F489010

General Info

Members Datasets Scaffolds Average Seq Length
1048 437 990 235

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2904615490|2904624358
Length 282
Sequence QWAAISKQGKVGACAKPKLTRLRPAWAELLTRQVLQLREKITEDTMSNTSQKVVVVTGASQGIGREVVKMFRRLDYRIVATARSIKPSDDANIVTIAGDIGDPATAHRVISEAIARFGRIDTLVNNAGIYIGKPFTEHTVEDYAAVLNVNLSGFYHITQRAIAEMERHSSGHVVSVTASVIDAPRSGVYSVLAALTKGGLNAATKSLAIEYARKGIRVNAVAPGLIKSPMHAPESHEALRTFHPLGRVGEMSDIANAILFLDSAPFITGEILHVDGGLSAGH

Samples

Sample ID Description Type Environment
1 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
2 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
3 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
4 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
5 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
6 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
7 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
8 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
9 2643221647 Streptomyces sp. Root369 Isolate Unclassified
10 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
11 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
12 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
13 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
14 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
15 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
16 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
17 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
18 2818991450 Burkholderia sp. 604 Isolate Unclassified
19 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
20 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
21 2867428634 Streptomyces sp. RP5T Isolate Unclassified
22 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
23 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
24 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
25 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
26 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
27 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
28 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
29 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
30 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
31 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
32 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
33 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
34 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
35 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
36 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
37 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
38 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
39 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
40 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
41 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
42 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
43 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
44 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
45 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
46 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
47 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
48 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
49 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
50 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
51 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
52 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
53 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
55 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
56 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
57 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
58 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
59 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
60 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
61 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
62 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
63 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
64 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
65 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
66 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
67 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
68 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
69 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
70 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
71 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
72 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
73 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
74 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
75 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
76 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
77 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
78 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
79 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
80 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
81 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
82 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
83 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
84 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
85 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
86 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
87 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
88 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
89 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
90 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
91 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
92 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
93 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
94 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
95 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
96 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
97 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
98 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
99 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
100 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
101 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
102 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
103 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
104 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
105 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
106 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
107 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
108 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
109 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
110 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
111 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
112 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
113 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
114 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
115 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
116 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
117 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
118 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
119 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
120 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
121 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
122 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
123 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
124 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
125 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
126 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
127 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
128 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
130 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
131 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
132 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
133 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
134 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
135 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
136 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
137 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
138 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
139 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
140 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
141 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
142 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
143 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
144 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
145 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
146 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
147 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
148 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
149 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
150 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
151 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
152 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
153 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
154 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
155 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
156 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
157 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
158 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
159 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
160 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
161 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
162 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
163 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
164 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
165 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
166 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
167 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
170 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
172 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
173 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
174 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
226 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
227 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
233 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
234 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
235 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
236 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
237 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
240 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
241 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
242 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
243 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
244 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
245 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
246 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
247 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
248 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
249 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
250 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
251 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
252 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
253 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
254 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
255 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
256 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
257 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
258 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
259 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
260 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
261 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
262 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
263 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
264 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
265 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
266 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
267 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
268 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
269 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
270 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
271 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
272 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
273 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
274 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
275 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
276 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
277 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
278 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
279 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
280 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
281 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
282 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
283 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
284 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
285 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
286 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
287 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
288 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
289 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
290 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
291 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
292 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
293 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
294 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
295 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
296 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
297 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
298 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
299 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
300 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
301 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
302 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
303 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
304 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
305 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
306 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
307 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
308 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
309 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
310 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
311 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
312 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
313 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
314 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
315 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
316 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
317 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
318 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
319 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
320 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
321 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
322 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
323 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
324 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
325 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
326 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
327 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
328 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
329 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
330 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
331 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
332 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
333 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
334 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
335 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
336 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
337 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
338 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
339 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
340 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
341 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
342 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
343 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
344 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
345 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
346 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
347 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
348 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
349 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
350 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
351 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
352 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
353 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
354 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
355 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
356 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
357 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
358 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
359 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
360 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
361 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
362 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
363 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
364 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
365 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
366 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
367 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
368 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
369 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
370 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
371 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
372 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
373 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
374 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
375 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
376 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
377 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
378 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
379 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
380 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
381 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
382 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
383 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
384 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
385 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
386 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
387 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
388 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
389 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
390 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
391 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
392 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
393 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
394 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
395 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
396 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
397 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
398 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
399 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
400 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
401 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
402 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
403 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
404 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
405 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
406 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
407 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
408 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
409 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
410 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
411 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
412 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
413 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
414 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
415 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
416 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
417 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
418 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
419 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
420 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
421 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
422 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
423 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
424 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
425 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
426 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
427 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
428 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
429 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
430 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
431 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
432 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
433 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
434 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
435 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
436 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
437 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.27
Metatranscriptomes 0.19
Isolates 5.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.44
Nodule 1.91
Rhizoplane 7.44
Rhizosphere 77.86
Stem 0
Stem Tuber 0
Unclassified 7.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1012632 3300001976 Bacteria 1104
2 JGI24739J22299_10034366 3300001989 Bacteria 1728
3 JGI24743J22301_10024796 3300001991 Bacteria 1160
4 JGI24750J21931_1001413 3300002070 Bacteria 3002
5 JGI24738J21930_10009149 3300002075 Bacteria 2239
6 JGI24744J21845_10002134 3300002077 Bacteria 4015
7 JGI25156J39149_1000390 3300002705 Bacteria 27525
8 JGI25159J45721_1003051 3300002987 Bacteria 6058
9 rootL2_10080295 3300003322 Bacteria 3939
10 JGI25160J50197_1000091 3300003354 Bacteria 90359
11 JGI25160J50197_1004106 3300003354 Bacteria 6345
12 JGI25161J50226_1001682 3300003374 Bacteria 6345
13 JGI25404J52841_10010576 3300003659 Unclassified 1983
14 Ga0055542_1016805 3300003762 Bacteria 1144
15 Ga0055543_1002320 3300004625 Bacteria 6383
16 Ga0065165_1000317 3300005262 Bacteria 78478
17 Ga0065165_1006192 3300005262 Bacteria 6383
