0495652_0236254 | 3300046529 | Bacteria | 1363 |
| 799 | Ga0495665_0036088 | 3300046531 | Bacteria | 2639 |
| 800 | Ga0495587_0001853 | 3300046536 | Bacteria | 14067 |
| 801 | Ga0495587_0079163 | 3300046536 | Bacteria | 1906 |
| 802 | Ga0495598_0003223 | 3300046537 | Bacteria | 3445 |
| 803 | Ga0495609_0080695 | 3300046538 | Bacteria | 1422 |
| 804 | Ga0495597_0022818 | 3300046542 | Bacteria | 2899 |
| 805 | Ga0495645_0001729 | 3300046543 | Bacteria | 14827 |
| 806 | Ga0495645_0008295 | 3300046543 | Bacteria | 7250 |
| 807 | Ga0495645_0230209 | 3300046543 | Bacteria | 1242 |
| 808 | Ga0495622_0021157 | 3300046557 | Bacteria | 3031 |
| 809 | Ga0495633_0016888 | 3300046558 | Bacteria | 3746 |
| 810 | Ga0495667_0009963 | 3300046559 | Bacteria | 6437 |
| 811 | Ga0495667_0034800 | 3300046559 | Bacteria | 3368 |
| 812 | Ga0495656_0000398 | 3300046615 | Bacteria | 14416 |
| 813 | Ga0495656_0007656 | 3300046615 | Bacteria | 3828 |
| 814 | Ga0495656_0185563 | 3300046615 | Bacteria | 1025 |
| 815 | Ga0495611_0034364 | 3300046648 | Bacteria | 2241 |
| 816 | Ga0495635_0016669 | 3300046663 | Bacteria | 5132 |
| 817 | Ga0495635_0067515 | 3300046663 | Bacteria | 2453 |
| 818 | Ga0495635_0197624 | 3300046663 | Bacteria | 1365 |
| 819 | Ga0495659_0003411 | 3300046664 | Bacteria | 5079 |
| 820 | Ga0495659_0029178 | 3300046664 | Bacteria | 1914 |
| 821 | Ga0495657_0017371 | 3300046675 | Bacteria | 5225 |
| 822 | Ga0495599_0025961 | 3300046678 | Bacteria | 3669 |
| 823 | Ga0495623_0014430 | 3300046679 | Bacteria | 5113 |
| 824 | Ga0495646_0093505 | 3300046680 | Bacteria | 1732 |
| 825 | Ga0495647_0051266 | 3300046681 | Bacteria | 1603 |
| 826 | Ga0495658_0004053 | 3300046683 | Bacteria | 7219 |
| 827 | Ga0495658_0010561 | 3300046683 | Bacteria | 4621 |
| 828 | Ga0495658_0080063 | 3300046683 | Bacteria | 1915 |
| 829 | Ga0495658_0147524 | 3300046683 | Bacteria | 1443 |
| 830 | Ga0495613_0013909 | 3300046689 | Bacteria | 5971 |
| 831 | Ga0495600_0015719 | 3300046809 | Bacteria | 4791 |
| 832 | Ga0495600_0041655 | 3300046809 | Bacteria | 2993 |
| 833 | Ga0495600_0046760 | 3300046809 | Bacteria | 2822 |
| 834 | Ga0495604_0051363 | 3300047317 | Bacteria | 3196 |
| 835 | Ga0495604_0057558 | 3300047317 | Bacteria | 2988 |
| 836 | Ga0495674_0002982 | 3300047319 | Bacteria | 16480 |
| 837 | Ga0495674_0021258 | 3300047319 | Bacteria | 6003 |
| 838 | Ga0495674_0091194 | 3300047319 | Bacteria | 2603 |
| 839 | Ga0495674_0129671 | 3300047319 | Bacteria | 2125 |
| 840 | Ga0495676_0085716 | 3300047321 | Bacteria | 2372 |
| 841 | Ga0495680_0008240 | 3300047322 | Bacteria | 9495 |
| 842 | Ga0495680_0019482 | 3300047322 | Bacteria | 5724 |
| 843 | Ga0495680_0082408 | 3300047322 | Bacteria | 2427 |
| 844 | Ga0495687_002565 | 3300047443 | Bacteria | 14333 |
| 845 | Ga0495675_0047109 | 3300047444 | Bacteria | 2743 |
| 846 | Ga0495677_0030178 | 3300047445 | Bacteria | 1973 |
| 847 | Ga0495679_039183 | 3300047446 | Bacteria | 1479 |
| 848 | Ga0495684_0000749 | 3300047471 | Bacteria | 26152 |
| 849 | Ga0495593_0148398 | 3300047673 | Bacteria | 1186 |
| 850 | Ga0495602_0004715 | 3300048088 | Bacteria | 14255 |
| 851 | Ga0495614_0045975 | 3300048089 | Unclassified | 1872 |
| 852 | Ga0495615_0004243 | 3300048090 | Bacteria | 2484 |
| 853 | Ga0496100_0001128 | 3300048903 | Bacteria | 12970 |
| 854 | Ga0496100_0002875 | 3300048903 | Bacteria | 8828 |
| 855 | Ga0496100_0009197 | 3300048903 | Bacteria | 5544 |
| 856 | Ga0496101_0002858 | 3300048904 | Bacteria | 10609 |
| 857 | Ga0496101_0014471 | 3300048904 | Bacteria | 5303 |
| 858 | Ga0496101_0024431 | 3300048904 | Bacteria | 4182 |
| 859 | Ga0496101_0046816 | 3300048904 | Bacteria | 3102 |
| 860 | Ga0496101_0388388 | 3300048904 | Bacteria | 1098 |
| 861 | Ga0496102_0010044 | 3300048905 | Bacteria | 8140 |
| 862 | Ga0496102_0085854 | 3300048905 | Bacteria | 2906 |
| 863 | Ga0496102_0199374 | 3300048905 | Bacteria | 1886 |
| 864 | Ga0496102_0342164 | 3300048905 | Bacteria | 1408 |
| 865 | Ga0496102_0378334 | 3300048905 | Bacteria | 1332 |
| 866 | Ga0496103_0001913 | 3300048906 | Bacteria | 13529 |
| 867 | Ga0496103_0002261 | 3300048906 | Bacteria | 12177 |
| 868 | Ga0496103_0041171 | 3300048906 | Bacteria | 2839 |
| 869 | Ga0496103_0070530 | 3300048906 | Bacteria | 2186 |
| 870 | Ga0496103_0073942 | 3300048906 | Bacteria | 2135 |
| 871 | Ga0496104_0000196 | 3300048907 | Bacteria | 53901 |
| 872 | Ga0496104_0000629 | 3300048907 | Bacteria | 30223 |
| 873 | Ga0496104_0074710 | 3300048907 | Bacteria | 3227 |
| 874 | Ga0496104_0095263 | 3300048907 | Bacteria | 2848 |
| 875 | Ga0496104_0245738 | 3300048907 | Bacteria | 1702 |
| 876 | Ga0496105_0002162 | 3300048908 | Bacteria | 14234 |
| 877 | Ga0496105_0002424 | 3300048908 | Bacteria | 13516 |
| 878 | Ga0496105_0004080 | 3300048908 | Bacteria | 10934 |
| 879 | Ga0496105_0010975 | 3300048908 | Bacteria | 7138 |
| 880 | Ga0496105_0069166 | 3300048908 | Bacteria | 2918 |
| 881 | Ga0496105_0186187 | 3300048908 | Unclassified | 1699 |
| 882 | Ga0496105_0199409 | 3300048908 | Bacteria | 1634 |
| 883 | Ga0496105_0284799 | 3300048908 | Bacteria | 1331 |
| 884 | Ga0496106_0012626 | 3300048909 | Bacteria | 6240 |
| 885 | Ga0496106_0018460 | 3300048909 | Bacteria | 5157 |
| 886 | Ga0496106_0019469 | 3300048909 | Bacteria | 5035 |
| 887 | Ga0496106_0025671 | 3300048909 | Bacteria | 4386 |
| 888 | Ga0496106_0080436 | 3300048909 | Bacteria | 2502 |
| 889 | Ga0496107_0000646 | 3300048910 | Bacteria | 19609 |
| 890 | Ga0496107_0002792 | 3300048910 | Bacteria | 11521 |
| 891 | Ga0496107_0005465 | 3300048910 | Bacteria | 8697 |
| 892 | Ga0496107_0006701 | 3300048910 | Bacteria | 7930 |
| 893 | Ga0496107_0100206 | 3300048910 | Bacteria | 2123 |
| 894 | Ga0496107_0306942 | 3300048910 | Unclassified | 1181 |
| 895 | Ga0496108_0031303 | 3300048911 | Bacteria | 4413 |
| 896 | Ga0496108_0050893 | 3300048911 | Bacteria | 3470 |
| 897 | Ga0496108_0055390 | 3300048911 | Bacteria | 3329 |
| 898 | Ga0496108_0093445 | 3300048911 | Plasmid | 2559 |
| 899 | Ga0496108_0103396 | 3300048911 | Bacteria | 2430 |
| 900 | Ga0496108_0255359 | 3300048911 | Bacteria | 1525 |
| 901 | Ga0496108_0271534 | 3300048911 | Bacteria | 1476 |
| 902 | Ga0496108_0296325 | 3300048911 | Bacteria | 1408 |
| 903 | Ga0496108_0370744 | 3300048911 | Bacteria | 1250 |
| 904 | Ga0496109_0001395 | 3300048912 | Bacteria | 20044 |
| 905 | Ga0496109_0003734 | 3300048912 | Bacteria | 12724 |
| 906 | Ga0496109_0005620 | 3300048912 | Bacteria | 10492 |
| 907 | Ga0496109_0031840 | 3300048912 | Bacteria | 4737 |
| 908 | Ga0496109_0069949 | 3300048912 | Bacteria | 3220 |
| 909 | Ga0496109_0074118 | 3300048912 | Plasmid | 3128 |
| 910 | Ga0496109_0240292 | 3300048912 | Bacteria | 1704 |
| 911 | Ga0496109_0308748 | 3300048912 | Bacteria | 1492 |
| 912 | Ga0496110_0009821 | 3300048913 | Bacteria | 7753 |
| 913 | Ga0496110_0032183 | 3300048913 | Bacteria | 4528 |
| 914 | Ga0496110_0230548 | 3300048913 | Bacteria | 1684 |
| 915 | Ga0496110_0275365 | 3300048913 | Bacteria | 1532 |
| 916 | Ga0496110_0424193 | 3300048913 | Bacteria | 1212 |
| 917 | Ga0496111_0002390 | 3300048914 | Bacteria | 11313 |
| 918 | Ga0496111_0007504 | 3300048914 | Bacteria | 7155 |
| 919 | Ga0496112_0029993 | 3300048915 | Bacteria | 5263 |
| 920 | Ga0496112_0032426 | 3300048915 | Bacteria | 5072 |
| 921 | Ga0496112_0055338 | 3300048915 | Bacteria | 3901 |
| 922 | Ga0496112_0099124 | 3300048915 | Bacteria | 2883 |
| 923 | Ga0496112_0255877 | 3300048915 | Bacteria | 1701 |
| 924 | Ga0496112_0323818 | 3300048915 | Bacteria | 1485 |
| 925 | Ga0496113_0000682 | 3300048916 | Bacteria | 17292 |
| 926 | Ga0496113_0004427 | 3300048916 | Bacteria | 8632 |
| 927 | Ga0496113_0019709 | 3300048916 | Bacteria | 4726 |
| 928 | Ga0496113_0100665 | 3300048916 | Unclassified | 2239 |
| 929 | Ga0496114_0001441 | 3300048917 | Bacteria | 18044 |
| 930 | Ga0496114_0003348 | 3300048917 | Bacteria | 12320 |
| 931 | Ga0496114_0013130 | 3300048917 | Bacteria | 6637 |
| 932 | Ga0496114_0091828 | 3300048917 | Bacteria | 2579 |
| 933 | Ga0496114_0397014 | 3300048917 | Bacteria | 1221 |
| 934 | Ga0496115_0001413 | 3300048918 | Bacteria | 17185 |
| 935 | Ga0496115_0003796 | 3300048918 | Bacteria | 10872 |
| 936 | Ga0496115_0023816 | 3300048918 | Bacteria | 4753 |
| 937 | Ga0496115_0032902 | 3300048918 | Bacteria | 4093 |
| 938 | Ga0496115_0079051 | 3300048918 | Bacteria | 2677 |
| 939 | Ga0496115_0179139 | 3300048918 | Bacteria | 1752 |
| 940 | Ga0496115_0204142 | 3300048918 | Bacteria | 1632 |
| 941 | Ga0501031_0028596 | 3300049568 | Bacteria | 3634 |
| 942 | Ga0501032_0049277 | 3300049569 | Bacteria | 2841 |
| 943 | Ga0501033_0024328 | 3300049570 | Bacteria | 4569 |
| 944 | Ga0501034_0062100 | 3300049571 | Bacteria | 3751 |
| 945 | Ga0501034_0356044 | 3300049571 | Bacteria | 1391 |
| 946 | Ga0501037_0020559 | 3300049573 | Bacteria | 4874 |
| 947 | Ga0501037_0056054 | 3300049573 | Bacteria | 2880 |
| 948 | Ga0501039_0124918 | 3300049575 | Bacteria | 2018 |
| 949 | Ga0501040_0230506 | 3300049576 | Bacteria | 1319 |
| 950 | Ga0501042_0278548 | 3300049578 | Bacteria | 1208 |
| 951 | Ga0501043_0034799 | 3300049579 | Bacteria | 3962 |
| 952 | Ga0501043_0116965 | 3300049579 | Bacteria | 2092 |
| 953 | Ga0501047_0132154 | 3300049581 | Bacteria | 2376 |
| 954 | Ga0501067_0127125 | 3300049583 | Bacteria | 1418 |
| 955 | Ga0501070_0036441 | 3300049586 | Bacteria | 4107 |
| 956 | Ga0501070_0191640 | 3300049586 | Bacteria | 1680 |
| 957 | Ga0501072_0155913 | 3300049588 | Bacteria | 1821 |
| 958 | Ga0501072_0239576 | 3300049588 | Bacteria | 1445 |
| 959 | Ga0501072_0330196 | 3300049588 | Bacteria | 1212 |
| 960 | Ga0501076_0120804 | 3300049592 | Bacteria | 2122 |
| 961 | Ga0501077_0055262 | 3300049593 | Bacteria | 2521 |
| 962 | Ga0501080_0168623 | 3300049742 | Bacteria | 2020 |
| 963 | Ga0501081_0046735 | 3300049743 | Bacteria | 2977 |
| 964 | Ga0501035_0016634 | 3300049822 | Bacteria | 6782 |
| 965 | nmdc:mga03683_10383_c1 | 3300050489 | Bacteria | 3338 |
| 966 | nmdc:mga03n38_117176_c1 | 3300050490 | Bacteria | 1304 |
| 967 | nmdc:mga00v17_179610_c1 | 3300050491 | Bacteria | 1365 |
| 968 | nmdc:mga00v17_97392_c1 | 3300050491 | Bacteria | 1854 |
| 969 | nmdc:mga0yw44_918_c1 | 3300050492 | Bacteria | 11147 |
| 970 | nmdc:mga0k408_108548_c1 | 3300050493 | Bacteria | 1639 |
| 971 | nmdc:mga0k408_20733_c1 | 3300050493 | Bacteria | 3687 |
| 972 | nmdc:mga0k408_2957_c1 | 3300050493 | Bacteria | 9007 |
| 973 | nmdc:mga0k408_83588_c1 | 3300050493 | Bacteria | 1871 |
| 974 | nmdc:mga06z11_181717_c1 | 3300050494 | Bacteria | 1213 |
| 975 | nmdc:mga06z11_24174_c1 | 3300050494 | Bacteria | 2863 |
| 976 | nmdc:mga06z11_40913_c1 | 3300050494 | Bacteria | 2316 |
| 977 | nmdc:mga07m45_121801_c1 | 3300050496 | Bacteria | 1506 |
| 978 | nmdc:mga07m45_12419_c1 | 3300050496 | Bacteria | 4502 |
| 979 | nmdc:mga07m45_93059_c1 | 3300050496 | Unclassified | 1728 |
| 980 | nmdc:mga05p37_13288_c1 | 3300050507 | Bacteria | 9859 |
| 981 | nmdc:mga05p37_2463_c1 | 3300050507 | Bacteria | 21532 |
| 982 | nmdc:mga05p37_267242_c1 | 3300050507 | Bacteria | 2045 |
| 983 | nmdc:mga05p37_368_c1 | 3300050507 | Bacteria | 48338 |
| 984 | nmdc:mga05p37_48824_c1 | 3300050507 | Bacteria | 5204 |
| 985 | nmdc:mga09592_38885_c1 | 3300050508 | Bacteria | 3995 |
| 986 | nmdc:mga09592_5152_c1 | 3300050508 | Bacteria | 10621 |
| 987 | nmdc:mga09592_7356_c1 | 3300050508 | Bacteria | 8951 |
| 988 | nmdc:mga09592_83007_c1 | 3300050508 | Bacteria | 2731 |
| 989 | nmdc:mga0qj67_120882_c1 | 3300050509 | Bacteria | 2119 |
| 990 | nmdc:mga0qj67_26463_c1 | 3300050509 | Bacteria | 4491 |
| 991 | nmdc:mga0qj67_37243_c1 | 3300050509 | Bacteria | 3809 |
| 992 | nmdc:mga0qj67_9055_c1 | 3300050509 | Bacteria | 7389 |