18 Ga0065165_1022355 3300005262 Bacteria 2170
19 Ga0065165_1063748 3300005262 Bacteria 1000
20 Ga0070658_10215953 3300005327 Bacteria 1621
21 Ga0070683_100179744 3300005329 Bacteria 2008
22 Ga0070690_100008674 3300005330 Bacteria 5864
23 Ga0068869_100235507 3300005334 Bacteria 1456
24 Ga0068869_100261874 3300005334 Bacteria 1384
25 Ga0070666_10042689 3300005335 Bacteria 3035
26 Ga0070682_100022026 3300005337 Bacteria 3769
27 Ga0070682_100071153 3300005337 Bacteria 2225
28 Ga0070682_100092828 3300005337 Bacteria 1978
29 Ga0070682_100197392 3300005337 Bacteria 1417
30 Ga0068868_100030498 3300005338 Bacteria 4135
31 Ga0070689_100252078 3300005340 Bacteria 1456
32 Ga0070691_10002933 3300005341 Bacteria 7646
33 Ga0070691_10113504 3300005341 Bacteria 1357
34 Ga0070687_100061247 3300005343 Bacteria 1989
35 Ga0070661_100192188 3300005344 Bacteria 1557
36 Ga0070661_100205666 3300005344 Bacteria 1505
37 Ga0070668_100001887 3300005347 Bacteria 15322
38 Ga0070668_100029574 3300005347 Bacteria 4161
39 Ga0070669_100051760 3300005353 Bacteria 3003
40 Ga0070669_100357970 3300005353 Bacteria 1186
41 Ga0070675_100215334 3300005354 Bacteria 1671
42 Ga0070671_100211647 3300005355 Bacteria 1644
43 Ga0070671_100297658 3300005355 Bacteria 1374
44 Ga0070674_100003900 3300005356 Bacteria 8445
45 Ga0070674_100089658 3300005356 Bacteria 2216
46 Ga0070688_100022220 3300005365 Bacteria 3713
47 Ga0070667_100000752 3300005367 Bacteria 30896
48 Ga0070667_100070868 3300005367 Bacteria 2968
49 Ga0070667_100097230 3300005367 Bacteria 2540
50 Ga0070667_100251782 3300005367 Bacteria 1579
51 Ga0070703_10018005 3300005406 Bacteria 2039
52 Ga0070709_10000720 3300005434 Bacteria 18720
53 Ga0070709_10009975 3300005434 Bacteria 5251
54 Ga0070709_10019264 3300005434 Bacteria 3942
55 Ga0070709_10057400 3300005434 Bacteria 2466
56 Ga0070709_10267430 3300005434 Bacteria 1238
57 Ga0070714_100007241 3300005435 Bacteria 8619
58 Ga0070714_100065817 3300005435 Bacteria 3122
59 Ga0070714_100077810 3300005435 Bacteria 2882
60 Ga0070714_100129182 3300005435 Bacteria 2257
61 Ga0070714_100472918 3300005435 Bacteria 1193
62 Ga0070713_100005323 3300005436 Bacteria 8780
63 Ga0070713_100349902 3300005436 Bacteria 1371
64 Ga0070713_100889101 3300005436 Bacteria 856
65 Ga0070710_10000771 3300005437 Bacteria 15308
66 Ga0070710_10006769 3300005437 Bacteria 5527
67 Ga0070710_10019664 3300005437 Bacteria 3493
68 Ga0070710_10165718 3300005437 Bacteria 1373
69 Ga0070701_10006164 3300005438 Bacteria 5028
70 Ga0070701_10054558 3300005438 Bacteria 2084
71 Ga0070711_100008402 3300005439 Bacteria 6323
72 Ga0070711_100012929 3300005439 Bacteria 5231
73 Ga0070711_100015606 3300005439 Bacteria 4809
74 Ga0070711_100442503 3300005439 Bacteria 1063
75 Ga0070705_100048453 3300005440 Bacteria 2461
76 Ga0070705_100062581 3300005440 Bacteria 2216
77 Ga0070705_100103227 3300005440 Bacteria 1805
78 Ga0070700_100000263 3300005441 Bacteria 28075
79 Ga0070694_100092881 3300005444 Bacteria 2120
80 Ga0070708_100188849 3300005445 Bacteria 1927
81 Ga0070708_100343899 3300005445 Bacteria 1405
82 Ga0070708_100381784 3300005445 Bacteria 1328
83 Ga0070663_100013973 3300005455 Bacteria 5140
84 Ga0070663_100014385 3300005455 Bacteria 5080
85 Ga0070678_100000712 3300005456 Bacteria 16488
86 Ga0070678_100148787 3300005456 Bacteria 1884
87 Ga0070662_100025103 3300005457 Bacteria 4113
88 Ga0068867_100000537 3300005459 Bacteria 24926
89 Ga0070685_10457616 3300005466 Bacteria 895
90 Ga0070706_100005492 3300005467 Bacteria 12069
91 Ga0070706_100232154 3300005467 Bacteria 1722
92 Ga0070706_100313442 3300005467 Bacteria 1463
93 Ga0070706_100471130 3300005467 Bacteria 1168
94 Ga0070707_100240923 3300005468 Bacteria 1760
95 Ga0070707_100542355 3300005468 Bacteria 1125
96 Ga0070698_100000710 3300005471 Bacteria 35637
97 Ga0070698_100007439 3300005471 Bacteria 11850
98 Ga0070698_100102574 3300005471 Bacteria 2831
99 Ga0070698_100108012 3300005471 Bacteria 2750
100 Ga0070684_100878302 3300005535 Bacteria 840
101 Ga0068853_100001294 3300005539 Bacteria 17970
102 Ga0068853_100196409 3300005539 Bacteria 1835
103 Ga0068853_100653803 3300005539 Bacteria 1001
104 Ga0070686_100057786 3300005544 Bacteria 2493
105 Ga0070696_100034286 3300005546 Bacteria 3491
106 Ga0070696_100147741 3300005546 Bacteria 1723
107 Ga0070693_100001778 3300005547 Bacteria 9827
108 Ga0070693_100013088 3300005547 Bacteria 4217
109 Ga0070665_100039971 3300005548 Bacteria 4716
110 Ga0070665_100121461 3300005548 Bacteria 2614
111 Ga0070665_100305012 3300005548 Bacteria 1595
112 Ga0068855_100149036 3300005563 Bacteria 2661
113 Ga0068854_100001607 3300005578 Bacteria 13732
114 Ga0068854_100058562 3300005578 Bacteria 2781
115 Ga0068856_100113940 3300005614 Bacteria 2703
116 Ga0070702_100004815 3300005615 Bacteria 6204
117 Ga0070702_100076938 3300005615 Bacteria 1987
118 Ga0068852_100064699 3300005616 Bacteria 3188
119 Ga0068852_100300126 3300005616 Bacteria 1554
120 Ga0068852_100322707 3300005616 Bacteria 1500
121 Ga0068852_100439637 3300005616 Bacteria 1289
122 Ga0068859_100001155 3300005617 Bacteria 26941
123 Ga0068859_100097799 3300005617 Bacteria 2988
124 Ga0068864_100116384 3300005618 Bacteria 2385
125 Ga0068866_10000629 3300005718 Bacteria 16020
126 Ga0068861_100000739 3300005719 Bacteria 19591
127 Ga0068863_100342979 3300005841 Bacteria 1453
128 Ga0068863_100438055 3300005841 Bacteria 1281
129 Ga0068858_100002363 3300005842 Bacteria 19075
130 Ga0068858_100096458 3300005842 Bacteria 2755
131 Ga0068860_100002272 3300005843 Bacteria 20190
132 Ga0068862_100017092 3300005844 Bacteria 6036
133 Ga0068862_100066778 3300005844 Bacteria 3100
134 Ga0081455_10019810 3300005937 Bacteria 6354
135 Ga0081540_1007347 3300005983 Bacteria 7877
136 Ga0081540_1018789 3300005983 Bacteria 4226
137 Ga0070717_10000133 3300006028 Bacteria 54960
138 Ga0070717_10480636 3300006028 Bacteria 1121
139 Ga0075365_10020751 3300006038 Bacteria 4080
140 Ga0075365_10054713 3300006038 Bacteria 2647
141 Ga0075365_10073961 3300006038 Bacteria 2297
142 Ga0075368_10057033 3300006042 Bacteria 1559
143 Ga0075363_100048051 3300006048 Bacteria 2268
144 Ga0075364_10001086 3300006051 Bacteria 14506
145 Ga0075364_10083360 3300006051 Bacteria 2116
146 Ga0070715_10001936 3300006163 Bacteria 6228
147 Ga0070715_10010676 3300006163 Bacteria 3281
148 Ga0070715_10021195 3300006163 Bacteria 2517
149 Ga0070716_100000613 3300006173 Bacteria 15075
150 Ga0070716_100243012 3300006173 Bacteria 1222
151 Ga0070712_100000495 3300006175 Bacteria 22525
152 Ga0070712_100007327 3300006175 Bacteria 6886
153 Ga0070712_100018654 3300006175 Bacteria 4511
154 Ga0070712_100092291 3300006175 Bacteria 2220
155 Ga0070712_100285645 3300006175 Bacteria 1330
156 Ga0070712_100297599 3300006175 Bacteria 1305
157 Ga0075367_10019338 3300006178 Bacteria 3776
158 Ga0075367_10105774 3300006178 Bacteria 1723
159 Ga0097621_100128797 3300006237 Bacteria 2152
160 Ga0075428_100306566 3300006844 Bacteria 1707
161 Ga0068865_100000670 3300006881 Bacteria 19290
162 Ga0075436_100216038 3300006914 Bacteria 1360
163 Ga0097620_100001155 3300006931 Bacteria 26941
164 Ga0097620_100097812 3300006931 Bacteria 2988
165 Ga0099826_10192256 3300006948 Bacteria 1125
166 Ga0075435_100199880 3300007076 Bacteria 1693
167 Ga0099794_10004935 3300007265 Bacteria 5306
168 Ga0099795_10000607 3300007788 Bacteria 6872
169 Ga0099795_10058501 3300007788 Bacteria 1423
170 Ga0105251_10000085 3300009011 Bacteria 89249
171 Ga0105251_10038544 3300009011 Bacteria 2340
172 Ga0105250_10043917 3300009092 Bacteria 1792
173 Ga0105240_10003464 3300009093 Bacteria 24478
174 Ga0105240_10071028 3300009093 Bacteria 4306
175 Ga0105240_10116529 3300009093 Bacteria 3222
176 Ga0105245_10003258 3300009098 Bacteria 14558
177 Ga0105245_10008425 3300009098 Bacteria 9005
178 Ga0105245_10024489 3300009098 Bacteria 5300
179 Ga0105245_10048836 3300009098 Bacteria 3787
180 Ga0105245_10318533 3300009098 Bacteria 1531
181 Ga0105247_10360071 3300009101 Bacteria 1025
182 Ga0105247_10434617 3300009101 Bacteria 943
183 Ga0105243_10051314 3300009148 Bacteria 3262
184 Ga0105243_10172160 3300009148 Bacteria 1876
185 Ga0105241_10025006 3300009174 Bacteria 4437
186 Ga0105241_10076984 3300009174 Bacteria 2603
187 Ga0105242_10177454 3300009176 Bacteria 1877
188 Ga0105242_10331151 3300009176 Bacteria 1400
189 Ga0105248_10283684 3300009177 Bacteria 1864
190 Ga0105248_10301804 3300009177 Bacteria 1803
191 Ga0105248_10676273 3300009177 Bacteria 1165
192 Ga0105248_11313376 3300009177 Bacteria 818
193 Ga0105237_10754138 3300009545 Bacteria 980
194 Ga0105238_10284922 3300009551 Bacteria 1634
195 Ga0105249_10006646 3300009553 Bacteria 10064
196 Ga0105249_10097458 3300009553 Bacteria 2760
197 Ga0105249_10263450 3300009553 Bacteria 1714
198 Ga0099796_10001405 3300010159 Bacteria 4824
199 Ga0105239_10053958 3300010375 Bacteria 4408
200 Ga0105239_10084668 3300010375 Bacteria 3493
201 Ga0105239_10224269 3300010375 Bacteria 2108
202 Ga0105239_10255673 3300010375 Bacteria 1968
203 Ga0105239_10801024 3300010375 Bacteria 1079
204 Ga0105246_10178427 3300011119 Bacteria 1633
205 Ga0157373_10108422 3300013100 Bacteria 1952
206 Ga0157371_10144150 3300013102 Bacteria 1697
207 Ga0157371_10502724 3300013102 Bacteria 895
208 Ga0157369_10136993 3300013105 Bacteria 2591
209 Ga0157369_10472705 3300013105 Bacteria 1297
210 Ga0157374_10111080 3300013296 Bacteria 2637
211 Ga0157374_10331042 3300013296 Bacteria 1511
212 Ga0157378_10066625 3300013297 Bacteria 3226
213 Ga0163162_10125638 3300013306 Bacteria 2671
214 Ga0163162_10242903 3300013306 Bacteria 1932
215 Ga0163162_10250430 3300013306 Bacteria 1903
216 Ga0157372_10444023 3300013307 Bacteria 1512
217 Ga0157375_10415587 3300013308 Bacteria 1511
218 Ga0163163_10053434 3300014325 Bacteria 3987
219 Ga0163163_10151941 3300014325 Bacteria 2359
220 Ga0163163_10178396 3300014325 Bacteria 2171
221 Ga0157380_10713002 3300014326 Bacteria 1010
222 Ga0157377_10021133 3300014745 Bacteria 3420
223 Ga0157377_10035664 3300014745 Bacteria 2730
224 Ga0157377_10141790 3300014745 Bacteria 1477
225 Ga0157379_10347831 3300014968 Bacteria 1357
226 Ga0157376_10183523 3300014969 Bacteria 1914
227 Ga0182007_10000576 3300015262 Bacteria 21613
228 Ga0163161_10000520 3300017792 Bacteria 31388
229 Ga0163161_10026064 3300017792 Bacteria 4141
230 Ga0163161_10079658 3300017792 Bacteria 2409
231 Ga0163161_10148005 3300017792 Bacteria 1783
232 Ga0213872_10018642 3300021361 Bacteria 3199
233 Ga0213874_10124173 3300021377 Bacteria 880
234 Ga0213875_10000581 3300021388 Bacteria 29658
235 Ga0228598_1008076 3300024227 Bacteria 2133
236 Ga0209258_104825 3300025242 Bacteria 2442
237 Ga0209148_1000480 3300025254 Bacteria 42052
238 Ga0209759_1000077 3300025256 Bacteria 175706
239 Ga0209455_1000604 3300025272 Bacteria 22805
240 Ga0209130_1001098 3300025284 Bacteria 20094
241 Ga0209130_1017193 3300025284 Bacteria 1730
242 Ga0209025_1001325 3300025294 Bacteria 33510
243 Ga0207426_1000004 3300025302 Bacteria 1047900
244 Ga0207426_1000158 3300025302 Bacteria 177323
245 Ga0207426_1001300 3300025302 Bacteria 21462
246 Ga0207713_1001373 3300025735 Bacteria 19794
247 Ga0207653_10012826 3300025885 Bacteria 2621
248 Ga0207692_10002318 3300025898 Bacteria 7314
249 Ga0207692_10004147 3300025898 Bacteria 5718
250 Ga0207692_10052439 3300025898 Bacteria 2073
251 Ga0207692_10104506 3300025898 Bacteria 1561
252 Ga0207688_10001068 3300025901 Bacteria 14029
253 Ga0207680_10062490 3300025903 Bacteria 2275
254 Ga0207680_10080712 3300025903 Bacteria 2043
255 Ga0207647_10009742 3300025904 Bacteria 6817
256 Ga0207647_10017088 3300025904 Bacteria 4939
257 Ga0207647_10066218 3300025904 Bacteria 2191
258 Ga0207685_10027551 3300025905 Bacteria 1990
259 Ga0207699_10006367 3300025906 Bacteria 5709
260 Ga0207699_10059031 3300025906 Bacteria 2298
261 Ga0207699_10067163 3300025906 Bacteria 2179
262 Ga0207699_10204423 3300025906 Bacteria 1340
263 Ga0207699_10225207 3300025906 Bacteria 1282
264 Ga0207645_10049352 3300025907 Bacteria 2687
265 Ga0207645_10212328 3300025907 Bacteria 1275
266 Ga0207643_10013681 3300025908 Bacteria 4399
267 Ga0207684_10242680 3300025910 Bacteria 1554
268 Ga0207684_10308741 3300025910 Bacteria 1364
269 Ga0207654_10215395 3300025911 Bacteria 1271
270 Ga0207695_10002566 3300025913 Bacteria 26692
271 Ga0207695_10155254 3300025913 Bacteria 2224
272 Ga0207695_10439579 3300025913 Bacteria 1188
273 Ga0207693_10000660 3300025915 Bacteria 30957
274 Ga0207693_10007199 3300025915 Bacteria 9164
275 Ga0207693_10011311 3300025915 Bacteria 7225
276 Ga0207693_10034284 3300025915 Bacteria 4004
277 Ga0207693_10201086 3300025915 Bacteria 1567
278 Ga0207693_10299414 3300025915 Bacteria 1260
279 Ga0207693_10682345 3300025915 Bacteria 796
280 Ga0207663_10010988 3300025916 Bacteria 4840
281 Ga0207663_10013686 3300025916 Bacteria 4417
282 Ga0207663_10030188 3300025916 Bacteria 3194
283 Ga0207663_10389712 3300025916 Bacteria 1063
284 Ga0207662_10021583 3300025918 Bacteria 3683
285 Ga0207649_10102098 3300025920 Bacteria 1900
286 Ga0207646_10269263 3300025922 Bacteria 1540
287 Ga0207694_10104675 3300025924 Bacteria 2246
288 Ga0207659_10711254 3300025926 Bacteria 860
289 Ga0207687_10006483 3300025927 Bacteria 7728
290 Ga0207687_10039391 3300025927 Bacteria 3235
291 Ga0207687_10044734 3300025927 Bacteria 3057
292 Ga0207687_10086617 3300025927 Bacteria 2275
293 Ga0207687_10393208 3300025927 Bacteria 1139
294 Ga0207700_10000057 3300025928 Bacteria 71098
295 Ga0207700_10104821 3300025928 Bacteria 2263
296 Ga0207700_10271770 3300025928 Bacteria 1455
297 Ga0207700_10571188 3300025928 Bacteria 1005
298 Ga0207664_10000763 3300025929 Bacteria 21844
299 Ga0207664_10006691 3300025929 Bacteria 7951
300 Ga0207664_10046291 3300025929 Bacteria 3414
301 Ga0207664_10142175 3300025929 Bacteria 2031
302 Ga0207664_10149634 3300025929 Bacteria 1982
303 Ga0207664_10266111 3300025929 Bacteria 1501
304 Ga0207644_10149525 3300025931 Bacteria 1806
305 Ga0207644_10326064 3300025931 Bacteria 1242
306 Ga0207690_10022446 3300025932 Bacteria 3927
307 Ga0207706_10011539 3300025933 Bacteria 8046
308 Ga0207706_10067450 3300025933 Bacteria 3147
309 Ga0207706_10351306 3300025933 Bacteria 1282
310 Ga0207686_10001835 3300025934 Bacteria 11817
311 Ga0207686_10428263 3300025934 Bacteria 1013
312 Ga0207709_10002099 3300025935 Bacteria 12841
313 Ga0207709_10041636 3300025935 Bacteria 2758
314 Ga0207709_10045428 3300025935 Bacteria 2660
315 Ga0207709_10394598 3300025935 Bacteria 1056
316 Ga0207669_10000218 3300025937 Bacteria 26144
317 Ga0207704_10000179 3300025938 Bacteria 33399
318 Ga0207665_10009061 3300025939 Bacteria 6533
319 Ga0207665_10019328 3300025939 Bacteria 4478
320 Ga0207665_10071923 3300025939 Bacteria 2362
321 Ga0207711_10364335 3300025941 Bacteria 1339
322 Ga0207689_10049736 3300025942 Bacteria 3458
323 Ga0207689_10103585 3300025942 Bacteria 2338
324 Ga0207661_10100823 3300025944 Bacteria 2424
325 Ga0207661_10316090 3300025944 Bacteria 1403
326 Ga0207679_10104168 3300025945 Bacteria 2225
327 Ga0207679_10194848 3300025945 Bacteria 1688
328 Ga0207651_10111139 3300025960 Bacteria 2057
329 Ga0207712_10141128 3300025961 Bacteria 1849
330 Ga0207712_10505561 3300025961 Bacteria 1034
331 Ga0207668_10002863 3300025972 Bacteria 10113
332 Ga0207640_10818371 3300025981 Bacteria 808
333 Ga0207658_10006956 3300025986 Bacteria 7702
334 Ga0207658_10171487 3300025986 Bacteria 1788
335 Ga0207658_10562444 3300025986 Bacteria 1021
336 Ga0207677_10031401 3300026023 Bacteria 3401
337 Ga0207677_10135312 3300026023 Bacteria 1878
338 Ga0207703_10002619 3300026035 Bacteria 15524
339 Ga0207703_10118434 3300026035 Bacteria 2270
340 Ga0207639_10173375 3300026041 Bacteria 1829
341 Ga0207678_10007543 3300026067 Bacteria 9615
342 Ga0207678_10026101 3300026067 Bacteria 5097
343 Ga0207708_10000787 3300026075 Bacteria 23921
344 Ga0207708_10479755 3300026075 Bacteria 1039
345 Ga0207641_10124293 3300026088 Bacteria 2307
346 Ga0207641_10127427 3300026088 Bacteria 2281
347 Ga0207641_10556957 3300026088 Bacteria 1118
348 Ga0207648_10001756 3300026089 Bacteria 23738
349 Ga0207648_10071777 3300026089 Bacteria 3017
350 Ga0207648_10086352 3300026089 Bacteria 2737
351 Ga0207648_10274966 3300026089 Bacteria 1505
352 Ga0207676_10045875 3300026095 Bacteria 3379
353 Ga0207676_10330023 3300026095 Bacteria 1403
354 Ga0207674_10080197 3300026116 Bacteria 3267
355 Ga0207675_100003125 3300026118 Bacteria 16240
356 Ga0207683_10000990 3300026121 Bacteria 26040
357 Ga0207683_10120202 3300026121 Bacteria 2358
358 Ga0209589_1000399 3300027357 Bacteria 59143
359 Ga0209489_100724 3300027361 Bacteria 64817
360 Ga0209179_1000955 3300027512 Bacteria 3277
361 Ga0209588_1001592 3300027671 Bacteria 5971
362 Ga0268266_10093888 3300028379 Bacteria 2633
363 Ga0268266_10165609 3300028379 Bacteria 2002
364 Ga0268266_10172322 3300028379 Bacteria 1965
365 Ga0268266_10262763 3300028379 Bacteria 1600
366 Ga0268266_10312123 3300028379 Bacteria 1470
367 Ga0268266_10398842 3300028379 Bacteria 1300
368 Ga0268265_10061372 3300028380 Bacteria 2884
369 Ga0268264_10002402 3300028381 Bacteria 16495
370 Ga0268264_10029721 3300028381 Bacteria 4479
371 Ga0307517_10010937 3300028786 Bacteria 12636
372 Ga0307515_10000262 3300028794 Bacteria 130525
373 Ga0265338_10093020 3300028800 Bacteria 2485
374 Ga0265338_10105408 3300028800 Bacteria 2285
375 Ga0307511_10001720 3300030521 Bacteria 23047
376 Ga0307512_10091341 3300030522 Bacteria 2118
377 Ga0265763_1008822 3300030763 Bacteria 907
378 Ga0265760_10098872 3300031090 Bacteria 921
379 Ga0307509_10006504 3300031507 Bacteria 15684
380 Ga0307509_10125480 3300031507 Bacteria 2534
381 Ga0307509_10251429 3300031507 Bacteria 1551
382 Ga0307508_10008814 3300031616 Bacteria 9306
383 Ga0307508_10018468 3300031616 Bacteria 6336
384 Ga0307508_10040471 3300031616 Bacteria 4184
385 Ga0265342_10207281 3300031712 Bacteria 1062
386 Ga0307516_10002271 3300031730 Bacteria 25921
387 Ga0307516_10037265 3300031730 Bacteria 4863
388 Ga0307518_10028846 3300031838 Bacteria 4009
389 Ga0307518_10053586 3300031838 Bacteria 2931
390 Ga0307518_10271255 3300031838 Bacteria 1059
391 Ga0307410_10389123 3300031852 Bacteria 1124
392 Ga0307412_10348620 3300031911 Bacteria 1188
393 Ga0307409_100106882 3300031995 Bacteria 2337
394 Ga0307507_10014440 3300033179 Bacteria 9417
395 Ga0307510_10249234 3300033180 Bacteria 1265
396 Ga0373948_0044771 3300034817 Bacteria 936
397 Ga0373958_0007049 3300034819 Bacteria 1776
398 Ga0373926_0001220 3300035083 Bacteria 7729
399 Ga0373926_0070833 3300035083 Bacteria 1281
400 Ga0373934_0004960 3300035086 Bacteria 4933
401 Ga0373934_0008907 3300035086 Bacteria 3750
402 Ga0373944_0001982 3300035089 Bacteria 5183
403 Ga0373951_0015400 3300035091 Bacteria 1722
404 Ga0373952_0021177 3300035092 Bacteria 1371
405 Ga0373923_0042529 3300035111 Bacteria 1877
406 Ga0373932_0048197 3300035112 Bacteria 1255
407 Ga0373936_0003112 3300035113 Bacteria 6212
408 Ga0373936_0003822 3300035113 Bacteria 5670
409 Ga0373936_0171079 3300035113 Bacteria 950
410 Ga0373941_0012172 3300035115 Bacteria 2243
411 Ga0373945_0013496 3300035116 Bacteria 2728
412 Ga0373953_0018435 3300035117 Bacteria 2583
413 Ga0373953_0022413 3300035117 Bacteria 2381
414 Ga0373954_0005554 3300035118 Bacteria 5461
415 Ga0373954_0088703 3300035118 Bacteria 1483
416 Ga0373954_0313266 3300035118 Bacteria 774
417 Ga0373956_0015364 3300035119 Bacteria 3204
418 Ga0373956_0036895 3300035119 Bacteria 2159
419 Ga0373957_0063104 3300035120 Bacteria 1438
420 Ga0373943_0015748 3300035170 Bacteria 3438
421 Ga0373946_0001302 3300035171 Bacteria 8629
422 Ga0373955_0001663 3300035172 Bacteria 9499
423 Ga0373955_0008149 3300035172 Bacteria 4849
424 Ga0373955_0058866 3300035172 Bacteria 2114
425 Ga0373955_0058950 3300035172 Bacteria 2113
426 Ga0373924_0001061 3300035410 Bacteria 8768
427 Ga0373924_0010280 3300035410 Bacteria 3444
428 Ga0373931_0104520 3300035691 Bacteria 1597
429 Ga0373935_0067629 3300035692 Bacteria 2297
430 Ga0373927_0311564 3300035695 Bacteria 1036
431 Ga0373933_0003649 3300035724 Bacteria 8526
432 Ga0373933_0014869 3300035724 Bacteria 4332
433 Ga0373933_0339844 3300035724 Bacteria 974
434 Ga0373933_0368649 3300035724 Bacteria 934
435 Ga0373947_0013077 3300035725 Bacteria 4757
436 Ga0373947_0297228 3300035725 Bacteria 1076
437 Ga0373937_0038642 3300036401 Bacteria 4349
438 Ga0373937_0142161 3300036401 Bacteria 2245
439 Ga0373937_0182203 3300036401 Bacteria 1972
440 Ga0373937_0500507 3300036401 Bacteria 1154
441 Ga0373925_0000356 3300037068 Bacteria 47640
442 Ga0373925_0006764 3300037068 Bacteria 8405
443 Ga0373925_0007590 3300037068 Bacteria 7899
444 Ga0373925_0022582 3300037068 Bacteria 4590
445 Ga0395899_0043785 3300037312 Bacteria 3337
446 Ga0395899_0259358 3300037312 Bacteria 1190
447 Ga0395900_0013353 3300037418 Bacteria 8395
448 Ga0395900_0093869 3300037418 Bacteria 3082
449 Ga0395898_0018741 3300037466 Bacteria 7054
450 Ga0395905_0130272 3300037471 Bacteria 2366
451 Ga0395905_0133592 3300037471 Bacteria 2334
452 Ga0395905_0178201 3300037471 Bacteria 1995
453 Ga0436364_0658848 3300037853 Bacteria 108122
454 Ga0436364_1281027 3300037853 Bacteria 2205
455 Ga0395901_0000040 3300038443 Bacteria 204677
456 Ga0395901_0100216 3300038443 Bacteria 3038
457 Ga0436360_0953330 3300039438 Bacteria 6374
458 Ga0436361_0056336 3300039447 Bacteria 32352
459 Ga0436361_1097664 3300039447 Bacteria 2289
460 Ga0436362_0083406 3300039453 Bacteria 972
461 Ga0436362_1279733 3300039453 Bacteria 1800
462 Ga0439436_0047539 3300041404 Bacteria 1218
463 Ga0451577_0134018 3300042876 Bacteria 2223
464 Ga0466972_0051034 3300044658 Bacteria 1996
465 Ga0453683_0032373 3300044673 Bacteria 3299
466 Ga0466966_0021132 3300044684 Bacteria 4274
467 Ga0466963_0002809 3300044694 Bacteria 9815
468 Ga0453684_0215598 3300044712 Bacteria 2227
469 Ga0466958_0078574 3300045836 Bacteria 2028
470 Ga0466967_0141552 3300045976 Bacteria 2241
471 Ga0495617_000076 3300046452 Bacteria 77876
472 Ga0495592_0012171 3300046454 Bacteria 6529
473 Ga0495592_0025810 3300046454 Bacteria 4460
474 Ga0495592_0130129 3300046454 Bacteria 1761
475 Ga0495592_0170918 3300046454 Bacteria 1488
476 Ga0495592_0182495 3300046454 Bacteria 1428
477 Ga0495592_0240060 3300046454 Bacteria 1203
478 Ga0495603_0003485 3300046455 Bacteria 9357
479 Ga0495603_0263202 3300046455 Bacteria 992
480 Ga0495590_0030089 3300046457 Bacteria 1902
481 Ga0495629_0000096 3300046459 Bacteria 76541
482 Ga0495629_0000115 3300046459 Bacteria 72648
483 Ga0495629_0000212 3300046459 Bacteria 52191
484 Ga0495629_0003036 3300046459 Bacteria 12761
485 Ga0495629_0006134 3300046459 Bacteria 8928
486 Ga0495629_0007439 3300046459 Bacteria 8065
487 Ga0495629_0009629 3300046459 Bacteria 7057
488 Ga0495629_0010882 3300046459 Bacteria 6615
489 Ga0495629_0015811 3300046459 Bacteria 5419
490 Ga0495629_0080429 3300046459 Bacteria 2275
491 Ga0495629_0090466 3300046459 Bacteria 2135
492 Ga0495629_0152283 3300046459 Bacteria 1607
493 Ga0495638_0027234 3300046460 Bacteria 3701
494 Ga0495638_0106309 3300046460 Bacteria 1672
495 Ga0495641_0012844 3300046461 Bacteria 4649
496 Ga0495641_0024166 3300046461 Bacteria 3003
497 Ga0495651_0004947 3300046462 Bacteria 10182
498 Ga0495651_0026690 3300046462 Bacteria 4497
499 Ga0495651_0051177 3300046462 Bacteria 3186
500 Ga0495651_0056803 3300046462 Bacteria 3006