| 993 | nmdc:mga06r32_14230_c1 | 3300050510 | Bacteria | 7216 |
| 994 | nmdc:mga06r32_2531_c1 | 3300050510 | Bacteria | 16356 |
| 995 | nmdc:mga06r32_75337_c1 | 3300050510 | Bacteria | 3274 |
| 996 | nmdc:mga06r32_931_c1 | 3300050510 | Bacteria | 26013 |
| 997 | nmdc:mga06r32_9987_c1 | 3300050510 | Bacteria | 8565 |
| 998 | nmdc:mga08y16_107_c1 | 3300050511 | Bacteria | 69847 |
| 999 | nmdc:mga08y16_1865_c1 | 3300050511 | Bacteria | 21428 |
| 1000 | nmdc:mga08y16_2031_c1 | 3300050511 | Bacteria | 20733 |
| 1001 | nmdc:mga08y16_246771_c1 | 3300050511 | Unclassified | 1845 |
| 1002 | nmdc:mga08y16_30420_c1 | 3300050511 | Bacteria | 5683 |
| 1003 | nmdc:mga08y16_61288_c1 | 3300050511 | Bacteria | 3928 |
| 1004 | nmdc:mga0n895_171934_c1 | 3300050512 | Bacteria | 2199 |
| 1005 | nmdc:mga0n895_359242_c1 | 3300050512 | Bacteria | 1475 |
| 1006 | nmdc:mga0n895_5417_c1 | 3300050512 | Bacteria | 10661 |
| 1007 | nmdc:mga0n895_8059_c1 | 3300050512 | Bacteria | 9092 |
| 1008 | nmdc:mga0n895_9034_c1 | 3300050512 | Bacteria | 8692 |
| 1009 | nmdc:mga0rr50_102381_c1 | 3300050513 | Bacteria | 2253 |
| 1010 | nmdc:mga0rr50_10240_c1 | 3300050513 | Bacteria | 5939 |
| 1011 | nmdc:mga0rr50_1332_c1 | 3300050513 | Bacteria | 13470 |
| 1012 | nmdc:mga0rr50_141010_c1 | 3300050513 | Bacteria | 1939 |
| 1013 | nmdc:mga0rr50_158703_c1 | 3300050513 | Bacteria | 1834 |
| 1014 | nmdc:mga0rr50_317415_c1 | 3300050513 | Bacteria | 1306 |
| 1015 | nmdc:mga08x19_385_c1 | 3300050514 | Bacteria | 31031 |
| 1016 | nmdc:mga08x19_58692_c1 | 3300050514 | Bacteria | 2490 |
| 1017 | nmdc:mga0a205_2168_c1 | 3300050515 | Bacteria | 17263 |
| 1018 | nmdc:mga0a205_30759_c1 | 3300050515 | Bacteria | 5142 |
| 1019 | nmdc:mga0a205_66835_c1 | 3300050515 | Bacteria | 3473 |
| 1020 | nmdc:mga0a205_72932_c1 | 3300050515 | Bacteria | 3317 |
| 1021 | Ga0495601_0003707 | 3300053077 | Bacteria | 8793 |
| 1022 | Ga0495601_0038284 | 3300053077 | Bacteria | 2998 |
| 1023 | Ga0495601_0041622 | 3300053077 | Bacteria | 2881 |
| 1024 | Ga0495601_0072682 | 3300053077 | Bacteria | 2197 |
| 1025 | Ga0495612_0000762 | 3300053078 | Bacteria | 13137 |
| 1026 | Ga0495612_0010430 | 3300053078 | Bacteria | 3758 |
| 1027 | Ga0495612_0013611 | 3300053078 | Bacteria | 3276 |
| 1028 | Ga0495612_0030805 | 3300053078 | Bacteria | 2161 |
| 1029 | Ga0495612_0046974 | 3300053078 | Bacteria | 1768 |
| 1030 | Ga0495655_0009026 | 3300053083 | Bacteria | 1917 |
| 1031 | Ga0495655_0014475 | 3300053083 | Bacteria | 1655 |
| 1032 | Ga0495595_0000429 | 3300053084 | Bacteria | 15919 |
| 1033 | Ga0495595_0001679 | 3300053084 | Bacteria | 8666 |
| 1034 | Ga0495595_0002216 | 3300053084 | Bacteria | 7554 |
| 1035 | Ga0495595_0005618 | 3300053084 | Bacteria | 5076 |
| 1036 | Ga0495595_0061915 | 3300053084 | Bacteria | 1753 |
| 1037 | Ga0495619_0000043 | 3300053085 | Bacteria | 109865 |
| 1038 | Ga0495619_0000551 | 3300053085 | Bacteria | 24828 |
| 1039 | Ga0495619_0068872 | 3300053085 | Bacteria | 2365 |
| 1040 | Ga0495619_0071319 | 3300053085 | Bacteria | 2324 |
| 1041 | Ga0495619_0138389 | 3300053085 | Bacteria | 1675 |
| 1042 | Ga0500650_0003295 | 3300053098 | Bacteria | 5578 |
| 1043 | Ga0500658_0003937 | 3300053134 | Bacteria | 5578 |
| 1044 | Ga0501084_0177498 | 3300054114 | Bacteria | 1798 |
| 1045 | Ga0501082_0227397 | 3300060353 | Bacteria | 1624 |
| 1046 | Ga0466962_0121814 | 3300061719 | Bacteria | 1259 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300007265 | Ga0099794_10074346 | Ga0099794_100743462 | 288 |
| 2 | 3300035695 | Ga0373927_0149038 | Ga0373927_0149038_216_1184 | 289 |
| 3 | 3300006194 | Ga0075427_10000004 | Ga0075427_100000045 | 300 |
| 4 | 3300006844 | Ga0075428_100008326 | Ga0075428_10000832611 | 300 |
| 5 | 3300006846 | Ga0075430_100001186 | Ga0075430_10000118612 | 300 |
| 6 | 3300006847 | Ga0075431_100001446 | Ga0075431_10000144611 | 300 |
| 7 | 3300006871 | Ga0075434_100003016 | Ga0075434_10000301612 | 300 |
| 8 | 3300006880 | Ga0075429_100002098 | Ga0075429_10000209817 | 300 |
| 9 | 3300009094 | Ga0111539_10002796 | Ga0111539_1000279620 | 300 |
| 10 | 3300050507 | nmdc:mga05p37_2463_c1 | nmdc:mga05p37_2463_c1_10220_11194 | 300 |
| 11 | 3300050509 | nmdc:mga0qj67_9055_c1 | nmdc:mga0qj67_9055_c1_1088_2062 | 300 |
| 12 | 3300050510 | nmdc:mga06r32_2531_c1 | nmdc:mga06r32_2531_c1_11368_12342 | 300 |
| 13 | 3300050512 | nmdc:mga0n895_9034_c1 | nmdc:mga0n895_9034_c1_3180_4154 | 300 |
| 14 | 3300050515 | nmdc:mga0a205_2168_c1 | nmdc:mga0a205_2168_c1_15074_16048 | 300 |
| 15 | 3300009553 | Ga0105249_10062903 | Ga0105249_100629034 | 303 |
| 16 | 3300013297 | Ga0157378_10025519 | Ga0157378_100255194 | 303 |
| 17 | 3300013306 | Ga0163162_10039558 | Ga0163162_100395582 | 303 |
| 18 | 3300014968 | Ga0157379_10023314 | Ga0157379_100233144 | 303 |
| 19 | 3300049571 | Ga0501034_0356044 | Ga0501034_0356044_336_1313 | 303 |
| 20 | 3300035119 | Ga0373956_0026502 | Ga0373956_0026502_842_1762 | 304 |
| 21 | 3300046683 | Ga0495658_0147524 | Ga0495658_0147524_135_1103 | 304 |
| 22 | 3300028794 | Ga0307515_10006871 | Ga0307515_1000687119 | 305 |
| 23 | 3300031456 | Ga0307513_10241854 | Ga0307513_102418542 | 305 |
| 24 | 3300046615 | Ga0495656_0000398 | Ga0495656_0000398_2702_3634 | 305 |
| 25 | 3300048090 | Ga0495615_0004243 | Ga0495615_0004243_281_1213 | 305 |
| 26 | 3300046516 | Ga0495628_0434381 | Ga0495628_0434381_18_938 | 306 |
| 27 | 3300048906 | Ga0496103_0070530 | Ga0496103_0070530_11_931 | 306 |
| 28 | 3300049743 | Ga0501081_0046735 | Ga0501081_0046735_1676_2605 | 306 |
| 29 | 3300006844 | Ga0075428_100114044 | Ga0075428_1001140442 | 307 |
| 30 | 3300009147 | Ga0114129_10595896 | Ga0114129_105958961 | 307 |
| 31 | 3300035692 | Ga0373935_0088090 | Ga0373935_0088090_956_1924 | 307 |
| 32 | 3300037068 | Ga0373925_0280354 | Ga0373925_0280354_308_1276 | 307 |
| 33 | 3300047319 | Ga0495674_0129671 | Ga0495674_0129671_895_1863 | 307 |
| 34 | 3300050507 | nmdc:mga05p37_267242_c1 | nmdc:mga05p37_267242_c1_688_1617 | 307 |
| 35 | 3300050509 | nmdc:mga0qj67_26463_c1 | nmdc:mga0qj67_26463_c1_3505_4434 | 307 |
| 36 | 3300050510 | nmdc:mga06r32_9987_c1 | nmdc:mga06r32_9987_c1_6032_6961 | 307 |
| 37 | 3300050493 | nmdc:mga0k408_83588_c1 | nmdc:mga0k408_83588_c1_193_1182 | 308 |
| 38 | 3300053098 | Ga0500650_0003295 | Ga0500650_0003295_2802_3767 | 309 |
| 39 | 3300006880 | Ga0075429_100002095 | Ga0075429_10000209516 | 310 |
| 40 | 3300009148 | Ga0105243_10017699 | Ga0105243_100176992 | 310 |
| 41 | 3300047445 | Ga0495677_0030178 | Ga0495677_0030178_1026_1958 | 310 |
| 42 | 3300050493 | nmdc:mga0k408_108548_c1 | nmdc:mga0k408_108548_c1_659_1600 | 310 |
| 43 | 3300050508 | nmdc:mga09592_7356_c1 | nmdc:mga09592_7356_c1_5437_6435 | 310 |
| 44 | 3300013104 | Ga0157370_10342441 | Ga0157370_103424412 | 311 |
| 45 | 3300041451 | Ga0451791_1369153 | Ga0451791_1369153_147_1103 | 311 |
| 46 | 3300046663 | Ga0495635_0067515 | Ga0495635_0067515_543_1499 | 311 |
| 47 | 3300049588 | Ga0501072_0155913 | Ga0501072_0155913_306_1280 | 311 |
| 48 | 3300050489 | nmdc:mga03683_10383_c1 | nmdc:mga03683_10383_c1_753_1706 | 311 |
| 49 | 3300050496 | nmdc:mga07m45_121801_c1 | nmdc:mga07m45_121801_c1_163_1119 | 311 |
| 50 | 3300053134 | Ga0500658_0003937 | Ga0500658_0003937_4389_5342 | 311 |
| 51 | 3300028786 | Ga0307517_10102413 | Ga0307517_101024132 | 312 |
| 52 | 3300005436 | Ga0070713_100276308 | Ga0070713_1002763082 | 313 |
| 53 | 3300005578 | Ga0068854_100249853 | Ga0068854_1002498532 | 313 |
| 54 | 3300009545 | Ga0105237_10034574 | Ga0105237_100345744 | 313 |
| 55 | 3300025901 | Ga0207688_10004456 | Ga0207688_100044565 | 313 |
| 56 | 3300046536 | Ga0495587_0079163 | Ga0495587_0079163_799_1785 | 313 |
| 57 | 3300050493 | nmdc:mga0k408_2957_c1 | nmdc:mga0k408_2957_c1_2985_4091 | 313 |
| 58 | 3300050494 | nmdc:mga06z11_181717_c1 | nmdc:mga06z11_181717_c1_58_1164 | 313 |
| 59 | 3300053083 | Ga0495655_0009026 | Ga0495655_0009026_144_1130 | 313 |
| 60 | 3300053085 | Ga0495619_0068872 | Ga0495619_0068872_321_1307 | 313 |
| 61 | 3300003771 | Ga0055526_1000027 | Ga0055526_100002712 | 314 |
| 62 | 3300005434 | Ga0070709_10081081 | Ga0070709_100810812 | 314 |
| 63 | 3300006871 | Ga0075434_100128389 | Ga0075434_1001283893 | 314 |
| 64 | 3300007076 | Ga0075435_100112730 | Ga0075435_1001127301 | 314 |
| 65 | 3300015683 | Ga0183362_10003 | Ga0183362_10003256 | 314 |
| 66 | 3300025295 | Ga0209564_1000180 | Ga0209564_1000180131 | 314 |
| 67 | 3300025906 | Ga0207699_10176231 | Ga0207699_101762312 | 314 |
| 68 | 3300048907 | Ga0496104_0095263 | Ga0496104_0095263_1727_2704 | 314 |
| 69 | 3300048911 | Ga0496108_0050893 | Ga0496108_0050893_1817_2794 | 314 |
| 70 | 3300048912 | Ga0496109_0031840 | Ga0496109_0031840_923_1900 | 314 |
| 71 | 3300048913 | Ga0496110_0032183 | Ga0496110_0032183_1717_2694 | 314 |
| 72 | 3300048914 | Ga0496111_0007504 | Ga0496111_0007504_4459_5436 | 314 |
| 73 | 3300050512 | nmdc:mga0n895_359242_c1 | nmdc:mga0n895_359242_c1_144_1109 | 314 |
| 74 | 3300050513 | nmdc:mga0rr50_141010_c1 | nmdc:mga0rr50_141010_c1_826_1791 | 314 |
| 75 | iso_pu_bacteria | 2929199973 | 2929203833 | 314 |
| 76 | iso_pu_bacteria | 8055909800 | 8055912852 | 314 |
| 77 | 3300005459 | Ga0068867_100000587 | Ga0068867_10000058722 | 315 |
| 78 | 3300005842 | Ga0068858_100184407 | Ga0068858_1001844071 | 315 |
| 79 | 3300005843 | Ga0068860_100001400 | Ga0068860_10000140012 | 315 |
| 80 | 3300005937 | Ga0081455_10120639 | Ga0081455_101206392 | 315 |
| 81 | 3300014968 | Ga0157379_10043364 | Ga0157379_100433643 | 315 |
| 82 | 3300025961 | Ga0207712_10028278 | Ga0207712_100282782 | 315 |
| 83 | 3300025972 | Ga0207668_10379019 | Ga0207668_103790192 | 315 |
| 84 | 3300026035 | Ga0207703_10160125 | Ga0207703_101601253 | 315 |
| 85 | 3300026089 | Ga0207648_10001396 | Ga0207648_100013966 | 315 |
| 86 | 3300028380 | Ga0268265_10004180 | Ga0268265_1000418010 | 315 |
| 87 | 3300028380 | Ga0268265_10086908 | Ga0268265_100869082 | 315 |
| 88 | 3300028381 | Ga0268264_10002438 | Ga0268264_1000243815 | 315 |
| 89 | 3300035118 | Ga0373954_0016689 | Ga0373954_0016689_946_1914 | 315 |
| 90 | 3300035170 | Ga0373943_0179214 | Ga0373943_0179214_94_1056 | 315 |
| 91 | 3300035695 | Ga0373927_0142822 | Ga0373927_0142822_384_1346 | 315 |
| 92 | 3300046542 | Ga0495597_0022818 | Ga0495597_0022818_1690_2658 | 315 |
| 93 | 3300046683 | Ga0495658_0080063 | Ga0495658_0080063_871_1833 | 315 |
| 94 | 3300047443 | Ga0495687_002565 | Ga0495687_002565_10868_11836 | 315 |
| 95 | 3300049583 | Ga0501067_0127125 | Ga0501067_0127125_118_1080 | 315 |
| 96 | 3300050493 | nmdc:mga0k408_20733_c1 | nmdc:mga0k408_20733_c1_1677_2639 | 315 |
| 97 | 3300050514 | nmdc:mga08x19_385_c1 | nmdc:mga08x19_385_c1_26151_27134 | 315 |
| 98 | iso_pu_bacteria | 2894772417 | 2894772972 | 315 |
| 99 | 3300005334 | Ga0068869_100185037 | Ga0068869_1001850372 | 316 |
| 100 | 3300005354 | Ga0070675_100009313 | Ga0070675_1000093132 | 316 |
| 101 | 3300005364 | Ga0070673_100011912 | Ga0070673_1000119122 | 316 |
| 102 | 3300005578 | Ga0068854_100053390 | Ga0068854_1000533901 | 316 |
| 103 | 3300005616 | Ga0068852_100047119 | Ga0068852_1000471192 | 316 |
| 104 | 3300006178 | Ga0075367_10050287 | Ga0075367_100502872 | 316 |
| 105 | 3300006353 | Ga0075370_10058571 | Ga0075370_100585712 | 316 |
| 106 | 3300006871 | Ga0075434_100300829 | Ga0075434_1003008292 | 316 |
| 107 | 3300009098 | Ga0105245_10373271 | Ga0105245_103732712 | 316 |
| 108 | 3300009148 | Ga0105243_10039541 | Ga0105243_100395411 | 316 |
| 109 | 3300009545 | Ga0105237_10018759 | Ga0105237_100187594 | 316 |
| 110 | 3300010375 | Ga0105239_10004906 | Ga0105239_100049064 | 316 |
| 111 | 3300025926 | Ga0207659_10061612 | Ga0207659_100616123 | 316 |
| 112 | 3300025927 | Ga0207687_10262886 | Ga0207687_102628862 | 316 |
| 113 | 3300025933 | Ga0207706_10027904 | Ga0207706_100279045 | 316 |