501 Ga0495651_0081505 3300046462 Bacteria 2442
502 Ga0495651_0085694 3300046462 Bacteria 2372
503 Ga0495653_0000758 3300046463 Bacteria 24734
504 Ga0495653_0001028 3300046463 Bacteria 21502
505 Ga0495653_0017059 3300046463 Bacteria 5907
506 Ga0495653_0028278 3300046463 Bacteria 4483
507 Ga0495653_0030050 3300046463 Bacteria 4332
508 Ga0495653_0044277 3300046463 Bacteria 3454
509 Ga0495653_0054011 3300046463 Bacteria 3071
510 Ga0495650_0000381 3300046471 Bacteria 76364
511 Ga0495650_0059390 3300046471 Bacteria 1540
512 Ga0495580_0000419 3300046472 Bacteria 35257
513 Ga0495580_0000778 3300046472 Bacteria 27449
514 Ga0495580_0001707 3300046472 Bacteria 19290
515 Ga0495580_0002281 3300046472 Bacteria 16741
516 Ga0495580_0003210 3300046472 Bacteria 14000
517 Ga0495580_0005083 3300046472 Bacteria 10959
518 Ga0495580_0007991 3300046472 Bacteria 8453
519 Ga0495580_0013903 3300046472 Bacteria 6127
520 Ga0495580_0016823 3300046472 Bacteria 5486
521 Ga0495580_0017866 3300046472 Bacteria 5290
522 Ga0495580_0060764 3300046472 Bacteria 2654
523 Ga0495580_0083237 3300046472 Bacteria 2230
524 Ga0495580_0113618 3300046472 Bacteria 1881
525 Ga0495582_0000907 3300046473 Bacteria 16487
526 Ga0495582_0043056 3300046473 Bacteria 2486
527 Ga0495582_0093040 3300046473 Bacteria 1682
528 Ga0495605_0003284 3300046474 Bacteria 9693
529 Ga0495605_0014648 3300046474 Bacteria 4287
530 Ga0495605_0029934 3300046474 Bacteria 2796
531 Ga0495639_0045956 3300046475 Bacteria 1976
532 Ga0495662_0004199 3300046476 Bacteria 7255
533 Ga0495662_0069940 3300046476 Bacteria 1700
534 Ga0495664_0020804 3300046477 Bacteria 3787
535 Ga0495664_0031579 3300046477 Bacteria 3106
536 Ga0495664_0087725 3300046477 Bacteria 1869
537 Ga0495664_0145195 3300046477 Bacteria 1438
538 Ga0495664_0179700 3300046477 Bacteria 1283
539 Ga0495664_0296435 3300046477 Bacteria 976
540 Ga0495584_0208137 3300046491 Bacteria 994
541 Ga0495585_0016913 3300046492 Bacteria 4224
542 Ga0495594_0034844 3300046499 Bacteria 2740
543 Ga0495594_0071898 3300046499 Bacteria 1924
544 Ga0495594_0073590 3300046499 Bacteria 1902
545 Ga0495594_0272794 3300046499 Bacteria 964
546 Ga0495607_0077238 3300046501 Bacteria 1840
547 Ga0495607_0095292 3300046501 Bacteria 1604
548 Ga0495583_0004535 3300046506 Bacteria 9889
549 Ga0495583_0009334 3300046506 Bacteria 5872
550 Ga0495583_0009898 3300046506 Bacteria 5638
551 Ga0495583_0012477 3300046506 Bacteria 4804
552 Ga0495583_0058614 3300046506 Bacteria 1728
553 Ga0495606_0000203 3300046507 Bacteria 103887
554 Ga0495606_0000692 3300046507 Bacteria 52383
555 Ga0495606_0001032 3300046507 Bacteria 40368
556 Ga0495606_0009353 3300046507 Bacteria 8301
557 Ga0495606_0044799 3300046507 Bacteria 2939
558 Ga0495606_0106311 3300046507 Bacteria 1699
559 Ga0495608_0006951 3300046511 Bacteria 8011
560 Ga0495608_0032001 3300046511 Bacteria 3555
561 Ga0495608_0141641 3300046511 Bacteria 1534
562 Ga0495610_0011552 3300046512 Bacteria 5389
563 Ga0495616_0000116 3300046513 Bacteria 70266
564 Ga0495616_0129447 3300046513 Bacteria 1158
565 Ga0495618_0005709 3300046514 Bacteria 7563
566 Ga0495618_0025527 3300046514 Bacteria 3668
567 Ga0495618_0029626 3300046514 Bacteria 3415
568 Ga0495618_0042585 3300046514 Bacteria 2862
569 Ga0495618_0057352 3300046514 Bacteria 2466
570 Ga0495618_0129525 3300046514 Bacteria 1614
571 Ga0495620_0002388 3300046515 Bacteria 10881
572 Ga0495620_0010623 3300046515 Bacteria 4848
573 Ga0495628_0004687 3300046516 Bacteria 12063
574 Ga0495628_0029156 3300046516 Bacteria 4478
575 Ga0495628_0032687 3300046516 Bacteria 4198
576 Ga0495628_0036053 3300046516 Bacteria 3972
577 Ga0495628_0038761 3300046516 Bacteria 3812
578 Ga0495628_0049761 3300046516 Bacteria 3317
579 Ga0495628_0133538 3300046516 Bacteria 1898
580 Ga0495628_0192709 3300046516 Bacteria 1538
581 Ga0495628_0236420 3300046516 Bacteria 1368
582 Ga0495628_0612997 3300046516 Bacteria 776
583 Ga0495630_0009808 3300046517 Bacteria 6894
584 Ga0495630_0018598 3300046517 Bacteria 5106
585 Ga0495630_0027118 3300046517 Bacteria 4246
586 Ga0495630_0037973 3300046517 Bacteria 3601
587 Ga0495630_0039716 3300046517 Bacteria 3518
588 Ga0495630_0164729 3300046517 Bacteria 1688
589 Ga0495630_0231582 3300046517 Bacteria 1411
590 Ga0495631_0000069 3300046518 Bacteria 64689
591 Ga0495632_0060074 3300046519 Bacteria 1848
592 Ga0495648_0006147 3300046524 Bacteria 9842
593 Ga0495648_0007831 3300046524 Bacteria 8501
594 Ga0495648_0008817 3300046524 Bacteria 7890
595 Ga0495648_0019853 3300046524 Bacteria 4705
596 Ga0495648_0027844 3300046524 Bacteria 3775
597 Ga0495648_0038688 3300046524 Bacteria 3046
598 Ga0495648_0060329 3300046524 Bacteria 2257
599 Ga0495648_0061874 3300046524 Bacteria 2220
600 Ga0495666_0004629 3300046526 Bacteria 6955
601 Ga0495666_0050392 3300046526 Bacteria 2001
602 Ga0495642_0026693 3300046528 Bacteria 2295
603 Ga0495652_0007447 3300046529 Bacteria 10088
604 Ga0495652_0027329 3300046529 Bacteria 5027
605 Ga0495652_0031835 3300046529 Bacteria 4616
606 Ga0495652_0062673 3300046529 Bacteria 3135
607 Ga0495652_0107929 3300046529 Bacteria 2244
608 Ga0495652_0191114 3300046529 Bacteria 1562
609 Ga0495652_0200248 3300046529 Bacteria 1516
610 Ga0495652_0394374 3300046529 Bacteria 981
611 Ga0495652_0581028 3300046529 Bacteria 767
612 Ga0495652_0600439 3300046529 Bacteria 751
613 Ga0495665_0000798 3300046531 Bacteria 16499
614 Ga0495665_0020853 3300046531 Bacteria 3520
615 Ga0495665_0047687 3300046531 Bacteria 2272
616 Ga0495665_0053787 3300046531 Bacteria 2128
617 Ga0495665_0096953 3300046531 Bacteria 1548
618 Ga0495640_0032636 3300046533 Bacteria 3708
619 Ga0495640_0045323 3300046533 Bacteria 3052
620 Ga0495640_0079570 3300046533 Bacteria 2182
621 Ga0495640_0125675 3300046533 Bacteria 1663
622 Ga0495640_0154943 3300046533 Bacteria 1471
623 Ga0495586_0015609 3300046535 Bacteria 4041
624 Ga0495586_0039893 3300046535 Bacteria 2525
625 Ga0495586_0136360 3300046535 Bacteria 1376
626 Ga0495587_0001951 3300046536 Bacteria 13745
627 Ga0495587_0005871 3300046536 Bacteria 7997
628 Ga0495587_0022642 3300046536 Bacteria 3867
629 Ga0495597_0026731 3300046542 Bacteria 2651
630 Ga0495597_0138913 3300046542 Bacteria 1003
631 Ga0495645_0003851 3300046543 Bacteria 10213
632 Ga0495645_0007764 3300046543 Bacteria 7461
633 Ga0495645_0009211 3300046543 Bacteria 6900
634 Ga0495645_0011571 3300046543 Bacteria 6213
635 Ga0495645_0011886 3300046543 Bacteria 6135
636 Ga0495645_0019759 3300046543 Bacteria 4853
637 Ga0495645_0059337 3300046543 Bacteria 2774
638 Ga0495645_0127517 3300046543 Bacteria 1787
639 Ga0495645_0197811 3300046543 Bacteria 1365
640 Ga0495645_0296145 3300046543 Bacteria 1058
641 Ga0495645_0297883 3300046543 Bacteria 1055
642 Ga0495622_0147896 3300046557 Bacteria 1064
643 Ga0495667_0002860 3300046559 Bacteria 11552
644 Ga0495667_0022779 3300046559 Bacteria 4219
645 Ga0495667_0175219 3300046559 Bacteria 1377
646 Ga0495668_0028972 3300046616 Bacteria 3130
647 Ga0495634_0002038 3300046642 Bacteria 17149
648 Ga0495634_0056867 3300046642 Bacteria 2612
649 Ga0495611_0000109 3300046648 Bacteria 57832
650 Ga0495611_0158778 3300046648 Bacteria 1056
651 Ga0495625_0002524 3300046660 Bacteria 19691
652 Ga0495625_0003969 3300046660 Bacteria 14193
653 Ga0495625_0017872 3300046660 Bacteria 5543
654 Ga0495625_0020607 3300046660 Bacteria 5086
655 Ga0495625_0052757 3300046660 Bacteria 2911
656 Ga0495625_0164231 3300046660 Bacteria 1486
657 Ga0495625_0257888 3300046660 Bacteria 1129
658 Ga0495635_0002608 3300046663 Bacteria 12347
659 Ga0495635_0010805 3300046663 Bacteria 6397
660 Ga0495635_0011344 3300046663 Bacteria 6251
661 Ga0495635_0021204 3300046663 Bacteria 4529
662 Ga0495635_0045742 3300046663 Bacteria 3019
663 Ga0495635_0075085 3300046663 Bacteria 2316
664 Ga0495635_0093245 3300046663 Bacteria 2059
665 Ga0495635_0263977 3300046663 Bacteria 1159
666 Ga0495588_0026520 3300046674 Bacteria 2894
667 Ga0495588_0075287 3300046674 Bacteria 1758
668 Ga0495657_0006712 3300046675 Bacteria 8976
669 Ga0495657_0022664 3300046675 Bacteria 4494
670 Ga0495657_0023905 3300046675 Bacteria 4361
671 Ga0495657_0102033 3300046675 Bacteria 1827
672 Ga0495599_0012930 3300046678 Bacteria 5152
673 Ga0495599_0014888 3300046678 Bacteria 4817
674 Ga0495599_0020987 3300046678 Bacteria 4072
675 Ga0495599_0030559 3300046678 Bacteria 3380
676 Ga0495599_0135194 3300046678 Bacteria 1530
677 Ga0495599_0213060 3300046678 Bacteria 1184
678 Ga0495623_0005652 3300046679 Bacteria 8162
679 Ga0495623_0030187 3300046679 Bacteria 3487
680 Ga0495623_0032873 3300046679 Bacteria 3332
681 Ga0495623_0071474 3300046679 Bacteria 2159
682 Ga0495623_0302340 3300046679 Bacteria 883
683 Ga0495646_0011648 3300046680 Bacteria 5588
684 Ga0495646_0015159 3300046680 Bacteria 4896
685 Ga0495646_0015358 3300046680 Bacteria 4860
686 Ga0495646_0016238 3300046680 Bacteria 4727
687 Ga0495646_0033405 3300046680 Bacteria 3197
688 Ga0495646_0078340 3300046680 Bacteria 1931
689 Ga0495646_0186653 3300046680 Bacteria 1135
690 Ga0495647_0229089 3300046681 Bacteria 822
691 Ga0495658_0033231 3300046683 Bacteria 2823
692 Ga0495658_0112330 3300046683 Bacteria 1639
693 Ga0495658_0205972 3300046683 Bacteria 1227
694 Ga0495669_0071108 3300046684 Bacteria 1586
695 Ga0495613_0013059 3300046689 Bacteria 6172
696 Ga0495613_0026308 3300046689 Bacteria 4335
697 Ga0495613_0066328 3300046689 Bacteria 2636
698 Ga0495613_0099243 3300046689 Bacteria 2104
699 Ga0495624_0002034 3300046690 Bacteria 15414
700 Ga0495624_0011981 3300046690 Bacteria 5942
701 Ga0495624_0033750 3300046690 Bacteria 3313
702 Ga0495624_0057855 3300046690 Bacteria 2436
703 Ga0495624_0109557 3300046690 Bacteria 1698
704 Ga0495624_0148717 3300046690 Bacteria 1433
705 Ga0495670_0014902 3300046691 Bacteria 3827
706 Ga0495670_0350839 3300046691 Bacteria 794
707 Ga0495671_0003529 3300046692 Bacteria 9566
708 Ga0495671_0026283 3300046692 Bacteria 3019
709 Ga0495649_0008663 3300046694 Bacteria 6107
710 Ga0495649_0016496 3300046694 Bacteria 4186
711 Ga0495589_0075469 3300046794 Bacteria 1644
712 Ga0495589_0109845 3300046794 Bacteria 1331
713 Ga0495600_0001440 3300046809 Bacteria 13170
714 Ga0495600_0030769 3300046809 Bacteria 3476
715 Ga0495600_0033670 3300046809 Bacteria 3325
716 Ga0495600_0072585 3300046809 Bacteria 2248
717 Ga0495600_0074868 3300046809 Bacteria 2211
718 Ga0495660_0252257 3300046810 Bacteria 818
719 Ga0495581_0020613 3300047315 Bacteria 3825
720 Ga0495581_0043353 3300047315 Bacteria 2602
721 Ga0495604_0004620 3300047317 Bacteria 10909
722 Ga0495604_0006454 3300047317 Bacteria 9303
723 Ga0495604_0013770 3300047317 Bacteria 6448
724 Ga0495604_0054220 3300047317 Bacteria 3095
725 Ga0495604_0055791 3300047317 Bacteria 3044
726 Ga0495604_0099714 3300047317 Bacteria 2137
727 Ga0495604_0235045 3300047317 Bacteria 1256
728 Ga0495604_0362145 3300047317 Bacteria 961
729 Ga0495674_0002437 3300047319 Bacteria 18178
730 Ga0495674_0005963 3300047319 Bacteria 11688
731 Ga0495674_0007367 3300047319 Bacteria 10523
732 Ga0495674_0009273 3300047319 Bacteria 9352
733 Ga0495674_0011092 3300047319 Bacteria 8508
734 Ga0495674_0016409 3300047319 Bacteria 6906
735 Ga0495674_0022547 3300047319 Bacteria 5807
736 Ga0495674_0031064 3300047319 Bacteria 4854
737 Ga0495674_0053595 3300047319 Bacteria 3544
738 Ga0495674_0060530 3300047319 Bacteria 3303
739 Ga0495674_0081827 3300047319 Bacteria 2769
740 Ga0495674_0263174 3300047319 Bacteria 1416
741 Ga0495674_0400227 3300047319 Bacteria 1108
742 Ga0495672_0011287 3300047320 Bacteria 6314
743 Ga0495672_0025928 3300047320 Bacteria 3747
744 Ga0495672_0065449 3300047320 Bacteria 2078
745 Ga0495672_0084691 3300047320 Bacteria 1758
746 Ga0495672_0111248 3300047320 Bacteria 1469
747 Ga0495676_0032839 3300047321 Bacteria 4377
748 Ga0495676_0042197 3300047321 Bacteria 3747
749 Ga0495676_0047871 3300047321 Bacteria 3452
750 Ga0495676_0065644 3300047321 Bacteria 2816
751 Ga0495676_0338394 3300047321 Bacteria 1008
752 Ga0495680_0004577 3300047322 Bacteria 13191
753 Ga0495680_0013421 3300047322 Bacteria 7148
754 Ga0495680_0035099 3300047322 Bacteria 4042
755 Ga0495680_0046247 3300047322 Bacteria 3432
756 Ga0495680_0062788 3300047322 Bacteria 2855
757 Ga0495680_0402124 3300047322 Bacteria 945
758 Ga0495680_0404741 3300047322 Bacteria 941
759 Ga0495680_0454935 3300047322 Bacteria 876
760 Ga0495683_0001084 3300047323 Bacteria 18805
761 Ga0495683_0001161 3300047323 Bacteria 18053
762 Ga0495683_0005347 3300047323 Bacteria 7131
763 Ga0495683_0009237 3300047323 Bacteria 5255
764 Ga0495683_0018081 3300047323 Bacteria 3648
765 Ga0495683_0085772 3300047323 Bacteria 1530
766 Ga0495683_0189249 3300047323 Bacteria 935
767 Ga0495687_005866 3300047443 Bacteria 7687
768 Ga0495687_008121 3300047443 Bacteria 6059
769 Ga0495687_013195 3300047443 Bacteria 4325
770 Ga0495687_020586 3300047443 Bacteria 3211
771 Ga0495687_028943 3300047443 Bacteria 2570
772 Ga0495687_086983 3300047443 Bacteria 1207
773 Ga0495675_0006549 3300047444 Bacteria 7132
774 Ga0495675_0043545 3300047444 Bacteria 2860
775 Ga0495675_0101006 3300047444 Bacteria 1805
776 Ga0495675_0132239 3300047444 Bacteria 1550
777 Ga0495677_0004263 3300047445 Bacteria 5502
778 Ga0495677_0005306 3300047445 Bacteria 4890
779 Ga0495677_0024924 3300047445 Bacteria 2170
780 Ga0495679_000025 3300047446 Bacteria 198386
781 Ga0495679_000641 3300047446 Bacteria 23464
782 Ga0495679_035792 3300047446 Bacteria 1571
783 Ga0495673_0000018 3300047469 Bacteria 569190
784 Ga0495673_0010794 3300047469 Bacteria 4947
785 Ga0495673_0014306 3300047469 Bacteria 4128
786 Ga0495673_0062553 3300047469 Bacteria 1589
787 Ga0495673_0087294 3300047469 Bacteria 1280
788 Ga0495681_0000595 3300047470 Bacteria 27599
789 Ga0495684_0049908 3300047471 Bacteria 3196
790 Ga0495684_0087347 3300047471 Bacteria 2363
791 Ga0495684_0118252 3300047471 Bacteria 1997
792 Ga0495684_0257696 3300047471 Bacteria 1266
793 Ga0495686_0001115 3300047472 Bacteria 31814
794 Ga0495686_0027219 3300047472 Bacteria 3735
795 Ga0495686_0074520 3300047472 Bacteria 2082
796 Ga0495686_0087841 3300047472 Bacteria 1891
797 Ga0495686_0267276 3300047472 Bacteria 955
798 Ga0495593_0001947 3300047673 Bacteria 12321
799 Ga0495593_0013548 3300047673 Bacteria 4648
800 Ga0495593_0015253 3300047673 Bacteria 4358
801 Ga0495593_0033195 3300047673 Bacteria 2812
802 Ga0495593_0042878 3300047673 Bacteria 2427
803 Ga0495593_0051120 3300047673 Bacteria 2187
804 Ga0495602_0025102 3300048088 Bacteria 5773
805 Ga0495602_0034148 3300048088 Bacteria 4762
806 Ga0495602_0048619 3300048088 Bacteria 3809
807 Ga0495602_0065291 3300048088 Bacteria 3142
808 Ga0495602_0077182 3300048088 Bacteria 2819
809 Ga0495602_0234150 3300048088 Bacteria 1377
810 Ga0495602_0241886 3300048088 Bacteria 1350
811 Ga0495602_0252976 3300048088 Bacteria 1312
812 Ga0495602_0310650 3300048088 Bacteria 1150
813 Ga0495602_0444999 3300048088 Bacteria 915
814 Ga0495602_0551281 3300048088 Bacteria 799
815 Ga0495614_0002694 3300048089 Bacteria 7895
816 Ga0495614_0034222 3300048089 Bacteria 2184
817 Ga0495614_0048179 3300048089 Bacteria 1827
818 Ga0495626_0051436 3300048091 Bacteria 1900
819 Ga0495626_0082751 3300048091 Bacteria 1423
820 Ga0496100_0000408 3300048903 Bacteria 20729
821 Ga0496100_0007056 3300048903 Bacteria 6164
822 Ga0496100_0070371 3300048903 Bacteria 2333
823 Ga0496100_0082018 3300048903 Bacteria 2180
824 Ga0496100_0256490 3300048903 Bacteria 1295
825 Ga0496100_0474065 3300048903 Bacteria 962
826 Ga0496101_0000741 3300048904 Bacteria 19422
827 Ga0496101_0004013 3300048904 Bacteria 9200
828 Ga0496101_0009987 3300048904 Bacteria 6255
829 Ga0496101_0013858 3300048904 Bacteria 5411
830 Ga0496101_0025872 3300048904 Bacteria 4075
831 Ga0496101_0032749 3300048904 Bacteria 3661
832 Ga0496101_0464546 3300048904 Bacteria 999
833 Ga0496101_0570527 3300048904 Bacteria 895
834 Ga0496102_0000675 3300048905 Bacteria 34171
835 Ga0496102_0002308 3300048905 Bacteria 16298
836 Ga0496102_0106287 3300048905 Bacteria 2612
837 Ga0496102_0179842 3300048905 Bacteria 1992
838 Ga0496102_0448606 3300048905 Bacteria 1210
839 Ga0496103_0001501 3300048906 Bacteria 15620
840 Ga0496103_0012537 3300048906 Bacteria 5026
841 Ga0496103_0018046 3300048906 Bacteria 4229
842 Ga0496103_0062856 3300048906 Bacteria 2312
843 Ga0496104_0002120 3300048907 Bacteria 17226
844 Ga0496104_0006567 3300048907 Bacteria 10231
845 Ga0496104_0016640 3300048907 Bacteria 6683
846 Ga0496104_0018398 3300048907 Bacteria 6374
847 Ga0496104_0165826 3300048907 Bacteria 2118
848 Ga0496104_0200131 3300048907 Bacteria 1909
849 Ga0496104_0208176 3300048907 Bacteria 1868
850 Ga0496104_0455112 3300048907 Unclassified 1192
851 Ga0496105_0003608 3300048908 Bacteria 11494
852 Ga0496105_0009503 3300048908 Bacteria 7607
853 Ga0496105_0016299 3300048908 Bacteria 5931
854 Ga0496105_0027223 3300048908 Bacteria 4668
855 Ga0496105_0032526 3300048908 Bacteria 4281
856 Ga0496105_0209434 3300048908 Bacteria 1589
857 Ga0496105_0351814 3300048908 Bacteria 1176
858 Ga0496105_0542947 3300048908 Bacteria 908
859 Ga0496106_0000079 3300048909 Bacteria 77180
860 Ga0496106_0002768 3300048909 Bacteria 12994
861 Ga0496106_0053974 3300048909 Bacteria 3036
862 Ga0496106_0584341 3300048909 Bacteria 895
863 Ga0496107_0000825 3300048910 Bacteria 18053
864 Ga0496107_0037326 3300048910 Bacteria 3486
865 Ga0496107_0073861 3300048910 Bacteria 2481
866 Ga0496107_0525558 3300048910 Bacteria 877
867 Ga0496108_0040495 3300048911 Bacteria 3884
868 Ga0496108_0060214 3300048911 Bacteria 3194
869 Ga0496108_0061903 3300048911 Bacteria 3151
870 Ga0496108_0073757 3300048911 Bacteria 2881
871 Ga0496108_0082380 3300048911 Bacteria 2728
872 Ga0496108_0085611 3300048911 Bacteria 2676
873 Ga0496108_0133704 3300048911 Bacteria 2132
874 Ga0496108_0142449 3300048911 Bacteria 2065
875 Ga0496108_0303240 3300048911 Bacteria 1391
876 Ga0496109_0022239 3300048912 Bacteria 5615
877 Ga0496109_0129474 3300048912 Bacteria 2355
878 Ga0496110_0038825 3300048913 Bacteria 4144
879 Ga0496110_0079539 3300048913 Bacteria 2919
880 Ga0496111_0353288 3300048914 Bacteria 1088
881 Ga0496112_0003459 3300048915 Bacteria 13049
882 Ga0496112_0074495 3300048915 Bacteria 3356
883 Ga0496112_0100860 3300048915 Bacteria 2856
884 Ga0496112_0138942 3300048915 Bacteria 2399
885 Ga0496112_0377530 3300048915 Bacteria 1359
886 Ga0496112_0683148 3300048915 Bacteria 955
887 Ga0496113_0092536 3300048916 Bacteria 2332
888 Ga0496113_0259193 3300048916 Bacteria 1389
889 Ga0496114_0003137 3300048917 Bacteria 12682
890 Ga0496114_0057284 3300048917 Bacteria 3253
891 Ga0496114_0082165 3300048917 Bacteria 2723
892 Ga0496114_0179592 3300048917 Bacteria 1848
893 Ga0496114_0202889 3300048917 Bacteria 1737
894 Ga0496114_0309965 3300048917 Bacteria 1394
895 Ga0496115_0027281 3300048918 Bacteria 4465
896 Ga0496115_0106461 3300048918 Bacteria 2302
897 Ga0496115_0567962 3300048918 Bacteria 905
898 Ga0496117_0001301 3300048920 Bacteria 36722
899 Ga0496117_0061746 3300048920 Bacteria 2573
900 Ga0496117_0098243 3300048920 Bacteria 1862
901 Ga0496117_0148230 3300048920 Bacteria 1393
902 Ga0496118_0000400 3300048921 Bacteria 73227
903 Ga0496118_0001513 3300048921 Bacteria 34617
904 Ga0496118_0001539 3300048921 Bacteria 34281
905 Ga0496118_0028560 3300048921 Bacteria 4695
906 Ga0496118_0041020 3300048921 Bacteria 3671
907 Ga0496118_0043130 3300048921 Bacteria 3550
908 Ga0496119_0008905 3300048922 Bacteria 8728
909 Ga0496119_0025360 3300048922 Bacteria 4143
910 Ga0496119_0044660 3300048922 Bacteria 2787
911 Ga0496119_0065612 3300048922 Bacteria 2149
912 Ga0496119_0249949 3300048922 Bacteria 894
913 Ga0496120_0001962 3300048923 Bacteria 22491
914 Ga0496121_0000557 3300048924 Bacteria 70347
915 Ga0496121_0002449 3300048924 Bacteria 28376
916 Ga0496121_0007417 3300048924 Bacteria 13253
917 Ga0496121_0013070 3300048924 Bacteria 8963
918 Ga0496121_0013692 3300048924 Bacteria 8694
919 Ga0496121_0017674 3300048924 Bacteria 7259
920 Ga0496121_0019038 3300048924 Bacteria 6888
921 Ga0496121_0019154 3300048924 Bacteria 6859
922 Ga0496121_0025055 3300048924 Bacteria 5678
923 Ga0496121_0030670 3300048924 Bacteria 4933
924 Ga0496121_0069969 3300048924 Bacteria 2829
925 Ga0496121_0380460 3300048924 Bacteria 931
926 Ga0496124_0013685 3300048927 Bacteria 7904
927 Ga0496124_0153122 3300048927 Bacteria 1806
928 Ga0496124_0463975 3300048927 Bacteria 860
929 Ga0496126_0000122 3300048929 Bacteria 182785
930 Ga0496126_0000196 3300048929 Bacteria 134394
931 Ga0496126_0168295 3300048929 Bacteria 1869
932 Ga0496126_0186526 3300048929 Bacteria 1759
933 Ga0496126_0233703 3300048929 Bacteria 1539
934 Ga0495682_0002681 3300049460 Bacteria 8301
935 Ga0495682_0037028 3300049460 Bacteria 1795
936 Ga0495682_0062470 3300049460 Bacteria 1344
937 nmdc:mga03n38_34014_c1 3300050490 Bacteria 2173
938 nmdc:mga00v17_188501_c1 3300050491 Bacteria 1331
939 nmdc:mga00v17_54876_c1 3300050491 Bacteria 2431
940 nmdc:mga00v17_974_c1 3300050491 Bacteria 15331
941 nmdc:mga0yw44_21137_c1 3300050492 Bacteria 3626
942 nmdc:mga0yw44_32482_c1 3300050492 Bacteria 3042
943 nmdc:mga0yw44_34204_c1 3300050492 Bacteria 2976
944 nmdc:mga0yw44_54893_c2 3300050492 Bacteria 1894
945 nmdc:mga06z11_318005_c1 3300050494 Bacteria 928
946 nmdc:mga06z11_32918_c1 3300050494 Bacteria 2531
947 nmdc:mga08y16_1559_c1 3300050511 Bacteria 23103
948 nmdc:mga0n895_412860_c1 3300050512 Bacteria 1365
949 nmdc:mga0rr50_223956_c1 3300050513 Bacteria 1554
950 nmdc:mga08x19_442795_c1 3300050514 Bacteria 914
951 nmdc:mga0a205_433448_c1 3300050515 Bacteria 1176
952 nmdc:mga0sz30_1052_c1 3300050516 Bacteria 9942
953 nmdc:mga0sz30_20509_c1 3300050516 Bacteria 2667
954 Ga0495601_0005701 3300053077 Bacteria 7257
955 Ga0495601_0019751 3300053077 Bacteria 4111
956 Ga0495601_0101247 3300053077 Bacteria 1861
957 Ga0495601_0179208 3300053077 Bacteria 1385
958 Ga0495601_0237103 3300053077 Bacteria 1191
959 Ga0495601_0518353 3300053077 Bacteria 768
960 Ga0495612_0000828 3300053078 Bacteria 12579
961 Ga0495612_0082824 3300053078 Bacteria 1349
962 Ga0495612_0148148 3300053078 Bacteria 1020
963 Ga0495655_0005701 3300053083 Bacteria 2217
964 Ga0495655_0082573 3300053083 Bacteria 921
965 Ga0495595_0013219 3300053084 Bacteria 3485
966 Ga0495595_0013691 3300053084 Bacteria 3429
967 Ga0495595_0024180 3300053084 Bacteria 2682
968 Ga0495595_0024548 3300053084 Bacteria 2663
969 Ga0495619_0031537 3300053085 Bacteria 3434
970 Ga0495619_0054149 3300053085 Bacteria 2654
971 Ga0495619_0172739 3300053085 Bacteria 1495
972 Ga0495619_0201876 3300053085 Bacteria 1376
973 Ga0500578_0019927 3300053086 Bacteria 4310
974 Ga0500644_0035958 3300053088 Bacteria 1608
975 Ga0500644_0078885 3300053088 Bacteria 1206
976 Ga0500646_0010555 3300053090 Bacteria 2369
977 Ga0500556_0070598 3300053104 Bacteria 1304
978 Ga0500560_009478 3300053107 Bacteria 2395
979 Ga0500642_0000842 3300053130 Bacteria 8956
980 Ga0500658_0133431 3300053134 Bacteria 1109
981 Ga0500568_0001070 3300053139 Bacteria 18524
982 Ga0500600_0017902 3300053149 Bacteria 4278
983 Ga0500616_0005363 3300053153 Bacteria 8729
984 Ga0500616_0011503 3300053153 Bacteria 5218
985 Ga0500633_0097654 3300053160 Bacteria 1078
986 Ga0500634_0013268 3300053161 Bacteria 4318
987 Ga0500634_0069008 3300053161 Bacteria 1855
988 Ga0500599_003553 3300053736 Bacteria 1906
989 Ga0500587_011172 3300053739 Bacteria 1136
990 Ga0466962_0233724 3300061719 Bacteria 902