| 114 | 3300025940 | Ga0207691_10336941 | Ga0207691_103369411 | 316 |
| 115 | 3300025942 | Ga0207689_10156942 | Ga0207689_101569422 | 316 |
| 116 | 3300025960 | Ga0207651_10031071 | Ga0207651_100310713 | 316 |
| 117 | 3300025960 | Ga0207651_10168286 | Ga0207651_101682862 | 316 |
| 118 | 3300026089 | Ga0207648_10255151 | Ga0207648_102551512 | 316 |
| 119 | 3300026116 | Ga0207674_10005570 | Ga0207674_1000557011 | 316 |
| 120 | 3300036401 | Ga0373937_0097894 | Ga0373937_0097894_285_1256 | 316 |
| 121 | 3300037068 | Ga0373925_0036705 | Ga0373925_0036705_1325_2293 | 316 |
| 122 | 3300046683 | Ga0495658_0010561 | Ga0495658_0010561_1812_2780 | 316 |
| 123 | 3300050491 | nmdc:mga00v17_97392_c1 | nmdc:mga00v17_97392_c1_556_1527 | 316 |
| 124 | 3300050496 | nmdc:mga07m45_12419_c1 | nmdc:mga07m45_12419_c1_1637_2608 | 316 |
| 125 | 3300003203 | JGI25406J46586_10004753 | JGI25406J46586_100047534 | 317 |
| 126 | 3300005331 | Ga0070670_100069446 | Ga0070670_1000694462 | 317 |
| 127 | 3300005347 | Ga0070668_100007916 | Ga0070668_1000079161 | 317 |
| 128 | 3300005353 | Ga0070669_100008715 | Ga0070669_1000087158 | 317 |
| 129 | 3300005364 | Ga0070673_100011342 | Ga0070673_1000113422 | 317 |
| 130 | 3300005367 | Ga0070667_100088218 | Ga0070667_1000882182 | 317 |
| 131 | 3300005456 | Ga0070678_100222051 | Ga0070678_1002220511 | 317 |
| 132 | 3300005457 | Ga0070662_100050332 | Ga0070662_1000503322 | 317 |
| 133 | 3300005543 | Ga0070672_100056051 | Ga0070672_1000560512 | 317 |
| 134 | 3300005618 | Ga0068864_100002660 | Ga0068864_1000026604 | 317 |
| 135 | 3300005841 | Ga0068863_100023141 | Ga0068863_1000231414 | 317 |
| 136 | 3300005841 | Ga0068863_100322454 | Ga0068863_1003224542 | 317 |
| 137 | 3300005985 | Ga0081539_10000169 | Ga0081539_10000169145 | 317 |
| 138 | 3300006844 | Ga0075428_100378678 | Ga0075428_1003786782 | 317 |
| 139 | 3300006852 | Ga0075433_10033704 | Ga0075433_100337043 | 317 |
| 140 | 3300006871 | Ga0075434_100142282 | Ga0075434_1001422824 | 317 |
| 141 | 3300009147 | Ga0114129_10116731 | Ga0114129_101167314 | 317 |
| 142 | 3300013296 | Ga0157374_10171180 | Ga0157374_101711802 | 317 |
| 143 | 3300014325 | Ga0163163_10096542 | Ga0163163_100965423 | 317 |
| 144 | 3300014326 | Ga0157380_10048023 | Ga0157380_100480233 | 317 |
| 145 | 3300017792 | Ga0163161_10247200 | Ga0163161_102472002 | 317 |
| 146 | 3300025925 | Ga0207650_10032976 | Ga0207650_100329763 | 317 |
| 147 | 3300025925 | Ga0207650_10087637 | Ga0207650_100876372 | 317 |
| 148 | 3300025926 | Ga0207659_10155828 | Ga0207659_101558281 | 317 |
| 149 | 3300025933 | Ga0207706_10017802 | Ga0207706_100178023 | 317 |
| 150 | 3300025940 | Ga0207691_10002245 | Ga0207691_1000224510 | 317 |
| 151 | 3300025960 | Ga0207651_10179722 | Ga0207651_101797222 | 317 |
| 152 | 3300025972 | Ga0207668_10012166 | Ga0207668_100121664 | 317 |
| 153 | 3300025986 | Ga0207658_10066673 | Ga0207658_100666732 | 317 |
| 154 | 3300026088 | Ga0207641_10392280 | Ga0207641_103922801 | 317 |
| 155 | 3300026095 | Ga0207676_10003967 | Ga0207676_100039673 | 317 |
| 156 | 3300048915 | Ga0496112_0255877 | Ga0496112_0255877_420_1439 | 317 |
| 157 | 3300049576 | Ga0501040_0230506 | Ga0501040_0230506_114_1118 | 317 |
| 158 | 3300049588 | Ga0501072_0239576 | Ga0501072_0239576_221_1225 | 317 |
| 159 | 3300050508 | nmdc:mga09592_83007_c1 | nmdc:mga09592_83007_c1_687_1658 | 317 |
| 160 | 3300050510 | nmdc:mga06r32_75337_c1 | nmdc:mga06r32_75337_c1_1693_2664 | 317 |
| 161 | 3300054114 | Ga0501084_0177498 | Ga0501084_0177498_405_1409 | 317 |
| 162 | 3300060353 | Ga0501082_0227397 | Ga0501082_0227397_221_1225 | 317 |
| 163 | 3300005937 | Ga0081455_10002005 | Ga0081455_100020054 | 318 |
| 164 | 3300005981 | Ga0081538_10027111 | Ga0081538_100271113 | 318 |
| 165 | 3300007788 | Ga0099795_10000065 | Ga0099795_100000653 | 318 |
| 166 | 3300010159 | Ga0099796_10011509 | Ga0099796_100115092 | 318 |
| 167 | 3300013105 | Ga0157369_10279705 | Ga0157369_102797053 | 318 |
| 168 | 3300025940 | Ga0207691_10095237 | Ga0207691_100952372 | 318 |
| 169 | 3300027512 | Ga0209179_1000797 | Ga0209179_10007972 | 318 |
| 170 | 3300030522 | Ga0307512_10023853 | Ga0307512_100238533 | 318 |
| 171 | 3300031247 | Ga0265340_10008082 | Ga0265340_100080825 | 318 |
| 172 | 3300031507 | Ga0307509_10000225 | Ga0307509_1000022586 | 318 |
| 173 | 3300031649 | Ga0307514_10030744 | Ga0307514_100307444 | 318 |
| 174 | 3300031712 | Ga0265342_10096067 | Ga0265342_100960672 | 318 |
| 175 | 3300031852 | Ga0307410_10327580 | Ga0307410_103275802 | 318 |
| 176 | 3300031995 | Ga0307409_100009307 | Ga0307409_1000093074 | 318 |
| 177 | 3300032002 | Ga0307416_100043851 | Ga0307416_1000438514 | 318 |
| 178 | 3300042461 | Ga0439460_0045514 | Ga0439460_0045514_194_1159 | 318 |
| 179 | 3300048907 | Ga0496104_0000629 | Ga0496104_0000629_27420_28397 | 318 |
| 180 | 3300048911 | Ga0496108_0370744 | Ga0496108_0370744_89_1057 | 318 |
| 181 | 3300048918 | Ga0496115_0204142 | Ga0496115_0204142_246_1223 | 318 |
| 182 | 3300049578 | Ga0501042_0278548 | Ga0501042_0278548_99_1088 | 318 |
| 183 | 3300050511 | nmdc:mga08y16_30420_c1 | nmdc:mga08y16_30420_c1_3748_4713 | 318 |
| 184 | 3300003203 | JGI25406J46586_10037191 | JGI25406J46586_100371911 | 319 |
| 185 | 3300005937 | Ga0081455_10033784 | Ga0081455_100337845 | 319 |
| 186 | 3300005985 | Ga0081539_10002225 | Ga0081539_1000222527 | 319 |
| 187 | 3300006844 | Ga0075428_100001565 | Ga0075428_10000156519 | 319 |
| 188 | 3300006844 | Ga0075428_100276708 | Ga0075428_1002767082 | 319 |
| 189 | 3300006844 | Ga0075428_100293266 | Ga0075428_1002932662 | 319 |
| 190 | 3300006846 | Ga0075430_100042149 | Ga0075430_1000421494 | 319 |
| 191 | 3300006846 | Ga0075430_100112812 | Ga0075430_1001128122 | 319 |
| 192 | 3300006846 | Ga0075430_100270664 | Ga0075430_1002706642 | 319 |
| 193 | 3300006847 | Ga0075431_100000584 | Ga0075431_1000005849 | 319 |
| 194 | 3300006847 | Ga0075431_100258581 | Ga0075431_1002585812 | 319 |
| 195 | 3300006847 | Ga0075431_100457943 | Ga0075431_1004579432 | 319 |
| 196 | 3300006880 | Ga0075429_100003512 | Ga0075429_1000035124 | 319 |
| 197 | 3300006880 | Ga0075429_100256367 | Ga0075429_1002563671 | 319 |
| 198 | 3300009094 | Ga0111539_10000705 | Ga0111539_1000070514 | 319 |
| 199 | 3300009147 | Ga0114129_10000057 | Ga0114129_1000005753 | 319 |
| 200 | 3300009551 | Ga0105238_10039159 | Ga0105238_100391593 | 319 |
| 201 | 3300013307 | Ga0157372_10530880 | Ga0157372_105308801 | 319 |
| 202 | 3300025944 | Ga0207661_10245083 | Ga0207661_102450832 | 319 |
| 203 | 3300027907 | Ga0207428_10009210 | Ga0207428_100092104 | 319 |
| 204 | 3300028379 | Ga0268266_10143756 | Ga0268266_101437562 | 319 |
| 205 | 3300031247 | Ga0265340_10023536 | Ga0265340_100235363 | 319 |
| 206 | 3300031456 | Ga0307513_10200042 | Ga0307513_102000422 | 319 |
| 207 | 3300035724 | Ga0373933_0012239 | Ga0373933_0012239_625_1590 | 319 |
| 208 | 3300037853 | Ga0436364_0928179 | Ga0436364_0928179_741_1709 | 319 |
| 209 | 3300039437 | Ga0436365_0314634 | Ga0436365_0314634_3920_4888 | 319 |
| 210 | 3300039437 | Ga0436365_1628126 | Ga0436365_1628126_3022_3990 | 319 |
| 211 | 3300044694 | Ga0466963_0001958 | Ga0466963_0001958_2255_3214 | 319 |
| 212 | 3300045976 | Ga0466967_0004256 | Ga0466967_0004256_385_1344 | 319 |
| 213 | 3300046663 | Ga0495635_0197624 | Ga0495635_0197624_258_1223 | 319 |
| 214 | 3300048907 | Ga0496104_0245738 | Ga0496104_0245738_246_1214 | 319 |
| 215 | 3300048908 | Ga0496105_0199409 | Ga0496105_0199409_505_1473 | 319 |
| 216 | 3300050507 | nmdc:mga05p37_368_c1 | nmdc:mga05p37_368_c1_12925_13899 | 319 |
| 217 | 3300050508 | nmdc:mga09592_5152_c1 | nmdc:mga09592_5152_c1_2584_3558 | 319 |
| 218 | 3300050509 | nmdc:mga0qj67_37243_c1 | nmdc:mga0qj67_37243_c1_581_1555 | 319 |
| 219 | 3300050510 | nmdc:mga06r32_931_c1 | nmdc:mga06r32_931_c1_23121_24095 | 319 |
| 220 | 3300050511 | nmdc:mga08y16_107_c1 | nmdc:mga08y16_107_c1_44268_45242 | 319 |
| 221 | 3300053077 | Ga0495601_0072682 | Ga0495601_0072682_82_1047 | 319 |
| 222 | 3300053078 | Ga0495612_0010430 | Ga0495612_0010430_1243_2208 | 319 |
| 223 | 3300053084 | Ga0495595_0061915 | Ga0495595_0061915_678_1643 | 319 |
| 224 | 3300053085 | Ga0495619_0138389 | Ga0495619_0138389_639_1607 | 319 |
| 225 | 2162886007 | SwRhRL2b_contig_2195022 | SwRhRL2b_0032.00001900 | 320 |
| 226 | 2209111006 | 2214745199 | 2213754594 | 320 |
| 227 | 3300000041 | ARcpr5oldR_c000024 | ARcpr5oldR_0000249 | 320 |
| 228 | 3300000042 | ARSoilYngRDRAFT_c00084 | ARSoilYngRDRAFT_000849 | 320 |
| 229 | 3300000043 | ARcpr5yngRDRAFT_c000226 | ARcpr5yngRDRAFT_0002263 | 320 |
| 230 | 3300000044 | ARSoilOldRDRAFT_c000027 | ARSoilOldRDRAFT_0000279 | 320 |
| 231 | 3300000045 | ARCol0oldRDRAFT_c00301 | ARCol0oldRDRAFT_003015 | 320 |
| 232 | 3300000652 | ARCol0yngRDRAFT_1000016 | ARCol0yngRDRAFT_10000169 | 320 |
| 233 | 3300001430 | JGI24032J14994_100052 | JGI24032J14994_1000522 | 320 |
| 234 | 3300001904 | JGI24736J21556_1013491 | JGI24736J21556_10134912 | 320 |
| 235 | 3300001978 | JGI24747J21853_1000417 | JGI24747J21853_10004172 | 320 |
| 236 | 3300001979 | JGI24740J21852_10017965 | JGI24740J21852_100179654 | 320 |
| 237 | 3300001989 | JGI24739J22299_10000472 | JGI24739J22299_100004729 | 320 |
| 238 | 3300001990 | JGI24737J22298_10000645 | JGI24737J22298_1000064510 | 320 |
| 239 | 3300001990 | JGI24737J22298_10012061 | JGI24737J22298_100120612 | 320 |
| 240 | 3300001991 | JGI24743J22301_10005214 | JGI24743J22301_100052143 | 320 |
| 241 | 3300001991 | JGI24743J22301_10022695 | JGI24743J22301_100226951 | 320 |
| 242 | 3300002070 | JGI24750J21931_1000292 | JGI24750J21931_10002923 | 320 |
| 243 | 3300002070 | JGI24750J21931_1002828 | JGI24750J21931_10028281 | 320 |
| 244 | 3300002073 | JGI24745J21846_1000564 | JGI24745J21846_10005644 | 320 |
| 245 | 3300002074 | JGI24748J21848_1000222 | JGI24748J21848_10002226 | 320 |
| 246 | 3300002076 | JGI24749J21850_1000285 | JGI24749J21850_10002858 | 320 |
| 247 | 3300002076 | JGI24749J21850_1001196 | JGI24749J21850_10011963 | 320 |
| 248 | 3300002077 | JGI24744J21845_10007239 | JGI24744J21845_100072392 | 320 |
| 249 | 3300002244 | JGI24742J22300_10000119 | JGI24742J22300_100001198 | 320 |
| 250 | 3300002459 | JGI24751J29686_10003797 | JGI24751J29686_100037973 | 320 |
| 251 | 3300003911 | JGI25405J52794_10005552 | JGI25405J52794_100055522 | 320 |
| 252 | 3300005277 | Ga0065716_1002390 | Ga0065716_10023902 | 320 |
| 253 | 3300005289 | Ga0065704_10009680 | Ga0065704_100096802 | 320 |
| 254 | 3300005290 | Ga0065712_10001193 | Ga0065712_100011932 | 320 |
| 255 | 3300005290 | Ga0065712_10092882 | Ga0065712_100928821 | 320 |
| 256 | 3300005293 | Ga0065715_10000313 | Ga0065715_100003137 | 320 |
| 257 | 3300005293 | Ga0065715_10005544 | Ga0065715_100055442 | 320 |
| 258 | 3300005293 | Ga0065715_10125061 | Ga0065715_101250611 | 320 |
| 259 | 3300005328 | Ga0070676_10001294 | Ga0070676_100012945 | 320 |
| 260 | 3300005328 | Ga0070676_10070817 | Ga0070676_100708172 | 320 |
| 261 | 3300005328 | Ga0070676_10113661 | Ga0070676_101136612 | 320 |
| 262 | 3300005329 | Ga0070683_100000384 | Ga0070683_10000038419 | 320 |
| 263 | 3300005330 | Ga0070690_100017855 | Ga0070690_1000178553 | 320 |
| 264 | 3300005330 | Ga0070690_100031974 | Ga0070690_1000319742 | 320 |
| 265 | 3300005331 | Ga0070670_100006373 | Ga0070670_1000063738 | 320 |
| 266 | 3300005331 | Ga0070670_100046837 | Ga0070670_1000468373 | 320 |
| 267 | 3300005331 | Ga0070670_100104882 | Ga0070670_1001048822 | 320 |
| 268 | 3300005333 | Ga0070677_10000366 | Ga0070677_100003666 | 320 |
| 269 | 3300005334 | Ga0068869_100000588 | Ga0068869_10000058811 | 320 |
| 270 | 3300005334 | Ga0068869_100099356 | Ga0068869_1000993563 | 320 |
| 271 | 3300005335 | Ga0070666_10046494 | Ga0070666_100464942 | 320 |
| 272 | 3300005335 | Ga0070666_10181614 | Ga0070666_101816141 | 320 |
| 273 | 3300005336 | Ga0070680_100003315 | Ga0070680_1000033154 | 320 |
| 274 | 3300005336 | Ga0070680_100017912 | Ga0070680_1000179125 | 320 |
| 275 | 3300005336 | Ga0070680_100212059 | Ga0070680_1002120592 | 320 |
| 276 | 3300005336 | Ga0070680_100213375 | Ga0070680_1002133752 | 320 |
| 277 | 3300005336 | Ga0070680_100313385 | Ga0070680_1003133852 | 320 |
| 278 | 3300005337 | Ga0070682_100001303 | Ga0070682_10000130312 | 320 |
| 279 | 3300005337 | Ga0070682_100011027 | Ga0070682_1000110275 | 320 |
| 280 | 3300005337 | Ga0070682_100157117 | Ga0070682_1001571171 | 320 |
| 281 | 3300005338 | Ga0068868_100007694 | Ga0068868_1000076947 | 320 |
| 282 | 3300005338 | Ga0068868_100010823 | Ga0068868_1000108236 | 320 |
| 283 | 3300005338 | Ga0068868_100031315 | Ga0068868_1000313153 | 320 |
| 284 | 3300005338 | Ga0068868_100051465 | Ga0068868_1000514653 | 320 |
| 285 | 3300005339 | Ga0070660_100006474 | Ga0070660_1000064746 | 320 |
| 286 | 3300005339 | Ga0070660_100113131 | Ga0070660_1001131312 | 320 |
| 287 | 3300005339 | Ga0070660_100170733 | Ga0070660_1001707332 | 320 |
| 288 | 3300005340 | Ga0070689_100001250 | Ga0070689_10000125016 | 320 |
| 289 | 3300005340 | Ga0070689_100022333 | Ga0070689_1000223332 | 320 |
| 290 | 3300005340 | Ga0070689_100056025 | Ga0070689_1000560252 | 320 |
| 291 | 3300005340 | Ga0070689_100108293 | Ga0070689_1001082933 | 320 |
| 292 | 3300005341 | Ga0070691_10000616 | Ga0070691_100006165 | 320 |
| 293 | 3300005341 | Ga0070691_10028317 | Ga0070691_100283172 | 320 |
| 294 | 3300005341 | Ga0070691_10080735 | Ga0070691_100807352 | 320 |
| 295 | 3300005343 | Ga0070687_100002805 | Ga0070687_1000028055 | 320 |
| 296 | 3300005343 | Ga0070687_100022541 | Ga0070687_1000225412 | 320 |
| 297 | 3300005343 | Ga0070687_100161850 | Ga0070687_1001618501 | 320 |
| 298 | 3300005344 | Ga0070661_100001627 | Ga0070661_1000016276 | 320 |
| 299 | 3300005344 | Ga0070661_100034366 | Ga0070661_1000343663 | 320 |
| 300 | 3300005344 | Ga0070661_100082007 | Ga0070661_1000820071 | 320 |
| 301 | 3300005345 | Ga0070692_10000719 | Ga0070692_100007197 | 320 |
| 302 | 3300005345 | Ga0070692_10078659 | Ga0070692_100786593 | 320 |
| 303 | 3300005347 | Ga0070668_100001772 | Ga0070668_10000177215 | 320 |
| 304 | 3300005347 | Ga0070668_100126854 | Ga0070668_1001268543 | 320 |
| 305 | 3300005353 | Ga0070669_100002584 | Ga0070669_10000258412 | 320 |
| 306 | 3300005354 | Ga0070675_100013013 | Ga0070675_1000130134 | 320 |
| 307 | 3300005354 | Ga0070675_100089854 | Ga0070675_1000898544 | 320 |
| 308 | 3300005354 | Ga0070675_100193666 | Ga0070675_1001936662 | 320 |
| 309 | 3300005355 | Ga0070671_100003610 | Ga0070671_1000036108 | 320 |
| 310 | 3300005356 | Ga0070674_100000598 | Ga0070674_1000005987 | 320 |
| 311 | 3300005356 | Ga0070674_100107301 | Ga0070674_1001073013 | 320 |
| 312 | 3300005364 | Ga0070673_100000255 | Ga0070673_10000025524 | 320 |
| 313 | 3300005364 | Ga0070673_100026950 | Ga0070673_1000269504 | 320 |
| 314 | 3300005365 | Ga0070688_100005214 | Ga0070688_1000052144 | 320 |
| 315 | 3300005365 | Ga0070688_100057375 | Ga0070688_1000573753 | 320 |
| 316 | 3300005366 | Ga0070659_100005703 | Ga0070659_1000057035 | 320 |
| 317 | 3300005367 | Ga0070667_100003947 | Ga0070667_1000039473 | 320 |
| 318 | 3300005367 | Ga0070667_100052781 | Ga0070667_1000527812 | 320 |
| 319 | 3300005367 | Ga0070667_100300005 | Ga0070667_1003000052 | 320 |
| 320 | 3300005434 | Ga0070709_10014657 | Ga0070709_100146573 | 320 |
| 321 | 3300005434 | Ga0070709_10015858 | Ga0070709_100158587 | 320 |
| 322 | 3300005435 | Ga0070714_100014498 | Ga0070714_1000144986 | 320 |
| 323 | 3300005435 | Ga0070714_100029784 | Ga0070714_1000297846 | 320 |
| 324 | 3300005435 | Ga0070714_100067295 | Ga0070714_1000672954 | 320 |
| 325 | 3300005436 | Ga0070713_100002318 | Ga0070713_1000023185 | 320 |
| 326 | 3300005436 | Ga0070713_100003244 | Ga0070713_10000324411 | 320 |
| 327 | 3300005436 | Ga0070713_100067968 | Ga0070713_1000679682 | 320 |
| 328 | 3300005439 | Ga0070711_100004584 | Ga0070711_1000045848 | 320 |
| 329 | 3300005439 | Ga0070711_100007766 | Ga0070711_1000077668 | 320 |
| 330 | 3300005439 | Ga0070711_100043251 | Ga0070711_1000432516 | 320 |
| 331 | 3300005439 | Ga0070711_100068223 | Ga0070711_1000682232 | 320 |
| 332 | 3300005439 | Ga0070711_100169787 | Ga0070711_1001697873 | 320 |
| 333 | 3300005440 | Ga0070705_100000971 | Ga0070705_10000097116 | 320 |
| 334 | 3300005440 | Ga0070705_100183681 | Ga0070705_1001836812 | 320 |
| 335 | 3300005441 | Ga0070700_100000495 | Ga0070700_10000049512 | 320 |
| 336 | 3300005444 | Ga0070694_100004679 | Ga0070694_1000046796 | 320 |
| 337 | 3300005445 | Ga0070708_100077192 | Ga0070708_1000771923 | 320 |
| 338 | 3300005455 | Ga0070663_100001070 | Ga0070663_10000107013 | 320 |
| 339 | 3300005455 | Ga0070663_100088958 | Ga0070663_1000889583 | 320 |
| 340 | 3300005456 | Ga0070678_100000552 | Ga0070678_1000005524 | 320 |
| 341 | 3300005456 | Ga0070678_100013095 | Ga0070678_1000130953 | 320 |
| 342 | 3300005456 | Ga0070678_100028784 | Ga0070678_1000287842 | 320 |
| 343 | 3300005456 | Ga0070678_100047267 | Ga0070678_1000472672 | 320 |
| 344 | 3300005456 | Ga0070678_100114528 | Ga0070678_1001145282 | 320 |
| 345 | 3300005456 | Ga0070678_100178175 | Ga0070678_1001781752 | 320 |
| 346 | 3300005457 | Ga0070662_100003388 | Ga0070662_1000033885 | 320 |
| 347 | 3300005457 | Ga0070662_100091451 | Ga0070662_1000914511 | 320 |
| 348 | 3300005458 | Ga0070681_10004188 | Ga0070681_1000418812 | 320 |
| 349 | 3300005458 | Ga0070681_10105385 | Ga0070681_101053852 | 320 |
| 350 | 3300005458 | Ga0070681_10108821 | Ga0070681_101088212 | 320 |
| 351 | 3300005458 | Ga0070681_10211860 | Ga0070681_102118602 | 320 |
| 352 | 3300005459 | Ga0068867_100012780 | Ga0068867_1000127804 | 320 |
| 353 | 3300005459 | Ga0068867_100109962 | Ga0068867_1001099622 | 320 |
| 354 | 3300005466 | Ga0070685_10002610 | Ga0070685_1000261010 | 320 |
| 355 | 3300005466 | Ga0070685_10021537 | Ga0070685_100215372 | 320 |
| 356 | 3300005466 | Ga0070685_10102274 | Ga0070685_101022742 | 320 |
| 357 | 3300005530 | Ga0070679_100138184 | Ga0070679_1001381841 | 320 |
| 358 | 3300005530 | Ga0070679_100145489 | Ga0070679_1001454892 | 320 |
| 359 | 3300005530 | Ga0070679_100227573 | Ga0070679_1002275731 | 320 |
| 360 | 3300005530 | Ga0070679_100232037 | Ga0070679_1002320371 | 320 |
| 361 | 3300005530 | Ga0070679_100259105 | Ga0070679_1002591051 | 320 |
| 362 | 3300005535 | Ga0070684_100001501 | Ga0070684_1000015016 | 320 |
| 363 | 3300005539 | Ga0068853_100001914 | Ga0068853_10000191411 | 320 |
| 364 | 3300005539 | Ga0068853_100333703 | Ga0068853_1003337032 | 320 |
| 365 | 3300005543 | Ga0070672_100000442 | Ga0070672_10000044215 | 320 |
| 366 | 3300005543 | Ga0070672_100063856 | Ga0070672_1000638565 | 320 |
| 367 | 3300005543 | Ga0070672_100073889 | Ga0070672_1000738895 | 320 |
| 368 | 3300005543 | Ga0070672_100192255 | Ga0070672_1001922551 | 320 |
| 369 | 3300005543 | Ga0070672_100357396 | Ga0070672_1003573962 | 320 |
| 370 | 3300005544 | Ga0070686_100002692 | Ga0070686_1000026926 | 320 |
| 371 | 3300005544 | Ga0070686_100094725 | Ga0070686_1000947252 | 320 |
| 372 | 3300005546 | Ga0070696_100006734 | Ga0070696_1000067344 | 320 |
| 373 | 3300005546 | Ga0070696_100013242 | Ga0070696_1000132426 | 320 |
| 374 | 3300005547 | Ga0070693_100000492 | Ga0070693_1000004927 | 320 |
| 375 | 3300005547 | Ga0070693_100006083 | Ga0070693_1000060832 | 320 |
| 376 | 3300005547 | Ga0070693_100017245 | Ga0070693_1000172453 | 320 |
| 377 | 3300005547 | Ga0070693_100022943 | Ga0070693_1000229432 | 320 |
| 378 | 3300005548 | Ga0070665_100037138 | Ga0070665_1000371383 | 320 |
| 379 | 3300005548 | Ga0070665_100037390 | Ga0070665_1000373907 | 320 |
| 380 | 3300005548 | Ga0070665_100280783 | Ga0070665_1002807832 | 320 |
| 381 | 3300005549 | Ga0070704_100004657 | Ga0070704_1000046573 | 320 |
| 382 | 3300005549 | Ga0070704_100092172 | Ga0070704_1000921723 | 320 |
| 383 | 3300005563 | Ga0068855_100004881 | Ga0068855_10000488113 | 320 |
| 384 | 3300005563 | Ga0068855_100165810 | Ga0068855_1001658102 | 320 |
| 385 | 3300005564 | Ga0070664_100009800 | Ga0070664_1000098004 | 320 |
| 386 | 3300005564 | Ga0070664_100090475 | Ga0070664_1000904752 | 320 |
| 387 | 3300005564 | Ga0070664_100099406 | Ga0070664_1000994064 | 320 |
| 388 | 3300005564 | Ga0070664_100173256 | Ga0070664_1001732563 | 320 |
| 389 | 3300005577 | Ga0068857_100002803 | Ga0068857_1000028036 | 320 |
| 390 | 3300005577 | Ga0068857_100113891 | Ga0068857_1001138912 | 320 |
| 391 | 3300005578 | Ga0068854_100003844 | Ga0068854_1000038447 | 320 |
| 392 | 3300005578 | Ga0068854_100019418 | Ga0068854_1000194184 | 320 |
| 393 | 3300005614 | Ga0068856_100000863 | Ga0068856_10000086312 | 320 |
| 394 | 3300005614 | Ga0068856_100076202 | Ga0068856_1000762024 | 320 |
| 395 | 3300005614 | Ga0068856_100212529 | Ga0068856_1002125292 | 320 |
| 396 | 3300005616 | Ga0068852_100016931 | Ga0068852_1000169316 | 320 |
| 397 | 3300005616 | Ga0068852_100075492 | Ga0068852_1000754922 | 320 |
| 398 | 3300005617 | Ga0068859_100017372 | Ga0068859_1000173725 | 320 |
| 399 | 3300005617 | Ga0068859_100035958 | Ga0068859_1000359584 | 320 |
| 400 | 3300005617 | Ga0068859_100053230 | Ga0068859_1000532306 | 320 |
| 401 | 3300005617 | Ga0068859_100059495 | Ga0068859_1000594952 | 320 |
| 402 | 3300005617 | Ga0068859_100326418 | Ga0068859_1003264181 | 320 |
| 403 | 3300005618 | Ga0068864_100001441 | Ga0068864_1000014417 | 320 |
| 404 | 3300005618 | Ga0068864_100012607 | Ga0068864_1000126072 | 320 |
| 405 | 3300005618 | Ga0068864_100014014 | Ga0068864_1000140147 | 320 |
| 406 | 3300005618 | Ga0068864_100082925 | Ga0068864_1000829253 | 320 |
| 407 | 3300005618 | Ga0068864_100092895 | Ga0068864_1000928952 | 320 |
| 408 | 3300005618 | Ga0068864_100204144 | Ga0068864_1002041442 | 320 |
| 409 | 3300005718 | Ga0068866_10000723 | Ga0068866_1000072313 | 320 |
| 410 | 3300005718 | Ga0068866_10008361 | Ga0068866_100083614 | 320 |
| 411 | 3300005718 | Ga0068866_10077224 | Ga0068866_100772242 | 320 |
| 412 | 3300005719 | Ga0068861_100000840 | Ga0068861_10000084018 | 320 |
| 413 | 3300005719 | Ga0068861_100007748 | Ga0068861_1000077488 | 320 |
| 414 | 3300005719 | Ga0068861_100177197 | Ga0068861_1001771972 | 320 |
| 415 | 3300005834 | Ga0068851_10026372 | Ga0068851_100263722 | 320 |
| 416 | 3300005840 | Ga0068870_10000302 | Ga0068870_1000030218 | 320 |
| 417 | 3300005840 | Ga0068870_10001054 | Ga0068870_100010546 | 320 |
| 418 | 3300005840 | Ga0068870_10018269 | Ga0068870_100182692 | 320 |
| 419 | 3300005841 | Ga0068863_100033650 | Ga0068863_1000336504 | 320 |
| 420 | 3300005841 | Ga0068863_100046329 | Ga0068863_1000463295 | 320 |
| 421 | 3300005842 | Ga0068858_100011645 | Ga0068858_1000116455 | 320 |
| 422 | 3300005842 | Ga0068858_100012780 | Ga0068858_1000127807 | 320 |
| 423 | 3300005842 | Ga0068858_100403408 | Ga0068858_1004034081 | 320 |
| 424 | 3300005843 | Ga0068860_100004558 | Ga0068860_1000045584 | 320 |
| 425 | 3300005843 | Ga0068860_100055279 | Ga0068860_1000552793 | 320 |
| 426 | 3300005843 | Ga0068860_100443607 | Ga0068860_1004436072 | 320 |
| 427 | 3300005844 | Ga0068862_100002629 | Ga0068862_1000026296 | 320 |
| 428 | 3300005844 | Ga0068862_100026786 | Ga0068862_1000267861 | 320 |
| 429 | 3300005937 | Ga0081455_10000009 | Ga0081455_10000009203 | 320 |
| 430 | 3300005937 | Ga0081455_10002521 | Ga0081455_1000252123 | 320 |
| 431 | 3300005937 | Ga0081455_10003750 | Ga0081455_100037502 | 320 |
| 432 | 3300006028 | Ga0070717_10001787 | Ga0070717_1000178719 | 320 |
| 433 | 3300006038 | Ga0075365_10139823 | Ga0075365_101398231 | 320 |
| 434 | 3300006058 | Ga0075432_10000952 | Ga0075432_1000095214 | 320 |