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048088 Ga0495602_0551281 Ga0495602_0551281_157_768 175
2 3300005445 Ga0070708_100343899 Ga0070708_1003438992 182
3 3300005468 Ga0070707_100240923 Ga0070707_1002409232 182
4 3300005471 Ga0070698_100102574 Ga0070698_1001025742 182
5 3300039453 Ga0436362_0083406 Ga0436362_0083406_325_942 182
6 3300048927 Ga0496124_0463975 Ga0496124_0463975_18_635 182
7 3300046533 Ga0495640_0125675 Ga0495640_0125675_83_703 183
8 3300046557 Ga0495622_0147896 Ga0495622_0147896_45_665 183
9 3300046559 Ga0495667_0175219 Ga0495667_0175219_17_637 183
10 3300046679 Ga0495623_0302340 Ga0495623_0302340_20_640 183
11 3300046809 Ga0495600_0072585 Ga0495600_0072585_1589_2209 183
12 3300048088 Ga0495602_0234150 Ga0495602_0234150_17_637 183
13 3300048088 Ga0495602_0444999 Ga0495602_0444999_228_848 183
14 3300050514 nmdc:mga08x19_442795_c1 nmdc:mga08x19_442795_c1_24_644 183
15 3300031507 Ga0307509_10006504 Ga0307509_1000650410 192
16 3300031838 Ga0307518_10053586 Ga0307518_100535864 192
17 3300046674 Ga0495588_0075287 Ga0495588_0075287_380_1081 192
18 3300046692 Ga0495671_0003529 Ga0495671_0003529_7171_8028 192
19 3300047321 Ga0495676_0338394 Ga0495676_0338394_106_963 192
20 3300047472 Ga0495686_0267276 Ga0495686_0267276_54_911 192
21 3300006042 Ga0075368_10057033 Ga0075368_100570332 193
22 3300031838 Ga0307518_10028846 Ga0307518_100288464 193
23 3300050492 nmdc:mga0yw44_21137_c1 nmdc:mga0yw44_21137_c1_517_1248 193
24 3300050494 nmdc:mga06z11_32918_c1 nmdc:mga06z11_32918_c1_172_903 193
25 3300053077 Ga0495601_0518353 Ga0495601_0518353_14_748 193
26 3300028786 Ga0307517_10010937 Ga0307517_100109378 194
27 3300028794 Ga0307515_10000262 Ga0307515_100002629 194
28 3300030522 Ga0307512_10091341 Ga0307512_100913412 194
29 3300031616 Ga0307508_10040471 Ga0307508_100404714 194
30 3300031838 Ga0307518_10271255 Ga0307518_102712551 194
31 3300033179 Ga0307507_10014440 Ga0307507_100144406 194
32 3300046459 Ga0495629_0003036 Ga0495629_0003036_4537_5394 194
33 3300046491 Ga0495584_0208137 Ga0495584_0208137_175_909 194
34 3300046660 Ga0495625_0002524 Ga0495625_0002524_3254_4111 194
35 3300047470 Ga0495681_0000595 Ga0495681_0000595_26712_27569 194
36 3300048089 Ga0495614_0002694 Ga0495614_0002694_4682_5539 194
37 3300053083 Ga0495655_0005701 Ga0495655_0005701_155_889 194
38 3300053107 Ga0500560_009478 Ga0500560_009478_408_1265 194
39 3300046477 Ga0495664_0296435 Ga0495664_0296435_75_791 195
40 3300006038 Ga0075365_10054713 Ga0075365_100547132 196
41 3300006178 Ga0075367_10019338 Ga0075367_100193382 196
42 3300046460 Ga0495638_0106309 Ga0495638_0106309_741_1451 196
43 3300046499 Ga0495594_0073590 Ga0495594_0073590_400_1110 196
44 3300050492 nmdc:mga0yw44_54893_c2 nmdc:mga0yw44_54893_c2_175_909 196
45 3300053088 Ga0500644_0035958 Ga0500644_0035958_477_1187 196
46 3300053161 Ga0500634_0069008 Ga0500634_0069008_900_1610 196
47 3300006038 Ga0075365_10020751 Ga0075365_100207514 197
48 3300006051 Ga0075364_10083360 Ga0075364_100833602 197
49 3300050491 nmdc:mga00v17_54876_c1 nmdc:mga00v17_54876_c1_880_1593 197
50 3300050492 nmdc:mga0yw44_34204_c1 nmdc:mga0yw44_34204_c1_1555_2268 197
51 3300048922 Ga0496119_0044660 Ga0496119_0044660_750_1475 198
52 3300006914 Ga0075436_100216038 Ga0075436_1002160383 199
53 3300025910 Ga0207684_10308741 Ga0207684_103087411 199
54 3300053153 Ga0500616_0011503 Ga0500616_0011503_4237_4959 201
55 3300005337 Ga0070682_100092828 Ga0070682_1000928282 203
56 3300005616 Ga0068852_100322707 Ga0068852_1003227072 203
57 3300009098 Ga0105245_10008425 Ga0105245_100084257 203
58 3300013105 Ga0157369_10472705 Ga0157369_104727052 203
59 3300013307 Ga0157372_10444023 Ga0157372_104440232 203
60 3300025927 Ga0207687_10044734 Ga0207687_100447343 203
61 3300048907 Ga0496104_0208176 Ga0496104_0208176_409_1176 203
62 3300048911 Ga0496108_0082380 Ga0496108_0082380_1112_1879 203
63 3300048913 Ga0496110_0038825 Ga0496110_0038825_1265_2032 203
64 3300048914 Ga0496111_0353288 Ga0496111_0353288_209_976 203
65 3300048917 Ga0496114_0057284 Ga0496114_0057284_435_1202 203
66 iso_pu_bacteria 2919450847 2919455336 207
67 iso_pu_bacteria 2510065045 2510248447 208
68 iso_pu_bacteria 2718217991 2719643126 208
69 3300025904 Ga0207647_10017088 Ga0207647_100170884 209
70 iso_pu_bacteria 2513237082 2513552510 209
71 iso_pu_bacteria 2513237083 2513560755 209
72 iso_pu_bacteria 2513237150 2513956893 209
73 iso_pu_bacteria 2513237165 2514043246 209
74 iso_pu_bacteria 2513237166 2514053926 209
75 iso_pu_bacteria 2562617112 2563056394 209
76 iso_pu_bacteria 2562617112 2563060939 209
77 iso_pu_bacteria 2562617112 2563064648 209
78 iso_pu_bacteria 2600255067 2600813363 209
79 iso_pu_bacteria 2711768613 2713480158 209
80 iso_pu_bacteria 2711768613 2713481588 209
81 iso_pu_bacteria 2711768613 2713482369 209
82 iso_pu_bacteria 2718218334 2721026824 209
83 iso_pu_bacteria 2721755763 2723878203 209
84 iso_pu_bacteria 2744054900 2746085966 209
85 iso_pu_bacteria 2744054900 2746090663 209
86 iso_pu_bacteria 2744054901 2746092476 209
87 iso_pu_bacteria 2744054901 2746092933 209
88 iso_pu_bacteria 2791355137 2792833598 209
89 iso_pu_bacteria 2791355137 2792837565 209
90 iso_pu_bacteria 2818991450 2819619160 209
91 iso_pu_bacteria 2839993093 2839995427 209
92 iso_pu_bacteria 2879099564 2879106982 209
93 iso_pu_bacteria 2885270888 2885271397 209
94 iso_pu_bacteria 2900634093 2900638581 209
95 iso_pu_bacteria 2904615490 2904618625 209
96 iso_pu_bacteria 2928108538 2928114488 209
97 iso_pu_bacteria 2928135762 2928142010 209
98 iso_pu_bacteria 2928503688 2928504566 209
99 iso_pu_bacteria 2935810662 2935811934 209
100 iso_pu_bacteria 2936037263 2936038517 209
101 iso_pu_bacteria 642555112 642596323 209
102 iso_pu_bacteria 642555112 642598740 209
103 iso_pu_bacteria 642555113 642615442 209
104 iso_pu_bacteria 643348564 643597467 209
105 iso_pu_bacteria 644736347 644747721 209
106 iso_pu_bacteria 8005301065 8005301734 209
107 iso_pu_bacteria 8055301274 8055306894 209
108 iso_pu_bacteria 8057575449 8057582087 209
109 3300003659 JGI25404J52841_10010576 JGI25404J52841_100105761 210
110 3300005937 Ga0081455_10019810 Ga0081455_100198106 210
111 3300005983 Ga0081540_1007347 Ga0081540_10073475 210
112 3300005983 Ga0081540_1018789 Ga0081540_10187893 210
113 3300025920 Ga0207649_10102098 Ga0207649_101020982 210
114 iso_pu_bacteria 2643221647 2644263866 210
115 iso_pu_bacteria 2867428634 2867436376 210
116 iso_pu_bacteria 2954380949 2954382494 210
117 iso_pu_bacteria 2954691527 2954693295 210
118 iso_pu_bacteria 2954701450 2954708388 210
119 iso_pu_bacteria 2954711539 2954713002 210
120 iso_pu_bacteria 2954721474 2954722961 210
121 iso_pu_bacteria 2954731030 2954738868 210
122 iso_pu_bacteria 2954740390 2954741871 210
123 iso_pu_bacteria 2954749733 2954757726 210
124 iso_pu_bacteria 2954759201 2954760848 210
125 3300031852 Ga0307410_10389123 Ga0307410_103891231 211
126 3300039438 Ga0436360_0953330 Ga0436360_0953330_4754_5473 211
127 3300039453 Ga0436362_1279733 Ga0436362_1279733_194_913 211
128 3300048929 Ga0496126_0186526 Ga0496126_0186526_1023_1736 211
129 iso_pu_bacteria 2887478801 2887479384 211
130 3300005434 Ga0070709_10019264 Ga0070709_100192642 212
131 3300005435 Ga0070714_100007241 Ga0070714_1000072414 212
132 3300005435 Ga0070714_100472918 Ga0070714_1004729181 212
133 3300005436 Ga0070713_100005323 Ga0070713_1000053236 212
134 3300005437 Ga0070710_10165718 Ga0070710_101657182 212
135 3300005439 Ga0070711_100012929 Ga0070711_1000129293 212
136 3300005548 Ga0070665_100039971 Ga0070665_1000399712 212
137 3300006028 Ga0070717_10000133 Ga0070717_1000013353 212
138 3300006028 Ga0070717_10480636 Ga0070717_104806362 212
139 3300006051 Ga0075364_10001086 Ga0075364_100010863 212
140 3300006173 Ga0070716_100243012 Ga0070716_1002430122 212
141 3300006175 Ga0070712_100092291 Ga0070712_1000922912 212
142 3300006844 Ga0075428_100306566 Ga0075428_1003065661 212
143 3300009098 Ga0105245_10024489 Ga0105245_100244893 212
144 3300009148 Ga0105243_10051314 Ga0105243_100513143 212
145 3300009553 Ga0105249_10263450 Ga0105249_102634502 212
146 3300010375 Ga0105239_10053958 Ga0105239_100539583 212
147 3300011119 Ga0105246_10178427 Ga0105246_101784272 212
148 3300014325 Ga0163163_10178396 Ga0163163_101783962 212
149 3300014745 Ga0157377_10141790 Ga0157377_101417902 212
150 3300025898 Ga0207692_10052439 Ga0207692_100524392 212
151 3300025906 Ga0207699_10204423 Ga0207699_102044232 212
152 3300025906 Ga0207699_10225207 Ga0207699_102252072 212
153 3300025915 Ga0207693_10034284 Ga0207693_100342846 212
154 3300025927 Ga0207687_10039391 Ga0207687_100393913 212
155 3300025928 Ga0207700_10000057 Ga0207700_1000005766 212
156 3300025929 Ga0207664_10000763 Ga0207664_1000076324 212
157 3300025935 Ga0207709_10041636 Ga0207709_100416363 212
158 3300028379 Ga0268266_10172322 Ga0268266_101723222 212
159 3300028800 Ga0265338_10093020 Ga0265338_100930202 212
160 3300031507 Ga0307509_10251429 Ga0307509_102514292 212
161 3300035172 Ga0373955_0008149 Ga0373955_0008149_368_1075 212
162 3300035724 Ga0373933_0368649 Ga0373933_0368649_128_835 212
163 3300036401 Ga0373937_0182203 Ga0373937_0182203_1193_1900 212
164 3300037312 Ga0395899_0043785 Ga0395899_0043785_512_1219 212
165 3300037418 Ga0395900_0013353 Ga0395900_0013353_1044_1751 212
166 3300037466 Ga0395898_0018741 Ga0395898_0018741_2228_2935 212
167 3300038443 Ga0395901_0000040 Ga0395901_0000040_10662_11369 212
168 3300045836 Ga0466958_0078574 Ga0466958_0078574_296_1003 212
169 3300045976 Ga0466967_0141552 Ga0466967_0141552_1060_1767 212
170 3300046516 Ga0495628_0612997 Ga0495628_0612997_21_728 212
171 3300046529 Ga0495652_0200248 Ga0495652_0200248_275_982 212
172 3300046663 Ga0495635_0093245 Ga0495635_0093245_736_1443 212
173 3300046675 Ga0495657_0006712 Ga0495657_0006712_408_1115 212
174 3300046679 Ga0495623_0071474 Ga0495623_0071474_1077_1784 212
175 3300047317 Ga0495604_0235045 Ga0495604_0235045_65_772 212
176 3300047444 Ga0495675_0132239 Ga0495675_0132239_458_1165 212
177 3300048911 Ga0496108_0303240 Ga0496108_0303240_236_943 212
178 3300048913 Ga0496110_0079539 Ga0496110_0079539_1053_1760 212
179 3300048917 Ga0496114_0202889 Ga0496114_0202889_769_1476 212
180 3300050491 nmdc:mga00v17_188501_c1 nmdc:mga00v17_188501_c1_251_961 212
181 3300050491 nmdc:mga00v17_974_c1 nmdc:mga00v17_974_c1_133_843 212
182 3300050516 nmdc:mga0sz30_1052_c1 nmdc:mga0sz30_1052_c1_2359_3069 212
183 3300050516 nmdc:mga0sz30_20509_c1 nmdc:mga0sz30_20509_c1_1422_2132 212
184 3300053088 Ga0500644_0078885 Ga0500644_0078885_377_1084 212
185 iso_pu_bacteria 2675903059 2676483731 212
186 3300001989 JGI24739J22299_10034366 JGI24739J22299_100343662 213
187 3300001991 JGI24743J22301_10024796 JGI24743J22301_100247962 213
188 3300002070 JGI24750J21931_1001413 JGI24750J21931_10014131 213
189 3300002075 JGI24738J21930_10009149 JGI24738J21930_100091491 213
190 3300002077 JGI24744J21845_10002134 JGI24744J21845_100021343 213
191 3300002705 JGI25156J39149_1000390 JGI25156J39149_10003908 213
192 3300002987 JGI25159J45721_1003051 JGI25159J45721_10030512 213
193 3300003322 rootL2_10080295 rootL2_100802952 213
194 3300003354 JGI25160J50197_1000091 JGI25160J50197_100009118 213
195 3300003354 JGI25160J50197_1004106 JGI25160J50197_10041066 213
196 3300003374 JGI25161J50226_1001682 JGI25161J50226_10016826 213
197 3300003762 Ga0055542_1016805 Ga0055542_10168051 213
198 3300004625 Ga0055543_1002320 Ga0055543_10023203 213
199 3300005262 Ga0065165_1000317 Ga0065165_100031711 213
200 3300005262 Ga0065165_1006192 Ga0065165_10061926 213
201 3300005262 Ga0065165_1022355 Ga0065165_10223552 213
202 3300005262 Ga0065165_1063748 Ga0065165_10637482 213
203 3300005329 Ga0070683_100179744 Ga0070683_1001797442 213
204 3300005330 Ga0070690_100008674 Ga0070690_1000086746 213
205 3300005335 Ga0070666_10042689 Ga0070666_100426893 213
206 3300005337 Ga0070682_100022026 Ga0070682_1000220263 213
207 3300005337 Ga0070682_100197392 Ga0070682_1001973922 213
208 3300005338 Ga0068868_100030498 Ga0068868_1000304984 213
209 3300005341 Ga0070691_10002933 Ga0070691_100029333 213
210 3300005344 Ga0070661_100192188 Ga0070661_1001921882 213
211 3300005347 Ga0070668_100001887 Ga0070668_1000018879 213
212 3300005347 Ga0070668_100029574 Ga0070668_1000295743 213
213 3300005353 Ga0070669_100051760 Ga0070669_1000517604 213
214 3300005354 Ga0070675_100215334 Ga0070675_1002153342 213
215 3300005355 Ga0070671_100211647 Ga0070671_1002116472 213
216 3300005356 Ga0070674_100003900 Ga0070674_1000039009 213
217 3300005367 Ga0070667_100000752 Ga0070667_1000007523 213
218 3300005367 Ga0070667_100097230 Ga0070667_1000972303 213
219 3300005367 Ga0070667_100251782 Ga0070667_1002517822 213
220 3300005434 Ga0070709_10057400 Ga0070709_100574002 213
221 3300005435 Ga0070714_100129182 Ga0070714_1001291822 213
222 3300005437 Ga0070710_10000771 Ga0070710_1000077114 213
223 3300005437 Ga0070710_10006769 Ga0070710_100067695 213
224 3300005438 Ga0070701_10006164 Ga0070701_100061645 213
225 3300005439 Ga0070711_100008402 Ga0070711_1000084022 213
226 3300005439 Ga0070711_100015606 Ga0070711_1000156062 213
227 3300005439 Ga0070711_100442503 Ga0070711_1004425031 213
228 3300005440 Ga0070705_100062581 Ga0070705_1000625811 213
229 3300005441 Ga0070700_100000263 Ga0070700_10000026314 213
230 3300005455 Ga0070663_100014385 Ga0070663_1000143852 213
231 3300005456 Ga0070678_100000712 Ga0070678_10000071214 213
232 3300005456 Ga0070678_100148787 Ga0070678_1001487872 213
233 3300005459 Ga0068867_100000537 Ga0068867_10000053711 213
234 3300005466 Ga0070685_10457616 Ga0070685_104576162 213
235 3300005471 Ga0070698_100000710 Ga0070698_10000071024 213
236 3300005539 Ga0068853_100001294 Ga0068853_10000129410 213
237 3300005539 Ga0068853_100196409 Ga0068853_1001964092 213
238 3300005539 Ga0068853_100653803 Ga0068853_1006538031 213
239 3300005546 Ga0070696_100147741 Ga0070696_1001477411 213
240 3300005547 Ga0070693_100001778 Ga0070693_1000017788 213
241 3300005548 Ga0070665_100121461 Ga0070665_1001214613 213
242 3300005563 Ga0068855_100149036 Ga0068855_1001490362 213
243 3300005578 Ga0068854_100001607 Ga0068854_10000160715 213
244 3300005614 Ga0068856_100113940 Ga0068856_1001139403 213
245 3300005615 Ga0070702_100004815 Ga0070702_1000048152 213
246 3300005616 Ga0068852_100064699 Ga0068852_1000646992 213
247 3300005616 Ga0068852_100300126 Ga0068852_1003001262 213
248 3300005617 Ga0068859_100001155 Ga0068859_10000115516 213
249 3300005718 Ga0068866_10000629 Ga0068866_100006294 213
250 3300005719 Ga0068861_100000739 Ga0068861_10000073915 213
251 3300005841 Ga0068863_100438055 Ga0068863_1004380551 213
252 3300005842 Ga0068858_100002363 Ga0068858_1000023639 213
253 3300005843 Ga0068860_100002272 Ga0068860_10000227219 213
254 3300005844 Ga0068862_100017092 Ga0068862_1000170928 213
255 3300005844 Ga0068862_100066778 Ga0068862_1000667782 213
256 3300006038 Ga0075365_10073961 Ga0075365_100739612 213
257 3300006048 Ga0075363_100048051 Ga0075363_1000480512 213
258 3300006163 Ga0070715_10021195 Ga0070715_100211953 213
259 3300006173 Ga0070716_100000613 Ga0070716_10000061311 213
260 3300006175 Ga0070712_100000495 Ga0070712_10000049515 213
261 3300006175 Ga0070712_100007327 Ga0070712_1000073276 213
262 3300006175 Ga0070712_100018654 Ga0070712_1000186544 213
263 3300006175 Ga0070712_100297599 Ga0070712_1002975992 213
264 3300006178 Ga0075367_10105774 Ga0075367_101057742 213
265 3300006237 Ga0097621_100128797 Ga0097621_1001287972 213
266 3300006881 Ga0068865_100000670 Ga0068865_1000006709 213
267 3300006931 Ga0097620_100001155 Ga0097620_10000115516 213
268 3300006948 Ga0099826_10192256 Ga0099826_101922562 213
269 3300007265 Ga0099794_10004935 Ga0099794_100049354 213
270 3300007788 Ga0099795_10000607 Ga0099795_100006075 213
271 3300007788 Ga0099795_10058501 Ga0099795_100585011 213
272 3300009011 Ga0105251_10000085 Ga0105251_1000008572 213
273 3300009092 Ga0105250_10043917 Ga0105250_100439173 213
274 3300009093 Ga0105240_10003464 Ga0105240_100034648 213
275 3300009093 Ga0105240_10071028 Ga0105240_100710284 213
276 3300009093 Ga0105240_10116529 Ga0105240_101165291 213
277 3300009098 Ga0105245_10003258 Ga0105245_100032582 213