| 435 | 3300006163 | Ga0070715_10000335 | Ga0070715_100003353 | 320 |
| 436 | 3300006163 | Ga0070715_10123590 | Ga0070715_101235902 | 320 |
| 437 | 3300006173 | Ga0070716_100005101 | Ga0070716_1000051013 | 320 |
| 438 | 3300006173 | Ga0070716_100103591 | Ga0070716_1001035912 | 320 |
| 439 | 3300006175 | Ga0070712_100124450 | Ga0070712_1001244501 | 320 |
| 440 | 3300006175 | Ga0070712_100459540 | Ga0070712_1004595401 | 320 |
| 441 | 3300006178 | Ga0075367_10015558 | Ga0075367_100155582 | 320 |
| 442 | 3300006178 | Ga0075367_10027997 | Ga0075367_100279972 | 320 |
| 443 | 3300006195 | Ga0075366_10001747 | Ga0075366_100017474 | 320 |
| 444 | 3300006237 | Ga0097621_100001589 | Ga0097621_1000015896 | 320 |
| 445 | 3300006237 | Ga0097621_100013414 | Ga0097621_1000134144 | 320 |
| 446 | 3300006237 | Ga0097621_100023262 | Ga0097621_1000232626 | 320 |
| 447 | 3300006237 | Ga0097621_100044633 | Ga0097621_1000446334 | 320 |
| 448 | 3300006353 | Ga0075370_10063596 | Ga0075370_100635963 | 320 |
| 449 | 3300006358 | Ga0068871_100000821 | Ga0068871_1000008216 | 320 |
| 450 | 3300006358 | Ga0068871_100083192 | Ga0068871_1000831922 | 320 |
| 451 | 3300006358 | Ga0068871_100134265 | Ga0068871_1001342651 | 320 |
| 452 | 3300006844 | Ga0075428_100556231 | Ga0075428_1005562311 | 320 |
| 453 | 3300006846 | Ga0075430_100381924 | Ga0075430_1003819241 | 320 |
| 454 | 3300006847 | Ga0075431_100143647 | Ga0075431_1001436471 | 320 |
| 455 | 3300006847 | Ga0075431_100174601 | Ga0075431_1001746013 | 320 |
| 456 | 3300006847 | Ga0075431_100297265 | Ga0075431_1002972652 | 320 |
| 457 | 3300006852 | Ga0075433_10000215 | Ga0075433_1000021532 | 320 |
| 458 | 3300006852 | Ga0075433_10029127 | Ga0075433_100291274 | 320 |
| 459 | 3300006871 | Ga0075434_100025301 | Ga0075434_1000253013 | 320 |
| 460 | 3300006871 | Ga0075434_100028038 | Ga0075434_1000280385 | 320 |
| 461 | 3300006871 | Ga0075434_100059633 | Ga0075434_1000596332 | 320 |
| 462 | 3300006881 | Ga0068865_100000904 | Ga0068865_1000009046 | 320 |
| 463 | 3300006881 | Ga0068865_100022470 | Ga0068865_1000224703 | 320 |
| 464 | 3300006881 | Ga0068865_100146644 | Ga0068865_1001466442 | 320 |
| 465 | 3300006881 | Ga0068865_100147550 | Ga0068865_1001475501 | 320 |
| 466 | 3300006914 | Ga0075436_100059046 | Ga0075436_1000590462 | 320 |
| 467 | 3300006931 | Ga0097620_100017372 | Ga0097620_1000173725 | 320 |
| 468 | 3300006931 | Ga0097620_100035960 | Ga0097620_1000359603 | 320 |
| 469 | 3300006931 | Ga0097620_100053232 | Ga0097620_1000532322 | 320 |
| 470 | 3300006931 | Ga0097620_100059497 | Ga0097620_1000594974 | 320 |
| 471 | 3300006931 | Ga0097620_100326411 | Ga0097620_1003264112 | 320 |
| 472 | 3300007076 | Ga0075435_100003952 | Ga0075435_1000039525 | 320 |
| 473 | 3300007076 | Ga0075435_100008222 | Ga0075435_1000082227 | 320 |
| 474 | 3300007076 | Ga0075435_100009478 | Ga0075435_1000094786 | 320 |
| 475 | 3300007076 | Ga0075435_100285608 | Ga0075435_1002856081 | 320 |
| 476 | 3300007076 | Ga0075435_100303690 | Ga0075435_1003036902 | 320 |
| 477 | 3300009011 | Ga0105251_10029534 | Ga0105251_100295342 | 320 |
| 478 | 3300009092 | Ga0105250_10029855 | Ga0105250_100298552 | 320 |
| 479 | 3300009093 | Ga0105240_10010852 | Ga0105240_100108529 | 320 |
| 480 | 3300009093 | Ga0105240_10040215 | Ga0105240_100402153 | 320 |
| 481 | 3300009093 | Ga0105240_10181925 | Ga0105240_101819252 | 320 |
| 482 | 3300009093 | Ga0105240_10385327 | Ga0105240_103853272 | 320 |
| 483 | 3300009094 | Ga0111539_10001590 | Ga0111539_1000159021 | 320 |
| 484 | 3300009094 | Ga0111539_10071163 | Ga0111539_100711633 | 320 |
| 485 | 3300009094 | Ga0111539_10240122 | Ga0111539_102401222 | 320 |
| 486 | 3300009098 | Ga0105245_10001399 | Ga0105245_1000139913 | 320 |
| 487 | 3300009098 | Ga0105245_10009709 | Ga0105245_100097096 | 320 |
| 488 | 3300009098 | Ga0105245_10058969 | Ga0105245_100589692 | 320 |
| 489 | 3300009098 | Ga0105245_10280158 | Ga0105245_102801582 | 320 |
| 490 | 3300009101 | Ga0105247_10001106 | Ga0105247_1000110611 | 320 |
| 491 | 3300009101 | Ga0105247_10003221 | Ga0105247_100032219 | 320 |
| 492 | 3300009101 | Ga0105247_10020381 | Ga0105247_100203813 | 320 |
| 493 | 3300009101 | Ga0105247_10054881 | Ga0105247_100548813 | 320 |
| 494 | 3300009147 | Ga0114129_10007384 | Ga0114129_100073848 | 320 |
| 495 | 3300009147 | Ga0114129_10019783 | Ga0114129_100197837 | 320 |
| 496 | 3300009147 | Ga0114129_10354510 | Ga0114129_103545102 | 320 |
| 497 | 3300009148 | Ga0105243_10002518 | Ga0105243_100025187 | 320 |
| 498 | 3300009148 | Ga0105243_10012299 | Ga0105243_100122995 | 320 |
| 499 | 3300009148 | Ga0105243_10158683 | Ga0105243_101586832 | 320 |
| 500 | 3300009148 | Ga0105243_10236804 | Ga0105243_102368042 | 320 |
| 501 | 3300009174 | Ga0105241_10017190 | Ga0105241_100171902 | 320 |
| 502 | 3300009174 | Ga0105241_10159404 | Ga0105241_101594042 | 320 |
| 503 | 3300009176 | Ga0105242_10001979 | Ga0105242_1000197915 | 320 |
| 504 | 3300009176 | Ga0105242_10035113 | Ga0105242_100351133 | 320 |
| 505 | 3300009176 | Ga0105242_10051405 | Ga0105242_100514052 | 320 |
| 506 | 3300009176 | Ga0105242_10133137 | Ga0105242_101331372 | 320 |
| 507 | 3300009176 | Ga0105242_10285819 | Ga0105242_102858191 | 320 |
| 508 | 3300009176 | Ga0105242_10366270 | Ga0105242_103662701 | 320 |
| 509 | 3300009176 | Ga0105242_10423821 | Ga0105242_104238211 | 320 |
| 510 | 3300009177 | Ga0105248_10002761 | Ga0105248_100027618 | 320 |
| 511 | 3300009177 | Ga0105248_10091263 | Ga0105248_100912632 | 320 |
| 512 | 3300009177 | Ga0105248_10103224 | Ga0105248_101032242 | 320 |
| 513 | 3300009177 | Ga0105248_10237313 | Ga0105248_102373132 | 320 |
| 514 | 3300009545 | Ga0105237_10053856 | Ga0105237_100538565 | 320 |
| 515 | 3300009545 | Ga0105237_10056173 | Ga0105237_100561736 | 320 |
| 516 | 3300009545 | Ga0105237_10113907 | Ga0105237_101139072 | 320 |
| 517 | 3300009545 | Ga0105237_10127937 | Ga0105237_101279372 | 320 |
| 518 | 3300009551 | Ga0105238_10065285 | Ga0105238_100652856 | 320 |
| 519 | 3300009551 | Ga0105238_10279920 | Ga0105238_102799203 | 320 |
| 520 | 3300009553 | Ga0105249_10001607 | Ga0105249_1000160711 | 320 |
| 521 | 3300009553 | Ga0105249_10041870 | Ga0105249_100418704 | 320 |
| 522 | 3300009553 | Ga0105249_10100649 | Ga0105249_101006492 | 320 |
| 523 | 3300010375 | Ga0105239_10014477 | Ga0105239_1001447710 | 320 |
| 524 | 3300010375 | Ga0105239_10023767 | Ga0105239_100237678 | 320 |
| 525 | 3300010375 | Ga0105239_10118946 | Ga0105239_101189462 | 320 |
| 526 | 3300010375 | Ga0105239_10258298 | Ga0105239_102582982 | 320 |
| 527 | 3300011119 | Ga0105246_10001743 | Ga0105246_100017433 | 320 |
| 528 | 3300011119 | Ga0105246_10007183 | Ga0105246_100071832 | 320 |
| 529 | 3300012498 | Ga0157345_1004578 | Ga0157345_10045781 | 320 |
| 530 | 3300013100 | Ga0157373_10057488 | Ga0157373_100574881 | 320 |
| 531 | 3300013102 | Ga0157371_10044904 | Ga0157371_100449043 | 320 |
| 532 | 3300013102 | Ga0157371_10175200 | Ga0157371_101752001 | 320 |
| 533 | 3300013104 | Ga0157370_10032704 | Ga0157370_100327043 | 320 |
| 534 | 3300013104 | Ga0157370_10336763 | Ga0157370_103367632 | 320 |
| 535 | 3300013105 | Ga0157369_10172905 | Ga0157369_101729053 | 320 |
| 536 | 3300013105 | Ga0157369_10266901 | Ga0157369_102669012 | 320 |
| 537 | 3300013105 | Ga0157369_10492777 | Ga0157369_104927772 | 320 |
| 538 | 3300013296 | Ga0157374_10002463 | Ga0157374_100024632 | 320 |
| 539 | 3300013296 | Ga0157374_10009285 | Ga0157374_100092856 | 320 |
| 540 | 3300013296 | Ga0157374_10139785 | Ga0157374_101397852 | 320 |
| 541 | 3300013296 | Ga0157374_10353689 | Ga0157374_103536892 | 320 |
| 542 | 3300013297 | Ga0157378_10003278 | Ga0157378_100032784 | 320 |
| 543 | 3300013297 | Ga0157378_10042152 | Ga0157378_100421523 | 320 |
| 544 | 3300013297 | Ga0157378_10704818 | Ga0157378_107048181 | 320 |
| 545 | 3300013306 | Ga0163162_10007479 | Ga0163162_100074798 | 320 |
| 546 | 3300013306 | Ga0163162_10023461 | Ga0163162_100234612 | 320 |
| 547 | 3300013306 | Ga0163162_10057610 | Ga0163162_100576107 | 320 |
| 548 | 3300013306 | Ga0163162_10162786 | Ga0163162_101627863 | 320 |
| 549 | 3300013306 | Ga0163162_10570830 | Ga0163162_105708301 | 320 |
| 550 | 3300013308 | Ga0157375_10000974 | Ga0157375_100009746 | 320 |
| 551 | 3300013308 | Ga0157375_10030322 | Ga0157375_100303225 | 320 |
| 552 | 3300013308 | Ga0157375_10068633 | Ga0157375_100686333 | 320 |
| 553 | 3300014325 | Ga0163163_10005044 | Ga0163163_1000504413 | 320 |
| 554 | 3300014325 | Ga0163163_10042234 | Ga0163163_100422343 | 320 |
| 555 | 3300014325 | Ga0163163_10170686 | Ga0163163_101706861 | 320 |
| 556 | 3300014326 | Ga0157380_10003351 | Ga0157380_1000335112 | 320 |
| 557 | 3300014326 | Ga0157380_10138947 | Ga0157380_101389473 | 320 |
| 558 | 3300014745 | Ga0157377_10000240 | Ga0157377_1000024025 | 320 |
| 559 | 3300014745 | Ga0157377_10002728 | Ga0157377_100027284 | 320 |
| 560 | 3300014968 | Ga0157379_10005829 | Ga0157379_100058299 | 320 |
| 561 | 3300014968 | Ga0157379_10013664 | Ga0157379_100136642 | 320 |
| 562 | 3300014969 | Ga0157376_10001267 | Ga0157376_1000126716 | 320 |
| 563 | 3300017792 | Ga0163161_10001738 | Ga0163161_1000173816 | 320 |
| 564 | 3300017792 | Ga0163161_10018293 | Ga0163161_100182933 | 320 |
| 565 | 3300017792 | Ga0163161_10028762 | Ga0163161_100287623 | 320 |
| 566 | 3300017792 | Ga0163161_10060749 | Ga0163161_100607492 | 320 |
| 567 | 3300025271 | Ga0207666_1000054 | Ga0207666_10000544 | 320 |
| 568 | 3300025271 | Ga0207666_1001378 | Ga0207666_10013783 | 320 |
| 569 | 3300025290 | Ga0207673_1000022 | Ga0207673_100002210 | 320 |
| 570 | 3300025315 | Ga0207697_10000200 | Ga0207697_1000020025 | 320 |
| 571 | 3300025315 | Ga0207697_10047545 | Ga0207697_100475452 | 320 |
| 572 | 3300025885 | Ga0207653_10001606 | Ga0207653_100016063 | 320 |
| 573 | 3300025893 | Ga0207682_10000589 | Ga0207682_1000058913 | 320 |
| 574 | 3300025898 | Ga0207692_10026161 | Ga0207692_100261611 | 320 |
| 575 | 3300025898 | Ga0207692_10144411 | Ga0207692_101444112 | 320 |
| 576 | 3300025899 | Ga0207642_10001001 | Ga0207642_100010014 | 320 |
| 577 | 3300025899 | Ga0207642_10003144 | Ga0207642_100031446 | 320 |
| 578 | 3300025900 | Ga0207710_10001512 | Ga0207710_100015128 | 320 |
| 579 | 3300025900 | Ga0207710_10005283 | Ga0207710_100052836 | 320 |
| 580 | 3300025900 | Ga0207710_10019583 | Ga0207710_100195833 | 320 |
| 581 | 3300025901 | Ga0207688_10000200 | Ga0207688_100002008 | 320 |
| 582 | 3300025901 | Ga0207688_10010290 | Ga0207688_100102905 | 320 |
| 583 | 3300025903 | Ga0207680_10017450 | Ga0207680_100174502 | 320 |
| 584 | 3300025904 | Ga0207647_10000472 | Ga0207647_100004728 | 320 |
| 585 | 3300025904 | Ga0207647_10005890 | Ga0207647_100058909 | 320 |
| 586 | 3300025905 | Ga0207685_10004135 | Ga0207685_100041352 | 320 |
| 587 | 3300025906 | Ga0207699_10059970 | Ga0207699_100599704 | 320 |
| 588 | 3300025906 | Ga0207699_10122948 | Ga0207699_101229481 | 320 |
| 589 | 3300025906 | Ga0207699_10223582 | Ga0207699_102235822 | 320 |
| 590 | 3300025907 | Ga0207645_10001225 | Ga0207645_1000122516 | 320 |
| 591 | 3300025907 | Ga0207645_10109490 | Ga0207645_101094902 | 320 |
| 592 | 3300025908 | Ga0207643_10000302 | Ga0207643_1000030212 | 320 |
| 593 | 3300025908 | Ga0207643_10001773 | Ga0207643_100017736 | 320 |
| 594 | 3300025908 | Ga0207643_10001904 | Ga0207643_1000190411 | 320 |
| 595 | 3300025911 | Ga0207654_10012697 | Ga0207654_100126976 | 320 |
| 596 | 3300025911 | Ga0207654_10017171 | Ga0207654_100171713 | 320 |
| 597 | 3300025912 | Ga0207707_10004595 | Ga0207707_1000459514 | 320 |
| 598 | 3300025912 | Ga0207707_10021311 | Ga0207707_100213112 | 320 |
| 599 | 3300025912 | Ga0207707_10203206 | Ga0207707_102032062 | 320 |
| 600 | 3300025913 | Ga0207695_10157850 | Ga0207695_101578503 | 320 |
| 601 | 3300025914 | Ga0207671_10011789 | Ga0207671_100117894 | 320 |
| 602 | 3300025914 | Ga0207671_10069816 | Ga0207671_100698162 | 320 |
| 603 | 3300025914 | Ga0207671_10244853 | Ga0207671_102448531 | 320 |
| 604 | 3300025915 | Ga0207693_10004654 | Ga0207693_1000465415 | 320 |
| 605 | 3300025915 | Ga0207693_10008892 | Ga0207693_100088926 | 320 |
| 606 | 3300025915 | Ga0207693_10017923 | Ga0207693_100179237 | 320 |
| 607 | 3300025915 | Ga0207693_10036811 | Ga0207693_100368113 | 320 |
| 608 | 3300025915 | Ga0207693_10067735 | Ga0207693_100677353 | 320 |
| 609 | 3300025916 | Ga0207663_10008376 | Ga0207663_100083766 | 320 |
| 610 | 3300025916 | Ga0207663_10092107 | Ga0207663_100921072 | 320 |
| 611 | 3300025916 | Ga0207663_10172250 | Ga0207663_101722501 | 320 |
| 612 | 3300025917 | Ga0207660_10001461 | Ga0207660_100014615 | 320 |
| 613 | 3300025917 | Ga0207660_10314358 | Ga0207660_103143581 | 320 |
| 614 | 3300025918 | Ga0207662_10000446 | Ga0207662_100004467 | 320 |
| 615 | 3300025918 | Ga0207662_10004160 | Ga0207662_100041603 | 320 |
| 616 | 3300025918 | Ga0207662_10019707 | Ga0207662_100197071 | 320 |
| 617 | 3300025919 | Ga0207657_10000917 | Ga0207657_100009178 | 320 |
| 618 | 3300025919 | Ga0207657_10021816 | Ga0207657_100218163 | 320 |
| 619 | 3300025919 | Ga0207657_10040989 | Ga0207657_100409892 | 320 |
| 620 | 3300025919 | Ga0207657_10142712 | Ga0207657_101427122 | 320 |
| 621 | 3300025919 | Ga0207657_10171252 | Ga0207657_101712522 | 320 |
| 622 | 3300025920 | Ga0207649_10000864 | Ga0207649_100008643 | 320 |
| 623 | 3300025920 | Ga0207649_10023029 | Ga0207649_100230292 | 320 |
| 624 | 3300025921 | Ga0207652_10002449 | Ga0207652_100024499 | 320 |
| 625 | 3300025921 | Ga0207652_10139221 | Ga0207652_101392212 | 320 |
| 626 | 3300025921 | Ga0207652_10403030 | Ga0207652_104030301 | 320 |
| 627 | 3300025923 | Ga0207681_10001739 | Ga0207681_1000173910 | 320 |
| 628 | 3300025923 | Ga0207681_10116698 | Ga0207681_101166982 | 320 |
| 629 | 3300025925 | Ga0207650_10006825 | Ga0207650_100068253 | 320 |
| 630 | 3300025925 | Ga0207650_10041636 | Ga0207650_100416363 | 320 |
| 631 | 3300025925 | Ga0207650_10151880 | Ga0207650_101518803 | 320 |
| 632 | 3300025926 | Ga0207659_10000683 | Ga0207659_1000068318 | 320 |
| 633 | 3300025926 | Ga0207659_10107039 | Ga0207659_101070391 | 320 |
| 634 | 3300025926 | Ga0207659_10207228 | Ga0207659_102072282 | 320 |
| 635 | 3300025927 | Ga0207687_10001148 | Ga0207687_100011483 | 320 |
| 636 | 3300025927 | Ga0207687_10004655 | Ga0207687_100046558 | 320 |
| 637 | 3300025927 | Ga0207687_10011621 | Ga0207687_100116213 | 320 |
| 638 | 3300025927 | Ga0207687_10044666 | Ga0207687_100446664 | 320 |
| 639 | 3300025927 | Ga0207687_10377946 | Ga0207687_103779462 | 320 |
| 640 | 3300025928 | Ga0207700_10058005 | Ga0207700_100580051 | 320 |
| 641 | 3300025928 | Ga0207700_10144123 | Ga0207700_101441232 | 320 |
| 642 | 3300025929 | Ga0207664_10069303 | Ga0207664_100693032 | 320 |
| 643 | 3300025931 | Ga0207644_10003175 | Ga0207644_100031758 | 320 |
| 644 | 3300025931 | Ga0207644_10019581 | Ga0207644_100195813 | 320 |
| 645 | 3300025931 | Ga0207644_10067516 | Ga0207644_100675163 | 320 |
| 646 | 3300025932 | Ga0207690_10001302 | Ga0207690_1000130215 | 320 |
| 647 | 3300025933 | Ga0207706_10001314 | Ga0207706_100013144 | 320 |
| 648 | 3300025933 | Ga0207706_10028177 | Ga0207706_100281772 | 320 |
| 649 | 3300025933 | Ga0207706_10119291 | Ga0207706_101192912 | 320 |
| 650 | 3300025934 | Ga0207686_10001107 | Ga0207686_1000110718 | 320 |
| 651 | 3300025934 | Ga0207686_10017202 | Ga0207686_100172024 | 320 |
| 652 | 3300025934 | Ga0207686_10017383 | Ga0207686_100173834 | 320 |
| 653 | 3300025934 | Ga0207686_10027799 | Ga0207686_100277992 | 320 |
| 654 | 3300025934 | Ga0207686_10186533 | Ga0207686_101865332 | 320 |
| 655 | 3300025935 | Ga0207709_10000742 | Ga0207709_1000074213 | 320 |
| 656 | 3300025935 | Ga0207709_10021237 | Ga0207709_100212372 | 320 |
| 657 | 3300025935 | Ga0207709_10047049 | Ga0207709_100470493 | 320 |
| 658 | 3300025935 | Ga0207709_10095419 | Ga0207709_100954192 | 320 |
| 659 | 3300025935 | Ga0207709_10238711 | Ga0207709_102387112 | 320 |
| 660 | 3300025936 | Ga0207670_10000707 | Ga0207670_100007074 | 320 |
| 661 | 3300025936 | Ga0207670_10005405 | Ga0207670_100054055 | 320 |
| 662 | 3300025936 | Ga0207670_10087631 | Ga0207670_100876313 | 320 |
| 663 | 3300025936 | Ga0207670_10283672 | Ga0207670_102836722 | 320 |
| 664 | 3300025937 | Ga0207669_10000470 | Ga0207669_100004708 | 320 |
| 665 | 3300025937 | Ga0207669_10021789 | Ga0207669_100217894 | 320 |
| 666 | 3300025938 | Ga0207704_10001346 | Ga0207704_100013463 | 320 |
| 667 | 3300025938 | Ga0207704_10028894 | Ga0207704_100288944 | 320 |
| 668 | 3300025938 | Ga0207704_10105202 | Ga0207704_101052022 | 320 |
| 669 | 3300025938 | Ga0207704_10308126 | Ga0207704_103081262 | 320 |
| 670 | 3300025939 | Ga0207665_10013405 | Ga0207665_100134052 | 320 |
| 671 | 3300025939 | Ga0207665_10034521 | Ga0207665_100345212 | 320 |
| 672 | 3300025940 | Ga0207691_10000627 | Ga0207691_1000062727 | 320 |
| 673 | 3300025940 | Ga0207691_10007735 | Ga0207691_100077359 | 320 |
| 674 | 3300025940 | Ga0207691_10058030 | Ga0207691_100580302 | 320 |
| 675 | 3300025940 | Ga0207691_10183905 | Ga0207691_101839052 | 320 |
| 676 | 3300025941 | Ga0207711_10006242 | Ga0207711_100062423 | 320 |
| 677 | 3300025941 | Ga0207711_10106063 | Ga0207711_101060631 | 320 |
| 678 | 3300025941 | Ga0207711_10198289 | Ga0207711_101982893 | 320 |
| 679 | 3300025942 | Ga0207689_10000823 | Ga0207689_100008236 | 320 |
| 680 | 3300025942 | Ga0207689_10013625 | Ga0207689_100136253 | 320 |
| 681 | 3300025942 | Ga0207689_10059931 | Ga0207689_100599316 | 320 |
| 682 | 3300025942 | Ga0207689_10078805 | Ga0207689_100788052 | 320 |
| 683 | 3300025944 | Ga0207661_10015006 | Ga0207661_100150063 | 320 |
| 684 | 3300025944 | Ga0207661_10089600 | Ga0207661_100896002 | 320 |
| 685 | 3300025945 | Ga0207679_10000409 | Ga0207679_100004096 | 320 |
| 686 | 3300025945 | Ga0207679_10003395 | Ga0207679_1000339510 | 320 |
| 687 | 3300025949 | Ga0207667_10091729 | Ga0207667_100917291 | 320 |
| 688 | 3300025949 | Ga0207667_10096675 | Ga0207667_100966753 | 320 |
| 689 | 3300025960 | Ga0207651_10000472 | Ga0207651_100004727 | 320 |
| 690 | 3300025960 | Ga0207651_10063218 | Ga0207651_100632183 | 320 |
| 691 | 3300025961 | Ga0207712_10002155 | Ga0207712_100021553 | 320 |
| 692 | 3300025961 | Ga0207712_10025600 | Ga0207712_100256003 | 320 |
| 693 | 3300025961 | Ga0207712_10347360 | Ga0207712_103473602 | 320 |
| 694 | 3300025972 | Ga0207668_10001632 | Ga0207668_100016326 | 320 |
| 695 | 3300025972 | Ga0207668_10038431 | Ga0207668_100384312 | 320 |
| 696 | 3300025981 | Ga0207640_10001082 | Ga0207640_1000108217 | 320 |
| 697 | 3300025981 | Ga0207640_10026699 | Ga0207640_100266993 | 320 |
| 698 | 3300025986 | Ga0207658_10006212 | Ga0207658_100062125 | 320 |
| 699 | 3300025986 | Ga0207658_10130492 | Ga0207658_101304922 | 320 |
| 700 | 3300026023 | Ga0207677_10011916 | Ga0207677_100119163 | 320 |
| 701 | 3300026023 | Ga0207677_10138668 | Ga0207677_101386682 | 320 |
| 702 | 3300026035 | Ga0207703_10001483 | Ga0207703_100014836 | 320 |
| 703 | 3300026035 | Ga0207703_10006044 | Ga0207703_100060444 | 320 |
| 704 | 3300026035 | Ga0207703_10023398 | Ga0207703_100233983 | 320 |
| 705 | 3300026035 | Ga0207703_10388100 | Ga0207703_103881002 | 320 |
| 706 | 3300026041 | Ga0207639_10001602 | Ga0207639_1000160218 | 320 |
| 707 | 3300026041 | Ga0207639_10075452 | Ga0207639_100754522 | 320 |
| 708 | 3300026067 | Ga0207678_10002063 | Ga0207678_100020638 | 320 |
| 709 | 3300026067 | Ga0207678_10012664 | Ga0207678_100126644 | 320 |
| 710 | 3300026067 | Ga0207678_10024225 | Ga0207678_100242258 | 320 |
| 711 | 3300026067 | Ga0207678_10037027 | Ga0207678_100370272 | 320 |
| 712 | 3300026067 | Ga0207678_10069547 | Ga0207678_100695475 | 320 |
| 713 | 3300026067 | Ga0207678_10144658 | Ga0207678_101446583 | 320 |
| 714 | 3300026067 | Ga0207678_10204817 | Ga0207678_102048171 | 320 |
| 715 | 3300026075 | Ga0207708_10000575 | Ga0207708_100005758 | 320 |
| 716 | 3300026075 | Ga0207708_10005514 | Ga0207708_100055143 | 320 |
| 717 | 3300026075 | Ga0207708_10009098 | Ga0207708_100090985 | 320 |
| 718 | 3300026075 | Ga0207708_10018000 | Ga0207708_100180005 | 320 |
| 719 | 3300026075 | Ga0207708_10139913 | Ga0207708_101399132 | 320 |
| 720 | 3300026078 | Ga0207702_10004242 | Ga0207702_100042423 | 320 |
| 721 | 3300026078 | Ga0207702_10111618 | Ga0207702_101116182 | 320 |
| 722 | 3300026088 | Ga0207641_10009610 | Ga0207641_100096104 | 320 |
| 723 | 3300026088 | Ga0207641_10012014 | Ga0207641_100120142 | 320 |
| 724 | 3300026088 | Ga0207641_10013698 | Ga0207641_100136982 | 320 |
| 725 | 3300026088 | Ga0207641_10162760 | Ga0207641_101627602 | 320 |
| 726 | 3300026089 | Ga0207648_10001152 | Ga0207648_100011528 | 320 |
| 727 | 3300026089 | Ga0207648_10003124 | Ga0207648_1000312417 | 320 |
| 728 | 3300026089 | Ga0207648_10035411 | Ga0207648_100354112 | 320 |
| 729 | 3300026095 | Ga0207676_10009698 | Ga0207676_100096982 | 320 |
| 730 | 3300026095 | Ga0207676_10068466 | Ga0207676_100684662 | 320 |
| 731 | 3300026095 | Ga0207676_10189490 | Ga0207676_101894903 | 320 |
| 732 | 3300026116 | Ga0207674_10001102 | Ga0207674_100011028 | 320 |
| 733 | 3300026116 | Ga0207674_10131166 | Ga0207674_101311662 | 320 |
| 734 | 3300026118 | Ga0207675_100002494 | Ga0207675_10000249416 | 320 |
| 735 | 3300026118 | Ga0207675_100009825 | Ga0207675_1000098252 | 320 |
| 736 | 3300026118 | Ga0207675_100028613 | Ga0207675_1000286133 | 320 |
| 737 | 3300026118 | Ga0207675_100029262 | Ga0207675_1000292626 | 320 |
| 738 | 3300026118 | Ga0207675_100119491 | Ga0207675_1001194911 | 320 |
| 739 | 3300026121 | Ga0207683_10000637 | Ga0207683_1000063725 | 320 |
| 740 | 3300026121 | Ga0207683_10034072 | Ga0207683_100340725 | 320 |
| 741 | 3300026121 | Ga0207683_10048246 | Ga0207683_100482462 | 320 |
| 742 | 3300026121 | Ga0207683_10062131 | Ga0207683_100621311 | 320 |
| 743 | 3300026121 | Ga0207683_10144885 | Ga0207683_101448852 | 320 |
| 744 | 3300026121 | Ga0207683_10249147 | Ga0207683_102491471 | 320 |
| 745 | 3300026142 | Ga0207698_10000980 | Ga0207698_100009809 | 320 |
| 746 | 3300026142 | Ga0207698_10072082 | Ga0207698_100720822 | 320 |
| 747 | 3300026142 | Ga0207698_10105903 | Ga0207698_101059032 | 320 |
| 748 | 3300027617 | Ga0210002_1000076 | Ga0210002_100007616 | 320 |
| 749 | 3300027682 | Ga0209971_1002029 | Ga0209971_10020294 | 320 |
| 750 | 3300027695 | Ga0209966_1008562 | Ga0209966_10085622 | 320 |
| 751 | 3300027717 | Ga0209998_10000471 | Ga0209998_100004717 | 320 |
| 752 | 3300027717 | Ga0209998_10007581 | Ga0209998_100075812 | 320 |
| 753 | 3300027876 | Ga0209974_10000316 | Ga0209974_1000031614 | 320 |
| 754 | 3300027876 | Ga0209974_10056241 | Ga0209974_100562412 | 320 |
| 755 | 3300027907 | Ga0207428_10000216 | Ga0207428_1000021652 | 320 |
| 756 | 3300027907 | Ga0207428_10001434 | Ga0207428_1000143424 | 320 |
| 757 | 3300027907 | Ga0207428_10001751 | Ga0207428_1000175115 | 320 |
| 758 | 3300027907 | Ga0207428_10343621 | Ga0207428_103436211 | 320 |
| 759 | 3300028379 | Ga0268266_10035794 | Ga0268266_100357945 | 320 |
| 760 | 3300028380 | Ga0268265_10001997 | Ga0268265_1000199714 | 320 |
| 761 | 3300028380 | Ga0268265_10074879 | Ga0268265_100748791 | 320 |
| 762 | 3300028380 | Ga0268265_10476435 | Ga0268265_104764351 | 320 |
| 763 | 3300028381 | Ga0268264_10010004 | Ga0268264_100100046 | 320 |
| 764 | 3300028381 | Ga0268264_10045422 | Ga0268264_100454223 | 320 |
| 765 | 3300028556 | Ga0265337_1001192 | Ga0265337_10011927 | 320 |
| 766 | 3300031235 | Ga0265330_10026527 | Ga0265330_100265273 | 320 |
| 767 | 3300031241 | Ga0265325_10000048 | Ga0265325_1000004869 | 320 |