278 3300009098 Ga0105245_10048836 Ga0105245_100488362 213
279 3300009101 Ga0105247_10360071 Ga0105247_103600711 213
280 3300009174 Ga0105241_10076984 Ga0105241_100769843 213
281 3300009176 Ga0105242_10177454 Ga0105242_101774542 213
282 3300009176 Ga0105242_10331151 Ga0105242_103311513 213
283 3300009177 Ga0105248_10676273 Ga0105248_106762732 213
284 3300009177 Ga0105248_11313376 Ga0105248_113133761 213
285 3300009545 Ga0105237_10754138 Ga0105237_107541381 213
286 3300009551 Ga0105238_10284922 Ga0105238_102849222 213
287 3300009553 Ga0105249_10006646 Ga0105249_100066462 213
288 3300009553 Ga0105249_10097458 Ga0105249_100974582 213
289 3300010159 Ga0099796_10001405 Ga0099796_100014054 213
290 3300010375 Ga0105239_10084668 Ga0105239_100846683 213
291 3300010375 Ga0105239_10224269 Ga0105239_102242693 213
292 3300010375 Ga0105239_10255673 Ga0105239_102556733 213
293 3300013102 Ga0157371_10502724 Ga0157371_105027241 213
294 3300013105 Ga0157369_10136993 Ga0157369_101369931 213
295 3300013296 Ga0157374_10111080 Ga0157374_101110802 213
296 3300013296 Ga0157374_10331042 Ga0157374_103310422 213
297 3300013297 Ga0157378_10066625 Ga0157378_100666251 213
298 3300013306 Ga0163162_10125638 Ga0163162_101256381 213
299 3300013306 Ga0163162_10250430 Ga0163162_102504303 213
300 3300014325 Ga0163163_10053434 Ga0163163_100534346 213
301 3300014325 Ga0163163_10151941 Ga0163163_101519413 213
302 3300014326 Ga0157380_10713002 Ga0157380_107130021 213
303 3300014745 Ga0157377_10035664 Ga0157377_100356642 213
304 3300014968 Ga0157379_10347831 Ga0157379_103478311 213
305 3300014969 Ga0157376_10183523 Ga0157376_101835233 213
306 3300015262 Ga0182007_10000576 Ga0182007_1000057614 213
307 3300017792 Ga0163161_10000520 Ga0163161_1000052013 213
308 3300017792 Ga0163161_10026064 Ga0163161_100260641 213
309 3300017792 Ga0163161_10079658 Ga0163161_100796583 213
310 3300025242 Ga0209258_104825 Ga0209258_1048252 213
311 3300025254 Ga0209148_1000480 Ga0209148_10004803 213
312 3300025256 Ga0209759_1000077 Ga0209759_1000077115 213
313 3300025272 Ga0209455_1000604 Ga0209455_100060412 213
314 3300025284 Ga0209130_1001098 Ga0209130_100109821 213
315 3300025284 Ga0209130_1017193 Ga0209130_10171932 213
316 3300025294 Ga0209025_1001325 Ga0209025_100132521 213
317 3300025302 Ga0207426_1000004 Ga0207426_100000484 213
318 3300025302 Ga0207426_1000158 Ga0207426_10001582 213
319 3300025302 Ga0207426_1001300 Ga0207426_100130021 213
320 3300025735 Ga0207713_1001373 Ga0207713_100137314 213
321 3300025898 Ga0207692_10002318 Ga0207692_100023185 213
322 3300025898 Ga0207692_10104506 Ga0207692_101045062 213
323 3300025901 Ga0207688_10001068 Ga0207688_100010685 213
324 3300025903 Ga0207680_10062490 Ga0207680_100624902 213
325 3300025904 Ga0207647_10009742 Ga0207647_100097425 213
326 3300025904 Ga0207647_10066218 Ga0207647_100662183 213
327 3300025905 Ga0207685_10027551 Ga0207685_100275512 213
328 3300025906 Ga0207699_10059031 Ga0207699_100590312 213
329 3300025906 Ga0207699_10067163 Ga0207699_100671631 213
330 3300025907 Ga0207645_10049352 Ga0207645_100493523 213
331 3300025911 Ga0207654_10215395 Ga0207654_102153952 213
332 3300025913 Ga0207695_10002566 Ga0207695_100025667 213
333 3300025913 Ga0207695_10439579 Ga0207695_104395791 213
334 3300025915 Ga0207693_10000660 Ga0207693_1000066020 213
335 3300025915 Ga0207693_10007199 Ga0207693_100071996 213
336 3300025915 Ga0207693_10011311 Ga0207693_100113112 213
337 3300025915 Ga0207693_10299414 Ga0207693_102994142 213
338 3300025916 Ga0207663_10010988 Ga0207663_100109884 213
339 3300025916 Ga0207663_10013686 Ga0207663_100136866 213
340 3300025916 Ga0207663_10389712 Ga0207663_103897121 213
341 3300025924 Ga0207694_10104675 Ga0207694_101046752 213
342 3300025926 Ga0207659_10711254 Ga0207659_107112541 213
343 3300025927 Ga0207687_10006483 Ga0207687_100064839 213
344 3300025927 Ga0207687_10086617 Ga0207687_100866171 213
345 3300025928 Ga0207700_10571188 Ga0207700_105711881 213
346 3300025929 Ga0207664_10046291 Ga0207664_100462912 213
347 3300025929 Ga0207664_10266111 Ga0207664_102661112 213
348 3300025931 Ga0207644_10149525 Ga0207644_101495253 213
349 3300025932 Ga0207690_10022446 Ga0207690_100224464 213
350 3300025933 Ga0207706_10011539 Ga0207706_100115394 213
351 3300025933 Ga0207706_10351306 Ga0207706_103513062 213
352 3300025934 Ga0207686_10001835 Ga0207686_100018357 213
353 3300025934 Ga0207686_10428263 Ga0207686_104282631 213
354 3300025935 Ga0207709_10002099 Ga0207709_100020993 213
355 3300025935 Ga0207709_10394598 Ga0207709_103945981 213
356 3300025937 Ga0207669_10000218 Ga0207669_1000021815 213
357 3300025938 Ga0207704_10000179 Ga0207704_1000017914 213
358 3300025939 Ga0207665_10009061 Ga0207665_100090611 213
359 3300025939 Ga0207665_10071923 Ga0207665_100719231 213
360 3300025941 Ga0207711_10364335 Ga0207711_103643352 213
361 3300025942 Ga0207689_10049736 Ga0207689_100497364 213
362 3300025944 Ga0207661_10316090 Ga0207661_103160902 213
363 3300025945 Ga0207679_10194848 Ga0207679_101948481 213
364 3300025961 Ga0207712_10141128 Ga0207712_101411281 213
365 3300025972 Ga0207668_10002863 Ga0207668_100028635 213
366 3300025981 Ga0207640_10818371 Ga0207640_108183711 213
367 3300025986 Ga0207658_10006956 Ga0207658_100069562 213
368 3300025986 Ga0207658_10171487 Ga0207658_101714872 213
369 3300025986 Ga0207658_10562444 Ga0207658_105624441 213
370 3300026023 Ga0207677_10135312 Ga0207677_101353122 213
371 3300026035 Ga0207703_10002619 Ga0207703_1000261910 213
372 3300026041 Ga0207639_10173375 Ga0207639_101733752 213
373 3300026067 Ga0207678_10007543 Ga0207678_100075436 213
374 3300026075 Ga0207708_10000787 Ga0207708_1000078710 213
375 3300026075 Ga0207708_10479755 Ga0207708_104797552 213
376 3300026088 Ga0207641_10124293 Ga0207641_101242933 213
377 3300026089 Ga0207648_10001756 Ga0207648_1000175611 213
378 3300026089 Ga0207648_10274966 Ga0207648_102749661 213
379 3300026095 Ga0207676_10045875 Ga0207676_100458753 213
380 3300026118 Ga0207675_100003125 Ga0207675_1000031254 213
381 3300026121 Ga0207683_10000990 Ga0207683_1000099011 213
382 3300026121 Ga0207683_10120202 Ga0207683_101202022 213
383 3300027357 Ga0209589_1000399 Ga0209589_100039923 213
384 3300027361 Ga0209489_100724 Ga0209489_10072429 213
385 3300027512 Ga0209179_1000955 Ga0209179_10009554 213
386 3300027671 Ga0209588_1001592 Ga0209588_10015923 213
387 3300028379 Ga0268266_10093888 Ga0268266_100938882 213
388 3300028379 Ga0268266_10262763 Ga0268266_102627632 213
389 3300028379 Ga0268266_10312123 Ga0268266_103121231 213
390 3300028379 Ga0268266_10398842 Ga0268266_103988421 213
391 3300028380 Ga0268265_10061372 Ga0268265_100613722 213
392 3300028381 Ga0268264_10002402 Ga0268264_1000240215 213
393 3300030521 Ga0307511_10001720 Ga0307511_1000172014 213
394 3300031507 Ga0307509_10125480 Ga0307509_101254804 213
395 3300031616 Ga0307508_10008814 Ga0307508_100088145 213
396 3300031616 Ga0307508_10018468 Ga0307508_100184682 213
397 3300031712 Ga0265342_10207281 Ga0265342_102072812 213
398 3300031730 Ga0307516_10002271 Ga0307516_100022718 213
399 3300031730 Ga0307516_10037265 Ga0307516_100372655 213
400 3300031911 Ga0307412_10348620 Ga0307412_103486202 213
401 3300031995 Ga0307409_100106882 Ga0307409_1001068822 213
402 3300033180 Ga0307510_10249234 Ga0307510_102492342 213
403 3300035112 Ga0373932_0048197 Ga0373932_0048197_192_905 213
404 3300037312 Ga0395899_0259358 Ga0395899_0259358_296_1006 213
405 3300037471 Ga0395905_0130272 Ga0395905_0130272_836_1546 213
406 3300037471 Ga0395905_0133592 Ga0395905_0133592_356_1066 213
407 3300037471 Ga0395905_0178201 Ga0395905_0178201_347_1057 213
408 3300039447 Ga0436361_1097664 Ga0436361_1097664_154_900 213
409 3300041404 Ga0439436_0047539 Ga0439436_0047539_28_738 213
410 3300042876 Ga0451577_0134018 Ga0451577_0134018_90_827 213
411 3300044658 Ga0466972_0051034 Ga0466972_0051034_34_744 213
412 3300044673 Ga0453683_0032373 Ga0453683_0032373_1398_2135 213
413 3300044684 Ga0466966_0021132 Ga0466966_0021132_2120_2830 213
414 3300044694 Ga0466963_0002809 Ga0466963_0002809_3412_4134 213
415 3300044712 Ga0453684_0215598 Ga0453684_0215598_1370_2107 213
416 3300046452 Ga0495617_000076 Ga0495617_000076_23137_23895 213
417 3300046454 Ga0495592_0182495 Ga0495592_0182495_52_762 213
418 3300046454 Ga0495592_0240060 Ga0495592_0240060_25_735 213
419 3300046455 Ga0495603_0003485 Ga0495603_0003485_5739_6449 213
420 3300046455 Ga0495603_0263202 Ga0495603_0263202_57_770 213
421 3300046457 Ga0495590_0030089 Ga0495590_0030089_566_1276 213
422 3300046459 Ga0495629_0000096 Ga0495629_0000096_58389_59099 213
423 3300046459 Ga0495629_0000115 Ga0495629_0000115_26136_26846 213
424 3300046459 Ga0495629_0000212 Ga0495629_0000212_50464_51174 213
425 3300046459 Ga0495629_0006134 Ga0495629_0006134_7265_7975 213
426 3300046459 Ga0495629_0009629 Ga0495629_0009629_381_1091 213
427 3300046459 Ga0495629_0015811 Ga0495629_0015811_3912_4622 213
428 3300046459 Ga0495629_0080429 Ga0495629_0080429_762_1472 213
429 3300046459 Ga0495629_0090466 Ga0495629_0090466_659_1369 213
430 3300046459 Ga0495629_0152283 Ga0495629_0152283_649_1362 213
431 3300046460 Ga0495638_0027234 Ga0495638_0027234_2152_2862 213
432 3300046462 Ga0495651_0085694 Ga0495651_0085694_1461_2171 213
433 3300046463 Ga0495653_0000758 Ga0495653_0000758_13208_13918 213
434 3300046463 Ga0495653_0001028 Ga0495653_0001028_12402_13112 213
435 3300046463 Ga0495653_0017059 Ga0495653_0017059_543_1253 213
436 3300046463 Ga0495653_0030050 Ga0495653_0030050_2147_2857 213
437 3300046471 Ga0495650_0000381 Ga0495650_0000381_36653_37390 213
438 3300046471 Ga0495650_0059390 Ga0495650_0059390_647_1357 213
439 3300046472 Ga0495580_0000419 Ga0495580_0000419_32289_32999 213
440 3300046472 Ga0495580_0000778 Ga0495580_0000778_23981_24691 213
441 3300046472 Ga0495580_0001707 Ga0495580_0001707_13595_14305 213
442 3300046472 Ga0495580_0002281 Ga0495580_0002281_10527_11237 213
443 3300046472 Ga0495580_0003210 Ga0495580_0003210_12766_13476 213
444 3300046472 Ga0495580_0005083 Ga0495580_0005083_6941_7651 213
445 3300046472 Ga0495580_0007991 Ga0495580_0007991_2937_3647 213
446 3300046472 Ga0495580_0013903 Ga0495580_0013903_5356_6069 213
447 3300046472 Ga0495580_0016823 Ga0495580_0016823_4249_4959 213
448 3300046472 Ga0495580_0017866 Ga0495580_0017866_2793_3503 213
449 3300046472 Ga0495580_0113618 Ga0495580_0113618_597_1307 213
450 3300046473 Ga0495582_0043056 Ga0495582_0043056_1174_1884 213
451 3300046474 Ga0495605_0003284 Ga0495605_0003284_6434_7192 213
452 3300046474 Ga0495605_0014648 Ga0495605_0014648_544_1254 213
453 3300046474 Ga0495605_0029934 Ga0495605_0029934_1225_1962 213
454 3300046477 Ga0495664_0031579 Ga0495664_0031579_1060_1770 213
455 3300046477 Ga0495664_0145195 Ga0495664_0145195_418_1128 213
456 3300046477 Ga0495664_0179700 Ga0495664_0179700_398_1108 213
457 3300046492 Ga0495585_0016913 Ga0495585_0016913_1190_1927 213
458 3300046499 Ga0495594_0071898 Ga0495594_0071898_114_827 213
459 3300046501 Ga0495607_0077238 Ga0495607_0077238_763_1521 213
460 3300046501 Ga0495607_0095292 Ga0495607_0095292_813_1550 213
461 3300046506 Ga0495583_0004535 Ga0495583_0004535_4856_5566 213
462 3300046506 Ga0495583_0009334 Ga0495583_0009334_4642_5352 213
463 3300046506 Ga0495583_0009898 Ga0495583_0009898_3827_4537 213
464 3300046506 Ga0495583_0012477 Ga0495583_0012477_2954_3712 213
465 3300046506 Ga0495583_0058614 Ga0495583_0058614_388_1098 213
466 3300046507 Ga0495606_0000203 Ga0495606_0000203_44969_45727 213
467 3300046507 Ga0495606_0000692 Ga0495606_0000692_32389_33126 213
468 3300046507 Ga0495606_0001032 Ga0495606_0001032_37665_38375 213
469 3300046507 Ga0495606_0009353 Ga0495606_0009353_7565_8275 213
470 3300046507 Ga0495606_0044799 Ga0495606_0044799_630_1340 213
471 3300046507 Ga0495606_0106311 Ga0495606_0106311_433_1143 213
472 3300046512 Ga0495610_0011552 Ga0495610_0011552_2114_2851 213
473 3300046513 Ga0495616_0000116 Ga0495616_0000116_31420_32157 213
474 3300046513 Ga0495616_0129447 Ga0495616_0129447_24_734 213
475 3300046514 Ga0495618_0029626 Ga0495618_0029626_601_1311 213
476 3300046514 Ga0495618_0057352 Ga0495618_0057352_1416_2126 213
477 3300046515 Ga0495620_0002388 Ga0495620_0002388_12_770 213
478 3300046515 Ga0495620_0010623 Ga0495620_0010623_2322_3059 213
479 3300046516 Ga0495628_0004687 Ga0495628_0004687_2329_3039 213
480 3300046516 Ga0495628_0029156 Ga0495628_0029156_1538_2248 213
481 3300046516 Ga0495628_0032687 Ga0495628_0032687_519_1229 213
482 3300046516 Ga0495628_0049761 Ga0495628_0049761_1104_1814 213
483 3300046516 Ga0495628_0133538 Ga0495628_0133538_551_1261 213
484 3300046516 Ga0495628_0192709 Ga0495628_0192709_521_1231 213
485 3300046516 Ga0495628_0236420 Ga0495628_0236420_617_1327 213
486 3300046517 Ga0495630_0018598 Ga0495630_0018598_2202_2912 213
487 3300046517 Ga0495630_0037973 Ga0495630_0037973_934_1644 213
488 3300046517 Ga0495630_0039716 Ga0495630_0039716_1458_2168 213
489 3300046517 Ga0495630_0231582 Ga0495630_0231582_134_844 213
490 3300046518 Ga0495631_0000069 Ga0495631_0000069_21254_21991 213
491 3300046519 Ga0495632_0060074 Ga0495632_0060074_32_769 213
492 3300046524 Ga0495648_0006147 Ga0495648_0006147_8547_9284 213
493 3300046524 Ga0495648_0007831 Ga0495648_0007831_6440_7198 213
494 3300046524 Ga0495648_0008817 Ga0495648_0008817_4458_5168 213
495 3300046524 Ga0495648_0019853 Ga0495648_0019853_2167_2877 213
496 3300046524 Ga0495648_0027844 Ga0495648_0027844_382_1092 213
497 3300046524 Ga0495648_0038688 Ga0495648_0038688_1947_2657 213
498 3300046524 Ga0495648_0060329 Ga0495648_0060329_437_1147 213
499 3300046524 Ga0495648_0061874 Ga0495648_0061874_1268_1978 213
500 3300046526 Ga0495666_0004629 Ga0495666_0004629_2135_2845 213
501 3300046528 Ga0495642_0026693 Ga0495642_0026693_1223_1933 213
502 3300046529 Ga0495652_0007447 Ga0495652_0007447_1862_2572 213
503 3300046529 Ga0495652_0062673 Ga0495652_0062673_339_1049 213
504 3300046529 Ga0495652_0581028 Ga0495652_0581028_17_727 213
505 3300046529 Ga0495652_0600439 Ga0495652_0600439_16_726 213
506 3300046531 Ga0495665_0000798 Ga0495665_0000798_7737_8447 213
507 3300046531 Ga0495665_0047687 Ga0495665_0047687_1251_1961 213
508 3300046531 Ga0495665_0053787 Ga0495665_0053787_201_911 213
509 3300046531 Ga0495665_0096953 Ga0495665_0096953_784_1494 213
510 3300046535 Ga0495586_0136360 Ga0495586_0136360_533_1243 213
511 3300046542 Ga0495597_0026731 Ga0495597_0026731_526_1236 213
512 3300046542 Ga0495597_0138913 Ga0495597_0138913_268_978 213
513 3300046543 Ga0495645_0003851 Ga0495645_0003851_577_1287 213
514 3300046543 Ga0495645_0007764 Ga0495645_0007764_2107_2817 213
515 3300046543 Ga0495645_0019759 Ga0495645_0019759_1158_1886 213
516 3300046543 Ga0495645_0197811 Ga0495645_0197811_568_1278 213
517 3300046543 Ga0495645_0297883 Ga0495645_0297883_28_771 213
518 3300046616 Ga0495668_0028972 Ga0495668_0028972_2277_2987 213
519 3300046648 Ga0495611_0000109 Ga0495611_0000109_46060_46797 213
520 3300046648 Ga0495611_0158778 Ga0495611_0158778_76_786 213
521 3300046660 Ga0495625_0003969 Ga0495625_0003969_12383_13093 213
522 3300046660 Ga0495625_0017872 Ga0495625_0017872_3085_3843 213
523 3300046660 Ga0495625_0020607 Ga0495625_0020607_3204_3941 213
524 3300046660 Ga0495625_0052757 Ga0495625_0052757_413_1123 213
525 3300046660 Ga0495625_0164231 Ga0495625_0164231_203_913 213
526 3300046660 Ga0495625_0257888 Ga0495625_0257888_16_726 213
527 3300046663 Ga0495635_0002608 Ga0495635_0002608_4514_5242 213
528 3300046663 Ga0495635_0075085 Ga0495635_0075085_534_1244 213
529 3300046678 Ga0495599_0012930 Ga0495599_0012930_3861_4571 213
530 3300046678 Ga0495599_0135194 Ga0495599_0135194_626_1336 213
531 3300046678 Ga0495599_0213060 Ga0495599_0213060_347_1057 213
532 3300046679 Ga0495623_0005652 Ga0495623_0005652_1410_2120 213
533 3300046680 Ga0495646_0011648 Ga0495646_0011648_1097_1807 213
534 3300046680 Ga0495646_0015159 Ga0495646_0015159_516_1226 213
535 3300046680 Ga0495646_0078340 Ga0495646_0078340_840_1550 213
536 3300046680 Ga0495646_0186653 Ga0495646_0186653_226_936 213
537 3300046684 Ga0495669_0071108 Ga0495669_0071108_840_1550 213
538 3300046690 Ga0495624_0002034 Ga0495624_0002034_11601_12311 213
539 3300046690 Ga0495624_0011981 Ga0495624_0011981_2224_2934 213