| 768 | 3300031250 | Ga0265331_10013663 | Ga0265331_100136636 | 320 |
| 769 | 3300031595 | Ga0265313_10000438 | Ga0265313_100004383 | 320 |
| 770 | 3300031595 | Ga0265313_10041021 | Ga0265313_100410211 | 320 |
| 771 | 3300034816 | Ga0373930_0000307 | Ga0373930_0000307_4405_5367 | 320 |
| 772 | 3300034816 | Ga0373930_0013015 | Ga0373930_0013015_528_1490 | 320 |
| 773 | 3300034817 | Ga0373948_0002119 | Ga0373948_0002119_1028_1990 | 320 |
| 774 | 3300034818 | Ga0373950_0001201 | Ga0373950_0001201_431_1402 | 320 |
| 775 | 3300034819 | Ga0373958_0000322 | Ga0373958_0000322_817_1779 | 320 |
| 776 | 3300034819 | Ga0373958_0003692 | Ga0373958_0003692_975_1937 | 320 |
| 777 | 3300034820 | Ga0373959_0007371 | Ga0373959_0007371_603_1565 | 320 |
| 778 | 3300035083 | Ga0373926_0005698 | Ga0373926_0005698_1673_2635 | 320 |
| 779 | 3300035083 | Ga0373926_0009376 | Ga0373926_0009376_909_1871 | 320 |
| 780 | 3300035084 | Ga0373928_0012069 | Ga0373928_0012069_148_1110 | 320 |
| 781 | 3300035085 | Ga0373929_0000143 | Ga0373929_0000143_7452_8414 | 320 |
| 782 | 3300035085 | Ga0373929_0015524 | Ga0373929_0015524_14_976 | 320 |
| 783 | 3300035086 | Ga0373934_0021268 | Ga0373934_0021268_532_1494 | 320 |
| 784 | 3300035088 | Ga0373940_0011892 | Ga0373940_0011892_485_1447 | 320 |
| 785 | 3300035089 | Ga0373944_0038993 | Ga0373944_0038993_120_1082 | 320 |
| 786 | 3300035090 | Ga0373949_0001165 | Ga0373949_0001165_1092_2054 | 320 |
| 787 | 3300035090 | Ga0373949_0008747 | Ga0373949_0008747_578_1540 | 320 |
| 788 | 3300035091 | Ga0373951_0000777 | Ga0373951_0000777_326_1288 | 320 |
| 789 | 3300035091 | Ga0373951_0004528 | Ga0373951_0004528_1713_2675 | 320 |
| 790 | 3300035091 | Ga0373951_0027103 | Ga0373951_0027103_35_997 | 320 |
| 791 | 3300035091 | Ga0373951_0034299 | Ga0373951_0034299_14_976 | 320 |
| 792 | 3300035092 | Ga0373952_0001954 | Ga0373952_0001954_2230_3192 | 320 |
| 793 | 3300035092 | Ga0373952_0004393 | Ga0373952_0004393_1301_2263 | 320 |
| 794 | 3300035111 | Ga0373923_0009412 | Ga0373923_0009412_1656_2618 | 320 |
| 795 | 3300035112 | Ga0373932_0000870 | Ga0373932_0000870_896_1858 | 320 |
| 796 | 3300035112 | Ga0373932_0003101 | Ga0373932_0003101_1782_2744 | 320 |
| 797 | 3300035113 | Ga0373936_0006749 | Ga0373936_0006749_2465_3427 | 320 |
| 798 | 3300035114 | Ga0373939_0001316 | Ga0373939_0001316_1547_2509 | 320 |
| 799 | 3300035114 | Ga0373939_0002013 | Ga0373939_0002013_3513_4475 | 320 |
| 800 | 3300035115 | Ga0373941_0001795 | Ga0373941_0001795_803_1765 | 320 |
| 801 | 3300035115 | Ga0373941_0005143 | Ga0373941_0005143_1381_2343 | 320 |
| 802 | 3300035116 | Ga0373945_0005139 | Ga0373945_0005139_1083_2045 | 320 |
| 803 | 3300035116 | Ga0373945_0020719 | Ga0373945_0020719_66_1028 | 320 |
| 804 | 3300035119 | Ga0373956_0005731 | Ga0373956_0005731_1810_2772 | 320 |
| 805 | 3300035119 | Ga0373956_0038409 | Ga0373956_0038409_69_1190 | 320 |
| 806 | 3300035120 | Ga0373957_0002589 | Ga0373957_0002589_3702_4664 | 320 |
| 807 | 3300035121 | Ga0373960_0000059 | Ga0373960_0000059_7428_8390 | 320 |
| 808 | 3300035121 | Ga0373960_0004733 | Ga0373960_0004733_1741_2703 | 320 |
| 809 | 3300035121 | Ga0373960_0005883 | Ga0373960_0005883_321_1283 | 320 |
| 810 | 3300035170 | Ga0373943_0009773 | Ga0373943_0009773_916_1878 | 320 |
| 811 | 3300035171 | Ga0373946_0017923 | Ga0373946_0017923_1082_2044 | 320 |
| 812 | 3300035172 | Ga0373955_0004501 | Ga0373955_0004501_2082_3044 | 320 |
| 813 | 3300035172 | Ga0373955_0004659 | Ga0373955_0004659_1338_2300 | 320 |
| 814 | 3300035172 | Ga0373955_0033246 | Ga0373955_0033246_246_1208 | 320 |
| 815 | 3300035207 | Ga0373942_0001389 | Ga0373942_0001389_2474_3436 | 320 |
| 816 | 3300035241 | Ga0373961_0005506 | Ga0373961_0005506_74_1036 | 320 |
| 817 | 3300035242 | Ga0373962_0000585 | Ga0373962_0000585_3780_4742 | 320 |
| 818 | 3300035691 | Ga0373931_0004620 | Ga0373931_0004620_387_1349 | 320 |
| 819 | 3300035691 | Ga0373931_0017840 | Ga0373931_0017840_1684_2646 | 320 |
| 820 | 3300035691 | Ga0373931_0030162 | Ga0373931_0030162_708_1670 | 320 |
| 821 | 3300035692 | Ga0373935_0018177 | Ga0373935_0018177_2156_3118 | 320 |
| 822 | 3300035692 | Ga0373935_0029643 | Ga0373935_0029643_1743_2705 | 320 |
| 823 | 3300035692 | Ga0373935_0324781 | Ga0373935_0324781_27_989 | 320 |
| 824 | 3300035695 | Ga0373927_0032493 | Ga0373927_0032493_2108_3070 | 320 |
| 825 | 3300035695 | Ga0373927_0085628 | Ga0373927_0085628_18_980 | 320 |
| 826 | 3300035724 | Ga0373933_0002274 | Ga0373933_0002274_8356_9318 | 320 |
| 827 | 3300035724 | Ga0373933_0003001 | Ga0373933_0003001_5213_6175 | 320 |
| 828 | 3300035724 | Ga0373933_0036242 | Ga0373933_0036242_805_1767 | 320 |
| 829 | 3300035724 | Ga0373933_0118759 | Ga0373933_0118759_153_1118 | 320 |
| 830 | 3300035725 | Ga0373947_0020225 | Ga0373947_0020225_2306_3268 | 320 |
| 831 | 3300036401 | Ga0373937_0010837 | Ga0373937_0010837_1747_2868 | 320 |
| 832 | 3300036401 | Ga0373937_0019262 | Ga0373937_0019262_643_1605 | 320 |
| 833 | 3300036401 | Ga0373937_0023232 | Ga0373937_0023232_1349_2311 | 320 |
| 834 | 3300036401 | Ga0373937_0477059 | Ga0373937_0477059_173_1135 | 320 |
| 835 | 3300037068 | Ga0373925_0038021 | Ga0373925_0038021_942_1904 | 320 |
| 836 | 3300037068 | Ga0373925_0061959 | Ga0373925_0061959_743_1705 | 320 |
| 837 | 3300037068 | Ga0373925_0061989 | Ga0373925_0061989_1070_2032 | 320 |
| 838 | 3300045051 | Ga0451576_0072236 | Ga0451576_0072236_2602_3564 | 320 |
| 839 | 3300046454 | Ga0495592_0039015 | Ga0495592_0039015_1495_2457 | 320 |
| 840 | 3300046454 | Ga0495592_0041402 | Ga0495592_0041402_1581_2543 | 320 |
| 841 | 3300046454 | Ga0495592_0116908 | Ga0495592_0116908_359_1321 | 320 |
| 842 | 3300046455 | Ga0495603_0034013 | Ga0495603_0034013_1699_2661 | 320 |
| 843 | 3300046459 | Ga0495629_0001000 | Ga0495629_0001000_3474_4436 | 320 |
| 844 | 3300046459 | Ga0495629_0030399 | Ga0495629_0030399_1899_2861 | 320 |
| 845 | 3300046461 | Ga0495641_0094093 | Ga0495641_0094093_69_1031 | 320 |
| 846 | 3300046462 | Ga0495651_0040850 | Ga0495651_0040850_42_1004 | 320 |
| 847 | 3300046462 | Ga0495651_0060876 | Ga0495651_0060876_799_1761 | 320 |
| 848 | 3300046463 | Ga0495653_0084967 | Ga0495653_0084967_656_1618 | 320 |
| 849 | 3300046472 | Ga0495580_0030435 | Ga0495580_0030435_1384_2346 | 320 |
| 850 | 3300046472 | Ga0495580_0059109 | Ga0495580_0059109_565_1527 | 320 |
| 851 | 3300046473 | Ga0495582_0003989 | Ga0495582_0003989_2822_3784 | 320 |
| 852 | 3300046473 | Ga0495582_0098827 | Ga0495582_0098827_625_1587 | 320 |
| 853 | 3300046475 | Ga0495639_0040360 | Ga0495639_0040360_873_1835 | 320 |
| 854 | 3300046476 | Ga0495662_0083361 | Ga0495662_0083361_22_984 | 320 |
| 855 | 3300046477 | Ga0495664_0010075 | Ga0495664_0010075_3402_4364 | 320 |
| 856 | 3300046477 | Ga0495664_0014802 | Ga0495664_0014802_1036_1998 | 320 |
| 857 | 3300046491 | Ga0495584_0056499 | Ga0495584_0056499_732_1694 | 320 |
| 858 | 3300046492 | Ga0495585_0034434 | Ga0495585_0034434_196_1182 | 320 |
| 859 | 3300046492 | Ga0495585_0118049 | Ga0495585_0118049_406_1368 | 320 |
| 860 | 3300046499 | Ga0495594_0005856 | Ga0495594_0005856_1778_2740 | 320 |
| 861 | 3300046499 | Ga0495594_0031869 | Ga0495594_0031869_1334_2296 | 320 |
| 862 | 3300046499 | Ga0495594_0131019 | Ga0495594_0131019_65_1027 | 320 |
| 863 | 3300046511 | Ga0495608_0041702 | Ga0495608_0041702_656_1618 | 320 |
| 864 | 3300046514 | Ga0495618_0110789 | Ga0495618_0110789_422_1384 | 320 |
| 865 | 3300046517 | Ga0495630_0027271 | Ga0495630_0027271_675_1637 | 320 |
| 866 | 3300046523 | Ga0495644_0002236 | Ga0495644_0002236_4928_5890 | 320 |
| 867 | 3300046523 | Ga0495644_0054986 | Ga0495644_0054986_310_1296 | 320 |
| 868 | 3300046526 | Ga0495666_0028309 | Ga0495666_0028309_396_1358 | 320 |
| 869 | 3300046526 | Ga0495666_0149938 | Ga0495666_0149938_70_1032 | 320 |
| 870 | 3300046529 | Ga0495652_0101319 | Ga0495652_0101319_1304_2290 | 320 |
| 871 | 3300046529 | Ga0495652_0236254 | Ga0495652_0236254_159_1121 | 320 |
| 872 | 3300046531 | Ga0495665_0036088 | Ga0495665_0036088_755_1717 | 320 |
| 873 | 3300046536 | Ga0495587_0001853 | Ga0495587_0001853_8940_9902 | 320 |
| 874 | 3300046537 | Ga0495598_0003223 | Ga0495598_0003223_943_1929 | 320 |
| 875 | 3300046538 | Ga0495609_0080695 | Ga0495609_0080695_349_1311 | 320 |
| 876 | 3300046543 | Ga0495645_0001729 | Ga0495645_0001729_1842_2804 | 320 |
| 877 | 3300046543 | Ga0495645_0008295 | Ga0495645_0008295_5616_6578 | 320 |
| 878 | 3300046543 | Ga0495645_0230209 | Ga0495645_0230209_17_979 | 320 |
| 879 | 3300046557 | Ga0495622_0021157 | Ga0495622_0021157_447_1409 | 320 |
| 880 | 3300046558 | Ga0495633_0016888 | Ga0495633_0016888_240_1202 | 320 |
| 881 | 3300046559 | Ga0495667_0009963 | Ga0495667_0009963_1865_2827 | 320 |
| 882 | 3300046559 | Ga0495667_0034800 | Ga0495667_0034800_768_1730 | 320 |
| 883 | 3300046615 | Ga0495656_0007656 | Ga0495656_0007656_768_1730 | 320 |
| 884 | 3300046615 | Ga0495656_0185563 | Ga0495656_0185563_31_1011 | 320 |
| 885 | 3300046648 | Ga0495611_0034364 | Ga0495611_0034364_1263_2225 | 320 |
| 886 | 3300046663 | Ga0495635_0016669 | Ga0495635_0016669_99_1061 | 320 |
| 887 | 3300046664 | Ga0495659_0003411 | Ga0495659_0003411_1363_2325 | 320 |
| 888 | 3300046664 | Ga0495659_0029178 | Ga0495659_0029178_899_1885 | 320 |
| 889 | 3300046675 | Ga0495657_0017371 | Ga0495657_0017371_2804_3766 | 320 |
| 890 | 3300046678 | Ga0495599_0025961 | Ga0495599_0025961_1581_2543 | 320 |
| 891 | 3300046679 | Ga0495623_0014430 | Ga0495623_0014430_3459_4421 | 320 |
| 892 | 3300046680 | Ga0495646_0093505 | Ga0495646_0093505_501_1463 | 320 |
| 893 | 3300046681 | Ga0495647_0051266 | Ga0495647_0051266_248_1210 | 320 |
| 894 | 3300046683 | Ga0495658_0004053 | Ga0495658_0004053_1051_2013 | 320 |
| 895 | 3300046689 | Ga0495613_0013909 | Ga0495613_0013909_4116_5078 | 320 |
| 896 | 3300046809 | Ga0495600_0015719 | Ga0495600_0015719_3124_4086 | 320 |
| 897 | 3300046809 | Ga0495600_0041655 | Ga0495600_0041655_295_1257 | 320 |
| 898 | 3300046809 | Ga0495600_0046760 | Ga0495600_0046760_393_1355 | 320 |
| 899 | 3300047317 | Ga0495604_0051363 | Ga0495604_0051363_782_1744 | 320 |
| 900 | 3300047317 | Ga0495604_0057558 | Ga0495604_0057558_1494_2456 | 320 |
| 901 | 3300047319 | Ga0495674_0002982 | Ga0495674_0002982_5903_6865 | 320 |
| 902 | 3300047319 | Ga0495674_0021258 | Ga0495674_0021258_459_1421 | 320 |
| 903 | 3300047319 | Ga0495674_0091194 | Ga0495674_0091194_567_1529 | 320 |
| 904 | 3300047321 | Ga0495676_0085716 | Ga0495676_0085716_1333_2295 | 320 |
| 905 | 3300047322 | Ga0495680_0008240 | Ga0495680_0008240_7081_8043 | 320 |
| 906 | 3300047322 | Ga0495680_0019482 | Ga0495680_0019482_1651_2613 | 320 |
| 907 | 3300047322 | Ga0495680_0082408 | Ga0495680_0082408_1009_1971 | 320 |
| 908 | 3300047444 | Ga0495675_0047109 | Ga0495675_0047109_101_1063 | 320 |
| 909 | 3300047446 | Ga0495679_039183 | Ga0495679_039183_408_1370 | 320 |
| 910 | 3300047471 | Ga0495684_0000749 | Ga0495684_0000749_4343_5305 | 320 |
| 911 | 3300047673 | Ga0495593_0148398 | Ga0495593_0148398_29_991 | 320 |
| 912 | 3300048088 | Ga0495602_0004715 | Ga0495602_0004715_3500_4462 | 320 |
| 913 | 3300048089 | Ga0495614_0045975 | Ga0495614_0045975_448_1410 | 320 |
| 914 | 3300048903 | Ga0496100_0001128 | Ga0496100_0001128_8968_9930 | 320 |
| 915 | 3300048903 | Ga0496100_0002875 | Ga0496100_0002875_3360_4337 | 320 |
| 916 | 3300048903 | Ga0496100_0009197 | Ga0496100_0009197_4111_5073 | 320 |
| 917 | 3300048904 | Ga0496101_0002858 | Ga0496101_0002858_390_1352 | 320 |
| 918 | 3300048904 | Ga0496101_0014471 | Ga0496101_0014471_685_1671 | 320 |
| 919 | 3300048904 | Ga0496101_0024431 | Ga0496101_0024431_2840_3817 | 320 |
| 920 | 3300048904 | Ga0496101_0046816 | Ga0496101_0046816_1564_2526 | 320 |
| 921 | 3300048904 | Ga0496101_0388388 | Ga0496101_0388388_40_1002 | 320 |