540 3300046690 Ga0495624_0033750 Ga0495624_0033750_648_1358 213
541 3300046690 Ga0495624_0057855 Ga0495624_0057855_693_1403 213
542 3300046691 Ga0495670_0014902 Ga0495670_0014902_2518_3255 213
543 3300046691 Ga0495670_0350839 Ga0495670_0350839_54_767 213
544 3300046692 Ga0495671_0026283 Ga0495671_0026283_1973_2683 213
545 3300046694 Ga0495649_0008663 Ga0495649_0008663_371_1081 213
546 3300046694 Ga0495649_0016496 Ga0495649_0016496_621_1331 213
547 3300046794 Ga0495589_0075469 Ga0495589_0075469_845_1555 213
548 3300046794 Ga0495589_0109845 Ga0495589_0109845_488_1198 213
549 3300046809 Ga0495600_0001440 Ga0495600_0001440_5175_5903 213
550 3300046810 Ga0495660_0252257 Ga0495660_0252257_68_778 213
551 3300047317 Ga0495604_0013770 Ga0495604_0013770_773_1483 213
552 3300047317 Ga0495604_0054220 Ga0495604_0054220_562_1272 213
553 3300047317 Ga0495604_0055791 Ga0495604_0055791_1968_2678 213
554 3300047317 Ga0495604_0099714 Ga0495604_0099714_98_808 213
555 3300047319 Ga0495674_0002437 Ga0495674_0002437_15527_16237 213
556 3300047319 Ga0495674_0005963 Ga0495674_0005963_542_1252 213
557 3300047319 Ga0495674_0009273 Ga0495674_0009273_3082_3792 213
558 3300047319 Ga0495674_0016409 Ga0495674_0016409_3236_3946 213
559 3300047319 Ga0495674_0022547 Ga0495674_0022547_3159_3869 213
560 3300047319 Ga0495674_0031064 Ga0495674_0031064_1942_2652 213
561 3300047319 Ga0495674_0081827 Ga0495674_0081827_852_1562 213
562 3300047319 Ga0495674_0263174 Ga0495674_0263174_543_1253 213
563 3300047320 Ga0495672_0011287 Ga0495672_0011287_3881_4639 213
564 3300047320 Ga0495672_0025928 Ga0495672_0025928_485_1195 213
565 3300047320 Ga0495672_0065449 Ga0495672_0065449_1309_2022 213
566 3300047320 Ga0495672_0084691 Ga0495672_0084691_375_1085 213
567 3300047320 Ga0495672_0111248 Ga0495672_0111248_168_878 213
568 3300047321 Ga0495676_0047871 Ga0495676_0047871_648_1358 213
569 3300047321 Ga0495676_0065644 Ga0495676_0065644_236_946 213
570 3300047322 Ga0495680_0402124 Ga0495680_0402124_223_933 213
571 3300047322 Ga0495680_0454935 Ga0495680_0454935_35_745 213
572 3300047323 Ga0495683_0001084 Ga0495683_0001084_4952_5662 213
573 3300047323 Ga0495683_0001161 Ga0495683_0001161_4286_5044 213
574 3300047323 Ga0495683_0005347 Ga0495683_0005347_4620_5330 213
575 3300047323 Ga0495683_0009237 Ga0495683_0009237_2944_3681 213
576 3300047323 Ga0495683_0018081 Ga0495683_0018081_2577_3290 213
577 3300047323 Ga0495683_0085772 Ga0495683_0085772_596_1306 213
578 3300047323 Ga0495683_0189249 Ga0495683_0189249_56_766 213
579 3300047443 Ga0495687_005866 Ga0495687_005866_5189_5899 213
580 3300047443 Ga0495687_008121 Ga0495687_008121_2411_3124 213
581 3300047443 Ga0495687_013195 Ga0495687_013195_586_1296 213
582 3300047443 Ga0495687_020586 Ga0495687_020586_98_856 213
583 3300047443 Ga0495687_028943 Ga0495687_028943_1443_2153 213
584 3300047443 Ga0495687_086983 Ga0495687_086983_17_727 213
585 3300047444 Ga0495675_0043545 Ga0495675_0043545_350_1060 213
586 3300047444 Ga0495675_0101006 Ga0495675_0101006_999_1709 213
587 3300047445 Ga0495677_0004263 Ga0495677_0004263_3344_4054 213
588 3300047445 Ga0495677_0005306 Ga0495677_0005306_1249_1959 213
589 3300047445 Ga0495677_0024924 Ga0495677_0024924_1239_1949 213
590 3300047446 Ga0495679_000025 Ga0495679_000025_141270_141980 213
591 3300047446 Ga0495679_000641 Ga0495679_000641_4979_5689 213
592 3300047446 Ga0495679_035792 Ga0495679_035792_571_1281 213
593 3300047469 Ga0495673_0000018 Ga0495673_0000018_512964_513701 213
594 3300047469 Ga0495673_0010794 Ga0495673_0010794_3998_4708 213
595 3300047469 Ga0495673_0014306 Ga0495673_0014306_2021_2731 213
596 3300047469 Ga0495673_0062553 Ga0495673_0062553_496_1206 213
597 3300047469 Ga0495673_0087294 Ga0495673_0087294_414_1124 213
598 3300047472 Ga0495686_0001115 Ga0495686_0001115_12153_12890 213
599 3300047472 Ga0495686_0027219 Ga0495686_0027219_2154_2864 213
600 3300047472 Ga0495686_0074520 Ga0495686_0074520_53_811 213
601 3300047472 Ga0495686_0087841 Ga0495686_0087841_519_1229 213
602 3300047673 Ga0495593_0001947 Ga0495593_0001947_11451_12161 213
603 3300047673 Ga0495593_0015253 Ga0495593_0015253_3014_3724 213
604 3300047673 Ga0495593_0042878 Ga0495593_0042878_693_1403 213
605 3300047673 Ga0495593_0051120 Ga0495593_0051120_991_1701 213
606 3300048088 Ga0495602_0025102 Ga0495602_0025102_3740_4450 213
607 3300048088 Ga0495602_0065291 Ga0495602_0065291_2018_2728 213
608 3300048088 Ga0495602_0077182 Ga0495602_0077182_556_1266 213
609 3300048088 Ga0495602_0241886 Ga0495602_0241886_323_1033 213
610 3300048088 Ga0495602_0252976 Ga0495602_0252976_267_977 213
611 3300048088 Ga0495602_0310650 Ga0495602_0310650_267_977 213
612 3300048089 Ga0495614_0048179 Ga0495614_0048179_1052_1762 213
613 3300048091 Ga0495626_0051436 Ga0495626_0051436_965_1678 213
614 3300048091 Ga0495626_0082751 Ga0495626_0082751_286_996 213
615 3300048903 Ga0496100_0000408 Ga0496100_0000408_13225_13935 213
616 3300048903 Ga0496100_0007056 Ga0496100_0007056_4585_5298 213
617 3300048903 Ga0496100_0082018 Ga0496100_0082018_1137_1850 213
618 3300048903 Ga0496100_0256490 Ga0496100_0256490_317_1027 213
619 3300048903 Ga0496100_0474065 Ga0496100_0474065_16_774 213
620 3300048904 Ga0496101_0000741 Ga0496101_0000741_11672_12382 213
621 3300048904 Ga0496101_0004013 Ga0496101_0004013_5443_6153 213
622 3300048904 Ga0496101_0009987 Ga0496101_0009987_199_912 213
623 3300048904 Ga0496101_0013858 Ga0496101_0013858_2832_3542 213
624 3300048904 Ga0496101_0025872 Ga0496101_0025872_1794_2507 213
625 3300048904 Ga0496101_0570527 Ga0496101_0570527_14_727 213
626 3300048905 Ga0496102_0000675 Ga0496102_0000675_21786_22496 213
627 3300048905 Ga0496102_0002308 Ga0496102_0002308_2507_3220 213
628 3300048905 Ga0496102_0106287 Ga0496102_0106287_1640_2350 213
629 3300048905 Ga0496102_0448606 Ga0496102_0448606_318_1028 213
630 3300048906 Ga0496103_0001501 Ga0496103_0001501_11579_12289 213
631 3300048906 Ga0496103_0012537 Ga0496103_0012537_3317_4030 213
632 3300048906 Ga0496103_0062856 Ga0496103_0062856_10_720 213
633 3300048907 Ga0496104_0006567 Ga0496104_0006567_6514_7224 213
634 3300048907 Ga0496104_0016640 Ga0496104_0016640_208_930 213
635 3300048907 Ga0496104_0018398 Ga0496104_0018398_5479_6192 213
636 3300048907 Ga0496104_0165826 Ga0496104_0165826_800_1510 213
637 3300048908 Ga0496105_0003608 Ga0496105_0003608_5637_6347 213
638 3300048908 Ga0496105_0009503 Ga0496105_0009503_2956_3714 213
639 3300048908 Ga0496105_0016299 Ga0496105_0016299_1045_1755 213
640 3300048908 Ga0496105_0027223 Ga0496105_0027223_2372_3082 213
641 3300048908 Ga0496105_0032526 Ga0496105_0032526_3404_4114 213
642 3300048908 Ga0496105_0542947 Ga0496105_0542947_156_875 213
643 3300048909 Ga0496106_0000079 Ga0496106_0000079_10994_11704 213
644 3300048909 Ga0496106_0002768 Ga0496106_0002768_11830_12543 213
645 3300048909 Ga0496106_0584341 Ga0496106_0584341_34_756 213
646 3300048910 Ga0496107_0000825 Ga0496107_0000825_6994_7707 213
647 3300048910 Ga0496107_0073861 Ga0496107_0073861_1731_2453 213
648 3300048910 Ga0496107_0525558 Ga0496107_0525558_116_826 213
649 3300048911 Ga0496108_0060214 Ga0496108_0060214_1351_2064 213
650 3300048911 Ga0496108_0061903 Ga0496108_0061903_1367_2080 213
651 3300048911 Ga0496108_0085611 Ga0496108_0085611_1925_2635 213
652 3300048912 Ga0496109_0022239 Ga0496109_0022239_3028_3741 213
653 3300048915 Ga0496112_0003459 Ga0496112_0003459_10321_11034 213
654 3300048915 Ga0496112_0074495 Ga0496112_0074495_1440_2153 213
655 3300048915 Ga0496112_0100860 Ga0496112_0100860_592_1311 213
656 3300048915 Ga0496112_0138942 Ga0496112_0138942_1207_1920 213
657 3300048915 Ga0496112_0377530 Ga0496112_0377530_636_1349 213
658 3300048915 Ga0496112_0683148 Ga0496112_0683148_184_894 213
659 3300048916 Ga0496113_0092536 Ga0496113_0092536_371_1084 213
660 3300048916 Ga0496113_0259193 Ga0496113_0259193_337_1050 213
661 3300048917 Ga0496114_0003137 Ga0496114_0003137_3647_4360 213
662 3300048917 Ga0496114_0309965 Ga0496114_0309965_662_1372 213
663 3300048918 Ga0496115_0567962 Ga0496115_0567962_124_834 213
664 3300048920 Ga0496117_0001301 Ga0496117_0001301_24346_25056 213
665 3300048920 Ga0496117_0061746 Ga0496117_0061746_793_1503 213
666 3300048920 Ga0496117_0098243 Ga0496117_0098243_507_1217 213
667 3300048920 Ga0496117_0148230 Ga0496117_0148230_156_866 213
668 3300048921 Ga0496118_0000400 Ga0496118_0000400_58842_59552 213
669 3300048921 Ga0496118_0001513 Ga0496118_0001513_33815_34525 213
670 3300048921 Ga0496118_0001539 Ga0496118_0001539_21771_22481 213
671 3300048921 Ga0496118_0028560 Ga0496118_0028560_587_1297 213
672 3300048921 Ga0496118_0041020 Ga0496118_0041020_282_992 213
673 3300048921 Ga0496118_0043130 Ga0496118_0043130_1033_1743 213
674 3300048922 Ga0496119_0008905 Ga0496119_0008905_77_799 213
675 3300048922 Ga0496119_0065612 Ga0496119_0065612_870_1592 213
676 3300048922 Ga0496119_0249949 Ga0496119_0249949_113_823 213
677 3300048923 Ga0496120_0001962 Ga0496120_0001962_19372_20094 213
678 3300048924 Ga0496121_0000557 Ga0496121_0000557_26851_27561 213
679 3300048924 Ga0496121_0002449 Ga0496121_0002449_19748_20485 213
680 3300048924 Ga0496121_0007417 Ga0496121_0007417_11657_12367 213
681 3300048924 Ga0496121_0013070 Ga0496121_0013070_1302_2012 213
682 3300048924 Ga0496121_0013692 Ga0496121_0013692_4755_5465 213
683 3300048924 Ga0496121_0017674 Ga0496121_0017674_4373_5083 213
684 3300048924 Ga0496121_0019038 Ga0496121_0019038_3028_3738 213
685 3300048924 Ga0496121_0019154 Ga0496121_0019154_598_1320 213
686 3300048924 Ga0496121_0025055 Ga0496121_0025055_4603_5316 213
687 3300048924 Ga0496121_0030670 Ga0496121_0030670_846_1604 213
688 3300048924 Ga0496121_0069969 Ga0496121_0069969_1205_2026 213
689 3300048924 Ga0496121_0380460 Ga0496121_0380460_14_724 213
690 3300048927 Ga0496124_0013685 Ga0496124_0013685_6842_7552 213
691 3300048927 Ga0496124_0153122 Ga0496124_0153122_933_1643 213
692 3300048929 Ga0496126_0000122 Ga0496126_0000122_80520_81230 213
693 3300048929 Ga0496126_0000196 Ga0496126_0000196_107650_108360 213
694 3300048929 Ga0496126_0168295 Ga0496126_0168295_672_1382 213
695 3300048929 Ga0496126_0233703 Ga0496126_0233703_169_927 213
696 3300049460 Ga0495682_0002681 Ga0495682_0002681_2160_2918 213
697 3300049460 Ga0495682_0037028 Ga0495682_0037028_429_1139 213
698 3300049460 Ga0495682_0062470 Ga0495682_0062470_278_991 213
699 3300050490 nmdc:mga03n38_34014_c1 nmdc:mga03n38_34014_c1_943_1656 213
700 3300050492 nmdc:mga0yw44_32482_c1 nmdc:mga0yw44_32482_c1_914_1648 213
701 3300050494 nmdc:mga06z11_318005_c1 nmdc:mga06z11_318005_c1_154_867 213
702 3300050511 nmdc:mga08y16_1559_c1 nmdc:mga08y16_1559_c1_19645_20355 213
703 3300050515 nmdc:mga0a205_433448_c1 nmdc:mga0a205_433448_c1_357_1067 213
704 3300053077 Ga0495601_0005701 Ga0495601_0005701_5983_6711 213
705 3300053078 Ga0495612_0000828 Ga0495612_0000828_1768_2496 213
706 3300053083 Ga0495655_0082573 Ga0495655_0082573_167_880 213
707 3300053086 Ga0500578_0019927 Ga0500578_0019927_2722_3435 213
708 3300053090 Ga0500646_0010555 Ga0500646_0010555_50_760 213
709 3300053104 Ga0500556_0070598 Ga0500556_0070598_118_885 213
710 3300053130 Ga0500642_0000842 Ga0500642_0000842_680_1390 213
711 3300053134 Ga0500658_0133431 Ga0500658_0133431_349_1062 213
712 3300053139 Ga0500568_0001070 Ga0500568_0001070_2923_3633 213
713 3300053149 Ga0500600_0017902 Ga0500600_0017902_3367_4080 213
714 3300053153 Ga0500616_0005363 Ga0500616_0005363_7197_7910 213
715 3300053160 Ga0500633_0097654 Ga0500633_0097654_226_939 213
716 3300053161 Ga0500634_0013268 Ga0500634_0013268_787_1500 213
717 3300053736 Ga0500599_003553 Ga0500599_003553_1011_1721 213
718 3300053739 Ga0500587_011172 Ga0500587_011172_173_886 213
719 3300061719 Ga0466962_0233724 Ga0466962_0233724_93_803 213
720 iso_pu_bacteria 2904615490 2904624358 213
721 iso_pu_bacteria 2919450847 2919455865 213
722 3300005435 Ga0070714_100077810 Ga0070714_1000778104 214
723 3300005467 Ga0070706_100005492 Ga0070706_1000054926 214
724 3300005468 Ga0070707_100542355 Ga0070707_1005423551 214
725 3300005471 Ga0070698_100108012 Ga0070698_1001080122 214
726 3300009177 Ga0105248_10283684 Ga0105248_102836843 214
727 3300021361 Ga0213872_10018642 Ga0213872_100186423 214
728 3300021377 Ga0213874_10124173 Ga0213874_101241731 214
729 3300025922 Ga0207646_10269263 Ga0207646_102692631 214
730 3300025928 Ga0207700_10271770 Ga0207700_102717701 214
731 3300026088 Ga0207641_10127427 Ga0207641_101274271 214
732 3300026089 Ga0207648_10086352 Ga0207648_100863523 214
733 3300035083 Ga0373926_0070833 Ga0373926_0070833_355_1068 214
734 3300035086 Ga0373934_0004960 Ga0373934_0004960_2887_3600 214
735 3300035092 Ga0373952_0021177 Ga0373952_0021177_100_813 214
736 3300035111 Ga0373923_0042529 Ga0373923_0042529_1138_1851 214
737 3300035113 Ga0373936_0003822 Ga0373936_0003822_3751_4464 214
738 3300035113 Ga0373936_0171079 Ga0373936_0171079_163_876 214
739 3300035116 Ga0373945_0013496 Ga0373945_0013496_138_851 214
740 3300035117 Ga0373953_0018435 Ga0373953_0018435_11_724 214
741 3300035118 Ga0373954_0313266 Ga0373954_0313266_45_758 214
742 3300035119 Ga0373956_0015364 Ga0373956_0015364_700_1413 214
743 3300035120 Ga0373957_0063104 Ga0373957_0063104_580_1293 214
744 3300035172 Ga0373955_0001663 Ga0373955_0001663_5545_6258 214
745 3300035410 Ga0373924_0001061 Ga0373924_0001061_7942_8655 214
746 3300035692 Ga0373935_0067629 Ga0373935_0067629_500_1213 214
747 3300035695 Ga0373927_0311564 Ga0373927_0311564_31_744 214
748 3300035724 Ga0373933_0003649 Ga0373933_0003649_5837_6550 214
749 3300035725 Ga0373947_0297228 Ga0373947_0297228_51_764 214
750 3300037068 Ga0373925_0006764 Ga0373925_0006764_6205_6918 214
751 3300037418 Ga0395900_0093869 Ga0395900_0093869_1682_2395 214
752 3300037853 Ga0436364_1281027 Ga0436364_1281027_1368_2084 214
753 3300038443 Ga0395901_0100216 Ga0395901_0100216_391_1104 214
754 3300039447 Ga0436361_0056336 Ga0436361_0056336_829_1548 214
755 3300046454 Ga0495592_0170918 Ga0495592_0170918_709_1422 214
756 3300046459 Ga0495629_0010882 Ga0495629_0010882_725_1438 214
757 3300046461 Ga0495641_0012844 Ga0495641_0012844_104_817 214
758 3300046462 Ga0495651_0056803 Ga0495651_0056803_1998_2711 214
759 3300046463 Ga0495653_0054011 Ga0495653_0054011_576_1289 214
760 3300046472 Ga0495580_0060764 Ga0495580_0060764_1818_2531 214
761 3300046473 Ga0495582_0093040 Ga0495582_0093040_18_731 214
762 3300046475 Ga0495639_0045956 Ga0495639_0045956_965_1678 214
763 3300046476 Ga0495662_0069940 Ga0495662_0069940_671_1384 214
764 3300046477 Ga0495664_0087725 Ga0495664_0087725_426_1139 214
765 3300046499 Ga0495594_0272794 Ga0495594_0272794_181_894 214
766 3300046514 Ga0495618_0042585 Ga0495618_0042585_1904_2617 214
767 3300046514 Ga0495618_0129525 Ga0495618_0129525_76_789 214
768 3300046517 Ga0495630_0009808 Ga0495630_0009808_2962_3675 214
769 3300046529 Ga0495652_0107929 Ga0495652_0107929_1514_2227 214
770 3300046529 Ga0495652_0191114 Ga0495652_0191114_723_1436 214
771 3300046533 Ga0495640_0032636 Ga0495640_0032636_2427_3140 214
772 3300046533 Ga0495640_0045323 Ga0495640_0045323_1855_2568 214
773 3300046533 Ga0495640_0079570 Ga0495640_0079570_256_1035 214
774 3300046535 Ga0495586_0039893 Ga0495586_0039893_985_1764 214
775 3300046536 Ga0495587_0022642 Ga0495587_0022642_2237_2950 214
776 3300046543 Ga0495645_0011571 Ga0495645_0011571_4051_4776 214
777 3300046543 Ga0495645_0059337 Ga0495645_0059337_1173_1886 214
778 3300046543 Ga0495645_0127517 Ga0495645_0127517_875_1588 214
779 3300046543 Ga0495645_0296145 Ga0495645_0296145_24_803 214
780 3300046642 Ga0495634_0002038 Ga0495634_0002038_1732_2445 214
781 3300046663 Ga0495635_0021204 Ga0495635_0021204_435_1148 214
782 3300046663 Ga0495635_0263977 Ga0495635_0263977_170_883 214
783 3300046674 Ga0495588_0026520 Ga0495588_0026520_1567_2280 214
784 3300046675 Ga0495657_0023905 Ga0495657_0023905_2031_2744 214
785 3300046675 Ga0495657_0102033 Ga0495657_0102033_488_1201 214
786 3300046678 Ga0495599_0014888 Ga0495599_0014888_983_1696 214
787 3300046679 Ga0495623_0032873 Ga0495623_0032873_1617_2330 214
788 3300046680 Ga0495646_0015358 Ga0495646_0015358_2197_2910 214
789 3300046681 Ga0495647_0229089 Ga0495647_0229089_17_730 214
790 3300046683 Ga0495658_0112330 Ga0495658_0112330_466_1179 214
791 3300046683 Ga0495658_0205972 Ga0495658_0205972_17_730 214
792 3300046689 Ga0495613_0013059 Ga0495613_0013059_3619_4332 214
793 3300046689 Ga0495613_0066328 Ga0495613_0066328_914_1627 214
794 3300046689 Ga0495613_0099243 Ga0495613_0099243_505_1305 214
795 3300046690 Ga0495624_0148717 Ga0495624_0148717_43_756 214
796 3300046809 Ga0495600_0030769 Ga0495600_0030769_2006_2719 214
797 3300046809 Ga0495600_0074868 Ga0495600_0074868_446_1159 214
798 3300047315 Ga0495581_0043353 Ga0495581_0043353_1258_1971 214
799 3300047317 Ga0495604_0006454 Ga0495604_0006454_7713_8426 214
800 3300047319 Ga0495674_0007367 Ga0495674_0007367_9325_10104 214
801 3300047319 Ga0495674_0060530 Ga0495674_0060530_669_1382 214
802 3300047321 Ga0495676_0032839 Ga0495676_0032839_1850_2563 214
803 3300047322 Ga0495680_0004577 Ga0495680_0004577_1858_2571 214
804 3300047322 Ga0495680_0062788 Ga0495680_0062788_779_1492 214
805 3300047322 Ga0495680_0404741 Ga0495680_0404741_89_802 214
806 3300047471 Ga0495684_0087347 Ga0495684_0087347_988_1701 214
807 3300047673 Ga0495593_0033195 Ga0495593_0033195_1984_2697 214
808 3300048907 Ga0496104_0455112 Ga0496104_0455112_228_941 214
809 3300048911 Ga0496108_0073757 Ga0496108_0073757_1569_2282 214
810 3300048917 Ga0496114_0082165 Ga0496114_0082165_632_1345 214
811 3300048917 Ga0496114_0179592 Ga0496114_0179592_433_1146 214
812 3300048922 Ga0496119_0025360 Ga0496119_0025360_1611_2324 214
813 3300053077 Ga0495601_0101247 Ga0495601_0101247_61_774 214
814 3300053077 Ga0495601_0179208 Ga0495601_0179208_62_775 214
815 3300053078 Ga0495612_0148148 Ga0495612_0148148_164_943 214
816 3300053084 Ga0495595_0024180 Ga0495595_0024180_102_815 214
817 3300053084 Ga0495595_0024548 Ga0495595_0024548_761_1474 214
818 3300053085 Ga0495619_0172739 Ga0495619_0172739_280_1005 214
819 3300053085 Ga0495619_0201876 Ga0495619_0201876_624_1337 214
820 iso_pu_bacteria 2818991458 2819665771 214
821 3300001976 JGI24752J21851_1012632 JGI24752J21851_10126322 215
822 3300005327 Ga0070658_10215953 Ga0070658_102159532 215
823 3300005334 Ga0068869_100235507 Ga0068869_1002355072 215
824 3300005334 Ga0068869_100261874 Ga0068869_1002618741 215
825 3300005337 Ga0070682_100071153 Ga0070682_1000711534 215
826 3300005340 Ga0070689_100252078 Ga0070689_1002520782 215
827 3300005341 Ga0070691_10113504 Ga0070691_101135042 215
828 3300005343 Ga0070687_100061247 Ga0070687_1000612471 215
829 3300005344 Ga0070661_100205666 Ga0070661_1002056662 215
830 3300005353 Ga0070669_100357970 Ga0070669_1003579702 215
831 3300005355 Ga0070671_100297658 Ga0070671_1002976581 215
832 3300005356 Ga0070674_100089658 Ga0070674_1000896582 215
833 3300005365 Ga0070688_100022220 Ga0070688_1000222202 215
834 3300005367 Ga0070667_100070868 Ga0070667_1000708684 215
835 3300005406 Ga0070703_10018005 Ga0070703_100180052 215
836 3300005434 Ga0070709_10000720 Ga0070709_100007206 215
837 3300005434 Ga0070709_10009975 Ga0070709_100099752 215
838 3300005434 Ga0070709_10267430 Ga0070709_102674302 215
839 3300005435 Ga0070714_100065817 Ga0070714_1000658172 215
840 3300005436 Ga0070713_100349902 Ga0070713_1003499022 215
841 3300005436 Ga0070713_100889101 Ga0070713_1008891011 215
842 3300005437 Ga0070710_10019664 Ga0070710_100196642 215
843 3300005438 Ga0070701_10054558 Ga0070701_100545583 215
844 3300005440 Ga0070705_100048453 Ga0070705_1000484532 215
845 3300005440 Ga0070705_100103227 Ga0070705_1001032272 215
846 3300005444 Ga0070694_100092881 Ga0070694_1000928812 215
847 3300005445 Ga0070708_100188849 Ga0070708_1001888492 215
848 3300005445 Ga0070708_100381784 Ga0070708_1003817841 215
849 3300005455 Ga0070663_100013973 Ga0070663_1000139733 215
850 3300005457 Ga0070662_100025103 Ga0070662_1000251033 215
851 3300005467 Ga0070706_100232154 Ga0070706_1002321542 215
852 3300005467 Ga0070706_100313442 Ga0070706_1003134421 215
853 3300005467 Ga0070706_100471130 Ga0070706_1004711302 215
854 3300005471 Ga0070698_100007439 Ga0070698_10000743913 215
855 3300005535 Ga0070684_100878302 Ga0070684_1008783021 215
856 3300005544 Ga0070686_100057786 Ga0070686_1000577862 215
857 3300005546 Ga0070696_100034286 Ga0070696_1000342862 215
858 3300005547 Ga0070693_100013088 Ga0070693_1000130882 215
859 3300005548 Ga0070665_100305012 Ga0070665_1003050122 215
860 3300005578 Ga0068854_100058562 Ga0068854_1000585623 215
861 3300005615 Ga0070702_100076938 Ga0070702_1000769383 215
862 3300005616 Ga0068852_100439637 Ga0068852_1004396372 215
863 3300005617 Ga0068859_100097799 Ga0068859_1000977992 215
864 3300005618 Ga0068864_100116384 Ga0068864_1001163842 215
865 3300005841 Ga0068863_100342979 Ga0068863_1003429792 215
866 3300005842 Ga0068858_100096458 Ga0068858_1000964584 215
867 3300006163 Ga0070715_10001936 Ga0070715_100019362 215
868 3300006163 Ga0070715_10010676 Ga0070715_100106764 215
869 3300006175 Ga0070712_100285645 Ga0070712_1002856452 215
870 3300006931 Ga0097620_100097812 Ga0097620_1000978122 215
871 3300007076 Ga0075435_100199880 Ga0075435_1001998802 215
872 3300009011 Ga0105251_10038544 Ga0105251_100385443 215
873 3300009098 Ga0105245_10318533 Ga0105245_103185332 215
874 3300009101 Ga0105247_10434617 Ga0105247_104346171 215
875 3300009148 Ga0105243_10172160 Ga0105243_101721602 215
876 3300009174 Ga0105241_10025006 Ga0105241_100250063 215
877 3300009177 Ga0105248_10301804 Ga0105248_103018042 215
878 3300010375 Ga0105239_10801024 Ga0105239_108010242 215
879 3300013100 Ga0157373_10108422 Ga0157373_101084222 215
880 3300013102 Ga0157371_10144150 Ga0157371_101441502 215
881 3300013306 Ga0163162_10242903 Ga0163162_102429032 215
882 3300013308 Ga0157375_10415587 Ga0157375_104155872 215
883 3300014745 Ga0157377_10021133 Ga0157377_100211332 215
884 3300017792 Ga0163161_10148005 Ga0163161_101480052 215
885 3300021388 Ga0213875_10000581 Ga0213875_1000058127 215
886 3300024227 Ga0228598_1008076 Ga0228598_10080762 215
887 3300025885 Ga0207653_10012826 Ga0207653_100128263 215
888 3300025898 Ga0207692_10004147 Ga0207692_100041475 215
889 3300025903 Ga0207680_10080712 Ga0207680_100807122 215
890 3300025906 Ga0207699_10006367 Ga0207699_100063674 215
891 3300025907 Ga0207645_10212328 Ga0207645_102123282 215
892 3300025908 Ga0207643_10013681 Ga0207643_100136812 215
893 3300025910 Ga0207684_10242680 Ga0207684_102426802 215
894 3300025913 Ga0207695_10155254 Ga0207695_101552542 215
895 3300025915 Ga0207693_10201086 Ga0207693_102010862 215
896 3300025915 Ga0207693_10682345 Ga0207693_106823451 215
897 3300025916 Ga0207663_10030188 Ga0207663_100301882 215
898 3300025918 Ga0207662_10021583 Ga0207662_100215832 215
899 3300025927 Ga0207687_10393208 Ga0207687_103932082 215
900 3300025928 Ga0207700_10104821 Ga0207700_101048212 215
901 3300025929 Ga0207664_10006691 Ga0207664_100066919 215
902 3300025929 Ga0207664_10142175 Ga0207664_101421752 215
903 3300025929 Ga0207664_10149634 Ga0207664_101496342 215
904 3300025931 Ga0207644_10326064 Ga0207644_103260642 215
905 3300025933 Ga0207706_10067450 Ga0207706_100674502 215
906 3300025935 Ga0207709_10045428 Ga0207709_100454283 215
907 3300025939 Ga0207665_10019328 Ga0207665_100193285 215
908 3300025942 Ga0207689_10103585 Ga0207689_101035854 215
909 3300025944 Ga0207661_10100823 Ga0207661_101008232 215
910 3300025945 Ga0207679_10104168 Ga0207679_101041682 215
911 3300025960 Ga0207651_10111139 Ga0207651_101111392 215
912 3300025961 Ga0207712_10505561 Ga0207712_105055612 215
913 3300026023 Ga0207677_10031401 Ga0207677_100314012 215
914 3300026035 Ga0207703_10118434 Ga0207703_101184342 215
915 3300026067 Ga0207678_10026101 Ga0207678_100261013 215
916 3300026088 Ga0207641_10556957 Ga0207641_105569572 215
917 3300026089 Ga0207648_10071777 Ga0207648_100717772 215
918 3300026095 Ga0207676_10330023 Ga0207676_103300232 215
919 3300026116 Ga0207674_10080197 Ga0207674_100801972 215
920 3300028379 Ga0268266_10165609 Ga0268266_101656092 215
921 3300028381 Ga0268264_10029721 Ga0268264_100297214 215
922 3300028800 Ga0265338_10105408 Ga0265338_101054084 215
923 3300030763 Ga0265763_1008822 Ga0265763_10088222 215
924 3300031090 Ga0265760_10098872 Ga0265760_100988721 215
925 3300034817 Ga0373948_0044771 Ga0373948_0044771_196_912 215
926 3300034819 Ga0373958_0007049 Ga0373958_0007049_327_1043 215
927 3300035083 Ga0373926_0001220 Ga0373926_0001220_4235_4951 215
928 3300035086 Ga0373934_0008907 Ga0373934_0008907_1274_1990 215
929 3300035089 Ga0373944_0001982 Ga0373944_0001982_2637_3353 215
930 3300035091 Ga0373951_0015400 Ga0373951_0015400_210_926 215
931 3300035113 Ga0373936_0003112 Ga0373936_0003112_4640_5356 215
932 3300035115 Ga0373941_0012172 Ga0373941_0012172_476_1192 215
933 3300035117 Ga0373953_0022413 Ga0373953_0022413_315_1031 215
934 3300035118 Ga0373954_0005554 Ga0373954_0005554_4616_5332 215
935 3300035118 Ga0373954_0088703 Ga0373954_0088703_702_1418 215
936 3300035119 Ga0373956_0036895 Ga0373956_0036895_1327_2043 215
937 3300035170 Ga0373943_0015748 Ga0373943_0015748_736_1452 215
938 3300035171 Ga0373946_0001302 Ga0373946_0001302_5579_6295 215
939 3300035172 Ga0373955_0058866 Ga0373955_0058866_543_1259 215
940 3300035172 Ga0373955_0058950 Ga0373955_0058950_415_1131 215
941 3300035410 Ga0373924_0010280 Ga0373924_0010280_1139_1855 215
942 3300035691 Ga0373931_0104520 Ga0373931_0104520_836_1552 215
943 3300035724 Ga0373933_0014869 Ga0373933_0014869_494_1210 215
944 3300035724 Ga0373933_0339844 Ga0373933_0339844_233_949 215
945 3300035725 Ga0373947_0013077 Ga0373947_0013077_1833_2549 215
946 3300036401 Ga0373937_0038642 Ga0373937_0038642_3291_4007 215
947 3300036401 Ga0373937_0142161 Ga0373937_0142161_505_1221 215
948 3300036401 Ga0373937_0500507 Ga0373937_0500507_49_765 215
949 3300037068 Ga0373925_0000356 Ga0373925_0000356_29138_29863 215
950 3300037068 Ga0373925_0007590 Ga0373925_0007590_4262_4978 215
951 3300037068 Ga0373925_0022582 Ga0373925_0022582_986_1702 215
952 3300037853 Ga0436364_0658848 Ga0436364_0658848_81781_82497 215
953 3300046454 Ga0495592_0012171 Ga0495592_0012171_241_957 215
954 3300046454 Ga0495592_0025810 Ga0495592_0025810_1772_2488 215
955 3300046454 Ga0495592_0130129 Ga0495592_0130129_814_1530 215
956 3300046459 Ga0495629_0007439 Ga0495629_0007439_5065_5781 215
957 3300046461 Ga0495641_0024166 Ga0495641_0024166_709_1425 215
958 3300046462 Ga0495651_0004947 Ga0495651_0004947_4072_4788 215
959 3300046462 Ga0495651_0026690 Ga0495651_0026690_888_1604 215
960 3300046462 Ga0495651_0051177 Ga0495651_0051177_995_1711 215
961 3300046462 Ga0495651_0081505 Ga0495651_0081505_1034_1750 215
962 3300046463 Ga0495653_0028278 Ga0495653_0028278_3126_3842 215
963 3300046463 Ga0495653_0044277 Ga0495653_0044277_766_1482 215
964 3300046472 Ga0495580_0083237 Ga0495580_0083237_1280_1996 215
965 3300046473 Ga0495582_0000907 Ga0495582_0000907_1475_2191 215
966 3300046476 Ga0495662_0004199 Ga0495662_0004199_3416_4132 215
967 3300046477 Ga0495664_0020804 Ga0495664_0020804_1037_1753 215
968 3300046499 Ga0495594_0034844 Ga0495594_0034844_1505_2221 215
969 3300046511 Ga0495608_0006951 Ga0495608_0006951_2173_2889 215
970 3300046511 Ga0495608_0032001 Ga0495608_0032001_2353_3069 215
971 3300046511 Ga0495608_0141641 Ga0495608_0141641_477_1193 215
972 3300046514 Ga0495618_0005709 Ga0495618_0005709_5132_5848 215
973 3300046514 Ga0495618_0025527 Ga0495618_0025527_22_738 215
974 3300046516 Ga0495628_0036053 Ga0495628_0036053_1722_2438 215
975 3300046516 Ga0495628_0038761 Ga0495628_0038761_1558_2274 215
976 3300046517 Ga0495630_0027118 Ga0495630_0027118_1558_2274 215
977 3300046517 Ga0495630_0164729 Ga0495630_0164729_818_1534 215
978 3300046526 Ga0495666_0050392 Ga0495666_0050392_807_1523 215
979 3300046529 Ga0495652_0027329 Ga0495652_0027329_2773_3489 215
980 3300046529 Ga0495652_0031835 Ga0495652_0031835_461_1177 215
981 3300046529 Ga0495652_0394374 Ga0495652_0394374_97_813 215
982 3300046531 Ga0495665_0020853 Ga0495665_0020853_799_1515 215
983 3300046533 Ga0495640_0154943 Ga0495640_0154943_138_854 215
984 3300046535 Ga0495586_0015609 Ga0495586_0015609_2964_3680 215
985 3300046536 Ga0495587_0001951 Ga0495587_0001951_5286_6002 215
986 3300046536 Ga0495587_0005871 Ga0495587_0005871_5526_6242 215
987 3300046543 Ga0495645_0009211 Ga0495645_0009211_3667_4383 215
988 3300046543 Ga0495645_0011886 Ga0495645_0011886_3885_4601 215
989 3300046559 Ga0495667_0002860 Ga0495667_0002860_3565_4281 215
990 3300046559 Ga0495667_0022779 Ga0495667_0022779_1914_2630 215
991 3300046642 Ga0495634_0056867 Ga0495634_0056867_766_1482 215
992 3300046663 Ga0495635_0010805 Ga0495635_0010805_3667_4383 215
993 3300046663 Ga0495635_0011344 Ga0495635_0011344_5018_5734 215
994 3300046663 Ga0495635_0045742 Ga0495635_0045742_766_1482 215
995 3300046675 Ga0495657_0022664 Ga0495657_0022664_1956_2672 215
996 3300046678 Ga0495599_0020987 Ga0495599_0020987_1895_2611 215
997 3300046678 Ga0495599_0030559 Ga0495599_0030559_2294_3010 215
998 3300046679 Ga0495623_0030187 Ga0495623_0030187_2450_3166 215
999 3300046680 Ga0495646_0016238 Ga0495646_0016238_3633_4349 215
1000 3300046680 Ga0495646_0033405 Ga0495646_0033405_766_1482 215
1001 3300046683 Ga0495658_0033231 Ga0495658_0033231_519_1235 215
1002 3300046689 Ga0495613_0026308 Ga0495613_0026308_1647_2363 215
1003 3300046690 Ga0495624_0109557 Ga0495624_0109557_830_1546 215
1004 3300046809 Ga0495600_0033670 Ga0495600_0033670_765_1481 215
1005 3300047315 Ga0495581_0020613 Ga0495581_0020613_2311_3027 215
1006 3300047317 Ga0495604_0004620 Ga0495604_0004620_5043_5759 215
1007 3300047317 Ga0495604_0362145 Ga0495604_0362145_196_912 215
1008 3300047319 Ga0495674_0011092 Ga0495674_0011092_6661_7377 215
1009 3300047319 Ga0495674_0053595 Ga0495674_0053595_1973_2689 215
1010 3300047319 Ga0495674_0400227 Ga0495674_0400227_106_822 215
1011 3300047321 Ga0495676_0042197 Ga0495676_0042197_1687_2403 215
1012 3300047322 Ga0495680_0013421 Ga0495680_0013421_2009_2725 215
1013 3300047322 Ga0495680_0035099 Ga0495680_0035099_1987_2703 215
1014 3300047322 Ga0495680_0046247 Ga0495680_0046247_41_757 215
1015 3300047444 Ga0495675_0006549 Ga0495675_0006549_960_1676 215
1016 3300047471 Ga0495684_0049908 Ga0495684_0049908_765_1481 215
1017 3300047471 Ga0495684_0118252 Ga0495684_0118252_1083_1799 215
1018 3300047471 Ga0495684_0257696 Ga0495684_0257696_384_1100 215
1019 3300047673 Ga0495593_0013548 Ga0495593_0013548_1856_2572 215
1020 3300048088 Ga0495602_0034148 Ga0495602_0034148_1539_2255 215
1021 3300048088 Ga0495602_0048619 Ga0495602_0048619_2534_3250 215
1022 3300048089 Ga0495614_0034222 Ga0495614_0034222_943_1659 215
1023 3300048903 Ga0496100_0070371 Ga0496100_0070371_500_1225 215
1024 3300048904 Ga0496101_0032749 Ga0496101_0032749_1750_2466 215
1025 3300048904 Ga0496101_0464546 Ga0496101_0464546_173_898 215
1026 3300048905 Ga0496102_0179842 Ga0496102_0179842_462_1187 215
1027 3300048906 Ga0496103_0018046 Ga0496103_0018046_1178_1894 215
1028 3300048907 Ga0496104_0002120 Ga0496104_0002120_9417_10142 215
1029 3300048907 Ga0496104_0200131 Ga0496104_0200131_986_1702 215
1030 3300048908 Ga0496105_0209434 Ga0496105_0209434_427_1143 215
1031 3300048908 Ga0496105_0351814 Ga0496105_0351814_81_797 215
1032 3300048909 Ga0496106_0053974 Ga0496106_0053974_339_1055 215
1033 3300048910 Ga0496107_0037326 Ga0496107_0037326_2345_3061 215
1034 3300048911 Ga0496108_0040495 Ga0496108_0040495_1616_2341 215
1035 3300048911 Ga0496108_0133704 Ga0496108_0133704_962_1678 215
1036 3300048911 Ga0496108_0142449 Ga0496108_0142449_407_1123 215
1037 3300048912 Ga0496109_0129474 Ga0496109_0129474_1324_2049 215
1038 3300048918 Ga0496115_0027281 Ga0496115_0027281_1328_2044 215
1039 3300048918 Ga0496115_0106461 Ga0496115_0106461_551_1276 215
1040 3300050512 nmdc:mga0n895_412860_c1 nmdc:mga0n895_412860_c1_399_1115 215
1041 3300050513 nmdc:mga0rr50_223956_c1 nmdc:mga0rr50_223956_c1_379_1095 215
1042 3300053077 Ga0495601_0019751 Ga0495601_0019751_2114_2830 215
1043 3300053077 Ga0495601_0237103 Ga0495601_0237103_174_890 215
1044 3300053078 Ga0495612_0082824 Ga0495612_0082824_371_1087 215
1045 3300053084 Ga0495595_0013219 Ga0495595_0013219_886_1602 215
1046 3300053084 Ga0495595_0013691 Ga0495595_0013691_1832_2548 215
1047 3300053085 Ga0495619_0031537 Ga0495619_0031537_2406_3122 215
1048 3300053085 Ga0495619_0054149 Ga0495619_0054149_1795_2511 215

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

52

239

0.9

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

58

279

0.87

PF23441

68

280

0.86

PF08659

KR

KR domain

52

228

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3m1a-assembly4.cif.gz_D the crystal structure of a short-chain dehydrogenase from streptomyces avermitilis to 2a 0.9019 5 159
6uhx-assembly1.cif.gz_A crystal structure of yir035c short chain dehydrogenases/reductase from saccharomyces cerevisiae 0.8955 7 159
3sju-assembly1.cif.gz_A hedamycin polyketide ketoreductase bound to nadph 0.8937 7 159
2q2v-assembly2.cif.gz_D structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida 0.89 7 159
4lvu-assembly1.cif.gz_A-2 crystal structure of a putative short chain dehydrogenase from burkholderia thailandensis 0.8899 7 159
ID Description Score Start End Superfamily
af_B4FAP3_11_264_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9241 5 159 3.40.50.720
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9183 5 159 3.40.50.720
af_A0A1D8PJ12_2_249_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9142 6 159 3.40.50.720
af_Q54IQ3_9_285_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9071 5 159 3.40.50.720
af_A0A0P0WB25_64_301_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9067 30 159 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2U0XY21-F1-model_v4 deleted 0.9762 1 126
AF-I5CMQ8-F1-model_v4 deleted 0.9747 4 110
AF-A0A8A6L033-F1-model_v4 deleted 0.9746 6 112
AF-A0A7I8CZV1-F1-model_v4 Gluconate 5-dehydrogenase 0.9608 4 159 GO:0016616
GO:0030497
AF-A0A520JEG2-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9551 6 159 GO:0016020

Feature Viewer

pLDDT pTM Quality
83.33 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map