| 922 | 3300048905 | Ga0496102_0010044 | Ga0496102_0010044_5631_6593 | 320 |
| 923 | 3300048905 | Ga0496102_0085854 | Ga0496102_0085854_1608_2594 | 320 |
| 924 | 3300048905 | Ga0496102_0199374 | Ga0496102_0199374_234_1196 | 320 |
| 925 | 3300048905 | Ga0496102_0342164 | Ga0496102_0342164_249_1211 | 320 |
| 926 | 3300048905 | Ga0496102_0378334 | Ga0496102_0378334_267_1229 | 320 |
| 927 | 3300048906 | Ga0496103_0001913 | Ga0496103_0001913_10024_10986 | 320 |
| 928 | 3300048906 | Ga0496103_0002261 | Ga0496103_0002261_3292_4269 | 320 |
| 929 | 3300048906 | Ga0496103_0041171 | Ga0496103_0041171_298_1284 | 320 |
| 930 | 3300048906 | Ga0496103_0073942 | Ga0496103_0073942_607_1569 | 320 |
| 931 | 3300048907 | Ga0496104_0000196 | Ga0496104_0000196_46541_47503 | 320 |
| 932 | 3300048907 | Ga0496104_0074710 | Ga0496104_0074710_760_1722 | 320 |
| 933 | 3300048908 | Ga0496105_0002162 | Ga0496105_0002162_1345_2307 | 320 |
| 934 | 3300048908 | Ga0496105_0002424 | Ga0496105_0002424_9945_10988 | 320 |
| 935 | 3300048908 | Ga0496105_0004080 | Ga0496105_0004080_5929_6906 | 320 |
| 936 | 3300048908 | Ga0496105_0010975 | Ga0496105_0010975_4554_5516 | 320 |
| 937 | 3300048908 | Ga0496105_0069166 | Ga0496105_0069166_871_1833 | 320 |
| 938 | 3300048908 | Ga0496105_0186187 | Ga0496105_0186187_548_1528 | 320 |
| 939 | 3300048908 | Ga0496105_0284799 | Ga0496105_0284799_176_1138 | 320 |
| 940 | 3300048909 | Ga0496106_0012626 | Ga0496106_0012626_1054_2031 | 320 |
| 941 | 3300048909 | Ga0496106_0018460 | Ga0496106_0018460_390_1352 | 320 |
| 942 | 3300048909 | Ga0496106_0019469 | Ga0496106_0019469_3424_4386 | 320 |
| 943 | 3300048909 | Ga0496106_0025671 | Ga0496106_0025671_1303_2265 | 320 |
| 944 | 3300048909 | Ga0496106_0080436 | Ga0496106_0080436_900_1886 | 320 |
| 945 | 3300048910 | Ga0496107_0000646 | Ga0496107_0000646_15510_16496 | 320 |
| 946 | 3300048910 | Ga0496107_0002792 | Ga0496107_0002792_6704_7681 | 320 |
| 947 | 3300048910 | Ga0496107_0005465 | Ga0496107_0005465_2558_3520 | 320 |
| 948 | 3300048910 | Ga0496107_0006701 | Ga0496107_0006701_3714_4676 | 320 |
| 949 | 3300048910 | Ga0496107_0100206 | Ga0496107_0100206_450_1412 | 320 |
| 950 | 3300048910 | Ga0496107_0306942 | Ga0496107_0306942_36_1016 | 320 |
| 951 | 3300048911 | Ga0496108_0031303 | Ga0496108_0031303_720_1706 | 320 |
| 952 | 3300048911 | Ga0496108_0055390 | Ga0496108_0055390_1968_2930 | 320 |
| 953 | 3300048911 | Ga0496108_0093445 | Ga0496108_0093445_1010_1990 | 320 |
| 954 | 3300048911 | Ga0496108_0103396 | Ga0496108_0103396_920_1882 | 320 |
| 955 | 3300048911 | Ga0496108_0255359 | Ga0496108_0255359_28_990 | 320 |
| 956 | 3300048911 | Ga0496108_0271534 | Ga0496108_0271534_229_1191 | 320 |
| 957 | 3300048911 | Ga0496108_0296325 | Ga0496108_0296325_176_1138 | 320 |
| 958 | 3300048912 | Ga0496109_0001395 | Ga0496109_0001395_8987_9949 | 320 |
| 959 | 3300048912 | Ga0496109_0003734 | Ga0496109_0003734_10378_11355 | 320 |
| 960 | 3300048912 | Ga0496109_0005620 | Ga0496109_0005620_8623_9609 | 320 |
| 961 | 3300048912 | Ga0496109_0069949 | Ga0496109_0069949_1038_2081 | 320 |
| 962 | 3300048912 | Ga0496109_0074118 | Ga0496109_0074118_1312_2292 | 320 |
| 963 | 3300048912 | Ga0496109_0240292 | Ga0496109_0240292_384_1346 | 320 |
| 964 | 3300048912 | Ga0496109_0308748 | Ga0496109_0308748_161_1123 | 320 |
| 965 | 3300048913 | Ga0496110_0009821 | Ga0496110_0009821_1440_2402 | 320 |
| 966 | 3300048913 | Ga0496110_0230548 | Ga0496110_0230548_93_1055 | 320 |
| 967 | 3300048913 | Ga0496110_0275365 | Ga0496110_0275365_160_1122 | 320 |
| 968 | 3300048913 | Ga0496110_0424193 | Ga0496110_0424193_91_1053 | 320 |
| 969 | 3300048914 | Ga0496111_0002390 | Ga0496111_0002390_6622_7599 | 320 |
| 970 | 3300048915 | Ga0496112_0029993 | Ga0496112_0029993_2800_3786 | 320 |
| 971 | 3300048915 | Ga0496112_0032426 | Ga0496112_0032426_494_1471 | 320 |
| 972 | 3300048915 | Ga0496112_0055338 | Ga0496112_0055338_710_1672 | 320 |
| 973 | 3300048915 | Ga0496112_0099124 | Ga0496112_0099124_237_1217 | 320 |
| 974 | 3300048915 | Ga0496112_0323818 | Ga0496112_0323818_160_1122 | 320 |
| 975 | 3300048916 | Ga0496113_0000682 | Ga0496113_0000682_1211_2197 | 320 |
| 976 | 3300048916 | Ga0496113_0004427 | Ga0496113_0004427_7497_8474 | 320 |
| 977 | 3300048916 | Ga0496113_0019709 | Ga0496113_0019709_2674_3636 | 320 |
| 978 | 3300048916 | Ga0496113_0100665 | Ga0496113_0100665_440_1420 | 320 |
| 979 | 3300048917 | Ga0496114_0001441 | Ga0496114_0001441_11801_12763 | 320 |
| 980 | 3300048917 | Ga0496114_0003348 | Ga0496114_0003348_4497_5474 | 320 |
| 981 | 3300048917 | Ga0496114_0013130 | Ga0496114_0013130_2531_3493 | 320 |
| 982 | 3300048917 | Ga0496114_0091828 | Ga0496114_0091828_480_1457 | 320 |
| 983 | 3300048917 | Ga0496114_0397014 | Ga0496114_0397014_27_989 | 320 |
| 984 | 3300048918 | Ga0496115_0001413 | Ga0496115_0001413_15556_16542 | 320 |
| 985 | 3300048918 | Ga0496115_0003796 | Ga0496115_0003796_6229_7191 | 320 |
| 986 | 3300048918 | Ga0496115_0023816 | Ga0496115_0023816_1250_2227 | 320 |
| 987 | 3300048918 | Ga0496115_0032902 | Ga0496115_0032902_683_1726 | 320 |
| 988 | 3300048918 | Ga0496115_0079051 | Ga0496115_0079051_1619_2596 | 320 |
| 989 | 3300048918 | Ga0496115_0179139 | Ga0496115_0179139_768_1730 | 320 |
| 990 | 3300049568 | Ga0501031_0028596 | Ga0501031_0028596_1279_2250 | 320 |
| 991 | 3300049569 | Ga0501032_0049277 | Ga0501032_0049277_1431_2402 | 320 |
| 992 | 3300049570 | Ga0501033_0024328 | Ga0501033_0024328_2341_3312 | 320 |
| 993 | 3300049571 | Ga0501034_0062100 | Ga0501034_0062100_2136_3107 | 320 |
| 994 | 3300049573 | Ga0501037_0020559 | Ga0501037_0020559_2558_3529 | 320 |
| 995 | 3300049573 | Ga0501037_0056054 | Ga0501037_0056054_677_1648 | 320 |
| 996 | 3300049575 | Ga0501039_0124918 | Ga0501039_0124918_308_1279 | 320 |
| 997 | 3300049579 | Ga0501043_0034799 | Ga0501043_0034799_1250_2221 | 320 |
| 998 | 3300049579 | Ga0501043_0116965 | Ga0501043_0116965_1079_2050 | 320 |
| 999 | 3300049581 | Ga0501047_0132154 | Ga0501047_0132154_755_1726 | 320 |
| 1000 | 3300049586 | Ga0501070_0036441 | Ga0501070_0036441_1831_2802 | 320 |
| 1001 | 3300049586 | Ga0501070_0191640 | Ga0501070_0191640_524_1495 | 320 |
| 1002 | 3300049588 | Ga0501072_0330196 | Ga0501072_0330196_218_1180 | 320 |
| 1003 | 3300049592 | Ga0501076_0120804 | Ga0501076_0120804_449_1411 | 320 |
| 1004 | 3300049593 | Ga0501077_0055262 | Ga0501077_0055262_284_1246 | 320 |
| 1005 | 3300049742 | Ga0501080_0168623 | Ga0501080_0168623_177_1139 | 320 |
| 1006 | 3300049822 | Ga0501035_0016634 | Ga0501035_0016634_1528_2499 | 320 |
| 1007 | 3300050490 | nmdc:mga03n38_117176_c1 | nmdc:mga03n38_117176_c1_269_1282 | 320 |
| 1008 | 3300050491 | nmdc:mga00v17_179610_c1 | nmdc:mga00v17_179610_c1_151_1122 | 320 |
| 1009 | 3300050492 | nmdc:mga0yw44_918_c1 | nmdc:mga0yw44_918_c1_501_1487 | 320 |
| 1010 | 3300050494 | nmdc:mga06z11_24174_c1 | nmdc:mga06z11_24174_c1_1559_2545 | 320 |
| 1011 | 3300050494 | nmdc:mga06z11_40913_c1 | nmdc:mga06z11_40913_c1_1215_2177 | 320 |
| 1012 | 3300050496 | nmdc:mga07m45_93059_c1 | nmdc:mga07m45_93059_c1_64_1026 | 320 |
| 1013 | 3300050507 | nmdc:mga05p37_13288_c1 | nmdc:mga05p37_13288_c1_49_1023 | 320 |
| 1014 | 3300050507 | nmdc:mga05p37_48824_c1 | nmdc:mga05p37_48824_c1_1390_2370 | 320 |
| 1015 | 3300050508 | nmdc:mga09592_38885_c1 | nmdc:mga09592_38885_c1_2680_3651 | 320 |
| 1016 | 3300050509 | nmdc:mga0qj67_120882_c1 | nmdc:mga0qj67_120882_c1_1061_2032 | 320 |
| 1017 | 3300050510 | nmdc:mga06r32_14230_c1 | nmdc:mga06r32_14230_c1_2773_3744 | 320 |
| 1018 | 3300050511 | nmdc:mga08y16_1865_c1 | nmdc:mga08y16_1865_c1_17872_18834 | 320 |
| 1019 | 3300050511 | nmdc:mga08y16_2031_c1 | nmdc:mga08y16_2031_c1_1008_1970 | 320 |
| 1020 | 3300050511 | nmdc:mga08y16_246771_c1 | nmdc:mga08y16_246771_c1_734_1711 | 320 |
| 1021 | 3300050511 | nmdc:mga08y16_61288_c1 | nmdc:mga08y16_61288_c1_2628_3590 | 320 |
| 1022 | 3300050512 | nmdc:mga0n895_171934_c1 | nmdc:mga0n895_171934_c1_432_1394 | 320 |
| 1023 | 3300050512 | nmdc:mga0n895_5417_c1 | nmdc:mga0n895_5417_c1_1750_2724 | 320 |
| 1024 | 3300050512 | nmdc:mga0n895_8059_c1 | nmdc:mga0n895_8059_c1_379_1341 | 320 |
| 1025 | 3300050513 | nmdc:mga0rr50_102381_c1 | nmdc:mga0rr50_102381_c1_1093_2055 | 320 |
| 1026 | 3300050513 | nmdc:mga0rr50_10240_c1 | nmdc:mga0rr50_10240_c1_3974_4948 | 320 |
| 1027 | 3300050513 | nmdc:mga0rr50_1332_c1 | nmdc:mga0rr50_1332_c1_4338_5312 | 320 |
| 1028 | 3300050513 | nmdc:mga0rr50_158703_c1 | nmdc:mga0rr50_158703_c1_249_1211 | 320 |
| 1029 | 3300050513 | nmdc:mga0rr50_317415_c1 | nmdc:mga0rr50_317415_c1_84_1046 | 320 |
| 1030 | 3300050514 | nmdc:mga08x19_58692_c1 | nmdc:mga08x19_58692_c1_649_1611 | 320 |
| 1031 | 3300050515 | nmdc:mga0a205_30759_c1 | nmdc:mga0a205_30759_c1_650_1624 | 320 |
| 1032 | 3300050515 | nmdc:mga0a205_66835_c1 | nmdc:mga0a205_66835_c1_1943_2989 | 320 |
| 1033 | 3300050515 | nmdc:mga0a205_72932_c1 | nmdc:mga0a205_72932_c1_2105_3067 | 320 |
| 1034 | 3300053077 | Ga0495601_0003707 | Ga0495601_0003707_4235_5197 | 320 |
| 1035 | 3300053077 | Ga0495601_0038284 | Ga0495601_0038284_529_1491 | 320 |
| 1036 | 3300053077 | Ga0495601_0041622 | Ga0495601_0041622_1874_2836 | 320 |
| 1037 | 3300053078 | Ga0495612_0000762 | Ga0495612_0000762_8580_9542 | 320 |
| 1038 | 3300053078 | Ga0495612_0013611 | Ga0495612_0013611_1656_2618 | 320 |
| 1039 | 3300053078 | Ga0495612_0030805 | Ga0495612_0030805_312_1274 | 320 |
| 1040 | 3300053078 | Ga0495612_0046974 | Ga0495612_0046974_537_1499 | 320 |
| 1041 | 3300053083 | Ga0495655_0014475 | Ga0495655_0014475_291_1277 | 320 |
| 1042 | 3300053084 | Ga0495595_0000429 | Ga0495595_0000429_12_974 | 320 |
| 1043 | 3300053084 | Ga0495595_0001679 | Ga0495595_0001679_4010_4972 | 320 |
| 1044 | 3300053084 | Ga0495595_0002216 | Ga0495595_0002216_3773_4735 | 320 |
| 1045 | 3300053084 | Ga0495595_0005618 | Ga0495595_0005618_3764_4726 | 320 |
| 1046 | 3300053085 | Ga0495619_0000043 | Ga0495619_0000043_54524_55486 | 320 |
| 1047 | 3300053085 | Ga0495619_0000551 | Ga0495619_0000551_23833_24795 | 320 |
| 1048 | 3300053085 | Ga0495619_0071319 | Ga0495619_0071319_99_1061 | 320 |
| 1049 | 3300061719 | Ga0466962_0121814 | Ga0466962_0121814_181_1146 | 320 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8hkb-assembly1.cif.gz_A | tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d | 0.9694 | 28 | 320 |
| 5oku-assembly1.cif.gz_A | r. palustris rpa4515 with adipate | 0.9669 | 25 | 319 |
| 2dvz-assembly1.cif.gz_A | structure of a periplasmic transporter | 0.9564 | 25 | 320 |
| 6hke-assembly1.cif.gz_A | matc (rpa3494) from rhodopseudomonas palustris with bound malate | 0.9514 | 25 | 312 |
| 5oku-assembly1.cif.gz_A | r. palustris rpa4515 with adipate | 0.9512 | 25 | 319 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6hkeC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9382 | 124 | 244 | 3.40.190.10 |
| 2dvzA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9336 | 124 | 239 | 3.40.190.10 |
| 2dvzA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 | 0.9329 | 25 | 320 | 3.40.190.150 |
| 4x9tA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9323 | 124 | 239 | 3.40.190.10 |
| 2qpqB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 | 0.9272 | 25 | 320 | 3.40.190.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1J5PQ67-F1-model_v4 | Tripartite tricarboxylate transporter family receptor | 0.9889 | 62 | 319 |
|
| AF-A0A1J5PQ67-F1-model_v4 | Tripartite tricarboxylate transporter family receptor | 0.9813 | 62 | 319 |
|
| AF-A0A2T7SUP8-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9771 | 11 | 320 |
|
| AF-A0A5C8CF86-F1-model_v4 | deleted | 0.9764 | 35 | 320 |
|
| AF-A0A1R0HGB9-F1-model_v4 | deleted | 0.9743 | 22 | 320 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar