F489010
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1048 | 437 | 990 | 235 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2904615490|2904624358 |
| Length | 282 |
| Sequence | QWAAISKQGKVGACAKPKLTRLRPAWAELLTRQVLQLREKITEDTMSNTSQKVVVVTGASQGIGREVVKMFRRLDYRIVATARSIKPSDDANIVTIAGDIGDPATAHRVISEAIARFGRIDTLVNNAGIYIGKPFTEHTVEDYAAVLNVNLSGFYHITQRAIAEMERHSSGHVVSVTASVIDAPRSGVYSVLAALTKGGLNAATKSLAIEYARKGIRVNAVAPGLIKSPMHAPESHEALRTFHPLGRVGEMSDIANAILFLDSAPFITGEILHVDGGLSAGH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 2 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 3 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 4 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 5 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 6 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 7 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 8 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 9 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 10 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 11 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 12 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 13 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 14 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 15 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 16 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 17 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 18 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 19 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 20 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 21 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 22 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 23 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 24 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 25 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 26 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 27 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 28 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 29 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 30 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 31 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 32 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 33 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 34 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 35 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 36 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 37 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 38 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 39 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 40 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 41 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 42 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 43 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 44 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 45 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 46 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 47 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 48 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 49 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 50 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 51 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 52 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 53 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 54 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 55 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 56 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 57 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 60 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 61 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 64 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 65 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 74 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 90 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 91 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 95 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 96 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 97 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 101 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 102 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 103 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 105 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 106 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 107 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 108 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 109 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 110 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 111 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 112 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 113 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 114 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 115 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 117 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 118 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 119 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 120 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 121 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 122 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 123 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 124 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 126 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 127 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 128 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 130 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 131 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 132 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 133 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 146 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 162 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 164 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 165 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 166 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 167 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 170 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 226 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 227 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 233 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 234 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 235 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 236 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 237 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 238 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 239 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 240 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 241 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 242 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 243 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 244 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 245 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 246 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 247 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 248 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 249 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 250 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 251 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 252 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 253 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 254 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 255 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 256 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 257 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 259 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 260 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 261 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 262 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 263 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 264 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 265 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 266 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 267 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 268 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 269 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 270 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 271 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 272 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 273 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 274 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 275 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 277 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 278 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 279 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 280 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 281 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 282 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 283 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 284 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 285 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 286 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 287 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 288 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 289 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 290 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 291 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 292 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 293 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 294 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 379 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 380 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 381 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 382 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 383 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 384 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 385 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 386 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 387 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 388 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 389 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 390 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 391 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 392 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 393 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 394 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 395 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 396 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 397 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 398 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 399 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 400 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 402 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 403 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 404 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 405 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 411 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 417 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 418 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 419 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 420 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 421 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 422 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 423 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 424 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 425 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 426 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 427 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 428 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 429 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 430 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 431 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 432 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 433 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 434 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 435 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 436 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
| 437 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.27 |
| Metatranscriptomes | 0.19 |
| Isolates | 5.53 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.44 |
| Nodule | 1.91 |
| Rhizoplane | 7.44 |
| Rhizosphere | 77.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1012632 | 3300001976 | Bacteria | 1104 |
| 2 | JGI24739J22299_10034366 | 3300001989 | Bacteria | 1728 |
| 3 | JGI24743J22301_10024796 | 3300001991 | Bacteria | 1160 |
| 4 | JGI24750J21931_1001413 | 3300002070 | Bacteria | 3002 |
| 5 | JGI24738J21930_10009149 | 3300002075 | Bacteria | 2239 |
| 6 | JGI24744J21845_10002134 | 3300002077 | Bacteria | 4015 |
| 7 | JGI25156J39149_1000390 | 3300002705 | Bacteria | 27525 |
| 8 | JGI25159J45721_1003051 | 3300002987 | Bacteria | 6058 |
| 9 | rootL2_10080295 | 3300003322 | Bacteria | 3939 |
| 10 | JGI25160J50197_1000091 | 3300003354 | Bacteria | 90359 |
| 11 | JGI25160J50197_1004106 | 3300003354 | Bacteria | 6345 |
| 12 | JGI25161J50226_1001682 | 3300003374 | Bacteria | 6345 |
| 13 | JGI25404J52841_10010576 | 3300003659 | Unclassified | 1983 |
| 14 | Ga0055542_1016805 | 3300003762 | Bacteria | 1144 |
| 15 | Ga0055543_1002320 | 3300004625 | Bacteria | 6383 |
| 16 | Ga0065165_1000317 | 3300005262 | Bacteria | 78478 |
| 17 | Ga0065165_1006192 | 3300005262 | Bacteria | 6383 |
| 18 | Ga0065165_1022355 | 3300005262 | Bacteria | 2170 |
| 19 | Ga0065165_1063748 | 3300005262 | Bacteria | 1000 |
| 20 | Ga0070658_10215953 | 3300005327 | Bacteria | 1621 |
| 21 | Ga0070683_100179744 | 3300005329 | Bacteria | 2008 |
| 22 | Ga0070690_100008674 | 3300005330 | Bacteria | 5864 |
| 23 | Ga0068869_100235507 | 3300005334 | Bacteria | 1456 |
| 24 | Ga0068869_100261874 | 3300005334 | Bacteria | 1384 |
| 25 | Ga0070666_10042689 | 3300005335 | Bacteria | 3035 |
| 26 | Ga0070682_100022026 | 3300005337 | Bacteria | 3769 |
| 27 | Ga0070682_100071153 | 3300005337 | Bacteria | 2225 |
| 28 | Ga0070682_100092828 | 3300005337 | Bacteria | 1978 |
| 29 | Ga0070682_100197392 | 3300005337 | Bacteria | 1417 |
| 30 | Ga0068868_100030498 | 3300005338 | Bacteria | 4135 |
| 31 | Ga0070689_100252078 | 3300005340 | Bacteria | 1456 |
| 32 | Ga0070691_10002933 | 3300005341 | Bacteria | 7646 |
| 33 | Ga0070691_10113504 | 3300005341 | Bacteria | 1357 |
| 34 | Ga0070687_100061247 | 3300005343 | Bacteria | 1989 |
| 35 | Ga0070661_100192188 | 3300005344 | Bacteria | 1557 |
| 36 | Ga0070661_100205666 | 3300005344 | Bacteria | 1505 |
| 37 | Ga0070668_100001887 | 3300005347 | Bacteria | 15322 |
| 38 | Ga0070668_100029574 | 3300005347 | Bacteria | 4161 |
| 39 | Ga0070669_100051760 | 3300005353 | Bacteria | 3003 |
| 40 | Ga0070669_100357970 | 3300005353 | Bacteria | 1186 |
| 41 | Ga0070675_100215334 | 3300005354 | Bacteria | 1671 |
| 42 | Ga0070671_100211647 | 3300005355 | Bacteria | 1644 |
| 43 | Ga0070671_100297658 | 3300005355 | Bacteria | 1374 |
| 44 | Ga0070674_100003900 | 3300005356 | Bacteria | 8445 |
| 45 | Ga0070674_100089658 | 3300005356 | Bacteria | 2216 |
| 46 | Ga0070688_100022220 | 3300005365 | Bacteria | 3713 |
| 47 | Ga0070667_100000752 | 3300005367 | Bacteria | 30896 |
| 48 | Ga0070667_100070868 | 3300005367 | Bacteria | 2968 |
| 49 | Ga0070667_100097230 | 3300005367 | Bacteria | 2540 |
| 50 | Ga0070667_100251782 | 3300005367 | Bacteria | 1579 |
| 51 | Ga0070703_10018005 | 3300005406 | Bacteria | 2039 |
| 52 | Ga0070709_10000720 | 3300005434 | Bacteria | 18720 |
| 53 | Ga0070709_10009975 | 3300005434 | Bacteria | 5251 |
| 54 | Ga0070709_10019264 | 3300005434 | Bacteria | 3942 |
| 55 | Ga0070709_10057400 | 3300005434 | Bacteria | 2466 |
| 56 | Ga0070709_10267430 | 3300005434 | Bacteria | 1238 |
| 57 | Ga0070714_100007241 | 3300005435 | Bacteria | 8619 |
| 58 | Ga0070714_100065817 | 3300005435 | Bacteria | 3122 |
| 59 | Ga0070714_100077810 | 3300005435 | Bacteria | 2882 |
| 60 | Ga0070714_100129182 | 3300005435 | Bacteria | 2257 |
| 61 | Ga0070714_100472918 | 3300005435 | Bacteria | 1193 |
| 62 | Ga0070713_100005323 | 3300005436 | Bacteria | 8780 |
| 63 | Ga0070713_100349902 | 3300005436 | Bacteria | 1371 |
| 64 | Ga0070713_100889101 | 3300005436 | Bacteria | 856 |
| 65 | Ga0070710_10000771 | 3300005437 | Bacteria | 15308 |
| 66 | Ga0070710_10006769 | 3300005437 | Bacteria | 5527 |
| 67 | Ga0070710_10019664 | 3300005437 | Bacteria | 3493 |
| 68 | Ga0070710_10165718 | 3300005437 | Bacteria | 1373 |
| 69 | Ga0070701_10006164 | 3300005438 | Bacteria | 5028 |
| 70 | Ga0070701_10054558 | 3300005438 | Bacteria | 2084 |
| 71 | Ga0070711_100008402 | 3300005439 | Bacteria | 6323 |
| 72 | Ga0070711_100012929 | 3300005439 | Bacteria | 5231 |
| 73 | Ga0070711_100015606 | 3300005439 | Bacteria | 4809 |
| 74 | Ga0070711_100442503 | 3300005439 | Bacteria | 1063 |
| 75 | Ga0070705_100048453 | 3300005440 | Bacteria | 2461 |
| 76 | Ga0070705_100062581 | 3300005440 | Bacteria | 2216 |
| 77 | Ga0070705_100103227 | 3300005440 | Bacteria | 1805 |
| 78 | Ga0070700_100000263 | 3300005441 | Bacteria | 28075 |
| 79 | Ga0070694_100092881 | 3300005444 | Bacteria | 2120 |
| 80 | Ga0070708_100188849 | 3300005445 | Bacteria | 1927 |
| 81 | Ga0070708_100343899 | 3300005445 | Bacteria | 1405 |
| 82 | Ga0070708_100381784 | 3300005445 | Bacteria | 1328 |
| 83 | Ga0070663_100013973 | 3300005455 | Bacteria | 5140 |
| 84 | Ga0070663_100014385 | 3300005455 | Bacteria | 5080 |
| 85 | Ga0070678_100000712 | 3300005456 | Bacteria | 16488 |
| 86 | Ga0070678_100148787 | 3300005456 | Bacteria | 1884 |
| 87 | Ga0070662_100025103 | 3300005457 | Bacteria | 4113 |
| 88 | Ga0068867_100000537 | 3300005459 | Bacteria | 24926 |
| 89 | Ga0070685_10457616 | 3300005466 | Bacteria | 895 |
| 90 | Ga0070706_100005492 | 3300005467 | Bacteria | 12069 |
| 91 | Ga0070706_100232154 | 3300005467 | Bacteria | 1722 |
| 92 | Ga0070706_100313442 | 3300005467 | Bacteria | 1463 |
| 93 | Ga0070706_100471130 | 3300005467 | Bacteria | 1168 |
| 94 | Ga0070707_100240923 | 3300005468 | Bacteria | 1760 |
| 95 | Ga0070707_100542355 | 3300005468 | Bacteria | 1125 |
| 96 | Ga0070698_100000710 | 3300005471 | Bacteria | 35637 |
| 97 | Ga0070698_100007439 | 3300005471 | Bacteria | 11850 |
| 98 | Ga0070698_100102574 | 3300005471 | Bacteria | 2831 |
| 99 | Ga0070698_100108012 | 3300005471 | Bacteria | 2750 |
| 100 | Ga0070684_100878302 | 3300005535 | Bacteria | 840 |
| 101 | Ga0068853_100001294 | 3300005539 | Bacteria | 17970 |
| 102 | Ga0068853_100196409 | 3300005539 | Bacteria | 1835 |
| 103 | Ga0068853_100653803 | 3300005539 | Bacteria | 1001 |
| 104 | Ga0070686_100057786 | 3300005544 | Bacteria | 2493 |
| 105 | Ga0070696_100034286 | 3300005546 | Bacteria | 3491 |
| 106 | Ga0070696_100147741 | 3300005546 | Bacteria | 1723 |
| 107 | Ga0070693_100001778 | 3300005547 | Bacteria | 9827 |
| 108 | Ga0070693_100013088 | 3300005547 | Bacteria | 4217 |
| 109 | Ga0070665_100039971 | 3300005548 | Bacteria | 4716 |
| 110 | Ga0070665_100121461 | 3300005548 | Bacteria | 2614 |
| 111 | Ga0070665_100305012 | 3300005548 | Bacteria | 1595 |
| 112 | Ga0068855_100149036 | 3300005563 | Bacteria | 2661 |
| 113 | Ga0068854_100001607 | 3300005578 | Bacteria | 13732 |
| 114 | Ga0068854_100058562 | 3300005578 | Bacteria | 2781 |
| 115 | Ga0068856_100113940 | 3300005614 | Bacteria | 2703 |
| 116 | Ga0070702_100004815 | 3300005615 | Bacteria | 6204 |
| 117 | Ga0070702_100076938 | 3300005615 | Bacteria | 1987 |
| 118 | Ga0068852_100064699 | 3300005616 | Bacteria | 3188 |
| 119 | Ga0068852_100300126 | 3300005616 | Bacteria | 1554 |
| 120 | Ga0068852_100322707 | 3300005616 | Bacteria | 1500 |
| 121 | Ga0068852_100439637 | 3300005616 | Bacteria | 1289 |
| 122 | Ga0068859_100001155 | 3300005617 | Bacteria | 26941 |
| 123 | Ga0068859_100097799 | 3300005617 | Bacteria | 2988 |
| 124 | Ga0068864_100116384 | 3300005618 | Bacteria | 2385 |
| 125 | Ga0068866_10000629 | 3300005718 | Bacteria | 16020 |
| 126 | Ga0068861_100000739 | 3300005719 | Bacteria | 19591 |
| 127 | Ga0068863_100342979 | 3300005841 | Bacteria | 1453 |
| 128 | Ga0068863_100438055 | 3300005841 | Bacteria | 1281 |
| 129 | Ga0068858_100002363 | 3300005842 | Bacteria | 19075 |
| 130 | Ga0068858_100096458 | 3300005842 | Bacteria | 2755 |
| 131 | Ga0068860_100002272 | 3300005843 | Bacteria | 20190 |
| 132 | Ga0068862_100017092 | 3300005844 | Bacteria | 6036 |
| 133 | Ga0068862_100066778 | 3300005844 | Bacteria | 3100 |
| 134 | Ga0081455_10019810 | 3300005937 | Bacteria | 6354 |
| 135 | Ga0081540_1007347 | 3300005983 | Bacteria | 7877 |
| 136 | Ga0081540_1018789 | 3300005983 | Bacteria | 4226 |
| 137 | Ga0070717_10000133 | 3300006028 | Bacteria | 54960 |
| 138 | Ga0070717_10480636 | 3300006028 | Bacteria | 1121 |
| 139 | Ga0075365_10020751 | 3300006038 | Bacteria | 4080 |
| 140 | Ga0075365_10054713 | 3300006038 | Bacteria | 2647 |
| 141 | Ga0075365_10073961 | 3300006038 | Bacteria | 2297 |
| 142 | Ga0075368_10057033 | 3300006042 | Bacteria | 1559 |
| 143 | Ga0075363_100048051 | 3300006048 | Bacteria | 2268 |
| 144 | Ga0075364_10001086 | 3300006051 | Bacteria | 14506 |
| 145 | Ga0075364_10083360 | 3300006051 | Bacteria | 2116 |
| 146 | Ga0070715_10001936 | 3300006163 | Bacteria | 6228 |
| 147 | Ga0070715_10010676 | 3300006163 | Bacteria | 3281 |
| 148 | Ga0070715_10021195 | 3300006163 | Bacteria | 2517 |
| 149 | Ga0070716_100000613 | 3300006173 | Bacteria | 15075 |
| 150 | Ga0070716_100243012 | 3300006173 | Bacteria | 1222 |
| 151 | Ga0070712_100000495 | 3300006175 | Bacteria | 22525 |
| 152 | Ga0070712_100007327 | 3300006175 | Bacteria | 6886 |
| 153 | Ga0070712_100018654 | 3300006175 | Bacteria | 4511 |
| 154 | Ga0070712_100092291 | 3300006175 | Bacteria | 2220 |
| 155 | Ga0070712_100285645 | 3300006175 | Bacteria | 1330 |
| 156 | Ga0070712_100297599 | 3300006175 | Bacteria | 1305 |
| 157 | Ga0075367_10019338 | 3300006178 | Bacteria | 3776 |
| 158 | Ga0075367_10105774 | 3300006178 | Bacteria | 1723 |
| 159 | Ga0097621_100128797 | 3300006237 | Bacteria | 2152 |
| 160 | Ga0075428_100306566 | 3300006844 | Bacteria | 1707 |
| 161 | Ga0068865_100000670 | 3300006881 | Bacteria | 19290 |
| 162 | Ga0075436_100216038 | 3300006914 | Bacteria | 1360 |
| 163 | Ga0097620_100001155 | 3300006931 | Bacteria | 26941 |
| 164 | Ga0097620_100097812 | 3300006931 | Bacteria | 2988 |
| 165 | Ga0099826_10192256 | 3300006948 | Bacteria | 1125 |
| 166 | Ga0075435_100199880 | 3300007076 | Bacteria | 1693 |
| 167 | Ga0099794_10004935 | 3300007265 | Bacteria | 5306 |
| 168 | Ga0099795_10000607 | 3300007788 | Bacteria | 6872 |
| 169 | Ga0099795_10058501 | 3300007788 | Bacteria | 1423 |
| 170 | Ga0105251_10000085 | 3300009011 | Bacteria | 89249 |
| 171 | Ga0105251_10038544 | 3300009011 | Bacteria | 2340 |
| 172 | Ga0105250_10043917 | 3300009092 | Bacteria | 1792 |
| 173 | Ga0105240_10003464 | 3300009093 | Bacteria | 24478 |
| 174 | Ga0105240_10071028 | 3300009093 | Bacteria | 4306 |
| 175 | Ga0105240_10116529 | 3300009093 | Bacteria | 3222 |
| 176 | Ga0105245_10003258 | 3300009098 | Bacteria | 14558 |
| 177 | Ga0105245_10008425 | 3300009098 | Bacteria | 9005 |
| 178 | Ga0105245_10024489 | 3300009098 | Bacteria | 5300 |
| 179 | Ga0105245_10048836 | 3300009098 | Bacteria | 3787 |
| 180 | Ga0105245_10318533 | 3300009098 | Bacteria | 1531 |
| 181 | Ga0105247_10360071 | 3300009101 | Bacteria | 1025 |
| 182 | Ga0105247_10434617 | 3300009101 | Bacteria | 943 |
| 183 | Ga0105243_10051314 | 3300009148 | Bacteria | 3262 |
| 184 | Ga0105243_10172160 | 3300009148 | Bacteria | 1876 |
| 185 | Ga0105241_10025006 | 3300009174 | Bacteria | 4437 |
| 186 | Ga0105241_10076984 | 3300009174 | Bacteria | 2603 |
| 187 | Ga0105242_10177454 | 3300009176 | Bacteria | 1877 |
| 188 | Ga0105242_10331151 | 3300009176 | Bacteria | 1400 |
| 189 | Ga0105248_10283684 | 3300009177 | Bacteria | 1864 |
| 190 | Ga0105248_10301804 | 3300009177 | Bacteria | 1803 |
| 191 | Ga0105248_10676273 | 3300009177 | Bacteria | 1165 |
| 192 | Ga0105248_11313376 | 3300009177 | Bacteria | 818 |
| 193 | Ga0105237_10754138 | 3300009545 | Bacteria | 980 |
| 194 | Ga0105238_10284922 | 3300009551 | Bacteria | 1634 |
| 195 | Ga0105249_10006646 | 3300009553 | Bacteria | 10064 |
| 196 | Ga0105249_10097458 | 3300009553 | Bacteria | 2760 |
| 197 | Ga0105249_10263450 | 3300009553 | Bacteria | 1714 |
| 198 | Ga0099796_10001405 | 3300010159 | Bacteria | 4824 |
| 199 | Ga0105239_10053958 | 3300010375 | Bacteria | 4408 |
| 200 | Ga0105239_10084668 | 3300010375 | Bacteria | 3493 |
| 201 | Ga0105239_10224269 | 3300010375 | Bacteria | 2108 |
| 202 | Ga0105239_10255673 | 3300010375 | Bacteria | 1968 |
| 203 | Ga0105239_10801024 | 3300010375 | Bacteria | 1079 |
| 204 | Ga0105246_10178427 | 3300011119 | Bacteria | 1633 |
| 205 | Ga0157373_10108422 | 3300013100 | Bacteria | 1952 |
| 206 | Ga0157371_10144150 | 3300013102 | Bacteria | 1697 |
| 207 | Ga0157371_10502724 | 3300013102 | Bacteria | 895 |
| 208 | Ga0157369_10136993 | 3300013105 | Bacteria | 2591 |
| 209 | Ga0157369_10472705 | 3300013105 | Bacteria | 1297 |
| 210 | Ga0157374_10111080 | 3300013296 | Bacteria | 2637 |
| 211 | Ga0157374_10331042 | 3300013296 | Bacteria | 1511 |
| 212 | Ga0157378_10066625 | 3300013297 | Bacteria | 3226 |
| 213 | Ga0163162_10125638 | 3300013306 | Bacteria | 2671 |
| 214 | Ga0163162_10242903 | 3300013306 | Bacteria | 1932 |
| 215 | Ga0163162_10250430 | 3300013306 | Bacteria | 1903 |
| 216 | Ga0157372_10444023 | 3300013307 | Bacteria | 1512 |
| 217 | Ga0157375_10415587 | 3300013308 | Bacteria | 1511 |
| 218 | Ga0163163_10053434 | 3300014325 | Bacteria | 3987 |
| 219 | Ga0163163_10151941 | 3300014325 | Bacteria | 2359 |
| 220 | Ga0163163_10178396 | 3300014325 | Bacteria | 2171 |
| 221 | Ga0157380_10713002 | 3300014326 | Bacteria | 1010 |
| 222 | Ga0157377_10021133 | 3300014745 | Bacteria | 3420 |
| 223 | Ga0157377_10035664 | 3300014745 | Bacteria | 2730 |
| 224 | Ga0157377_10141790 | 3300014745 | Bacteria | 1477 |
| 225 | Ga0157379_10347831 | 3300014968 | Bacteria | 1357 |
| 226 | Ga0157376_10183523 | 3300014969 | Bacteria | 1914 |
| 227 | Ga0182007_10000576 | 3300015262 | Bacteria | 21613 |
| 228 | Ga0163161_10000520 | 3300017792 | Bacteria | 31388 |
| 229 | Ga0163161_10026064 | 3300017792 | Bacteria | 4141 |
| 230 | Ga0163161_10079658 | 3300017792 | Bacteria | 2409 |
| 231 | Ga0163161_10148005 | 3300017792 | Bacteria | 1783 |
| 232 | Ga0213872_10018642 | 3300021361 | Bacteria | 3199 |
| 233 | Ga0213874_10124173 | 3300021377 | Bacteria | 880 |
| 234 | Ga0213875_10000581 | 3300021388 | Bacteria | 29658 |
| 235 | Ga0228598_1008076 | 3300024227 | Bacteria | 2133 |
| 236 | Ga0209258_104825 | 3300025242 | Bacteria | 2442 |
| 237 | Ga0209148_1000480 | 3300025254 | Bacteria | 42052 |
| 238 | Ga0209759_1000077 | 3300025256 | Bacteria | 175706 |
| 239 | Ga0209455_1000604 | 3300025272 | Bacteria | 22805 |
| 240 | Ga0209130_1001098 | 3300025284 | Bacteria | 20094 |
| 241 | Ga0209130_1017193 | 3300025284 | Bacteria | 1730 |
| 242 | Ga0209025_1001325 | 3300025294 | Bacteria | 33510 |
| 243 | Ga0207426_1000004 | 3300025302 | Bacteria | 1047900 |
| 244 | Ga0207426_1000158 | 3300025302 | Bacteria | 177323 |
| 245 | Ga0207426_1001300 | 3300025302 | Bacteria | 21462 |
| 246 | Ga0207713_1001373 | 3300025735 | Bacteria | 19794 |
| 247 | Ga0207653_10012826 | 3300025885 | Bacteria | 2621 |
| 248 | Ga0207692_10002318 | 3300025898 | Bacteria | 7314 |
| 249 | Ga0207692_10004147 | 3300025898 | Bacteria | 5718 |
| 250 | Ga0207692_10052439 | 3300025898 | Bacteria | 2073 |
| 251 | Ga0207692_10104506 | 3300025898 | Bacteria | 1561 |
| 252 | Ga0207688_10001068 | 3300025901 | Bacteria | 14029 |
| 253 | Ga0207680_10062490 | 3300025903 | Bacteria | 2275 |
| 254 | Ga0207680_10080712 | 3300025903 | Bacteria | 2043 |
| 255 | Ga0207647_10009742 | 3300025904 | Bacteria | 6817 |
| 256 | Ga0207647_10017088 | 3300025904 | Bacteria | 4939 |
| 257 | Ga0207647_10066218 | 3300025904 | Bacteria | 2191 |
| 258 | Ga0207685_10027551 | 3300025905 | Bacteria | 1990 |
| 259 | Ga0207699_10006367 | 3300025906 | Bacteria | 5709 |
| 260 | Ga0207699_10059031 | 3300025906 | Bacteria | 2298 |
| 261 | Ga0207699_10067163 | 3300025906 | Bacteria | 2179 |
| 262 | Ga0207699_10204423 | 3300025906 | Bacteria | 1340 |
| 263 | Ga0207699_10225207 | 3300025906 | Bacteria | 1282 |
| 264 | Ga0207645_10049352 | 3300025907 | Bacteria | 2687 |
| 265 | Ga0207645_10212328 | 3300025907 | Bacteria | 1275 |
| 266 | Ga0207643_10013681 | 3300025908 | Bacteria | 4399 |
| 267 | Ga0207684_10242680 | 3300025910 | Bacteria | 1554 |
| 268 | Ga0207684_10308741 | 3300025910 | Bacteria | 1364 |
| 269 | Ga0207654_10215395 | 3300025911 | Bacteria | 1271 |
| 270 | Ga0207695_10002566 | 3300025913 | Bacteria | 26692 |
| 271 | Ga0207695_10155254 | 3300025913 | Bacteria | 2224 |
| 272 | Ga0207695_10439579 | 3300025913 | Bacteria | 1188 |
| 273 | Ga0207693_10000660 | 3300025915 | Bacteria | 30957 |
| 274 | Ga0207693_10007199 | 3300025915 | Bacteria | 9164 |
| 275 | Ga0207693_10011311 | 3300025915 | Bacteria | 7225 |
| 276 | Ga0207693_10034284 | 3300025915 | Bacteria | 4004 |
| 277 | Ga0207693_10201086 | 3300025915 | Bacteria | 1567 |
| 278 | Ga0207693_10299414 | 3300025915 | Bacteria | 1260 |
| 279 | Ga0207693_10682345 | 3300025915 | Bacteria | 796 |
| 280 | Ga0207663_10010988 | 3300025916 | Bacteria | 4840 |
| 281 | Ga0207663_10013686 | 3300025916 | Bacteria | 4417 |
| 282 | Ga0207663_10030188 | 3300025916 | Bacteria | 3194 |
| 283 | Ga0207663_10389712 | 3300025916 | Bacteria | 1063 |
| 284 | Ga0207662_10021583 | 3300025918 | Bacteria | 3683 |
| 285 | Ga0207649_10102098 | 3300025920 | Bacteria | 1900 |
| 286 | Ga0207646_10269263 | 3300025922 | Bacteria | 1540 |
| 287 | Ga0207694_10104675 | 3300025924 | Bacteria | 2246 |
| 288 | Ga0207659_10711254 | 3300025926 | Bacteria | 860 |
| 289 | Ga0207687_10006483 | 3300025927 | Bacteria | 7728 |
| 290 | Ga0207687_10039391 | 3300025927 | Bacteria | 3235 |
| 291 | Ga0207687_10044734 | 3300025927 | Bacteria | 3057 |
| 292 | Ga0207687_10086617 | 3300025927 | Bacteria | 2275 |
| 293 | Ga0207687_10393208 | 3300025927 | Bacteria | 1139 |
| 294 | Ga0207700_10000057 | 3300025928 | Bacteria | 71098 |
| 295 | Ga0207700_10104821 | 3300025928 | Bacteria | 2263 |
| 296 | Ga0207700_10271770 | 3300025928 | Bacteria | 1455 |
| 297 | Ga0207700_10571188 | 3300025928 | Bacteria | 1005 |
| 298 | Ga0207664_10000763 | 3300025929 | Bacteria | 21844 |
| 299 | Ga0207664_10006691 | 3300025929 | Bacteria | 7951 |
| 300 | Ga0207664_10046291 | 3300025929 | Bacteria | 3414 |
| 301 | Ga0207664_10142175 | 3300025929 | Bacteria | 2031 |
| 302 | Ga0207664_10149634 | 3300025929 | Bacteria | 1982 |
| 303 | Ga0207664_10266111 | 3300025929 | Bacteria | 1501 |
| 304 | Ga0207644_10149525 | 3300025931 | Bacteria | 1806 |
| 305 | Ga0207644_10326064 | 3300025931 | Bacteria | 1242 |
| 306 | Ga0207690_10022446 | 3300025932 | Bacteria | 3927 |
| 307 | Ga0207706_10011539 | 3300025933 | Bacteria | 8046 |
| 308 | Ga0207706_10067450 | 3300025933 | Bacteria | 3147 |
| 309 | Ga0207706_10351306 | 3300025933 | Bacteria | 1282 |
| 310 | Ga0207686_10001835 | 3300025934 | Bacteria | 11817 |
| 311 | Ga0207686_10428263 | 3300025934 | Bacteria | 1013 |
| 312 | Ga0207709_10002099 | 3300025935 | Bacteria | 12841 |
| 313 | Ga0207709_10041636 | 3300025935 | Bacteria | 2758 |
| 314 | Ga0207709_10045428 | 3300025935 | Bacteria | 2660 |
| 315 | Ga0207709_10394598 | 3300025935 | Bacteria | 1056 |
| 316 | Ga0207669_10000218 | 3300025937 | Bacteria | 26144 |
| 317 | Ga0207704_10000179 | 3300025938 | Bacteria | 33399 |
| 318 | Ga0207665_10009061 | 3300025939 | Bacteria | 6533 |
| 319 | Ga0207665_10019328 | 3300025939 | Bacteria | 4478 |
| 320 | Ga0207665_10071923 | 3300025939 | Bacteria | 2362 |
| 321 | Ga0207711_10364335 | 3300025941 | Bacteria | 1339 |
| 322 | Ga0207689_10049736 | 3300025942 | Bacteria | 3458 |
| 323 | Ga0207689_10103585 | 3300025942 | Bacteria | 2338 |
| 324 | Ga0207661_10100823 | 3300025944 | Bacteria | 2424 |
| 325 | Ga0207661_10316090 | 3300025944 | Bacteria | 1403 |
| 326 | Ga0207679_10104168 | 3300025945 | Bacteria | 2225 |
| 327 | Ga0207679_10194848 | 3300025945 | Bacteria | 1688 |
| 328 | Ga0207651_10111139 | 3300025960 | Bacteria | 2057 |
| 329 | Ga0207712_10141128 | 3300025961 | Bacteria | 1849 |
| 330 | Ga0207712_10505561 | 3300025961 | Bacteria | 1034 |
| 331 | Ga0207668_10002863 | 3300025972 | Bacteria | 10113 |
| 332 | Ga0207640_10818371 | 3300025981 | Bacteria | 808 |
| 333 | Ga0207658_10006956 | 3300025986 | Bacteria | 7702 |
| 334 | Ga0207658_10171487 | 3300025986 | Bacteria | 1788 |
| 335 | Ga0207658_10562444 | 3300025986 | Bacteria | 1021 |
| 336 | Ga0207677_10031401 | 3300026023 | Bacteria | 3401 |
| 337 | Ga0207677_10135312 | 3300026023 | Bacteria | 1878 |
| 338 | Ga0207703_10002619 | 3300026035 | Bacteria | 15524 |
| 339 | Ga0207703_10118434 | 3300026035 | Bacteria | 2270 |
| 340 | Ga0207639_10173375 | 3300026041 | Bacteria | 1829 |
| 341 | Ga0207678_10007543 | 3300026067 | Bacteria | 9615 |
| 342 | Ga0207678_10026101 | 3300026067 | Bacteria | 5097 |
| 343 | Ga0207708_10000787 | 3300026075 | Bacteria | 23921 |
| 344 | Ga0207708_10479755 | 3300026075 | Bacteria | 1039 |
| 345 | Ga0207641_10124293 | 3300026088 | Bacteria | 2307 |
| 346 | Ga0207641_10127427 | 3300026088 | Bacteria | 2281 |
| 347 | Ga0207641_10556957 | 3300026088 | Bacteria | 1118 |
| 348 | Ga0207648_10001756 | 3300026089 | Bacteria | 23738 |
| 349 | Ga0207648_10071777 | 3300026089 | Bacteria | 3017 |
| 350 | Ga0207648_10086352 | 3300026089 | Bacteria | 2737 |
| 351 | Ga0207648_10274966 | 3300026089 | Bacteria | 1505 |
| 352 | Ga0207676_10045875 | 3300026095 | Bacteria | 3379 |
| 353 | Ga0207676_10330023 | 3300026095 | Bacteria | 1403 |
| 354 | Ga0207674_10080197 | 3300026116 | Bacteria | 3267 |
| 355 | Ga0207675_100003125 | 3300026118 | Bacteria | 16240 |
| 356 | Ga0207683_10000990 | 3300026121 | Bacteria | 26040 |
| 357 | Ga0207683_10120202 | 3300026121 | Bacteria | 2358 |
| 358 | Ga0209589_1000399 | 3300027357 | Bacteria | 59143 |
| 359 | Ga0209489_100724 | 3300027361 | Bacteria | 64817 |
| 360 | Ga0209179_1000955 | 3300027512 | Bacteria | 3277 |
| 361 | Ga0209588_1001592 | 3300027671 | Bacteria | 5971 |
| 362 | Ga0268266_10093888 | 3300028379 | Bacteria | 2633 |
| 363 | Ga0268266_10165609 | 3300028379 | Bacteria | 2002 |
| 364 | Ga0268266_10172322 | 3300028379 | Bacteria | 1965 |
| 365 | Ga0268266_10262763 | 3300028379 | Bacteria | 1600 |
| 366 | Ga0268266_10312123 | 3300028379 | Bacteria | 1470 |
| 367 | Ga0268266_10398842 | 3300028379 | Bacteria | 1300 |
| 368 | Ga0268265_10061372 | 3300028380 | Bacteria | 2884 |
| 369 | Ga0268264_10002402 | 3300028381 | Bacteria | 16495 |
| 370 | Ga0268264_10029721 | 3300028381 | Bacteria | 4479 |
| 371 | Ga0307517_10010937 | 3300028786 | Bacteria | 12636 |
| 372 | Ga0307515_10000262 | 3300028794 | Bacteria | 130525 |
| 373 | Ga0265338_10093020 | 3300028800 | Bacteria | 2485 |
| 374 | Ga0265338_10105408 | 3300028800 | Bacteria | 2285 |
| 375 | Ga0307511_10001720 | 3300030521 | Bacteria | 23047 |
| 376 | Ga0307512_10091341 | 3300030522 | Bacteria | 2118 |
| 377 | Ga0265763_1008822 | 3300030763 | Bacteria | 907 |
| 378 | Ga0265760_10098872 | 3300031090 | Bacteria | 921 |
| 379 | Ga0307509_10006504 | 3300031507 | Bacteria | 15684 |
| 380 | Ga0307509_10125480 | 3300031507 | Bacteria | 2534 |
| 381 | Ga0307509_10251429 | 3300031507 | Bacteria | 1551 |
| 382 | Ga0307508_10008814 | 3300031616 | Bacteria | 9306 |
| 383 | Ga0307508_10018468 | 3300031616 | Bacteria | 6336 |
| 384 | Ga0307508_10040471 | 3300031616 | Bacteria | 4184 |
| 385 | Ga0265342_10207281 | 3300031712 | Bacteria | 1062 |
| 386 | Ga0307516_10002271 | 3300031730 | Bacteria | 25921 |
| 387 | Ga0307516_10037265 | 3300031730 | Bacteria | 4863 |
| 388 | Ga0307518_10028846 | 3300031838 | Bacteria | 4009 |
| 389 | Ga0307518_10053586 | 3300031838 | Bacteria | 2931 |
| 390 | Ga0307518_10271255 | 3300031838 | Bacteria | 1059 |
| 391 | Ga0307410_10389123 | 3300031852 | Bacteria | 1124 |
| 392 | Ga0307412_10348620 | 3300031911 | Bacteria | 1188 |
| 393 | Ga0307409_100106882 | 3300031995 | Bacteria | 2337 |
| 394 | Ga0307507_10014440 | 3300033179 | Bacteria | 9417 |
| 395 | Ga0307510_10249234 | 3300033180 | Bacteria | 1265 |
| 396 | Ga0373948_0044771 | 3300034817 | Bacteria | 936 |
| 397 | Ga0373958_0007049 | 3300034819 | Bacteria | 1776 |
| 398 | Ga0373926_0001220 | 3300035083 | Bacteria | 7729 |
| 399 | Ga0373926_0070833 | 3300035083 | Bacteria | 1281 |
| 400 | Ga0373934_0004960 | 3300035086 | Bacteria | 4933 |
| 401 | Ga0373934_0008907 | 3300035086 | Bacteria | 3750 |
| 402 | Ga0373944_0001982 | 3300035089 | Bacteria | 5183 |
| 403 | Ga0373951_0015400 | 3300035091 | Bacteria | 1722 |
| 404 | Ga0373952_0021177 | 3300035092 | Bacteria | 1371 |
| 405 | Ga0373923_0042529 | 3300035111 | Bacteria | 1877 |
| 406 | Ga0373932_0048197 | 3300035112 | Bacteria | 1255 |
| 407 | Ga0373936_0003112 | 3300035113 | Bacteria | 6212 |
| 408 | Ga0373936_0003822 | 3300035113 | Bacteria | 5670 |
| 409 | Ga0373936_0171079 | 3300035113 | Bacteria | 950 |
| 410 | Ga0373941_0012172 | 3300035115 | Bacteria | 2243 |
| 411 | Ga0373945_0013496 | 3300035116 | Bacteria | 2728 |
| 412 | Ga0373953_0018435 | 3300035117 | Bacteria | 2583 |
| 413 | Ga0373953_0022413 | 3300035117 | Bacteria | 2381 |
| 414 | Ga0373954_0005554 | 3300035118 | Bacteria | 5461 |
| 415 | Ga0373954_0088703 | 3300035118 | Bacteria | 1483 |
| 416 | Ga0373954_0313266 | 3300035118 | Bacteria | 774 |
| 417 | Ga0373956_0015364 | 3300035119 | Bacteria | 3204 |
| 418 | Ga0373956_0036895 | 3300035119 | Bacteria | 2159 |
| 419 | Ga0373957_0063104 | 3300035120 | Bacteria | 1438 |
| 420 | Ga0373943_0015748 | 3300035170 | Bacteria | 3438 |
| 421 | Ga0373946_0001302 | 3300035171 | Bacteria | 8629 |
| 422 | Ga0373955_0001663 | 3300035172 | Bacteria | 9499 |
| 423 | Ga0373955_0008149 | 3300035172 | Bacteria | 4849 |
| 424 | Ga0373955_0058866 | 3300035172 | Bacteria | 2114 |
| 425 | Ga0373955_0058950 | 3300035172 | Bacteria | 2113 |
| 426 | Ga0373924_0001061 | 3300035410 | Bacteria | 8768 |
| 427 | Ga0373924_0010280 | 3300035410 | Bacteria | 3444 |
| 428 | Ga0373931_0104520 | 3300035691 | Bacteria | 1597 |
| 429 | Ga0373935_0067629 | 3300035692 | Bacteria | 2297 |
| 430 | Ga0373927_0311564 | 3300035695 | Bacteria | 1036 |
| 431 | Ga0373933_0003649 | 3300035724 | Bacteria | 8526 |
| 432 | Ga0373933_0014869 | 3300035724 | Bacteria | 4332 |
| 433 | Ga0373933_0339844 | 3300035724 | Bacteria | 974 |
| 434 | Ga0373933_0368649 | 3300035724 | Bacteria | 934 |
| 435 | Ga0373947_0013077 | 3300035725 | Bacteria | 4757 |
| 436 | Ga0373947_0297228 | 3300035725 | Bacteria | 1076 |
| 437 | Ga0373937_0038642 | 3300036401 | Bacteria | 4349 |
| 438 | Ga0373937_0142161 | 3300036401 | Bacteria | 2245 |
| 439 | Ga0373937_0182203 | 3300036401 | Bacteria | 1972 |
| 440 | Ga0373937_0500507 | 3300036401 | Bacteria | 1154 |
| 441 | Ga0373925_0000356 | 3300037068 | Bacteria | 47640 |
| 442 | Ga0373925_0006764 | 3300037068 | Bacteria | 8405 |
| 443 | Ga0373925_0007590 | 3300037068 | Bacteria | 7899 |
| 444 | Ga0373925_0022582 | 3300037068 | Bacteria | 4590 |
| 445 | Ga0395899_0043785 | 3300037312 | Bacteria | 3337 |
| 446 | Ga0395899_0259358 | 3300037312 | Bacteria | 1190 |
| 447 | Ga0395900_0013353 | 3300037418 | Bacteria | 8395 |
| 448 | Ga0395900_0093869 | 3300037418 | Bacteria | 3082 |
| 449 | Ga0395898_0018741 | 3300037466 | Bacteria | 7054 |
| 450 | Ga0395905_0130272 | 3300037471 | Bacteria | 2366 |
| 451 | Ga0395905_0133592 | 3300037471 | Bacteria | 2334 |
| 452 | Ga0395905_0178201 | 3300037471 | Bacteria | 1995 |
| 453 | Ga0436364_0658848 | 3300037853 | Bacteria | 108122 |
| 454 | Ga0436364_1281027 | 3300037853 | Bacteria | 2205 |
| 455 | Ga0395901_0000040 | 3300038443 | Bacteria | 204677 |
| 456 | Ga0395901_0100216 | 3300038443 | Bacteria | 3038 |
| 457 | Ga0436360_0953330 | 3300039438 | Bacteria | 6374 |
| 458 | Ga0436361_0056336 | 3300039447 | Bacteria | 32352 |
| 459 | Ga0436361_1097664 | 3300039447 | Bacteria | 2289 |
| 460 | Ga0436362_0083406 | 3300039453 | Bacteria | 972 |
| 461 | Ga0436362_1279733 | 3300039453 | Bacteria | 1800 |
| 462 | Ga0439436_0047539 | 3300041404 | Bacteria | 1218 |
| 463 | Ga0451577_0134018 | 3300042876 | Bacteria | 2223 |
| 464 | Ga0466972_0051034 | 3300044658 | Bacteria | 1996 |
| 465 | Ga0453683_0032373 | 3300044673 | Bacteria | 3299 |
| 466 | Ga0466966_0021132 | 3300044684 | Bacteria | 4274 |
| 467 | Ga0466963_0002809 | 3300044694 | Bacteria | 9815 |
| 468 | Ga0453684_0215598 | 3300044712 | Bacteria | 2227 |
| 469 | Ga0466958_0078574 | 3300045836 | Bacteria | 2028 |
| 470 | Ga0466967_0141552 | 3300045976 | Bacteria | 2241 |
| 471 | Ga0495617_000076 | 3300046452 | Bacteria | 77876 |
| 472 | Ga0495592_0012171 | 3300046454 | Bacteria | 6529 |
| 473 | Ga0495592_0025810 | 3300046454 | Bacteria | 4460 |
| 474 | Ga0495592_0130129 | 3300046454 | Bacteria | 1761 |
| 475 | Ga0495592_0170918 | 3300046454 | Bacteria | 1488 |
| 476 | Ga0495592_0182495 | 3300046454 | Bacteria | 1428 |
| 477 | Ga0495592_0240060 | 3300046454 | Bacteria | 1203 |
| 478 | Ga0495603_0003485 | 3300046455 | Bacteria | 9357 |
| 479 | Ga0495603_0263202 | 3300046455 | Bacteria | 992 |
| 480 | Ga0495590_0030089 | 3300046457 | Bacteria | 1902 |
| 481 | Ga0495629_0000096 | 3300046459 | Bacteria | 76541 |
| 482 | Ga0495629_0000115 | 3300046459 | Bacteria | 72648 |
| 483 | Ga0495629_0000212 | 3300046459 | Bacteria | 52191 |
| 484 | Ga0495629_0003036 | 3300046459 | Bacteria | 12761 |
| 485 | Ga0495629_0006134 | 3300046459 | Bacteria | 8928 |
| 486 | Ga0495629_0007439 | 3300046459 | Bacteria | 8065 |
| 487 | Ga0495629_0009629 | 3300046459 | Bacteria | 7057 |
| 488 | Ga0495629_0010882 | 3300046459 | Bacteria | 6615 |
| 489 | Ga0495629_0015811 | 3300046459 | Bacteria | 5419 |
| 490 | Ga0495629_0080429 | 3300046459 | Bacteria | 2275 |
| 491 | Ga0495629_0090466 | 3300046459 | Bacteria | 2135 |
| 492 | Ga0495629_0152283 | 3300046459 | Bacteria | 1607 |
| 493 | Ga0495638_0027234 | 3300046460 | Bacteria | 3701 |
| 494 | Ga0495638_0106309 | 3300046460 | Bacteria | 1672 |
| 495 | Ga0495641_0012844 | 3300046461 | Bacteria | 4649 |
| 496 | Ga0495641_0024166 | 3300046461 | Bacteria | 3003 |
| 497 | Ga0495651_0004947 | 3300046462 | Bacteria | 10182 |
| 498 | Ga0495651_0026690 | 3300046462 | Bacteria | 4497 |
| 499 | Ga0495651_0051177 | 3300046462 | Bacteria | 3186 |
| 500 | Ga0495651_0056803 | 3300046462 | Bacteria | 3006 |
| 501 | Ga0495651_0081505 | 3300046462 | Bacteria | 2442 |
| 502 | Ga0495651_0085694 | 3300046462 | Bacteria | 2372 |
| 503 | Ga0495653_0000758 | 3300046463 | Bacteria | 24734 |
| 504 | Ga0495653_0001028 | 3300046463 | Bacteria | 21502 |
| 505 | Ga0495653_0017059 | 3300046463 | Bacteria | 5907 |
| 506 | Ga0495653_0028278 | 3300046463 | Bacteria | 4483 |
| 507 | Ga0495653_0030050 | 3300046463 | Bacteria | 4332 |
| 508 | Ga0495653_0044277 | 3300046463 | Bacteria | 3454 |
| 509 | Ga0495653_0054011 | 3300046463 | Bacteria | 3071 |
| 510 | Ga0495650_0000381 | 3300046471 | Bacteria | 76364 |
| 511 | Ga0495650_0059390 | 3300046471 | Bacteria | 1540 |
| 512 | Ga0495580_0000419 | 3300046472 | Bacteria | 35257 |
| 513 | Ga0495580_0000778 | 3300046472 | Bacteria | 27449 |
| 514 | Ga0495580_0001707 | 3300046472 | Bacteria | 19290 |
| 515 | Ga0495580_0002281 | 3300046472 | Bacteria | 16741 |
| 516 | Ga0495580_0003210 | 3300046472 | Bacteria | 14000 |
| 517 | Ga0495580_0005083 | 3300046472 | Bacteria | 10959 |
| 518 | Ga0495580_0007991 | 3300046472 | Bacteria | 8453 |
| 519 | Ga0495580_0013903 | 3300046472 | Bacteria | 6127 |
| 520 | Ga0495580_0016823 | 3300046472 | Bacteria | 5486 |
| 521 | Ga0495580_0017866 | 3300046472 | Bacteria | 5290 |
| 522 | Ga0495580_0060764 | 3300046472 | Bacteria | 2654 |
| 523 | Ga0495580_0083237 | 3300046472 | Bacteria | 2230 |
| 524 | Ga0495580_0113618 | 3300046472 | Bacteria | 1881 |
| 525 | Ga0495582_0000907 | 3300046473 | Bacteria | 16487 |
| 526 | Ga0495582_0043056 | 3300046473 | Bacteria | 2486 |
| 527 | Ga0495582_0093040 | 3300046473 | Bacteria | 1682 |
| 528 | Ga0495605_0003284 | 3300046474 | Bacteria | 9693 |
| 529 | Ga0495605_0014648 | 3300046474 | Bacteria | 4287 |
| 530 | Ga0495605_0029934 | 3300046474 | Bacteria | 2796 |
| 531 | Ga0495639_0045956 | 3300046475 | Bacteria | 1976 |
| 532 | Ga0495662_0004199 | 3300046476 | Bacteria | 7255 |
| 533 | Ga0495662_0069940 | 3300046476 | Bacteria | 1700 |
| 534 | Ga0495664_0020804 | 3300046477 | Bacteria | 3787 |
| 535 | Ga0495664_0031579 | 3300046477 | Bacteria | 3106 |
| 536 | Ga0495664_0087725 | 3300046477 | Bacteria | 1869 |
| 537 | Ga0495664_0145195 | 3300046477 | Bacteria | 1438 |
| 538 | Ga0495664_0179700 | 3300046477 | Bacteria | 1283 |
| 539 | Ga0495664_0296435 | 3300046477 | Bacteria | 976 |
| 540 | Ga0495584_0208137 | 3300046491 | Bacteria | 994 |
| 541 | Ga0495585_0016913 | 3300046492 | Bacteria | 4224 |
| 542 | Ga0495594_0034844 | 3300046499 | Bacteria | 2740 |
| 543 | Ga0495594_0071898 | 3300046499 | Bacteria | 1924 |
| 544 | Ga0495594_0073590 | 3300046499 | Bacteria | 1902 |
| 545 | Ga0495594_0272794 | 3300046499 | Bacteria | 964 |
| 546 | Ga0495607_0077238 | 3300046501 | Bacteria | 1840 |
| 547 | Ga0495607_0095292 | 3300046501 | Bacteria | 1604 |
| 548 | Ga0495583_0004535 | 3300046506 | Bacteria | 9889 |
| 549 | Ga0495583_0009334 | 3300046506 | Bacteria | 5872 |
| 550 | Ga0495583_0009898 | 3300046506 | Bacteria | 5638 |
| 551 | Ga0495583_0012477 | 3300046506 | Bacteria | 4804 |
| 552 | Ga0495583_0058614 | 3300046506 | Bacteria | 1728 |
| 553 | Ga0495606_0000203 | 3300046507 | Bacteria | 103887 |
| 554 | Ga0495606_0000692 | 3300046507 | Bacteria | 52383 |
| 555 | Ga0495606_0001032 | 3300046507 | Bacteria | 40368 |
| 556 | Ga0495606_0009353 | 3300046507 | Bacteria | 8301 |
| 557 | Ga0495606_0044799 | 3300046507 | Bacteria | 2939 |
| 558 | Ga0495606_0106311 | 3300046507 | Bacteria | 1699 |
| 559 | Ga0495608_0006951 | 3300046511 | Bacteria | 8011 |
| 560 | Ga0495608_0032001 | 3300046511 | Bacteria | 3555 |
| 561 | Ga0495608_0141641 | 3300046511 | Bacteria | 1534 |
| 562 | Ga0495610_0011552 | 3300046512 | Bacteria | 5389 |
| 563 | Ga0495616_0000116 | 3300046513 | Bacteria | 70266 |
| 564 | Ga0495616_0129447 | 3300046513 | Bacteria | 1158 |
| 565 | Ga0495618_0005709 | 3300046514 | Bacteria | 7563 |
| 566 | Ga0495618_0025527 | 3300046514 | Bacteria | 3668 |
| 567 | Ga0495618_0029626 | 3300046514 | Bacteria | 3415 |
| 568 | Ga0495618_0042585 | 3300046514 | Bacteria | 2862 |
| 569 | Ga0495618_0057352 | 3300046514 | Bacteria | 2466 |
| 570 | Ga0495618_0129525 | 3300046514 | Bacteria | 1614 |
| 571 | Ga0495620_0002388 | 3300046515 | Bacteria | 10881 |
| 572 | Ga0495620_0010623 | 3300046515 | Bacteria | 4848 |
| 573 | Ga0495628_0004687 | 3300046516 | Bacteria | 12063 |
| 574 | Ga0495628_0029156 | 3300046516 | Bacteria | 4478 |
| 575 | Ga0495628_0032687 | 3300046516 | Bacteria | 4198 |
| 576 | Ga0495628_0036053 | 3300046516 | Bacteria | 3972 |
| 577 | Ga0495628_0038761 | 3300046516 | Bacteria | 3812 |
| 578 | Ga0495628_0049761 | 3300046516 | Bacteria | 3317 |
| 579 | Ga0495628_0133538 | 3300046516 | Bacteria | 1898 |
| 580 | Ga0495628_0192709 | 3300046516 | Bacteria | 1538 |
| 581 | Ga0495628_0236420 | 3300046516 | Bacteria | 1368 |
| 582 | Ga0495628_0612997 | 3300046516 | Bacteria | 776 |
| 583 | Ga0495630_0009808 | 3300046517 | Bacteria | 6894 |
| 584 | Ga0495630_0018598 | 3300046517 | Bacteria | 5106 |
| 585 | Ga0495630_0027118 | 3300046517 | Bacteria | 4246 |
| 586 | Ga0495630_0037973 | 3300046517 | Bacteria | 3601 |
| 587 | Ga0495630_0039716 | 3300046517 | Bacteria | 3518 |
| 588 | Ga0495630_0164729 | 3300046517 | Bacteria | 1688 |
| 589 | Ga0495630_0231582 | 3300046517 | Bacteria | 1411 |
| 590 | Ga0495631_0000069 | 3300046518 | Bacteria | 64689 |
| 591 | Ga0495632_0060074 | 3300046519 | Bacteria | 1848 |
| 592 | Ga0495648_0006147 | 3300046524 | Bacteria | 9842 |
| 593 | Ga0495648_0007831 | 3300046524 | Bacteria | 8501 |
| 594 | Ga0495648_0008817 | 3300046524 | Bacteria | 7890 |
| 595 | Ga0495648_0019853 | 3300046524 | Bacteria | 4705 |
| 596 | Ga0495648_0027844 | 3300046524 | Bacteria | 3775 |
| 597 | Ga0495648_0038688 | 3300046524 | Bacteria | 3046 |
| 598 | Ga0495648_0060329 | 3300046524 | Bacteria | 2257 |
| 599 | Ga0495648_0061874 | 3300046524 | Bacteria | 2220 |
| 600 | Ga0495666_0004629 | 3300046526 | Bacteria | 6955 |
| 601 | Ga0495666_0050392 | 3300046526 | Bacteria | 2001 |
| 602 | Ga0495642_0026693 | 3300046528 | Bacteria | 2295 |
| 603 | Ga0495652_0007447 | 3300046529 | Bacteria | 10088 |
| 604 | Ga0495652_0027329 | 3300046529 | Bacteria | 5027 |
| 605 | Ga0495652_0031835 | 3300046529 | Bacteria | 4616 |
| 606 | Ga0495652_0062673 | 3300046529 | Bacteria | 3135 |
| 607 | Ga0495652_0107929 | 3300046529 | Bacteria | 2244 |
| 608 | Ga0495652_0191114 | 3300046529 | Bacteria | 1562 |
| 609 | Ga0495652_0200248 | 3300046529 | Bacteria | 1516 |
| 610 | Ga0495652_0394374 | 3300046529 | Bacteria | 981 |
| 611 | Ga0495652_0581028 | 3300046529 | Bacteria | 767 |
| 612 | Ga0495652_0600439 | 3300046529 | Bacteria | 751 |
| 613 | Ga0495665_0000798 | 3300046531 | Bacteria | 16499 |
| 614 | Ga0495665_0020853 | 3300046531 | Bacteria | 3520 |
| 615 | Ga0495665_0047687 | 3300046531 | Bacteria | 2272 |
| 616 | Ga0495665_0053787 | 3300046531 | Bacteria | 2128 |
| 617 | Ga0495665_0096953 | 3300046531 | Bacteria | 1548 |
| 618 | Ga0495640_0032636 | 3300046533 | Bacteria | 3708 |
| 619 | Ga0495640_0045323 | 3300046533 | Bacteria | 3052 |
| 620 | Ga0495640_0079570 | 3300046533 | Bacteria | 2182 |
| 621 | Ga0495640_0125675 | 3300046533 | Bacteria | 1663 |
| 622 | Ga0495640_0154943 | 3300046533 | Bacteria | 1471 |
| 623 | Ga0495586_0015609 | 3300046535 | Bacteria | 4041 |
| 624 | Ga0495586_0039893 | 3300046535 | Bacteria | 2525 |
| 625 | Ga0495586_0136360 | 3300046535 | Bacteria | 1376 |
| 626 | Ga0495587_0001951 | 3300046536 | Bacteria | 13745 |
| 627 | Ga0495587_0005871 | 3300046536 | Bacteria | 7997 |
| 628 | Ga0495587_0022642 | 3300046536 | Bacteria | 3867 |
| 629 | Ga0495597_0026731 | 3300046542 | Bacteria | 2651 |
| 630 | Ga0495597_0138913 | 3300046542 | Bacteria | 1003 |
| 631 | Ga0495645_0003851 | 3300046543 | Bacteria | 10213 |
| 632 | Ga0495645_0007764 | 3300046543 | Bacteria | 7461 |
| 633 | Ga0495645_0009211 | 3300046543 | Bacteria | 6900 |
| 634 | Ga0495645_0011571 | 3300046543 | Bacteria | 6213 |
| 635 | Ga0495645_0011886 | 3300046543 | Bacteria | 6135 |
| 636 | Ga0495645_0019759 | 3300046543 | Bacteria | 4853 |
| 637 | Ga0495645_0059337 | 3300046543 | Bacteria | 2774 |
| 638 | Ga0495645_0127517 | 3300046543 | Bacteria | 1787 |
| 639 | Ga0495645_0197811 | 3300046543 | Bacteria | 1365 |
| 640 | Ga0495645_0296145 | 3300046543 | Bacteria | 1058 |
| 641 | Ga0495645_0297883 | 3300046543 | Bacteria | 1055 |
| 642 | Ga0495622_0147896 | 3300046557 | Bacteria | 1064 |
| 643 | Ga0495667_0002860 | 3300046559 | Bacteria | 11552 |
| 644 | Ga0495667_0022779 | 3300046559 | Bacteria | 4219 |
| 645 | Ga0495667_0175219 | 3300046559 | Bacteria | 1377 |
| 646 | Ga0495668_0028972 | 3300046616 | Bacteria | 3130 |
| 647 | Ga0495634_0002038 | 3300046642 | Bacteria | 17149 |
| 648 | Ga0495634_0056867 | 3300046642 | Bacteria | 2612 |
| 649 | Ga0495611_0000109 | 3300046648 | Bacteria | 57832 |
| 650 | Ga0495611_0158778 | 3300046648 | Bacteria | 1056 |
| 651 | Ga0495625_0002524 | 3300046660 | Bacteria | 19691 |
| 652 | Ga0495625_0003969 | 3300046660 | Bacteria | 14193 |
| 653 | Ga0495625_0017872 | 3300046660 | Bacteria | 5543 |
| 654 | Ga0495625_0020607 | 3300046660 | Bacteria | 5086 |
| 655 | Ga0495625_0052757 | 3300046660 | Bacteria | 2911 |
| 656 | Ga0495625_0164231 | 3300046660 | Bacteria | 1486 |
| 657 | Ga0495625_0257888 | 3300046660 | Bacteria | 1129 |
| 658 | Ga0495635_0002608 | 3300046663 | Bacteria | 12347 |
| 659 | Ga0495635_0010805 | 3300046663 | Bacteria | 6397 |
| 660 | Ga0495635_0011344 | 3300046663 | Bacteria | 6251 |
| 661 | Ga0495635_0021204 | 3300046663 | Bacteria | 4529 |
| 662 | Ga0495635_0045742 | 3300046663 | Bacteria | 3019 |
| 663 | Ga0495635_0075085 | 3300046663 | Bacteria | 2316 |
| 664 | Ga0495635_0093245 | 3300046663 | Bacteria | 2059 |
| 665 | Ga0495635_0263977 | 3300046663 | Bacteria | 1159 |
| 666 | Ga0495588_0026520 | 3300046674 | Bacteria | 2894 |
| 667 | Ga0495588_0075287 | 3300046674 | Bacteria | 1758 |
| 668 | Ga0495657_0006712 | 3300046675 | Bacteria | 8976 |
| 669 | Ga0495657_0022664 | 3300046675 | Bacteria | 4494 |
| 670 | Ga0495657_0023905 | 3300046675 | Bacteria | 4361 |
| 671 | Ga0495657_0102033 | 3300046675 | Bacteria | 1827 |
| 672 | Ga0495599_0012930 | 3300046678 | Bacteria | 5152 |
| 673 | Ga0495599_0014888 | 3300046678 | Bacteria | 4817 |
| 674 | Ga0495599_0020987 | 3300046678 | Bacteria | 4072 |
| 675 | Ga0495599_0030559 | 3300046678 | Bacteria | 3380 |
| 676 | Ga0495599_0135194 | 3300046678 | Bacteria | 1530 |
| 677 | Ga0495599_0213060 | 3300046678 | Bacteria | 1184 |
| 678 | Ga0495623_0005652 | 3300046679 | Bacteria | 8162 |
| 679 | Ga0495623_0030187 | 3300046679 | Bacteria | 3487 |
| 680 | Ga0495623_0032873 | 3300046679 | Bacteria | 3332 |
| 681 | Ga0495623_0071474 | 3300046679 | Bacteria | 2159 |
| 682 | Ga0495623_0302340 | 3300046679 | Bacteria | 883 |
| 683 | Ga0495646_0011648 | 3300046680 | Bacteria | 5588 |
| 684 | Ga0495646_0015159 | 3300046680 | Bacteria | 4896 |
| 685 | Ga0495646_0015358 | 3300046680 | Bacteria | 4860 |
| 686 | Ga0495646_0016238 | 3300046680 | Bacteria | 4727 |
| 687 | Ga0495646_0033405 | 3300046680 | Bacteria | 3197 |
| 688 | Ga0495646_0078340 | 3300046680 | Bacteria | 1931 |
| 689 | Ga0495646_0186653 | 3300046680 | Bacteria | 1135 |
| 690 | Ga0495647_0229089 | 3300046681 | Bacteria | 822 |
| 691 | Ga0495658_0033231 | 3300046683 | Bacteria | 2823 |
| 692 | Ga0495658_0112330 | 3300046683 | Bacteria | 1639 |
| 693 | Ga0495658_0205972 | 3300046683 | Bacteria | 1227 |
| 694 | Ga0495669_0071108 | 3300046684 | Bacteria | 1586 |
| 695 | Ga0495613_0013059 | 3300046689 | Bacteria | 6172 |
| 696 | Ga0495613_0026308 | 3300046689 | Bacteria | 4335 |
| 697 | Ga0495613_0066328 | 3300046689 | Bacteria | 2636 |
| 698 | Ga0495613_0099243 | 3300046689 | Bacteria | 2104 |
| 699 | Ga0495624_0002034 | 3300046690 | Bacteria | 15414 |
| 700 | Ga0495624_0011981 | 3300046690 | Bacteria | 5942 |
| 701 | Ga0495624_0033750 | 3300046690 | Bacteria | 3313 |
| 702 | Ga0495624_0057855 | 3300046690 | Bacteria | 2436 |
| 703 | Ga0495624_0109557 | 3300046690 | Bacteria | 1698 |
| 704 | Ga0495624_0148717 | 3300046690 | Bacteria | 1433 |
| 705 | Ga0495670_0014902 | 3300046691 | Bacteria | 3827 |
| 706 | Ga0495670_0350839 | 3300046691 | Bacteria | 794 |
| 707 | Ga0495671_0003529 | 3300046692 | Bacteria | 9566 |
| 708 | Ga0495671_0026283 | 3300046692 | Bacteria | 3019 |
| 709 | Ga0495649_0008663 | 3300046694 | Bacteria | 6107 |
| 710 | Ga0495649_0016496 | 3300046694 | Bacteria | 4186 |
| 711 | Ga0495589_0075469 | 3300046794 | Bacteria | 1644 |
| 712 | Ga0495589_0109845 | 3300046794 | Bacteria | 1331 |
| 713 | Ga0495600_0001440 | 3300046809 | Bacteria | 13170 |
| 714 | Ga0495600_0030769 | 3300046809 | Bacteria | 3476 |
| 715 | Ga0495600_0033670 | 3300046809 | Bacteria | 3325 |
| 716 | Ga0495600_0072585 | 3300046809 | Bacteria | 2248 |
| 717 | Ga0495600_0074868 | 3300046809 | Bacteria | 2211 |
| 718 | Ga0495660_0252257 | 3300046810 | Bacteria | 818 |
| 719 | Ga0495581_0020613 | 3300047315 | Bacteria | 3825 |
| 720 | Ga0495581_0043353 | 3300047315 | Bacteria | 2602 |
| 721 | Ga0495604_0004620 | 3300047317 | Bacteria | 10909 |
| 722 | Ga0495604_0006454 | 3300047317 | Bacteria | 9303 |
| 723 | Ga0495604_0013770 | 3300047317 | Bacteria | 6448 |
| 724 | Ga0495604_0054220 | 3300047317 | Bacteria | 3095 |
| 725 | Ga0495604_0055791 | 3300047317 | Bacteria | 3044 |
| 726 | Ga0495604_0099714 | 3300047317 | Bacteria | 2137 |
| 727 | Ga0495604_0235045 | 3300047317 | Bacteria | 1256 |
| 728 | Ga0495604_0362145 | 3300047317 | Bacteria | 961 |
| 729 | Ga0495674_0002437 | 3300047319 | Bacteria | 18178 |
| 730 | Ga0495674_0005963 | 3300047319 | Bacteria | 11688 |
| 731 | Ga0495674_0007367 | 3300047319 | Bacteria | 10523 |
| 732 | Ga0495674_0009273 | 3300047319 | Bacteria | 9352 |
| 733 | Ga0495674_0011092 | 3300047319 | Bacteria | 8508 |
| 734 | Ga0495674_0016409 | 3300047319 | Bacteria | 6906 |
| 735 | Ga0495674_0022547 | 3300047319 | Bacteria | 5807 |
| 736 | Ga0495674_0031064 | 3300047319 | Bacteria | 4854 |
| 737 | Ga0495674_0053595 | 3300047319 | Bacteria | 3544 |
| 738 | Ga0495674_0060530 | 3300047319 | Bacteria | 3303 |
| 739 | Ga0495674_0081827 | 3300047319 | Bacteria | 2769 |
| 740 | Ga0495674_0263174 | 3300047319 | Bacteria | 1416 |
| 741 | Ga0495674_0400227 | 3300047319 | Bacteria | 1108 |
| 742 | Ga0495672_0011287 | 3300047320 | Bacteria | 6314 |
| 743 | Ga0495672_0025928 | 3300047320 | Bacteria | 3747 |
| 744 | Ga0495672_0065449 | 3300047320 | Bacteria | 2078 |
| 745 | Ga0495672_0084691 | 3300047320 | Bacteria | 1758 |
| 746 | Ga0495672_0111248 | 3300047320 | Bacteria | 1469 |
| 747 | Ga0495676_0032839 | 3300047321 | Bacteria | 4377 |
| 748 | Ga0495676_0042197 | 3300047321 | Bacteria | 3747 |
| 749 | Ga0495676_0047871 | 3300047321 | Bacteria | 3452 |
| 750 | Ga0495676_0065644 | 3300047321 | Bacteria | 2816 |
| 751 | Ga0495676_0338394 | 3300047321 | Bacteria | 1008 |
| 752 | Ga0495680_0004577 | 3300047322 | Bacteria | 13191 |
| 753 | Ga0495680_0013421 | 3300047322 | Bacteria | 7148 |
| 754 | Ga0495680_0035099 | 3300047322 | Bacteria | 4042 |
| 755 | Ga0495680_0046247 | 3300047322 | Bacteria | 3432 |
| 756 | Ga0495680_0062788 | 3300047322 | Bacteria | 2855 |
| 757 | Ga0495680_0402124 | 3300047322 | Bacteria | 945 |
| 758 | Ga0495680_0404741 | 3300047322 | Bacteria | 941 |
| 759 | Ga0495680_0454935 | 3300047322 | Bacteria | 876 |
| 760 | Ga0495683_0001084 | 3300047323 | Bacteria | 18805 |
| 761 | Ga0495683_0001161 | 3300047323 | Bacteria | 18053 |
| 762 | Ga0495683_0005347 | 3300047323 | Bacteria | 7131 |
| 763 | Ga0495683_0009237 | 3300047323 | Bacteria | 5255 |
| 764 | Ga0495683_0018081 | 3300047323 | Bacteria | 3648 |
| 765 | Ga0495683_0085772 | 3300047323 | Bacteria | 1530 |
| 766 | Ga0495683_0189249 | 3300047323 | Bacteria | 935 |
| 767 | Ga0495687_005866 | 3300047443 | Bacteria | 7687 |
| 768 | Ga0495687_008121 | 3300047443 | Bacteria | 6059 |
| 769 | Ga0495687_013195 | 3300047443 | Bacteria | 4325 |
| 770 | Ga0495687_020586 | 3300047443 | Bacteria | 3211 |
| 771 | Ga0495687_028943 | 3300047443 | Bacteria | 2570 |
| 772 | Ga0495687_086983 | 3300047443 | Bacteria | 1207 |
| 773 | Ga0495675_0006549 | 3300047444 | Bacteria | 7132 |
| 774 | Ga0495675_0043545 | 3300047444 | Bacteria | 2860 |
| 775 | Ga0495675_0101006 | 3300047444 | Bacteria | 1805 |
| 776 | Ga0495675_0132239 | 3300047444 | Bacteria | 1550 |
| 777 | Ga0495677_0004263 | 3300047445 | Bacteria | 5502 |
| 778 | Ga0495677_0005306 | 3300047445 | Bacteria | 4890 |
| 779 | Ga0495677_0024924 | 3300047445 | Bacteria | 2170 |
| 780 | Ga0495679_000025 | 3300047446 | Bacteria | 198386 |
| 781 | Ga0495679_000641 | 3300047446 | Bacteria | 23464 |
| 782 | Ga0495679_035792 | 3300047446 | Bacteria | 1571 |
| 783 | Ga0495673_0000018 | 3300047469 | Bacteria | 569190 |
| 784 | Ga0495673_0010794 | 3300047469 | Bacteria | 4947 |
| 785 | Ga0495673_0014306 | 3300047469 | Bacteria | 4128 |
| 786 | Ga0495673_0062553 | 3300047469 | Bacteria | 1589 |
| 787 | Ga0495673_0087294 | 3300047469 | Bacteria | 1280 |
| 788 | Ga0495681_0000595 | 3300047470 | Bacteria | 27599 |
| 789 | Ga0495684_0049908 | 3300047471 | Bacteria | 3196 |
| 790 | Ga0495684_0087347 | 3300047471 | Bacteria | 2363 |
| 791 | Ga0495684_0118252 | 3300047471 | Bacteria | 1997 |
| 792 | Ga0495684_0257696 | 3300047471 | Bacteria | 1266 |
| 793 | Ga0495686_0001115 | 3300047472 | Bacteria | 31814 |
| 794 | Ga0495686_0027219 | 3300047472 | Bacteria | 3735 |
| 795 | Ga0495686_0074520 | 3300047472 | Bacteria | 2082 |
| 796 | Ga0495686_0087841 | 3300047472 | Bacteria | 1891 |
| 797 | Ga0495686_0267276 | 3300047472 | Bacteria | 955 |
| 798 | Ga0495593_0001947 | 3300047673 | Bacteria | 12321 |
| 799 | Ga0495593_0013548 | 3300047673 | Bacteria | 4648 |
| 800 | Ga0495593_0015253 | 3300047673 | Bacteria | 4358 |
| 801 | Ga0495593_0033195 | 3300047673 | Bacteria | 2812 |
| 802 | Ga0495593_0042878 | 3300047673 | Bacteria | 2427 |
| 803 | Ga0495593_0051120 | 3300047673 | Bacteria | 2187 |
| 804 | Ga0495602_0025102 | 3300048088 | Bacteria | 5773 |
| 805 | Ga0495602_0034148 | 3300048088 | Bacteria | 4762 |
| 806 | Ga0495602_0048619 | 3300048088 | Bacteria | 3809 |
| 807 | Ga0495602_0065291 | 3300048088 | Bacteria | 3142 |
| 808 | Ga0495602_0077182 | 3300048088 | Bacteria | 2819 |
| 809 | Ga0495602_0234150 | 3300048088 | Bacteria | 1377 |
| 810 | Ga0495602_0241886 | 3300048088 | Bacteria | 1350 |
| 811 | Ga0495602_0252976 | 3300048088 | Bacteria | 1312 |
| 812 | Ga0495602_0310650 | 3300048088 | Bacteria | 1150 |
| 813 | Ga0495602_0444999 | 3300048088 | Bacteria | 915 |
| 814 | Ga0495602_0551281 | 3300048088 | Bacteria | 799 |
| 815 | Ga0495614_0002694 | 3300048089 | Bacteria | 7895 |
| 816 | Ga0495614_0034222 | 3300048089 | Bacteria | 2184 |
| 817 | Ga0495614_0048179 | 3300048089 | Bacteria | 1827 |
| 818 | Ga0495626_0051436 | 3300048091 | Bacteria | 1900 |
| 819 | Ga0495626_0082751 | 3300048091 | Bacteria | 1423 |
| 820 | Ga0496100_0000408 | 3300048903 | Bacteria | 20729 |
| 821 | Ga0496100_0007056 | 3300048903 | Bacteria | 6164 |
| 822 | Ga0496100_0070371 | 3300048903 | Bacteria | 2333 |
| 823 | Ga0496100_0082018 | 3300048903 | Bacteria | 2180 |
| 824 | Ga0496100_0256490 | 3300048903 | Bacteria | 1295 |
| 825 | Ga0496100_0474065 | 3300048903 | Bacteria | 962 |
| 826 | Ga0496101_0000741 | 3300048904 | Bacteria | 19422 |
| 827 | Ga0496101_0004013 | 3300048904 | Bacteria | 9200 |
| 828 | Ga0496101_0009987 | 3300048904 | Bacteria | 6255 |
| 829 | Ga0496101_0013858 | 3300048904 | Bacteria | 5411 |
| 830 | Ga0496101_0025872 | 3300048904 | Bacteria | 4075 |
| 831 | Ga0496101_0032749 | 3300048904 | Bacteria | 3661 |
| 832 | Ga0496101_0464546 | 3300048904 | Bacteria | 999 |
| 833 | Ga0496101_0570527 | 3300048904 | Bacteria | 895 |
| 834 | Ga0496102_0000675 | 3300048905 | Bacteria | 34171 |
| 835 | Ga0496102_0002308 | 3300048905 | Bacteria | 16298 |
| 836 | Ga0496102_0106287 | 3300048905 | Bacteria | 2612 |
| 837 | Ga0496102_0179842 | 3300048905 | Bacteria | 1992 |
| 838 | Ga0496102_0448606 | 3300048905 | Bacteria | 1210 |
| 839 | Ga0496103_0001501 | 3300048906 | Bacteria | 15620 |
| 840 | Ga0496103_0012537 | 3300048906 | Bacteria | 5026 |
| 841 | Ga0496103_0018046 | 3300048906 | Bacteria | 4229 |
| 842 | Ga0496103_0062856 | 3300048906 | Bacteria | 2312 |
| 843 | Ga0496104_0002120 | 3300048907 | Bacteria | 17226 |
| 844 | Ga0496104_0006567 | 3300048907 | Bacteria | 10231 |
| 845 | Ga0496104_0016640 | 3300048907 | Bacteria | 6683 |
| 846 | Ga0496104_0018398 | 3300048907 | Bacteria | 6374 |
| 847 | Ga0496104_0165826 | 3300048907 | Bacteria | 2118 |
| 848 | Ga0496104_0200131 | 3300048907 | Bacteria | 1909 |
| 849 | Ga0496104_0208176 | 3300048907 | Bacteria | 1868 |
| 850 | Ga0496104_0455112 | 3300048907 | Unclassified | 1192 |
| 851 | Ga0496105_0003608 | 3300048908 | Bacteria | 11494 |
| 852 | Ga0496105_0009503 | 3300048908 | Bacteria | 7607 |
| 853 | Ga0496105_0016299 | 3300048908 | Bacteria | 5931 |
| 854 | Ga0496105_0027223 | 3300048908 | Bacteria | 4668 |
| 855 | Ga0496105_0032526 | 3300048908 | Bacteria | 4281 |
| 856 | Ga0496105_0209434 | 3300048908 | Bacteria | 1589 |
| 857 | Ga0496105_0351814 | 3300048908 | Bacteria | 1176 |
| 858 | Ga0496105_0542947 | 3300048908 | Bacteria | 908 |
| 859 | Ga0496106_0000079 | 3300048909 | Bacteria | 77180 |
| 860 | Ga0496106_0002768 | 3300048909 | Bacteria | 12994 |
| 861 | Ga0496106_0053974 | 3300048909 | Bacteria | 3036 |
| 862 | Ga0496106_0584341 | 3300048909 | Bacteria | 895 |
| 863 | Ga0496107_0000825 | 3300048910 | Bacteria | 18053 |
| 864 | Ga0496107_0037326 | 3300048910 | Bacteria | 3486 |
| 865 | Ga0496107_0073861 | 3300048910 | Bacteria | 2481 |
| 866 | Ga0496107_0525558 | 3300048910 | Bacteria | 877 |
| 867 | Ga0496108_0040495 | 3300048911 | Bacteria | 3884 |
| 868 | Ga0496108_0060214 | 3300048911 | Bacteria | 3194 |
| 869 | Ga0496108_0061903 | 3300048911 | Bacteria | 3151 |
| 870 | Ga0496108_0073757 | 3300048911 | Bacteria | 2881 |
| 871 | Ga0496108_0082380 | 3300048911 | Bacteria | 2728 |
| 872 | Ga0496108_0085611 | 3300048911 | Bacteria | 2676 |
| 873 | Ga0496108_0133704 | 3300048911 | Bacteria | 2132 |
| 874 | Ga0496108_0142449 | 3300048911 | Bacteria | 2065 |
| 875 | Ga0496108_0303240 | 3300048911 | Bacteria | 1391 |
| 876 | Ga0496109_0022239 | 3300048912 | Bacteria | 5615 |
| 877 | Ga0496109_0129474 | 3300048912 | Bacteria | 2355 |
| 878 | Ga0496110_0038825 | 3300048913 | Bacteria | 4144 |
| 879 | Ga0496110_0079539 | 3300048913 | Bacteria | 2919 |
| 880 | Ga0496111_0353288 | 3300048914 | Bacteria | 1088 |
| 881 | Ga0496112_0003459 | 3300048915 | Bacteria | 13049 |
| 882 | Ga0496112_0074495 | 3300048915 | Bacteria | 3356 |
| 883 | Ga0496112_0100860 | 3300048915 | Bacteria | 2856 |
| 884 | Ga0496112_0138942 | 3300048915 | Bacteria | 2399 |
| 885 | Ga0496112_0377530 | 3300048915 | Bacteria | 1359 |
| 886 | Ga0496112_0683148 | 3300048915 | Bacteria | 955 |
| 887 | Ga0496113_0092536 | 3300048916 | Bacteria | 2332 |
| 888 | Ga0496113_0259193 | 3300048916 | Bacteria | 1389 |
| 889 | Ga0496114_0003137 | 3300048917 | Bacteria | 12682 |
| 890 | Ga0496114_0057284 | 3300048917 | Bacteria | 3253 |
| 891 | Ga0496114_0082165 | 3300048917 | Bacteria | 2723 |
| 892 | Ga0496114_0179592 | 3300048917 | Bacteria | 1848 |
| 893 | Ga0496114_0202889 | 3300048917 | Bacteria | 1737 |
| 894 | Ga0496114_0309965 | 3300048917 | Bacteria | 1394 |
| 895 | Ga0496115_0027281 | 3300048918 | Bacteria | 4465 |
| 896 | Ga0496115_0106461 | 3300048918 | Bacteria | 2302 |
| 897 | Ga0496115_0567962 | 3300048918 | Bacteria | 905 |
| 898 | Ga0496117_0001301 | 3300048920 | Bacteria | 36722 |
| 899 | Ga0496117_0061746 | 3300048920 | Bacteria | 2573 |
| 900 | Ga0496117_0098243 | 3300048920 | Bacteria | 1862 |
| 901 | Ga0496117_0148230 | 3300048920 | Bacteria | 1393 |
| 902 | Ga0496118_0000400 | 3300048921 | Bacteria | 73227 |
| 903 | Ga0496118_0001513 | 3300048921 | Bacteria | 34617 |
| 904 | Ga0496118_0001539 | 3300048921 | Bacteria | 34281 |
| 905 | Ga0496118_0028560 | 3300048921 | Bacteria | 4695 |
| 906 | Ga0496118_0041020 | 3300048921 | Bacteria | 3671 |
| 907 | Ga0496118_0043130 | 3300048921 | Bacteria | 3550 |
| 908 | Ga0496119_0008905 | 3300048922 | Bacteria | 8728 |
| 909 | Ga0496119_0025360 | 3300048922 | Bacteria | 4143 |
| 910 | Ga0496119_0044660 | 3300048922 | Bacteria | 2787 |
| 911 | Ga0496119_0065612 | 3300048922 | Bacteria | 2149 |
| 912 | Ga0496119_0249949 | 3300048922 | Bacteria | 894 |
| 913 | Ga0496120_0001962 | 3300048923 | Bacteria | 22491 |
| 914 | Ga0496121_0000557 | 3300048924 | Bacteria | 70347 |
| 915 | Ga0496121_0002449 | 3300048924 | Bacteria | 28376 |
| 916 | Ga0496121_0007417 | 3300048924 | Bacteria | 13253 |
| 917 | Ga0496121_0013070 | 3300048924 | Bacteria | 8963 |
| 918 | Ga0496121_0013692 | 3300048924 | Bacteria | 8694 |
| 919 | Ga0496121_0017674 | 3300048924 | Bacteria | 7259 |
| 920 | Ga0496121_0019038 | 3300048924 | Bacteria | 6888 |
| 921 | Ga0496121_0019154 | 3300048924 | Bacteria | 6859 |
| 922 | Ga0496121_0025055 | 3300048924 | Bacteria | 5678 |
| 923 | Ga0496121_0030670 | 3300048924 | Bacteria | 4933 |
| 924 | Ga0496121_0069969 | 3300048924 | Bacteria | 2829 |
| 925 | Ga0496121_0380460 | 3300048924 | Bacteria | 931 |
| 926 | Ga0496124_0013685 | 3300048927 | Bacteria | 7904 |
| 927 | Ga0496124_0153122 | 3300048927 | Bacteria | 1806 |
| 928 | Ga0496124_0463975 | 3300048927 | Bacteria | 860 |
| 929 | Ga0496126_0000122 | 3300048929 | Bacteria | 182785 |
| 930 | Ga0496126_0000196 | 3300048929 | Bacteria | 134394 |
| 931 | Ga0496126_0168295 | 3300048929 | Bacteria | 1869 |
| 932 | Ga0496126_0186526 | 3300048929 | Bacteria | 1759 |
| 933 | Ga0496126_0233703 | 3300048929 | Bacteria | 1539 |
| 934 | Ga0495682_0002681 | 3300049460 | Bacteria | 8301 |
| 935 | Ga0495682_0037028 | 3300049460 | Bacteria | 1795 |
| 936 | Ga0495682_0062470 | 3300049460 | Bacteria | 1344 |
| 937 | nmdc:mga03n38_34014_c1 | 3300050490 | Bacteria | 2173 |
| 938 | nmdc:mga00v17_188501_c1 | 3300050491 | Bacteria | 1331 |
| 939 | nmdc:mga00v17_54876_c1 | 3300050491 | Bacteria | 2431 |
| 940 | nmdc:mga00v17_974_c1 | 3300050491 | Bacteria | 15331 |
| 941 | nmdc:mga0yw44_21137_c1 | 3300050492 | Bacteria | 3626 |
| 942 | nmdc:mga0yw44_32482_c1 | 3300050492 | Bacteria | 3042 |
| 943 | nmdc:mga0yw44_34204_c1 | 3300050492 | Bacteria | 2976 |
| 944 | nmdc:mga0yw44_54893_c2 | 3300050492 | Bacteria | 1894 |
| 945 | nmdc:mga06z11_318005_c1 | 3300050494 | Bacteria | 928 |
| 946 | nmdc:mga06z11_32918_c1 | 3300050494 | Bacteria | 2531 |
| 947 | nmdc:mga08y16_1559_c1 | 3300050511 | Bacteria | 23103 |
| 948 | nmdc:mga0n895_412860_c1 | 3300050512 | Bacteria | 1365 |
| 949 | nmdc:mga0rr50_223956_c1 | 3300050513 | Bacteria | 1554 |
| 950 | nmdc:mga08x19_442795_c1 | 3300050514 | Bacteria | 914 |
| 951 | nmdc:mga0a205_433448_c1 | 3300050515 | Bacteria | 1176 |
| 952 | nmdc:mga0sz30_1052_c1 | 3300050516 | Bacteria | 9942 |
| 953 | nmdc:mga0sz30_20509_c1 | 3300050516 | Bacteria | 2667 |
| 954 | Ga0495601_0005701 | 3300053077 | Bacteria | 7257 |
| 955 | Ga0495601_0019751 | 3300053077 | Bacteria | 4111 |
| 956 | Ga0495601_0101247 | 3300053077 | Bacteria | 1861 |
| 957 | Ga0495601_0179208 | 3300053077 | Bacteria | 1385 |
| 958 | Ga0495601_0237103 | 3300053077 | Bacteria | 1191 |
| 959 | Ga0495601_0518353 | 3300053077 | Bacteria | 768 |
| 960 | Ga0495612_0000828 | 3300053078 | Bacteria | 12579 |
| 961 | Ga0495612_0082824 | 3300053078 | Bacteria | 1349 |
| 962 | Ga0495612_0148148 | 3300053078 | Bacteria | 1020 |
| 963 | Ga0495655_0005701 | 3300053083 | Bacteria | 2217 |
| 964 | Ga0495655_0082573 | 3300053083 | Bacteria | 921 |
| 965 | Ga0495595_0013219 | 3300053084 | Bacteria | 3485 |
| 966 | Ga0495595_0013691 | 3300053084 | Bacteria | 3429 |
| 967 | Ga0495595_0024180 | 3300053084 | Bacteria | 2682 |
| 968 | Ga0495595_0024548 | 3300053084 | Bacteria | 2663 |
| 969 | Ga0495619_0031537 | 3300053085 | Bacteria | 3434 |
| 970 | Ga0495619_0054149 | 3300053085 | Bacteria | 2654 |
| 971 | Ga0495619_0172739 | 3300053085 | Bacteria | 1495 |
| 972 | Ga0495619_0201876 | 3300053085 | Bacteria | 1376 |
| 973 | Ga0500578_0019927 | 3300053086 | Bacteria | 4310 |
| 974 | Ga0500644_0035958 | 3300053088 | Bacteria | 1608 |
| 975 | Ga0500644_0078885 | 3300053088 | Bacteria | 1206 |
| 976 | Ga0500646_0010555 | 3300053090 | Bacteria | 2369 |
| 977 | Ga0500556_0070598 | 3300053104 | Bacteria | 1304 |
| 978 | Ga0500560_009478 | 3300053107 | Bacteria | 2395 |
| 979 | Ga0500642_0000842 | 3300053130 | Bacteria | 8956 |
| 980 | Ga0500658_0133431 | 3300053134 | Bacteria | 1109 |
| 981 | Ga0500568_0001070 | 3300053139 | Bacteria | 18524 |
| 982 | Ga0500600_0017902 | 3300053149 | Bacteria | 4278 |
| 983 | Ga0500616_0005363 | 3300053153 | Bacteria | 8729 |
| 984 | Ga0500616_0011503 | 3300053153 | Bacteria | 5218 |
| 985 | Ga0500633_0097654 | 3300053160 | Bacteria | 1078 |
| 986 | Ga0500634_0013268 | 3300053161 | Bacteria | 4318 |
| 987 | Ga0500634_0069008 | 3300053161 | Bacteria | 1855 |
| 988 | Ga0500599_003553 | 3300053736 | Bacteria | 1906 |
| 989 | Ga0500587_011172 | 3300053739 | Bacteria | 1136 |
| 990 | Ga0466962_0233724 | 3300061719 | Bacteria | 902 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048088 | Ga0495602_0551281 | Ga0495602_0551281_157_768 | 175 |
| 2 | 3300005445 | Ga0070708_100343899 | Ga0070708_1003438992 | 182 |
| 3 | 3300005468 | Ga0070707_100240923 | Ga0070707_1002409232 | 182 |
| 4 | 3300005471 | Ga0070698_100102574 | Ga0070698_1001025742 | 182 |
| 5 | 3300039453 | Ga0436362_0083406 | Ga0436362_0083406_325_942 | 182 |
| 6 | 3300048927 | Ga0496124_0463975 | Ga0496124_0463975_18_635 | 182 |
| 7 | 3300046533 | Ga0495640_0125675 | Ga0495640_0125675_83_703 | 183 |
| 8 | 3300046557 | Ga0495622_0147896 | Ga0495622_0147896_45_665 | 183 |
| 9 | 3300046559 | Ga0495667_0175219 | Ga0495667_0175219_17_637 | 183 |
| 10 | 3300046679 | Ga0495623_0302340 | Ga0495623_0302340_20_640 | 183 |
| 11 | 3300046809 | Ga0495600_0072585 | Ga0495600_0072585_1589_2209 | 183 |
| 12 | 3300048088 | Ga0495602_0234150 | Ga0495602_0234150_17_637 | 183 |
| 13 | 3300048088 | Ga0495602_0444999 | Ga0495602_0444999_228_848 | 183 |
| 14 | 3300050514 | nmdc:mga08x19_442795_c1 | nmdc:mga08x19_442795_c1_24_644 | 183 |
| 15 | 3300031507 | Ga0307509_10006504 | Ga0307509_1000650410 | 192 |
| 16 | 3300031838 | Ga0307518_10053586 | Ga0307518_100535864 | 192 |
| 17 | 3300046674 | Ga0495588_0075287 | Ga0495588_0075287_380_1081 | 192 |
| 18 | 3300046692 | Ga0495671_0003529 | Ga0495671_0003529_7171_8028 | 192 |
| 19 | 3300047321 | Ga0495676_0338394 | Ga0495676_0338394_106_963 | 192 |
| 20 | 3300047472 | Ga0495686_0267276 | Ga0495686_0267276_54_911 | 192 |
| 21 | 3300006042 | Ga0075368_10057033 | Ga0075368_100570332 | 193 |
| 22 | 3300031838 | Ga0307518_10028846 | Ga0307518_100288464 | 193 |
| 23 | 3300050492 | nmdc:mga0yw44_21137_c1 | nmdc:mga0yw44_21137_c1_517_1248 | 193 |
| 24 | 3300050494 | nmdc:mga06z11_32918_c1 | nmdc:mga06z11_32918_c1_172_903 | 193 |
| 25 | 3300053077 | Ga0495601_0518353 | Ga0495601_0518353_14_748 | 193 |
| 26 | 3300028786 | Ga0307517_10010937 | Ga0307517_100109378 | 194 |
| 27 | 3300028794 | Ga0307515_10000262 | Ga0307515_100002629 | 194 |
| 28 | 3300030522 | Ga0307512_10091341 | Ga0307512_100913412 | 194 |
| 29 | 3300031616 | Ga0307508_10040471 | Ga0307508_100404714 | 194 |
| 30 | 3300031838 | Ga0307518_10271255 | Ga0307518_102712551 | 194 |
| 31 | 3300033179 | Ga0307507_10014440 | Ga0307507_100144406 | 194 |
| 32 | 3300046459 | Ga0495629_0003036 | Ga0495629_0003036_4537_5394 | 194 |
| 33 | 3300046491 | Ga0495584_0208137 | Ga0495584_0208137_175_909 | 194 |
| 34 | 3300046660 | Ga0495625_0002524 | Ga0495625_0002524_3254_4111 | 194 |
| 35 | 3300047470 | Ga0495681_0000595 | Ga0495681_0000595_26712_27569 | 194 |
| 36 | 3300048089 | Ga0495614_0002694 | Ga0495614_0002694_4682_5539 | 194 |
| 37 | 3300053083 | Ga0495655_0005701 | Ga0495655_0005701_155_889 | 194 |
| 38 | 3300053107 | Ga0500560_009478 | Ga0500560_009478_408_1265 | 194 |
| 39 | 3300046477 | Ga0495664_0296435 | Ga0495664_0296435_75_791 | 195 |
| 40 | 3300006038 | Ga0075365_10054713 | Ga0075365_100547132 | 196 |
| 41 | 3300006178 | Ga0075367_10019338 | Ga0075367_100193382 | 196 |
| 42 | 3300046460 | Ga0495638_0106309 | Ga0495638_0106309_741_1451 | 196 |
| 43 | 3300046499 | Ga0495594_0073590 | Ga0495594_0073590_400_1110 | 196 |
| 44 | 3300050492 | nmdc:mga0yw44_54893_c2 | nmdc:mga0yw44_54893_c2_175_909 | 196 |
| 45 | 3300053088 | Ga0500644_0035958 | Ga0500644_0035958_477_1187 | 196 |
| 46 | 3300053161 | Ga0500634_0069008 | Ga0500634_0069008_900_1610 | 196 |
| 47 | 3300006038 | Ga0075365_10020751 | Ga0075365_100207514 | 197 |
| 48 | 3300006051 | Ga0075364_10083360 | Ga0075364_100833602 | 197 |
| 49 | 3300050491 | nmdc:mga00v17_54876_c1 | nmdc:mga00v17_54876_c1_880_1593 | 197 |
| 50 | 3300050492 | nmdc:mga0yw44_34204_c1 | nmdc:mga0yw44_34204_c1_1555_2268 | 197 |
| 51 | 3300048922 | Ga0496119_0044660 | Ga0496119_0044660_750_1475 | 198 |
| 52 | 3300006914 | Ga0075436_100216038 | Ga0075436_1002160383 | 199 |
| 53 | 3300025910 | Ga0207684_10308741 | Ga0207684_103087411 | 199 |
| 54 | 3300053153 | Ga0500616_0011503 | Ga0500616_0011503_4237_4959 | 201 |
| 55 | 3300005337 | Ga0070682_100092828 | Ga0070682_1000928282 | 203 |
| 56 | 3300005616 | Ga0068852_100322707 | Ga0068852_1003227072 | 203 |
| 57 | 3300009098 | Ga0105245_10008425 | Ga0105245_100084257 | 203 |
| 58 | 3300013105 | Ga0157369_10472705 | Ga0157369_104727052 | 203 |
| 59 | 3300013307 | Ga0157372_10444023 | Ga0157372_104440232 | 203 |
| 60 | 3300025927 | Ga0207687_10044734 | Ga0207687_100447343 | 203 |
| 61 | 3300048907 | Ga0496104_0208176 | Ga0496104_0208176_409_1176 | 203 |
| 62 | 3300048911 | Ga0496108_0082380 | Ga0496108_0082380_1112_1879 | 203 |
| 63 | 3300048913 | Ga0496110_0038825 | Ga0496110_0038825_1265_2032 | 203 |
| 64 | 3300048914 | Ga0496111_0353288 | Ga0496111_0353288_209_976 | 203 |
| 65 | 3300048917 | Ga0496114_0057284 | Ga0496114_0057284_435_1202 | 203 |
| 66 | iso_pu_bacteria | 2919450847 | 2919455336 | 207 |
| 67 | iso_pu_bacteria | 2510065045 | 2510248447 | 208 |
| 68 | iso_pu_bacteria | 2718217991 | 2719643126 | 208 |
| 69 | 3300025904 | Ga0207647_10017088 | Ga0207647_100170884 | 209 |
| 70 | iso_pu_bacteria | 2513237082 | 2513552510 | 209 |
| 71 | iso_pu_bacteria | 2513237083 | 2513560755 | 209 |
| 72 | iso_pu_bacteria | 2513237150 | 2513956893 | 209 |
| 73 | iso_pu_bacteria | 2513237165 | 2514043246 | 209 |
| 74 | iso_pu_bacteria | 2513237166 | 2514053926 | 209 |
| 75 | iso_pu_bacteria | 2562617112 | 2563056394 | 209 |
| 76 | iso_pu_bacteria | 2562617112 | 2563060939 | 209 |
| 77 | iso_pu_bacteria | 2562617112 | 2563064648 | 209 |
| 78 | iso_pu_bacteria | 2600255067 | 2600813363 | 209 |
| 79 | iso_pu_bacteria | 2711768613 | 2713480158 | 209 |
| 80 | iso_pu_bacteria | 2711768613 | 2713481588 | 209 |
| 81 | iso_pu_bacteria | 2711768613 | 2713482369 | 209 |
| 82 | iso_pu_bacteria | 2718218334 | 2721026824 | 209 |
| 83 | iso_pu_bacteria | 2721755763 | 2723878203 | 209 |
| 84 | iso_pu_bacteria | 2744054900 | 2746085966 | 209 |
| 85 | iso_pu_bacteria | 2744054900 | 2746090663 | 209 |
| 86 | iso_pu_bacteria | 2744054901 | 2746092476 | 209 |
| 87 | iso_pu_bacteria | 2744054901 | 2746092933 | 209 |
| 88 | iso_pu_bacteria | 2791355137 | 2792833598 | 209 |
| 89 | iso_pu_bacteria | 2791355137 | 2792837565 | 209 |
| 90 | iso_pu_bacteria | 2818991450 | 2819619160 | 209 |
| 91 | iso_pu_bacteria | 2839993093 | 2839995427 | 209 |
| 92 | iso_pu_bacteria | 2879099564 | 2879106982 | 209 |
| 93 | iso_pu_bacteria | 2885270888 | 2885271397 | 209 |
| 94 | iso_pu_bacteria | 2900634093 | 2900638581 | 209 |
| 95 | iso_pu_bacteria | 2904615490 | 2904618625 | 209 |
| 96 | iso_pu_bacteria | 2928108538 | 2928114488 | 209 |
| 97 | iso_pu_bacteria | 2928135762 | 2928142010 | 209 |
| 98 | iso_pu_bacteria | 2928503688 | 2928504566 | 209 |
| 99 | iso_pu_bacteria | 2935810662 | 2935811934 | 209 |
| 100 | iso_pu_bacteria | 2936037263 | 2936038517 | 209 |
| 101 | iso_pu_bacteria | 642555112 | 642596323 | 209 |
| 102 | iso_pu_bacteria | 642555112 | 642598740 | 209 |
| 103 | iso_pu_bacteria | 642555113 | 642615442 | 209 |
| 104 | iso_pu_bacteria | 643348564 | 643597467 | 209 |
| 105 | iso_pu_bacteria | 644736347 | 644747721 | 209 |
| 106 | iso_pu_bacteria | 8005301065 | 8005301734 | 209 |
| 107 | iso_pu_bacteria | 8055301274 | 8055306894 | 209 |
| 108 | iso_pu_bacteria | 8057575449 | 8057582087 | 209 |
| 109 | 3300003659 | JGI25404J52841_10010576 | JGI25404J52841_100105761 | 210 |
| 110 | 3300005937 | Ga0081455_10019810 | Ga0081455_100198106 | 210 |
| 111 | 3300005983 | Ga0081540_1007347 | Ga0081540_10073475 | 210 |
| 112 | 3300005983 | Ga0081540_1018789 | Ga0081540_10187893 | 210 |
| 113 | 3300025920 | Ga0207649_10102098 | Ga0207649_101020982 | 210 |
| 114 | iso_pu_bacteria | 2643221647 | 2644263866 | 210 |
| 115 | iso_pu_bacteria | 2867428634 | 2867436376 | 210 |
| 116 | iso_pu_bacteria | 2954380949 | 2954382494 | 210 |
| 117 | iso_pu_bacteria | 2954691527 | 2954693295 | 210 |
| 118 | iso_pu_bacteria | 2954701450 | 2954708388 | 210 |
| 119 | iso_pu_bacteria | 2954711539 | 2954713002 | 210 |
| 120 | iso_pu_bacteria | 2954721474 | 2954722961 | 210 |
| 121 | iso_pu_bacteria | 2954731030 | 2954738868 | 210 |
| 122 | iso_pu_bacteria | 2954740390 | 2954741871 | 210 |
| 123 | iso_pu_bacteria | 2954749733 | 2954757726 | 210 |
| 124 | iso_pu_bacteria | 2954759201 | 2954760848 | 210 |
| 125 | 3300031852 | Ga0307410_10389123 | Ga0307410_103891231 | 211 |
| 126 | 3300039438 | Ga0436360_0953330 | Ga0436360_0953330_4754_5473 | 211 |
| 127 | 3300039453 | Ga0436362_1279733 | Ga0436362_1279733_194_913 | 211 |
| 128 | 3300048929 | Ga0496126_0186526 | Ga0496126_0186526_1023_1736 | 211 |
| 129 | iso_pu_bacteria | 2887478801 | 2887479384 | 211 |
| 130 | 3300005434 | Ga0070709_10019264 | Ga0070709_100192642 | 212 |
| 131 | 3300005435 | Ga0070714_100007241 | Ga0070714_1000072414 | 212 |
| 132 | 3300005435 | Ga0070714_100472918 | Ga0070714_1004729181 | 212 |
| 133 | 3300005436 | Ga0070713_100005323 | Ga0070713_1000053236 | 212 |
| 134 | 3300005437 | Ga0070710_10165718 | Ga0070710_101657182 | 212 |
| 135 | 3300005439 | Ga0070711_100012929 | Ga0070711_1000129293 | 212 |
| 136 | 3300005548 | Ga0070665_100039971 | Ga0070665_1000399712 | 212 |
| 137 | 3300006028 | Ga0070717_10000133 | Ga0070717_1000013353 | 212 |
| 138 | 3300006028 | Ga0070717_10480636 | Ga0070717_104806362 | 212 |
| 139 | 3300006051 | Ga0075364_10001086 | Ga0075364_100010863 | 212 |
| 140 | 3300006173 | Ga0070716_100243012 | Ga0070716_1002430122 | 212 |
| 141 | 3300006175 | Ga0070712_100092291 | Ga0070712_1000922912 | 212 |
| 142 | 3300006844 | Ga0075428_100306566 | Ga0075428_1003065661 | 212 |
| 143 | 3300009098 | Ga0105245_10024489 | Ga0105245_100244893 | 212 |
| 144 | 3300009148 | Ga0105243_10051314 | Ga0105243_100513143 | 212 |
| 145 | 3300009553 | Ga0105249_10263450 | Ga0105249_102634502 | 212 |
| 146 | 3300010375 | Ga0105239_10053958 | Ga0105239_100539583 | 212 |
| 147 | 3300011119 | Ga0105246_10178427 | Ga0105246_101784272 | 212 |
| 148 | 3300014325 | Ga0163163_10178396 | Ga0163163_101783962 | 212 |
| 149 | 3300014745 | Ga0157377_10141790 | Ga0157377_101417902 | 212 |
| 150 | 3300025898 | Ga0207692_10052439 | Ga0207692_100524392 | 212 |
| 151 | 3300025906 | Ga0207699_10204423 | Ga0207699_102044232 | 212 |
| 152 | 3300025906 | Ga0207699_10225207 | Ga0207699_102252072 | 212 |
| 153 | 3300025915 | Ga0207693_10034284 | Ga0207693_100342846 | 212 |
| 154 | 3300025927 | Ga0207687_10039391 | Ga0207687_100393913 | 212 |
| 155 | 3300025928 | Ga0207700_10000057 | Ga0207700_1000005766 | 212 |
| 156 | 3300025929 | Ga0207664_10000763 | Ga0207664_1000076324 | 212 |
| 157 | 3300025935 | Ga0207709_10041636 | Ga0207709_100416363 | 212 |
| 158 | 3300028379 | Ga0268266_10172322 | Ga0268266_101723222 | 212 |
| 159 | 3300028800 | Ga0265338_10093020 | Ga0265338_100930202 | 212 |
| 160 | 3300031507 | Ga0307509_10251429 | Ga0307509_102514292 | 212 |
| 161 | 3300035172 | Ga0373955_0008149 | Ga0373955_0008149_368_1075 | 212 |
| 162 | 3300035724 | Ga0373933_0368649 | Ga0373933_0368649_128_835 | 212 |
| 163 | 3300036401 | Ga0373937_0182203 | Ga0373937_0182203_1193_1900 | 212 |
| 164 | 3300037312 | Ga0395899_0043785 | Ga0395899_0043785_512_1219 | 212 |
| 165 | 3300037418 | Ga0395900_0013353 | Ga0395900_0013353_1044_1751 | 212 |
| 166 | 3300037466 | Ga0395898_0018741 | Ga0395898_0018741_2228_2935 | 212 |
| 167 | 3300038443 | Ga0395901_0000040 | Ga0395901_0000040_10662_11369 | 212 |
| 168 | 3300045836 | Ga0466958_0078574 | Ga0466958_0078574_296_1003 | 212 |
| 169 | 3300045976 | Ga0466967_0141552 | Ga0466967_0141552_1060_1767 | 212 |
| 170 | 3300046516 | Ga0495628_0612997 | Ga0495628_0612997_21_728 | 212 |
| 171 | 3300046529 | Ga0495652_0200248 | Ga0495652_0200248_275_982 | 212 |
| 172 | 3300046663 | Ga0495635_0093245 | Ga0495635_0093245_736_1443 | 212 |
| 173 | 3300046675 | Ga0495657_0006712 | Ga0495657_0006712_408_1115 | 212 |
| 174 | 3300046679 | Ga0495623_0071474 | Ga0495623_0071474_1077_1784 | 212 |
| 175 | 3300047317 | Ga0495604_0235045 | Ga0495604_0235045_65_772 | 212 |
| 176 | 3300047444 | Ga0495675_0132239 | Ga0495675_0132239_458_1165 | 212 |
| 177 | 3300048911 | Ga0496108_0303240 | Ga0496108_0303240_236_943 | 212 |
| 178 | 3300048913 | Ga0496110_0079539 | Ga0496110_0079539_1053_1760 | 212 |
| 179 | 3300048917 | Ga0496114_0202889 | Ga0496114_0202889_769_1476 | 212 |
| 180 | 3300050491 | nmdc:mga00v17_188501_c1 | nmdc:mga00v17_188501_c1_251_961 | 212 |
| 181 | 3300050491 | nmdc:mga00v17_974_c1 | nmdc:mga00v17_974_c1_133_843 | 212 |
| 182 | 3300050516 | nmdc:mga0sz30_1052_c1 | nmdc:mga0sz30_1052_c1_2359_3069 | 212 |
| 183 | 3300050516 | nmdc:mga0sz30_20509_c1 | nmdc:mga0sz30_20509_c1_1422_2132 | 212 |
| 184 | 3300053088 | Ga0500644_0078885 | Ga0500644_0078885_377_1084 | 212 |
| 185 | iso_pu_bacteria | 2675903059 | 2676483731 | 212 |
| 186 | 3300001989 | JGI24739J22299_10034366 | JGI24739J22299_100343662 | 213 |
| 187 | 3300001991 | JGI24743J22301_10024796 | JGI24743J22301_100247962 | 213 |
| 188 | 3300002070 | JGI24750J21931_1001413 | JGI24750J21931_10014131 | 213 |
| 189 | 3300002075 | JGI24738J21930_10009149 | JGI24738J21930_100091491 | 213 |
| 190 | 3300002077 | JGI24744J21845_10002134 | JGI24744J21845_100021343 | 213 |
| 191 | 3300002705 | JGI25156J39149_1000390 | JGI25156J39149_10003908 | 213 |
| 192 | 3300002987 | JGI25159J45721_1003051 | JGI25159J45721_10030512 | 213 |
| 193 | 3300003322 | rootL2_10080295 | rootL2_100802952 | 213 |
| 194 | 3300003354 | JGI25160J50197_1000091 | JGI25160J50197_100009118 | 213 |
| 195 | 3300003354 | JGI25160J50197_1004106 | JGI25160J50197_10041066 | 213 |
| 196 | 3300003374 | JGI25161J50226_1001682 | JGI25161J50226_10016826 | 213 |
| 197 | 3300003762 | Ga0055542_1016805 | Ga0055542_10168051 | 213 |
| 198 | 3300004625 | Ga0055543_1002320 | Ga0055543_10023203 | 213 |
| 199 | 3300005262 | Ga0065165_1000317 | Ga0065165_100031711 | 213 |
| 200 | 3300005262 | Ga0065165_1006192 | Ga0065165_10061926 | 213 |
| 201 | 3300005262 | Ga0065165_1022355 | Ga0065165_10223552 | 213 |
| 202 | 3300005262 | Ga0065165_1063748 | Ga0065165_10637482 | 213 |
| 203 | 3300005329 | Ga0070683_100179744 | Ga0070683_1001797442 | 213 |
| 204 | 3300005330 | Ga0070690_100008674 | Ga0070690_1000086746 | 213 |
| 205 | 3300005335 | Ga0070666_10042689 | Ga0070666_100426893 | 213 |
| 206 | 3300005337 | Ga0070682_100022026 | Ga0070682_1000220263 | 213 |
| 207 | 3300005337 | Ga0070682_100197392 | Ga0070682_1001973922 | 213 |
| 208 | 3300005338 | Ga0068868_100030498 | Ga0068868_1000304984 | 213 |
| 209 | 3300005341 | Ga0070691_10002933 | Ga0070691_100029333 | 213 |
| 210 | 3300005344 | Ga0070661_100192188 | Ga0070661_1001921882 | 213 |
| 211 | 3300005347 | Ga0070668_100001887 | Ga0070668_1000018879 | 213 |
| 212 | 3300005347 | Ga0070668_100029574 | Ga0070668_1000295743 | 213 |
| 213 | 3300005353 | Ga0070669_100051760 | Ga0070669_1000517604 | 213 |
| 214 | 3300005354 | Ga0070675_100215334 | Ga0070675_1002153342 | 213 |
| 215 | 3300005355 | Ga0070671_100211647 | Ga0070671_1002116472 | 213 |
| 216 | 3300005356 | Ga0070674_100003900 | Ga0070674_1000039009 | 213 |
| 217 | 3300005367 | Ga0070667_100000752 | Ga0070667_1000007523 | 213 |
| 218 | 3300005367 | Ga0070667_100097230 | Ga0070667_1000972303 | 213 |
| 219 | 3300005367 | Ga0070667_100251782 | Ga0070667_1002517822 | 213 |
| 220 | 3300005434 | Ga0070709_10057400 | Ga0070709_100574002 | 213 |
| 221 | 3300005435 | Ga0070714_100129182 | Ga0070714_1001291822 | 213 |
| 222 | 3300005437 | Ga0070710_10000771 | Ga0070710_1000077114 | 213 |
| 223 | 3300005437 | Ga0070710_10006769 | Ga0070710_100067695 | 213 |
| 224 | 3300005438 | Ga0070701_10006164 | Ga0070701_100061645 | 213 |
| 225 | 3300005439 | Ga0070711_100008402 | Ga0070711_1000084022 | 213 |
| 226 | 3300005439 | Ga0070711_100015606 | Ga0070711_1000156062 | 213 |
| 227 | 3300005439 | Ga0070711_100442503 | Ga0070711_1004425031 | 213 |
| 228 | 3300005440 | Ga0070705_100062581 | Ga0070705_1000625811 | 213 |
| 229 | 3300005441 | Ga0070700_100000263 | Ga0070700_10000026314 | 213 |
| 230 | 3300005455 | Ga0070663_100014385 | Ga0070663_1000143852 | 213 |
| 231 | 3300005456 | Ga0070678_100000712 | Ga0070678_10000071214 | 213 |
| 232 | 3300005456 | Ga0070678_100148787 | Ga0070678_1001487872 | 213 |
| 233 | 3300005459 | Ga0068867_100000537 | Ga0068867_10000053711 | 213 |
| 234 | 3300005466 | Ga0070685_10457616 | Ga0070685_104576162 | 213 |
| 235 | 3300005471 | Ga0070698_100000710 | Ga0070698_10000071024 | 213 |
| 236 | 3300005539 | Ga0068853_100001294 | Ga0068853_10000129410 | 213 |
| 237 | 3300005539 | Ga0068853_100196409 | Ga0068853_1001964092 | 213 |
| 238 | 3300005539 | Ga0068853_100653803 | Ga0068853_1006538031 | 213 |
| 239 | 3300005546 | Ga0070696_100147741 | Ga0070696_1001477411 | 213 |
| 240 | 3300005547 | Ga0070693_100001778 | Ga0070693_1000017788 | 213 |
| 241 | 3300005548 | Ga0070665_100121461 | Ga0070665_1001214613 | 213 |
| 242 | 3300005563 | Ga0068855_100149036 | Ga0068855_1001490362 | 213 |
| 243 | 3300005578 | Ga0068854_100001607 | Ga0068854_10000160715 | 213 |
| 244 | 3300005614 | Ga0068856_100113940 | Ga0068856_1001139403 | 213 |
| 245 | 3300005615 | Ga0070702_100004815 | Ga0070702_1000048152 | 213 |
| 246 | 3300005616 | Ga0068852_100064699 | Ga0068852_1000646992 | 213 |
| 247 | 3300005616 | Ga0068852_100300126 | Ga0068852_1003001262 | 213 |
| 248 | 3300005617 | Ga0068859_100001155 | Ga0068859_10000115516 | 213 |
| 249 | 3300005718 | Ga0068866_10000629 | Ga0068866_100006294 | 213 |
| 250 | 3300005719 | Ga0068861_100000739 | Ga0068861_10000073915 | 213 |
| 251 | 3300005841 | Ga0068863_100438055 | Ga0068863_1004380551 | 213 |
| 252 | 3300005842 | Ga0068858_100002363 | Ga0068858_1000023639 | 213 |
| 253 | 3300005843 | Ga0068860_100002272 | Ga0068860_10000227219 | 213 |
| 254 | 3300005844 | Ga0068862_100017092 | Ga0068862_1000170928 | 213 |
| 255 | 3300005844 | Ga0068862_100066778 | Ga0068862_1000667782 | 213 |
| 256 | 3300006038 | Ga0075365_10073961 | Ga0075365_100739612 | 213 |
| 257 | 3300006048 | Ga0075363_100048051 | Ga0075363_1000480512 | 213 |
| 258 | 3300006163 | Ga0070715_10021195 | Ga0070715_100211953 | 213 |
| 259 | 3300006173 | Ga0070716_100000613 | Ga0070716_10000061311 | 213 |
| 260 | 3300006175 | Ga0070712_100000495 | Ga0070712_10000049515 | 213 |
| 261 | 3300006175 | Ga0070712_100007327 | Ga0070712_1000073276 | 213 |
| 262 | 3300006175 | Ga0070712_100018654 | Ga0070712_1000186544 | 213 |
| 263 | 3300006175 | Ga0070712_100297599 | Ga0070712_1002975992 | 213 |
| 264 | 3300006178 | Ga0075367_10105774 | Ga0075367_101057742 | 213 |
| 265 | 3300006237 | Ga0097621_100128797 | Ga0097621_1001287972 | 213 |
| 266 | 3300006881 | Ga0068865_100000670 | Ga0068865_1000006709 | 213 |
| 267 | 3300006931 | Ga0097620_100001155 | Ga0097620_10000115516 | 213 |
| 268 | 3300006948 | Ga0099826_10192256 | Ga0099826_101922562 | 213 |
| 269 | 3300007265 | Ga0099794_10004935 | Ga0099794_100049354 | 213 |
| 270 | 3300007788 | Ga0099795_10000607 | Ga0099795_100006075 | 213 |
| 271 | 3300007788 | Ga0099795_10058501 | Ga0099795_100585011 | 213 |
| 272 | 3300009011 | Ga0105251_10000085 | Ga0105251_1000008572 | 213 |
| 273 | 3300009092 | Ga0105250_10043917 | Ga0105250_100439173 | 213 |
| 274 | 3300009093 | Ga0105240_10003464 | Ga0105240_100034648 | 213 |
| 275 | 3300009093 | Ga0105240_10071028 | Ga0105240_100710284 | 213 |
| 276 | 3300009093 | Ga0105240_10116529 | Ga0105240_101165291 | 213 |
| 277 | 3300009098 | Ga0105245_10003258 | Ga0105245_100032582 | 213 |
| 278 | 3300009098 | Ga0105245_10048836 | Ga0105245_100488362 | 213 |
| 279 | 3300009101 | Ga0105247_10360071 | Ga0105247_103600711 | 213 |
| 280 | 3300009174 | Ga0105241_10076984 | Ga0105241_100769843 | 213 |
| 281 | 3300009176 | Ga0105242_10177454 | Ga0105242_101774542 | 213 |
| 282 | 3300009176 | Ga0105242_10331151 | Ga0105242_103311513 | 213 |
| 283 | 3300009177 | Ga0105248_10676273 | Ga0105248_106762732 | 213 |
| 284 | 3300009177 | Ga0105248_11313376 | Ga0105248_113133761 | 213 |
| 285 | 3300009545 | Ga0105237_10754138 | Ga0105237_107541381 | 213 |
| 286 | 3300009551 | Ga0105238_10284922 | Ga0105238_102849222 | 213 |
| 287 | 3300009553 | Ga0105249_10006646 | Ga0105249_100066462 | 213 |
| 288 | 3300009553 | Ga0105249_10097458 | Ga0105249_100974582 | 213 |
| 289 | 3300010159 | Ga0099796_10001405 | Ga0099796_100014054 | 213 |
| 290 | 3300010375 | Ga0105239_10084668 | Ga0105239_100846683 | 213 |
| 291 | 3300010375 | Ga0105239_10224269 | Ga0105239_102242693 | 213 |
| 292 | 3300010375 | Ga0105239_10255673 | Ga0105239_102556733 | 213 |
| 293 | 3300013102 | Ga0157371_10502724 | Ga0157371_105027241 | 213 |
| 294 | 3300013105 | Ga0157369_10136993 | Ga0157369_101369931 | 213 |
| 295 | 3300013296 | Ga0157374_10111080 | Ga0157374_101110802 | 213 |
| 296 | 3300013296 | Ga0157374_10331042 | Ga0157374_103310422 | 213 |
| 297 | 3300013297 | Ga0157378_10066625 | Ga0157378_100666251 | 213 |
| 298 | 3300013306 | Ga0163162_10125638 | Ga0163162_101256381 | 213 |
| 299 | 3300013306 | Ga0163162_10250430 | Ga0163162_102504303 | 213 |
| 300 | 3300014325 | Ga0163163_10053434 | Ga0163163_100534346 | 213 |
| 301 | 3300014325 | Ga0163163_10151941 | Ga0163163_101519413 | 213 |
| 302 | 3300014326 | Ga0157380_10713002 | Ga0157380_107130021 | 213 |
| 303 | 3300014745 | Ga0157377_10035664 | Ga0157377_100356642 | 213 |
| 304 | 3300014968 | Ga0157379_10347831 | Ga0157379_103478311 | 213 |
| 305 | 3300014969 | Ga0157376_10183523 | Ga0157376_101835233 | 213 |
| 306 | 3300015262 | Ga0182007_10000576 | Ga0182007_1000057614 | 213 |
| 307 | 3300017792 | Ga0163161_10000520 | Ga0163161_1000052013 | 213 |
| 308 | 3300017792 | Ga0163161_10026064 | Ga0163161_100260641 | 213 |
| 309 | 3300017792 | Ga0163161_10079658 | Ga0163161_100796583 | 213 |
| 310 | 3300025242 | Ga0209258_104825 | Ga0209258_1048252 | 213 |
| 311 | 3300025254 | Ga0209148_1000480 | Ga0209148_10004803 | 213 |
| 312 | 3300025256 | Ga0209759_1000077 | Ga0209759_1000077115 | 213 |
| 313 | 3300025272 | Ga0209455_1000604 | Ga0209455_100060412 | 213 |
| 314 | 3300025284 | Ga0209130_1001098 | Ga0209130_100109821 | 213 |
| 315 | 3300025284 | Ga0209130_1017193 | Ga0209130_10171932 | 213 |
| 316 | 3300025294 | Ga0209025_1001325 | Ga0209025_100132521 | 213 |
| 317 | 3300025302 | Ga0207426_1000004 | Ga0207426_100000484 | 213 |
| 318 | 3300025302 | Ga0207426_1000158 | Ga0207426_10001582 | 213 |
| 319 | 3300025302 | Ga0207426_1001300 | Ga0207426_100130021 | 213 |
| 320 | 3300025735 | Ga0207713_1001373 | Ga0207713_100137314 | 213 |
| 321 | 3300025898 | Ga0207692_10002318 | Ga0207692_100023185 | 213 |
| 322 | 3300025898 | Ga0207692_10104506 | Ga0207692_101045062 | 213 |
| 323 | 3300025901 | Ga0207688_10001068 | Ga0207688_100010685 | 213 |
| 324 | 3300025903 | Ga0207680_10062490 | Ga0207680_100624902 | 213 |
| 325 | 3300025904 | Ga0207647_10009742 | Ga0207647_100097425 | 213 |
| 326 | 3300025904 | Ga0207647_10066218 | Ga0207647_100662183 | 213 |
| 327 | 3300025905 | Ga0207685_10027551 | Ga0207685_100275512 | 213 |
| 328 | 3300025906 | Ga0207699_10059031 | Ga0207699_100590312 | 213 |
| 329 | 3300025906 | Ga0207699_10067163 | Ga0207699_100671631 | 213 |
| 330 | 3300025907 | Ga0207645_10049352 | Ga0207645_100493523 | 213 |
| 331 | 3300025911 | Ga0207654_10215395 | Ga0207654_102153952 | 213 |
| 332 | 3300025913 | Ga0207695_10002566 | Ga0207695_100025667 | 213 |
| 333 | 3300025913 | Ga0207695_10439579 | Ga0207695_104395791 | 213 |
| 334 | 3300025915 | Ga0207693_10000660 | Ga0207693_1000066020 | 213 |
| 335 | 3300025915 | Ga0207693_10007199 | Ga0207693_100071996 | 213 |
| 336 | 3300025915 | Ga0207693_10011311 | Ga0207693_100113112 | 213 |
| 337 | 3300025915 | Ga0207693_10299414 | Ga0207693_102994142 | 213 |
| 338 | 3300025916 | Ga0207663_10010988 | Ga0207663_100109884 | 213 |
| 339 | 3300025916 | Ga0207663_10013686 | Ga0207663_100136866 | 213 |
| 340 | 3300025916 | Ga0207663_10389712 | Ga0207663_103897121 | 213 |
| 341 | 3300025924 | Ga0207694_10104675 | Ga0207694_101046752 | 213 |
| 342 | 3300025926 | Ga0207659_10711254 | Ga0207659_107112541 | 213 |
| 343 | 3300025927 | Ga0207687_10006483 | Ga0207687_100064839 | 213 |
| 344 | 3300025927 | Ga0207687_10086617 | Ga0207687_100866171 | 213 |
| 345 | 3300025928 | Ga0207700_10571188 | Ga0207700_105711881 | 213 |
| 346 | 3300025929 | Ga0207664_10046291 | Ga0207664_100462912 | 213 |
| 347 | 3300025929 | Ga0207664_10266111 | Ga0207664_102661112 | 213 |
| 348 | 3300025931 | Ga0207644_10149525 | Ga0207644_101495253 | 213 |
| 349 | 3300025932 | Ga0207690_10022446 | Ga0207690_100224464 | 213 |
| 350 | 3300025933 | Ga0207706_10011539 | Ga0207706_100115394 | 213 |
| 351 | 3300025933 | Ga0207706_10351306 | Ga0207706_103513062 | 213 |
| 352 | 3300025934 | Ga0207686_10001835 | Ga0207686_100018357 | 213 |
| 353 | 3300025934 | Ga0207686_10428263 | Ga0207686_104282631 | 213 |
| 354 | 3300025935 | Ga0207709_10002099 | Ga0207709_100020993 | 213 |
| 355 | 3300025935 | Ga0207709_10394598 | Ga0207709_103945981 | 213 |
| 356 | 3300025937 | Ga0207669_10000218 | Ga0207669_1000021815 | 213 |
| 357 | 3300025938 | Ga0207704_10000179 | Ga0207704_1000017914 | 213 |
| 358 | 3300025939 | Ga0207665_10009061 | Ga0207665_100090611 | 213 |
| 359 | 3300025939 | Ga0207665_10071923 | Ga0207665_100719231 | 213 |
| 360 | 3300025941 | Ga0207711_10364335 | Ga0207711_103643352 | 213 |
| 361 | 3300025942 | Ga0207689_10049736 | Ga0207689_100497364 | 213 |
| 362 | 3300025944 | Ga0207661_10316090 | Ga0207661_103160902 | 213 |
| 363 | 3300025945 | Ga0207679_10194848 | Ga0207679_101948481 | 213 |
| 364 | 3300025961 | Ga0207712_10141128 | Ga0207712_101411281 | 213 |
| 365 | 3300025972 | Ga0207668_10002863 | Ga0207668_100028635 | 213 |
| 366 | 3300025981 | Ga0207640_10818371 | Ga0207640_108183711 | 213 |
| 367 | 3300025986 | Ga0207658_10006956 | Ga0207658_100069562 | 213 |
| 368 | 3300025986 | Ga0207658_10171487 | Ga0207658_101714872 | 213 |
| 369 | 3300025986 | Ga0207658_10562444 | Ga0207658_105624441 | 213 |
| 370 | 3300026023 | Ga0207677_10135312 | Ga0207677_101353122 | 213 |
| 371 | 3300026035 | Ga0207703_10002619 | Ga0207703_1000261910 | 213 |
| 372 | 3300026041 | Ga0207639_10173375 | Ga0207639_101733752 | 213 |
| 373 | 3300026067 | Ga0207678_10007543 | Ga0207678_100075436 | 213 |
| 374 | 3300026075 | Ga0207708_10000787 | Ga0207708_1000078710 | 213 |
| 375 | 3300026075 | Ga0207708_10479755 | Ga0207708_104797552 | 213 |
| 376 | 3300026088 | Ga0207641_10124293 | Ga0207641_101242933 | 213 |
| 377 | 3300026089 | Ga0207648_10001756 | Ga0207648_1000175611 | 213 |
| 378 | 3300026089 | Ga0207648_10274966 | Ga0207648_102749661 | 213 |
| 379 | 3300026095 | Ga0207676_10045875 | Ga0207676_100458753 | 213 |
| 380 | 3300026118 | Ga0207675_100003125 | Ga0207675_1000031254 | 213 |
| 381 | 3300026121 | Ga0207683_10000990 | Ga0207683_1000099011 | 213 |
| 382 | 3300026121 | Ga0207683_10120202 | Ga0207683_101202022 | 213 |
| 383 | 3300027357 | Ga0209589_1000399 | Ga0209589_100039923 | 213 |
| 384 | 3300027361 | Ga0209489_100724 | Ga0209489_10072429 | 213 |
| 385 | 3300027512 | Ga0209179_1000955 | Ga0209179_10009554 | 213 |
| 386 | 3300027671 | Ga0209588_1001592 | Ga0209588_10015923 | 213 |
| 387 | 3300028379 | Ga0268266_10093888 | Ga0268266_100938882 | 213 |
| 388 | 3300028379 | Ga0268266_10262763 | Ga0268266_102627632 | 213 |
| 389 | 3300028379 | Ga0268266_10312123 | Ga0268266_103121231 | 213 |
| 390 | 3300028379 | Ga0268266_10398842 | Ga0268266_103988421 | 213 |
| 391 | 3300028380 | Ga0268265_10061372 | Ga0268265_100613722 | 213 |
| 392 | 3300028381 | Ga0268264_10002402 | Ga0268264_1000240215 | 213 |
| 393 | 3300030521 | Ga0307511_10001720 | Ga0307511_1000172014 | 213 |
| 394 | 3300031507 | Ga0307509_10125480 | Ga0307509_101254804 | 213 |
| 395 | 3300031616 | Ga0307508_10008814 | Ga0307508_100088145 | 213 |
| 396 | 3300031616 | Ga0307508_10018468 | Ga0307508_100184682 | 213 |
| 397 | 3300031712 | Ga0265342_10207281 | Ga0265342_102072812 | 213 |
| 398 | 3300031730 | Ga0307516_10002271 | Ga0307516_100022718 | 213 |
| 399 | 3300031730 | Ga0307516_10037265 | Ga0307516_100372655 | 213 |
| 400 | 3300031911 | Ga0307412_10348620 | Ga0307412_103486202 | 213 |
| 401 | 3300031995 | Ga0307409_100106882 | Ga0307409_1001068822 | 213 |
| 402 | 3300033180 | Ga0307510_10249234 | Ga0307510_102492342 | 213 |
| 403 | 3300035112 | Ga0373932_0048197 | Ga0373932_0048197_192_905 | 213 |
| 404 | 3300037312 | Ga0395899_0259358 | Ga0395899_0259358_296_1006 | 213 |
| 405 | 3300037471 | Ga0395905_0130272 | Ga0395905_0130272_836_1546 | 213 |
| 406 | 3300037471 | Ga0395905_0133592 | Ga0395905_0133592_356_1066 | 213 |
| 407 | 3300037471 | Ga0395905_0178201 | Ga0395905_0178201_347_1057 | 213 |
| 408 | 3300039447 | Ga0436361_1097664 | Ga0436361_1097664_154_900 | 213 |
| 409 | 3300041404 | Ga0439436_0047539 | Ga0439436_0047539_28_738 | 213 |
| 410 | 3300042876 | Ga0451577_0134018 | Ga0451577_0134018_90_827 | 213 |
| 411 | 3300044658 | Ga0466972_0051034 | Ga0466972_0051034_34_744 | 213 |
| 412 | 3300044673 | Ga0453683_0032373 | Ga0453683_0032373_1398_2135 | 213 |
| 413 | 3300044684 | Ga0466966_0021132 | Ga0466966_0021132_2120_2830 | 213 |
| 414 | 3300044694 | Ga0466963_0002809 | Ga0466963_0002809_3412_4134 | 213 |
| 415 | 3300044712 | Ga0453684_0215598 | Ga0453684_0215598_1370_2107 | 213 |
| 416 | 3300046452 | Ga0495617_000076 | Ga0495617_000076_23137_23895 | 213 |
| 417 | 3300046454 | Ga0495592_0182495 | Ga0495592_0182495_52_762 | 213 |
| 418 | 3300046454 | Ga0495592_0240060 | Ga0495592_0240060_25_735 | 213 |
| 419 | 3300046455 | Ga0495603_0003485 | Ga0495603_0003485_5739_6449 | 213 |
| 420 | 3300046455 | Ga0495603_0263202 | Ga0495603_0263202_57_770 | 213 |
| 421 | 3300046457 | Ga0495590_0030089 | Ga0495590_0030089_566_1276 | 213 |
| 422 | 3300046459 | Ga0495629_0000096 | Ga0495629_0000096_58389_59099 | 213 |
| 423 | 3300046459 | Ga0495629_0000115 | Ga0495629_0000115_26136_26846 | 213 |
| 424 | 3300046459 | Ga0495629_0000212 | Ga0495629_0000212_50464_51174 | 213 |
| 425 | 3300046459 | Ga0495629_0006134 | Ga0495629_0006134_7265_7975 | 213 |
| 426 | 3300046459 | Ga0495629_0009629 | Ga0495629_0009629_381_1091 | 213 |
| 427 | 3300046459 | Ga0495629_0015811 | Ga0495629_0015811_3912_4622 | 213 |
| 428 | 3300046459 | Ga0495629_0080429 | Ga0495629_0080429_762_1472 | 213 |
| 429 | 3300046459 | Ga0495629_0090466 | Ga0495629_0090466_659_1369 | 213 |
| 430 | 3300046459 | Ga0495629_0152283 | Ga0495629_0152283_649_1362 | 213 |
| 431 | 3300046460 | Ga0495638_0027234 | Ga0495638_0027234_2152_2862 | 213 |
| 432 | 3300046462 | Ga0495651_0085694 | Ga0495651_0085694_1461_2171 | 213 |
| 433 | 3300046463 | Ga0495653_0000758 | Ga0495653_0000758_13208_13918 | 213 |
| 434 | 3300046463 | Ga0495653_0001028 | Ga0495653_0001028_12402_13112 | 213 |
| 435 | 3300046463 | Ga0495653_0017059 | Ga0495653_0017059_543_1253 | 213 |
| 436 | 3300046463 | Ga0495653_0030050 | Ga0495653_0030050_2147_2857 | 213 |
| 437 | 3300046471 | Ga0495650_0000381 | Ga0495650_0000381_36653_37390 | 213 |
| 438 | 3300046471 | Ga0495650_0059390 | Ga0495650_0059390_647_1357 | 213 |
| 439 | 3300046472 | Ga0495580_0000419 | Ga0495580_0000419_32289_32999 | 213 |
| 440 | 3300046472 | Ga0495580_0000778 | Ga0495580_0000778_23981_24691 | 213 |
| 441 | 3300046472 | Ga0495580_0001707 | Ga0495580_0001707_13595_14305 | 213 |
| 442 | 3300046472 | Ga0495580_0002281 | Ga0495580_0002281_10527_11237 | 213 |
| 443 | 3300046472 | Ga0495580_0003210 | Ga0495580_0003210_12766_13476 | 213 |
| 444 | 3300046472 | Ga0495580_0005083 | Ga0495580_0005083_6941_7651 | 213 |
| 445 | 3300046472 | Ga0495580_0007991 | Ga0495580_0007991_2937_3647 | 213 |
| 446 | 3300046472 | Ga0495580_0013903 | Ga0495580_0013903_5356_6069 | 213 |
| 447 | 3300046472 | Ga0495580_0016823 | Ga0495580_0016823_4249_4959 | 213 |
| 448 | 3300046472 | Ga0495580_0017866 | Ga0495580_0017866_2793_3503 | 213 |
| 449 | 3300046472 | Ga0495580_0113618 | Ga0495580_0113618_597_1307 | 213 |
| 450 | 3300046473 | Ga0495582_0043056 | Ga0495582_0043056_1174_1884 | 213 |
| 451 | 3300046474 | Ga0495605_0003284 | Ga0495605_0003284_6434_7192 | 213 |
| 452 | 3300046474 | Ga0495605_0014648 | Ga0495605_0014648_544_1254 | 213 |
| 453 | 3300046474 | Ga0495605_0029934 | Ga0495605_0029934_1225_1962 | 213 |
| 454 | 3300046477 | Ga0495664_0031579 | Ga0495664_0031579_1060_1770 | 213 |
| 455 | 3300046477 | Ga0495664_0145195 | Ga0495664_0145195_418_1128 | 213 |
| 456 | 3300046477 | Ga0495664_0179700 | Ga0495664_0179700_398_1108 | 213 |
| 457 | 3300046492 | Ga0495585_0016913 | Ga0495585_0016913_1190_1927 | 213 |
| 458 | 3300046499 | Ga0495594_0071898 | Ga0495594_0071898_114_827 | 213 |
| 459 | 3300046501 | Ga0495607_0077238 | Ga0495607_0077238_763_1521 | 213 |
| 460 | 3300046501 | Ga0495607_0095292 | Ga0495607_0095292_813_1550 | 213 |
| 461 | 3300046506 | Ga0495583_0004535 | Ga0495583_0004535_4856_5566 | 213 |
| 462 | 3300046506 | Ga0495583_0009334 | Ga0495583_0009334_4642_5352 | 213 |
| 463 | 3300046506 | Ga0495583_0009898 | Ga0495583_0009898_3827_4537 | 213 |
| 464 | 3300046506 | Ga0495583_0012477 | Ga0495583_0012477_2954_3712 | 213 |
| 465 | 3300046506 | Ga0495583_0058614 | Ga0495583_0058614_388_1098 | 213 |
| 466 | 3300046507 | Ga0495606_0000203 | Ga0495606_0000203_44969_45727 | 213 |
| 467 | 3300046507 | Ga0495606_0000692 | Ga0495606_0000692_32389_33126 | 213 |
| 468 | 3300046507 | Ga0495606_0001032 | Ga0495606_0001032_37665_38375 | 213 |
| 469 | 3300046507 | Ga0495606_0009353 | Ga0495606_0009353_7565_8275 | 213 |
| 470 | 3300046507 | Ga0495606_0044799 | Ga0495606_0044799_630_1340 | 213 |
| 471 | 3300046507 | Ga0495606_0106311 | Ga0495606_0106311_433_1143 | 213 |
| 472 | 3300046512 | Ga0495610_0011552 | Ga0495610_0011552_2114_2851 | 213 |
| 473 | 3300046513 | Ga0495616_0000116 | Ga0495616_0000116_31420_32157 | 213 |
| 474 | 3300046513 | Ga0495616_0129447 | Ga0495616_0129447_24_734 | 213 |
| 475 | 3300046514 | Ga0495618_0029626 | Ga0495618_0029626_601_1311 | 213 |
| 476 | 3300046514 | Ga0495618_0057352 | Ga0495618_0057352_1416_2126 | 213 |
| 477 | 3300046515 | Ga0495620_0002388 | Ga0495620_0002388_12_770 | 213 |
| 478 | 3300046515 | Ga0495620_0010623 | Ga0495620_0010623_2322_3059 | 213 |
| 479 | 3300046516 | Ga0495628_0004687 | Ga0495628_0004687_2329_3039 | 213 |
| 480 | 3300046516 | Ga0495628_0029156 | Ga0495628_0029156_1538_2248 | 213 |
| 481 | 3300046516 | Ga0495628_0032687 | Ga0495628_0032687_519_1229 | 213 |
| 482 | 3300046516 | Ga0495628_0049761 | Ga0495628_0049761_1104_1814 | 213 |
| 483 | 3300046516 | Ga0495628_0133538 | Ga0495628_0133538_551_1261 | 213 |
| 484 | 3300046516 | Ga0495628_0192709 | Ga0495628_0192709_521_1231 | 213 |
| 485 | 3300046516 | Ga0495628_0236420 | Ga0495628_0236420_617_1327 | 213 |
| 486 | 3300046517 | Ga0495630_0018598 | Ga0495630_0018598_2202_2912 | 213 |
| 487 | 3300046517 | Ga0495630_0037973 | Ga0495630_0037973_934_1644 | 213 |
| 488 | 3300046517 | Ga0495630_0039716 | Ga0495630_0039716_1458_2168 | 213 |
| 489 | 3300046517 | Ga0495630_0231582 | Ga0495630_0231582_134_844 | 213 |
| 490 | 3300046518 | Ga0495631_0000069 | Ga0495631_0000069_21254_21991 | 213 |
| 491 | 3300046519 | Ga0495632_0060074 | Ga0495632_0060074_32_769 | 213 |
| 492 | 3300046524 | Ga0495648_0006147 | Ga0495648_0006147_8547_9284 | 213 |
| 493 | 3300046524 | Ga0495648_0007831 | Ga0495648_0007831_6440_7198 | 213 |
| 494 | 3300046524 | Ga0495648_0008817 | Ga0495648_0008817_4458_5168 | 213 |
| 495 | 3300046524 | Ga0495648_0019853 | Ga0495648_0019853_2167_2877 | 213 |
| 496 | 3300046524 | Ga0495648_0027844 | Ga0495648_0027844_382_1092 | 213 |
| 497 | 3300046524 | Ga0495648_0038688 | Ga0495648_0038688_1947_2657 | 213 |
| 498 | 3300046524 | Ga0495648_0060329 | Ga0495648_0060329_437_1147 | 213 |
| 499 | 3300046524 | Ga0495648_0061874 | Ga0495648_0061874_1268_1978 | 213 |
| 500 | 3300046526 | Ga0495666_0004629 | Ga0495666_0004629_2135_2845 | 213 |
| 501 | 3300046528 | Ga0495642_0026693 | Ga0495642_0026693_1223_1933 | 213 |
| 502 | 3300046529 | Ga0495652_0007447 | Ga0495652_0007447_1862_2572 | 213 |
| 503 | 3300046529 | Ga0495652_0062673 | Ga0495652_0062673_339_1049 | 213 |
| 504 | 3300046529 | Ga0495652_0581028 | Ga0495652_0581028_17_727 | 213 |
| 505 | 3300046529 | Ga0495652_0600439 | Ga0495652_0600439_16_726 | 213 |
| 506 | 3300046531 | Ga0495665_0000798 | Ga0495665_0000798_7737_8447 | 213 |
| 507 | 3300046531 | Ga0495665_0047687 | Ga0495665_0047687_1251_1961 | 213 |
| 508 | 3300046531 | Ga0495665_0053787 | Ga0495665_0053787_201_911 | 213 |
| 509 | 3300046531 | Ga0495665_0096953 | Ga0495665_0096953_784_1494 | 213 |
| 510 | 3300046535 | Ga0495586_0136360 | Ga0495586_0136360_533_1243 | 213 |
| 511 | 3300046542 | Ga0495597_0026731 | Ga0495597_0026731_526_1236 | 213 |
| 512 | 3300046542 | Ga0495597_0138913 | Ga0495597_0138913_268_978 | 213 |
| 513 | 3300046543 | Ga0495645_0003851 | Ga0495645_0003851_577_1287 | 213 |
| 514 | 3300046543 | Ga0495645_0007764 | Ga0495645_0007764_2107_2817 | 213 |
| 515 | 3300046543 | Ga0495645_0019759 | Ga0495645_0019759_1158_1886 | 213 |
| 516 | 3300046543 | Ga0495645_0197811 | Ga0495645_0197811_568_1278 | 213 |
| 517 | 3300046543 | Ga0495645_0297883 | Ga0495645_0297883_28_771 | 213 |
| 518 | 3300046616 | Ga0495668_0028972 | Ga0495668_0028972_2277_2987 | 213 |
| 519 | 3300046648 | Ga0495611_0000109 | Ga0495611_0000109_46060_46797 | 213 |
| 520 | 3300046648 | Ga0495611_0158778 | Ga0495611_0158778_76_786 | 213 |
| 521 | 3300046660 | Ga0495625_0003969 | Ga0495625_0003969_12383_13093 | 213 |
| 522 | 3300046660 | Ga0495625_0017872 | Ga0495625_0017872_3085_3843 | 213 |
| 523 | 3300046660 | Ga0495625_0020607 | Ga0495625_0020607_3204_3941 | 213 |
| 524 | 3300046660 | Ga0495625_0052757 | Ga0495625_0052757_413_1123 | 213 |
| 525 | 3300046660 | Ga0495625_0164231 | Ga0495625_0164231_203_913 | 213 |
| 526 | 3300046660 | Ga0495625_0257888 | Ga0495625_0257888_16_726 | 213 |
| 527 | 3300046663 | Ga0495635_0002608 | Ga0495635_0002608_4514_5242 | 213 |
| 528 | 3300046663 | Ga0495635_0075085 | Ga0495635_0075085_534_1244 | 213 |
| 529 | 3300046678 | Ga0495599_0012930 | Ga0495599_0012930_3861_4571 | 213 |
| 530 | 3300046678 | Ga0495599_0135194 | Ga0495599_0135194_626_1336 | 213 |
| 531 | 3300046678 | Ga0495599_0213060 | Ga0495599_0213060_347_1057 | 213 |
| 532 | 3300046679 | Ga0495623_0005652 | Ga0495623_0005652_1410_2120 | 213 |
| 533 | 3300046680 | Ga0495646_0011648 | Ga0495646_0011648_1097_1807 | 213 |
| 534 | 3300046680 | Ga0495646_0015159 | Ga0495646_0015159_516_1226 | 213 |
| 535 | 3300046680 | Ga0495646_0078340 | Ga0495646_0078340_840_1550 | 213 |
| 536 | 3300046680 | Ga0495646_0186653 | Ga0495646_0186653_226_936 | 213 |
| 537 | 3300046684 | Ga0495669_0071108 | Ga0495669_0071108_840_1550 | 213 |
| 538 | 3300046690 | Ga0495624_0002034 | Ga0495624_0002034_11601_12311 | 213 |
| 539 | 3300046690 | Ga0495624_0011981 | Ga0495624_0011981_2224_2934 | 213 |
| 540 | 3300046690 | Ga0495624_0033750 | Ga0495624_0033750_648_1358 | 213 |
| 541 | 3300046690 | Ga0495624_0057855 | Ga0495624_0057855_693_1403 | 213 |
| 542 | 3300046691 | Ga0495670_0014902 | Ga0495670_0014902_2518_3255 | 213 |
| 543 | 3300046691 | Ga0495670_0350839 | Ga0495670_0350839_54_767 | 213 |
| 544 | 3300046692 | Ga0495671_0026283 | Ga0495671_0026283_1973_2683 | 213 |
| 545 | 3300046694 | Ga0495649_0008663 | Ga0495649_0008663_371_1081 | 213 |
| 546 | 3300046694 | Ga0495649_0016496 | Ga0495649_0016496_621_1331 | 213 |
| 547 | 3300046794 | Ga0495589_0075469 | Ga0495589_0075469_845_1555 | 213 |
| 548 | 3300046794 | Ga0495589_0109845 | Ga0495589_0109845_488_1198 | 213 |
| 549 | 3300046809 | Ga0495600_0001440 | Ga0495600_0001440_5175_5903 | 213 |
| 550 | 3300046810 | Ga0495660_0252257 | Ga0495660_0252257_68_778 | 213 |
| 551 | 3300047317 | Ga0495604_0013770 | Ga0495604_0013770_773_1483 | 213 |
| 552 | 3300047317 | Ga0495604_0054220 | Ga0495604_0054220_562_1272 | 213 |
| 553 | 3300047317 | Ga0495604_0055791 | Ga0495604_0055791_1968_2678 | 213 |
| 554 | 3300047317 | Ga0495604_0099714 | Ga0495604_0099714_98_808 | 213 |
| 555 | 3300047319 | Ga0495674_0002437 | Ga0495674_0002437_15527_16237 | 213 |
| 556 | 3300047319 | Ga0495674_0005963 | Ga0495674_0005963_542_1252 | 213 |
| 557 | 3300047319 | Ga0495674_0009273 | Ga0495674_0009273_3082_3792 | 213 |
| 558 | 3300047319 | Ga0495674_0016409 | Ga0495674_0016409_3236_3946 | 213 |
| 559 | 3300047319 | Ga0495674_0022547 | Ga0495674_0022547_3159_3869 | 213 |
| 560 | 3300047319 | Ga0495674_0031064 | Ga0495674_0031064_1942_2652 | 213 |
| 561 | 3300047319 | Ga0495674_0081827 | Ga0495674_0081827_852_1562 | 213 |
| 562 | 3300047319 | Ga0495674_0263174 | Ga0495674_0263174_543_1253 | 213 |
| 563 | 3300047320 | Ga0495672_0011287 | Ga0495672_0011287_3881_4639 | 213 |
| 564 | 3300047320 | Ga0495672_0025928 | Ga0495672_0025928_485_1195 | 213 |
| 565 | 3300047320 | Ga0495672_0065449 | Ga0495672_0065449_1309_2022 | 213 |
| 566 | 3300047320 | Ga0495672_0084691 | Ga0495672_0084691_375_1085 | 213 |
| 567 | 3300047320 | Ga0495672_0111248 | Ga0495672_0111248_168_878 | 213 |
| 568 | 3300047321 | Ga0495676_0047871 | Ga0495676_0047871_648_1358 | 213 |
| 569 | 3300047321 | Ga0495676_0065644 | Ga0495676_0065644_236_946 | 213 |
| 570 | 3300047322 | Ga0495680_0402124 | Ga0495680_0402124_223_933 | 213 |
| 571 | 3300047322 | Ga0495680_0454935 | Ga0495680_0454935_35_745 | 213 |
| 572 | 3300047323 | Ga0495683_0001084 | Ga0495683_0001084_4952_5662 | 213 |
| 573 | 3300047323 | Ga0495683_0001161 | Ga0495683_0001161_4286_5044 | 213 |
| 574 | 3300047323 | Ga0495683_0005347 | Ga0495683_0005347_4620_5330 | 213 |
| 575 | 3300047323 | Ga0495683_0009237 | Ga0495683_0009237_2944_3681 | 213 |
| 576 | 3300047323 | Ga0495683_0018081 | Ga0495683_0018081_2577_3290 | 213 |
| 577 | 3300047323 | Ga0495683_0085772 | Ga0495683_0085772_596_1306 | 213 |
| 578 | 3300047323 | Ga0495683_0189249 | Ga0495683_0189249_56_766 | 213 |
| 579 | 3300047443 | Ga0495687_005866 | Ga0495687_005866_5189_5899 | 213 |
| 580 | 3300047443 | Ga0495687_008121 | Ga0495687_008121_2411_3124 | 213 |
| 581 | 3300047443 | Ga0495687_013195 | Ga0495687_013195_586_1296 | 213 |
| 582 | 3300047443 | Ga0495687_020586 | Ga0495687_020586_98_856 | 213 |
| 583 | 3300047443 | Ga0495687_028943 | Ga0495687_028943_1443_2153 | 213 |
| 584 | 3300047443 | Ga0495687_086983 | Ga0495687_086983_17_727 | 213 |
| 585 | 3300047444 | Ga0495675_0043545 | Ga0495675_0043545_350_1060 | 213 |
| 586 | 3300047444 | Ga0495675_0101006 | Ga0495675_0101006_999_1709 | 213 |
| 587 | 3300047445 | Ga0495677_0004263 | Ga0495677_0004263_3344_4054 | 213 |
| 588 | 3300047445 | Ga0495677_0005306 | Ga0495677_0005306_1249_1959 | 213 |
| 589 | 3300047445 | Ga0495677_0024924 | Ga0495677_0024924_1239_1949 | 213 |
| 590 | 3300047446 | Ga0495679_000025 | Ga0495679_000025_141270_141980 | 213 |
| 591 | 3300047446 | Ga0495679_000641 | Ga0495679_000641_4979_5689 | 213 |
| 592 | 3300047446 | Ga0495679_035792 | Ga0495679_035792_571_1281 | 213 |
| 593 | 3300047469 | Ga0495673_0000018 | Ga0495673_0000018_512964_513701 | 213 |
| 594 | 3300047469 | Ga0495673_0010794 | Ga0495673_0010794_3998_4708 | 213 |
| 595 | 3300047469 | Ga0495673_0014306 | Ga0495673_0014306_2021_2731 | 213 |
| 596 | 3300047469 | Ga0495673_0062553 | Ga0495673_0062553_496_1206 | 213 |
| 597 | 3300047469 | Ga0495673_0087294 | Ga0495673_0087294_414_1124 | 213 |
| 598 | 3300047472 | Ga0495686_0001115 | Ga0495686_0001115_12153_12890 | 213 |
| 599 | 3300047472 | Ga0495686_0027219 | Ga0495686_0027219_2154_2864 | 213 |
| 600 | 3300047472 | Ga0495686_0074520 | Ga0495686_0074520_53_811 | 213 |
| 601 | 3300047472 | Ga0495686_0087841 | Ga0495686_0087841_519_1229 | 213 |
| 602 | 3300047673 | Ga0495593_0001947 | Ga0495593_0001947_11451_12161 | 213 |
| 603 | 3300047673 | Ga0495593_0015253 | Ga0495593_0015253_3014_3724 | 213 |
| 604 | 3300047673 | Ga0495593_0042878 | Ga0495593_0042878_693_1403 | 213 |
| 605 | 3300047673 | Ga0495593_0051120 | Ga0495593_0051120_991_1701 | 213 |
| 606 | 3300048088 | Ga0495602_0025102 | Ga0495602_0025102_3740_4450 | 213 |
| 607 | 3300048088 | Ga0495602_0065291 | Ga0495602_0065291_2018_2728 | 213 |
| 608 | 3300048088 | Ga0495602_0077182 | Ga0495602_0077182_556_1266 | 213 |
| 609 | 3300048088 | Ga0495602_0241886 | Ga0495602_0241886_323_1033 | 213 |
| 610 | 3300048088 | Ga0495602_0252976 | Ga0495602_0252976_267_977 | 213 |
| 611 | 3300048088 | Ga0495602_0310650 | Ga0495602_0310650_267_977 | 213 |
| 612 | 3300048089 | Ga0495614_0048179 | Ga0495614_0048179_1052_1762 | 213 |
| 613 | 3300048091 | Ga0495626_0051436 | Ga0495626_0051436_965_1678 | 213 |
| 614 | 3300048091 | Ga0495626_0082751 | Ga0495626_0082751_286_996 | 213 |
| 615 | 3300048903 | Ga0496100_0000408 | Ga0496100_0000408_13225_13935 | 213 |
| 616 | 3300048903 | Ga0496100_0007056 | Ga0496100_0007056_4585_5298 | 213 |
| 617 | 3300048903 | Ga0496100_0082018 | Ga0496100_0082018_1137_1850 | 213 |
| 618 | 3300048903 | Ga0496100_0256490 | Ga0496100_0256490_317_1027 | 213 |
| 619 | 3300048903 | Ga0496100_0474065 | Ga0496100_0474065_16_774 | 213 |
| 620 | 3300048904 | Ga0496101_0000741 | Ga0496101_0000741_11672_12382 | 213 |
| 621 | 3300048904 | Ga0496101_0004013 | Ga0496101_0004013_5443_6153 | 213 |
| 622 | 3300048904 | Ga0496101_0009987 | Ga0496101_0009987_199_912 | 213 |
| 623 | 3300048904 | Ga0496101_0013858 | Ga0496101_0013858_2832_3542 | 213 |
| 624 | 3300048904 | Ga0496101_0025872 | Ga0496101_0025872_1794_2507 | 213 |
| 625 | 3300048904 | Ga0496101_0570527 | Ga0496101_0570527_14_727 | 213 |
| 626 | 3300048905 | Ga0496102_0000675 | Ga0496102_0000675_21786_22496 | 213 |
| 627 | 3300048905 | Ga0496102_0002308 | Ga0496102_0002308_2507_3220 | 213 |
| 628 | 3300048905 | Ga0496102_0106287 | Ga0496102_0106287_1640_2350 | 213 |
| 629 | 3300048905 | Ga0496102_0448606 | Ga0496102_0448606_318_1028 | 213 |
| 630 | 3300048906 | Ga0496103_0001501 | Ga0496103_0001501_11579_12289 | 213 |
| 631 | 3300048906 | Ga0496103_0012537 | Ga0496103_0012537_3317_4030 | 213 |
| 632 | 3300048906 | Ga0496103_0062856 | Ga0496103_0062856_10_720 | 213 |
| 633 | 3300048907 | Ga0496104_0006567 | Ga0496104_0006567_6514_7224 | 213 |
| 634 | 3300048907 | Ga0496104_0016640 | Ga0496104_0016640_208_930 | 213 |
| 635 | 3300048907 | Ga0496104_0018398 | Ga0496104_0018398_5479_6192 | 213 |
| 636 | 3300048907 | Ga0496104_0165826 | Ga0496104_0165826_800_1510 | 213 |
| 637 | 3300048908 | Ga0496105_0003608 | Ga0496105_0003608_5637_6347 | 213 |
| 638 | 3300048908 | Ga0496105_0009503 | Ga0496105_0009503_2956_3714 | 213 |
| 639 | 3300048908 | Ga0496105_0016299 | Ga0496105_0016299_1045_1755 | 213 |
| 640 | 3300048908 | Ga0496105_0027223 | Ga0496105_0027223_2372_3082 | 213 |
| 641 | 3300048908 | Ga0496105_0032526 | Ga0496105_0032526_3404_4114 | 213 |
| 642 | 3300048908 | Ga0496105_0542947 | Ga0496105_0542947_156_875 | 213 |
| 643 | 3300048909 | Ga0496106_0000079 | Ga0496106_0000079_10994_11704 | 213 |
| 644 | 3300048909 | Ga0496106_0002768 | Ga0496106_0002768_11830_12543 | 213 |
| 645 | 3300048909 | Ga0496106_0584341 | Ga0496106_0584341_34_756 | 213 |
| 646 | 3300048910 | Ga0496107_0000825 | Ga0496107_0000825_6994_7707 | 213 |
| 647 | 3300048910 | Ga0496107_0073861 | Ga0496107_0073861_1731_2453 | 213 |
| 648 | 3300048910 | Ga0496107_0525558 | Ga0496107_0525558_116_826 | 213 |
| 649 | 3300048911 | Ga0496108_0060214 | Ga0496108_0060214_1351_2064 | 213 |
| 650 | 3300048911 | Ga0496108_0061903 | Ga0496108_0061903_1367_2080 | 213 |
| 651 | 3300048911 | Ga0496108_0085611 | Ga0496108_0085611_1925_2635 | 213 |
| 652 | 3300048912 | Ga0496109_0022239 | Ga0496109_0022239_3028_3741 | 213 |
| 653 | 3300048915 | Ga0496112_0003459 | Ga0496112_0003459_10321_11034 | 213 |
| 654 | 3300048915 | Ga0496112_0074495 | Ga0496112_0074495_1440_2153 | 213 |
| 655 | 3300048915 | Ga0496112_0100860 | Ga0496112_0100860_592_1311 | 213 |
| 656 | 3300048915 | Ga0496112_0138942 | Ga0496112_0138942_1207_1920 | 213 |
| 657 | 3300048915 | Ga0496112_0377530 | Ga0496112_0377530_636_1349 | 213 |
| 658 | 3300048915 | Ga0496112_0683148 | Ga0496112_0683148_184_894 | 213 |
| 659 | 3300048916 | Ga0496113_0092536 | Ga0496113_0092536_371_1084 | 213 |
| 660 | 3300048916 | Ga0496113_0259193 | Ga0496113_0259193_337_1050 | 213 |
| 661 | 3300048917 | Ga0496114_0003137 | Ga0496114_0003137_3647_4360 | 213 |
| 662 | 3300048917 | Ga0496114_0309965 | Ga0496114_0309965_662_1372 | 213 |
| 663 | 3300048918 | Ga0496115_0567962 | Ga0496115_0567962_124_834 | 213 |
| 664 | 3300048920 | Ga0496117_0001301 | Ga0496117_0001301_24346_25056 | 213 |
| 665 | 3300048920 | Ga0496117_0061746 | Ga0496117_0061746_793_1503 | 213 |
| 666 | 3300048920 | Ga0496117_0098243 | Ga0496117_0098243_507_1217 | 213 |
| 667 | 3300048920 | Ga0496117_0148230 | Ga0496117_0148230_156_866 | 213 |
| 668 | 3300048921 | Ga0496118_0000400 | Ga0496118_0000400_58842_59552 | 213 |
| 669 | 3300048921 | Ga0496118_0001513 | Ga0496118_0001513_33815_34525 | 213 |
| 670 | 3300048921 | Ga0496118_0001539 | Ga0496118_0001539_21771_22481 | 213 |
| 671 | 3300048921 | Ga0496118_0028560 | Ga0496118_0028560_587_1297 | 213 |
| 672 | 3300048921 | Ga0496118_0041020 | Ga0496118_0041020_282_992 | 213 |
| 673 | 3300048921 | Ga0496118_0043130 | Ga0496118_0043130_1033_1743 | 213 |
| 674 | 3300048922 | Ga0496119_0008905 | Ga0496119_0008905_77_799 | 213 |
| 675 | 3300048922 | Ga0496119_0065612 | Ga0496119_0065612_870_1592 | 213 |
| 676 | 3300048922 | Ga0496119_0249949 | Ga0496119_0249949_113_823 | 213 |
| 677 | 3300048923 | Ga0496120_0001962 | Ga0496120_0001962_19372_20094 | 213 |
| 678 | 3300048924 | Ga0496121_0000557 | Ga0496121_0000557_26851_27561 | 213 |
| 679 | 3300048924 | Ga0496121_0002449 | Ga0496121_0002449_19748_20485 | 213 |
| 680 | 3300048924 | Ga0496121_0007417 | Ga0496121_0007417_11657_12367 | 213 |
| 681 | 3300048924 | Ga0496121_0013070 | Ga0496121_0013070_1302_2012 | 213 |
| 682 | 3300048924 | Ga0496121_0013692 | Ga0496121_0013692_4755_5465 | 213 |
| 683 | 3300048924 | Ga0496121_0017674 | Ga0496121_0017674_4373_5083 | 213 |
| 684 | 3300048924 | Ga0496121_0019038 | Ga0496121_0019038_3028_3738 | 213 |
| 685 | 3300048924 | Ga0496121_0019154 | Ga0496121_0019154_598_1320 | 213 |
| 686 | 3300048924 | Ga0496121_0025055 | Ga0496121_0025055_4603_5316 | 213 |
| 687 | 3300048924 | Ga0496121_0030670 | Ga0496121_0030670_846_1604 | 213 |
| 688 | 3300048924 | Ga0496121_0069969 | Ga0496121_0069969_1205_2026 | 213 |
| 689 | 3300048924 | Ga0496121_0380460 | Ga0496121_0380460_14_724 | 213 |
| 690 | 3300048927 | Ga0496124_0013685 | Ga0496124_0013685_6842_7552 | 213 |
| 691 | 3300048927 | Ga0496124_0153122 | Ga0496124_0153122_933_1643 | 213 |
| 692 | 3300048929 | Ga0496126_0000122 | Ga0496126_0000122_80520_81230 | 213 |
| 693 | 3300048929 | Ga0496126_0000196 | Ga0496126_0000196_107650_108360 | 213 |
| 694 | 3300048929 | Ga0496126_0168295 | Ga0496126_0168295_672_1382 | 213 |
| 695 | 3300048929 | Ga0496126_0233703 | Ga0496126_0233703_169_927 | 213 |
| 696 | 3300049460 | Ga0495682_0002681 | Ga0495682_0002681_2160_2918 | 213 |
| 697 | 3300049460 | Ga0495682_0037028 | Ga0495682_0037028_429_1139 | 213 |
| 698 | 3300049460 | Ga0495682_0062470 | Ga0495682_0062470_278_991 | 213 |
| 699 | 3300050490 | nmdc:mga03n38_34014_c1 | nmdc:mga03n38_34014_c1_943_1656 | 213 |
| 700 | 3300050492 | nmdc:mga0yw44_32482_c1 | nmdc:mga0yw44_32482_c1_914_1648 | 213 |
| 701 | 3300050494 | nmdc:mga06z11_318005_c1 | nmdc:mga06z11_318005_c1_154_867 | 213 |
| 702 | 3300050511 | nmdc:mga08y16_1559_c1 | nmdc:mga08y16_1559_c1_19645_20355 | 213 |
| 703 | 3300050515 | nmdc:mga0a205_433448_c1 | nmdc:mga0a205_433448_c1_357_1067 | 213 |
| 704 | 3300053077 | Ga0495601_0005701 | Ga0495601_0005701_5983_6711 | 213 |
| 705 | 3300053078 | Ga0495612_0000828 | Ga0495612_0000828_1768_2496 | 213 |
| 706 | 3300053083 | Ga0495655_0082573 | Ga0495655_0082573_167_880 | 213 |
| 707 | 3300053086 | Ga0500578_0019927 | Ga0500578_0019927_2722_3435 | 213 |
| 708 | 3300053090 | Ga0500646_0010555 | Ga0500646_0010555_50_760 | 213 |
| 709 | 3300053104 | Ga0500556_0070598 | Ga0500556_0070598_118_885 | 213 |
| 710 | 3300053130 | Ga0500642_0000842 | Ga0500642_0000842_680_1390 | 213 |
| 711 | 3300053134 | Ga0500658_0133431 | Ga0500658_0133431_349_1062 | 213 |
| 712 | 3300053139 | Ga0500568_0001070 | Ga0500568_0001070_2923_3633 | 213 |
| 713 | 3300053149 | Ga0500600_0017902 | Ga0500600_0017902_3367_4080 | 213 |
| 714 | 3300053153 | Ga0500616_0005363 | Ga0500616_0005363_7197_7910 | 213 |
| 715 | 3300053160 | Ga0500633_0097654 | Ga0500633_0097654_226_939 | 213 |
| 716 | 3300053161 | Ga0500634_0013268 | Ga0500634_0013268_787_1500 | 213 |
| 717 | 3300053736 | Ga0500599_003553 | Ga0500599_003553_1011_1721 | 213 |
| 718 | 3300053739 | Ga0500587_011172 | Ga0500587_011172_173_886 | 213 |
| 719 | 3300061719 | Ga0466962_0233724 | Ga0466962_0233724_93_803 | 213 |
| 720 | iso_pu_bacteria | 2904615490 | 2904624358 | 213 |
| 721 | iso_pu_bacteria | 2919450847 | 2919455865 | 213 |
| 722 | 3300005435 | Ga0070714_100077810 | Ga0070714_1000778104 | 214 |
| 723 | 3300005467 | Ga0070706_100005492 | Ga0070706_1000054926 | 214 |
| 724 | 3300005468 | Ga0070707_100542355 | Ga0070707_1005423551 | 214 |
| 725 | 3300005471 | Ga0070698_100108012 | Ga0070698_1001080122 | 214 |
| 726 | 3300009177 | Ga0105248_10283684 | Ga0105248_102836843 | 214 |
| 727 | 3300021361 | Ga0213872_10018642 | Ga0213872_100186423 | 214 |
| 728 | 3300021377 | Ga0213874_10124173 | Ga0213874_101241731 | 214 |
| 729 | 3300025922 | Ga0207646_10269263 | Ga0207646_102692631 | 214 |
| 730 | 3300025928 | Ga0207700_10271770 | Ga0207700_102717701 | 214 |
| 731 | 3300026088 | Ga0207641_10127427 | Ga0207641_101274271 | 214 |
| 732 | 3300026089 | Ga0207648_10086352 | Ga0207648_100863523 | 214 |
| 733 | 3300035083 | Ga0373926_0070833 | Ga0373926_0070833_355_1068 | 214 |
| 734 | 3300035086 | Ga0373934_0004960 | Ga0373934_0004960_2887_3600 | 214 |
| 735 | 3300035092 | Ga0373952_0021177 | Ga0373952_0021177_100_813 | 214 |
| 736 | 3300035111 | Ga0373923_0042529 | Ga0373923_0042529_1138_1851 | 214 |
| 737 | 3300035113 | Ga0373936_0003822 | Ga0373936_0003822_3751_4464 | 214 |
| 738 | 3300035113 | Ga0373936_0171079 | Ga0373936_0171079_163_876 | 214 |
| 739 | 3300035116 | Ga0373945_0013496 | Ga0373945_0013496_138_851 | 214 |
| 740 | 3300035117 | Ga0373953_0018435 | Ga0373953_0018435_11_724 | 214 |
| 741 | 3300035118 | Ga0373954_0313266 | Ga0373954_0313266_45_758 | 214 |
| 742 | 3300035119 | Ga0373956_0015364 | Ga0373956_0015364_700_1413 | 214 |
| 743 | 3300035120 | Ga0373957_0063104 | Ga0373957_0063104_580_1293 | 214 |
| 744 | 3300035172 | Ga0373955_0001663 | Ga0373955_0001663_5545_6258 | 214 |
| 745 | 3300035410 | Ga0373924_0001061 | Ga0373924_0001061_7942_8655 | 214 |
| 746 | 3300035692 | Ga0373935_0067629 | Ga0373935_0067629_500_1213 | 214 |
| 747 | 3300035695 | Ga0373927_0311564 | Ga0373927_0311564_31_744 | 214 |
| 748 | 3300035724 | Ga0373933_0003649 | Ga0373933_0003649_5837_6550 | 214 |
| 749 | 3300035725 | Ga0373947_0297228 | Ga0373947_0297228_51_764 | 214 |
| 750 | 3300037068 | Ga0373925_0006764 | Ga0373925_0006764_6205_6918 | 214 |
| 751 | 3300037418 | Ga0395900_0093869 | Ga0395900_0093869_1682_2395 | 214 |
| 752 | 3300037853 | Ga0436364_1281027 | Ga0436364_1281027_1368_2084 | 214 |
| 753 | 3300038443 | Ga0395901_0100216 | Ga0395901_0100216_391_1104 | 214 |
| 754 | 3300039447 | Ga0436361_0056336 | Ga0436361_0056336_829_1548 | 214 |
| 755 | 3300046454 | Ga0495592_0170918 | Ga0495592_0170918_709_1422 | 214 |
| 756 | 3300046459 | Ga0495629_0010882 | Ga0495629_0010882_725_1438 | 214 |
| 757 | 3300046461 | Ga0495641_0012844 | Ga0495641_0012844_104_817 | 214 |
| 758 | 3300046462 | Ga0495651_0056803 | Ga0495651_0056803_1998_2711 | 214 |
| 759 | 3300046463 | Ga0495653_0054011 | Ga0495653_0054011_576_1289 | 214 |
| 760 | 3300046472 | Ga0495580_0060764 | Ga0495580_0060764_1818_2531 | 214 |
| 761 | 3300046473 | Ga0495582_0093040 | Ga0495582_0093040_18_731 | 214 |
| 762 | 3300046475 | Ga0495639_0045956 | Ga0495639_0045956_965_1678 | 214 |
| 763 | 3300046476 | Ga0495662_0069940 | Ga0495662_0069940_671_1384 | 214 |
| 764 | 3300046477 | Ga0495664_0087725 | Ga0495664_0087725_426_1139 | 214 |
| 765 | 3300046499 | Ga0495594_0272794 | Ga0495594_0272794_181_894 | 214 |
| 766 | 3300046514 | Ga0495618_0042585 | Ga0495618_0042585_1904_2617 | 214 |
| 767 | 3300046514 | Ga0495618_0129525 | Ga0495618_0129525_76_789 | 214 |
| 768 | 3300046517 | Ga0495630_0009808 | Ga0495630_0009808_2962_3675 | 214 |
| 769 | 3300046529 | Ga0495652_0107929 | Ga0495652_0107929_1514_2227 | 214 |
| 770 | 3300046529 | Ga0495652_0191114 | Ga0495652_0191114_723_1436 | 214 |
| 771 | 3300046533 | Ga0495640_0032636 | Ga0495640_0032636_2427_3140 | 214 |
| 772 | 3300046533 | Ga0495640_0045323 | Ga0495640_0045323_1855_2568 | 214 |
| 773 | 3300046533 | Ga0495640_0079570 | Ga0495640_0079570_256_1035 | 214 |
| 774 | 3300046535 | Ga0495586_0039893 | Ga0495586_0039893_985_1764 | 214 |
| 775 | 3300046536 | Ga0495587_0022642 | Ga0495587_0022642_2237_2950 | 214 |
| 776 | 3300046543 | Ga0495645_0011571 | Ga0495645_0011571_4051_4776 | 214 |
| 777 | 3300046543 | Ga0495645_0059337 | Ga0495645_0059337_1173_1886 | 214 |
| 778 | 3300046543 | Ga0495645_0127517 | Ga0495645_0127517_875_1588 | 214 |
| 779 | 3300046543 | Ga0495645_0296145 | Ga0495645_0296145_24_803 | 214 |
| 780 | 3300046642 | Ga0495634_0002038 | Ga0495634_0002038_1732_2445 | 214 |
| 781 | 3300046663 | Ga0495635_0021204 | Ga0495635_0021204_435_1148 | 214 |
| 782 | 3300046663 | Ga0495635_0263977 | Ga0495635_0263977_170_883 | 214 |
| 783 | 3300046674 | Ga0495588_0026520 | Ga0495588_0026520_1567_2280 | 214 |
| 784 | 3300046675 | Ga0495657_0023905 | Ga0495657_0023905_2031_2744 | 214 |
| 785 | 3300046675 | Ga0495657_0102033 | Ga0495657_0102033_488_1201 | 214 |
| 786 | 3300046678 | Ga0495599_0014888 | Ga0495599_0014888_983_1696 | 214 |
| 787 | 3300046679 | Ga0495623_0032873 | Ga0495623_0032873_1617_2330 | 214 |
| 788 | 3300046680 | Ga0495646_0015358 | Ga0495646_0015358_2197_2910 | 214 |
| 789 | 3300046681 | Ga0495647_0229089 | Ga0495647_0229089_17_730 | 214 |
| 790 | 3300046683 | Ga0495658_0112330 | Ga0495658_0112330_466_1179 | 214 |
| 791 | 3300046683 | Ga0495658_0205972 | Ga0495658_0205972_17_730 | 214 |
| 792 | 3300046689 | Ga0495613_0013059 | Ga0495613_0013059_3619_4332 | 214 |
| 793 | 3300046689 | Ga0495613_0066328 | Ga0495613_0066328_914_1627 | 214 |
| 794 | 3300046689 | Ga0495613_0099243 | Ga0495613_0099243_505_1305 | 214 |
| 795 | 3300046690 | Ga0495624_0148717 | Ga0495624_0148717_43_756 | 214 |
| 796 | 3300046809 | Ga0495600_0030769 | Ga0495600_0030769_2006_2719 | 214 |
| 797 | 3300046809 | Ga0495600_0074868 | Ga0495600_0074868_446_1159 | 214 |
| 798 | 3300047315 | Ga0495581_0043353 | Ga0495581_0043353_1258_1971 | 214 |
| 799 | 3300047317 | Ga0495604_0006454 | Ga0495604_0006454_7713_8426 | 214 |
| 800 | 3300047319 | Ga0495674_0007367 | Ga0495674_0007367_9325_10104 | 214 |
| 801 | 3300047319 | Ga0495674_0060530 | Ga0495674_0060530_669_1382 | 214 |
| 802 | 3300047321 | Ga0495676_0032839 | Ga0495676_0032839_1850_2563 | 214 |
| 803 | 3300047322 | Ga0495680_0004577 | Ga0495680_0004577_1858_2571 | 214 |
| 804 | 3300047322 | Ga0495680_0062788 | Ga0495680_0062788_779_1492 | 214 |
| 805 | 3300047322 | Ga0495680_0404741 | Ga0495680_0404741_89_802 | 214 |
| 806 | 3300047471 | Ga0495684_0087347 | Ga0495684_0087347_988_1701 | 214 |
| 807 | 3300047673 | Ga0495593_0033195 | Ga0495593_0033195_1984_2697 | 214 |
| 808 | 3300048907 | Ga0496104_0455112 | Ga0496104_0455112_228_941 | 214 |
| 809 | 3300048911 | Ga0496108_0073757 | Ga0496108_0073757_1569_2282 | 214 |
| 810 | 3300048917 | Ga0496114_0082165 | Ga0496114_0082165_632_1345 | 214 |
| 811 | 3300048917 | Ga0496114_0179592 | Ga0496114_0179592_433_1146 | 214 |
| 812 | 3300048922 | Ga0496119_0025360 | Ga0496119_0025360_1611_2324 | 214 |
| 813 | 3300053077 | Ga0495601_0101247 | Ga0495601_0101247_61_774 | 214 |
| 814 | 3300053077 | Ga0495601_0179208 | Ga0495601_0179208_62_775 | 214 |
| 815 | 3300053078 | Ga0495612_0148148 | Ga0495612_0148148_164_943 | 214 |
| 816 | 3300053084 | Ga0495595_0024180 | Ga0495595_0024180_102_815 | 214 |
| 817 | 3300053084 | Ga0495595_0024548 | Ga0495595_0024548_761_1474 | 214 |
| 818 | 3300053085 | Ga0495619_0172739 | Ga0495619_0172739_280_1005 | 214 |
| 819 | 3300053085 | Ga0495619_0201876 | Ga0495619_0201876_624_1337 | 214 |
| 820 | iso_pu_bacteria | 2818991458 | 2819665771 | 214 |
| 821 | 3300001976 | JGI24752J21851_1012632 | JGI24752J21851_10126322 | 215 |
| 822 | 3300005327 | Ga0070658_10215953 | Ga0070658_102159532 | 215 |
| 823 | 3300005334 | Ga0068869_100235507 | Ga0068869_1002355072 | 215 |
| 824 | 3300005334 | Ga0068869_100261874 | Ga0068869_1002618741 | 215 |
| 825 | 3300005337 | Ga0070682_100071153 | Ga0070682_1000711534 | 215 |
| 826 | 3300005340 | Ga0070689_100252078 | Ga0070689_1002520782 | 215 |
| 827 | 3300005341 | Ga0070691_10113504 | Ga0070691_101135042 | 215 |
| 828 | 3300005343 | Ga0070687_100061247 | Ga0070687_1000612471 | 215 |
| 829 | 3300005344 | Ga0070661_100205666 | Ga0070661_1002056662 | 215 |
| 830 | 3300005353 | Ga0070669_100357970 | Ga0070669_1003579702 | 215 |
| 831 | 3300005355 | Ga0070671_100297658 | Ga0070671_1002976581 | 215 |
| 832 | 3300005356 | Ga0070674_100089658 | Ga0070674_1000896582 | 215 |
| 833 | 3300005365 | Ga0070688_100022220 | Ga0070688_1000222202 | 215 |
| 834 | 3300005367 | Ga0070667_100070868 | Ga0070667_1000708684 | 215 |
| 835 | 3300005406 | Ga0070703_10018005 | Ga0070703_100180052 | 215 |
| 836 | 3300005434 | Ga0070709_10000720 | Ga0070709_100007206 | 215 |
| 837 | 3300005434 | Ga0070709_10009975 | Ga0070709_100099752 | 215 |
| 838 | 3300005434 | Ga0070709_10267430 | Ga0070709_102674302 | 215 |
| 839 | 3300005435 | Ga0070714_100065817 | Ga0070714_1000658172 | 215 |
| 840 | 3300005436 | Ga0070713_100349902 | Ga0070713_1003499022 | 215 |
| 841 | 3300005436 | Ga0070713_100889101 | Ga0070713_1008891011 | 215 |
| 842 | 3300005437 | Ga0070710_10019664 | Ga0070710_100196642 | 215 |
| 843 | 3300005438 | Ga0070701_10054558 | Ga0070701_100545583 | 215 |
| 844 | 3300005440 | Ga0070705_100048453 | Ga0070705_1000484532 | 215 |
| 845 | 3300005440 | Ga0070705_100103227 | Ga0070705_1001032272 | 215 |
| 846 | 3300005444 | Ga0070694_100092881 | Ga0070694_1000928812 | 215 |
| 847 | 3300005445 | Ga0070708_100188849 | Ga0070708_1001888492 | 215 |
| 848 | 3300005445 | Ga0070708_100381784 | Ga0070708_1003817841 | 215 |
| 849 | 3300005455 | Ga0070663_100013973 | Ga0070663_1000139733 | 215 |
| 850 | 3300005457 | Ga0070662_100025103 | Ga0070662_1000251033 | 215 |
| 851 | 3300005467 | Ga0070706_100232154 | Ga0070706_1002321542 | 215 |
| 852 | 3300005467 | Ga0070706_100313442 | Ga0070706_1003134421 | 215 |
| 853 | 3300005467 | Ga0070706_100471130 | Ga0070706_1004711302 | 215 |
| 854 | 3300005471 | Ga0070698_100007439 | Ga0070698_10000743913 | 215 |
| 855 | 3300005535 | Ga0070684_100878302 | Ga0070684_1008783021 | 215 |
| 856 | 3300005544 | Ga0070686_100057786 | Ga0070686_1000577862 | 215 |
| 857 | 3300005546 | Ga0070696_100034286 | Ga0070696_1000342862 | 215 |
| 858 | 3300005547 | Ga0070693_100013088 | Ga0070693_1000130882 | 215 |
| 859 | 3300005548 | Ga0070665_100305012 | Ga0070665_1003050122 | 215 |
| 860 | 3300005578 | Ga0068854_100058562 | Ga0068854_1000585623 | 215 |
| 861 | 3300005615 | Ga0070702_100076938 | Ga0070702_1000769383 | 215 |
| 862 | 3300005616 | Ga0068852_100439637 | Ga0068852_1004396372 | 215 |
| 863 | 3300005617 | Ga0068859_100097799 | Ga0068859_1000977992 | 215 |
| 864 | 3300005618 | Ga0068864_100116384 | Ga0068864_1001163842 | 215 |
| 865 | 3300005841 | Ga0068863_100342979 | Ga0068863_1003429792 | 215 |
| 866 | 3300005842 | Ga0068858_100096458 | Ga0068858_1000964584 | 215 |
| 867 | 3300006163 | Ga0070715_10001936 | Ga0070715_100019362 | 215 |
| 868 | 3300006163 | Ga0070715_10010676 | Ga0070715_100106764 | 215 |
| 869 | 3300006175 | Ga0070712_100285645 | Ga0070712_1002856452 | 215 |
| 870 | 3300006931 | Ga0097620_100097812 | Ga0097620_1000978122 | 215 |
| 871 | 3300007076 | Ga0075435_100199880 | Ga0075435_1001998802 | 215 |
| 872 | 3300009011 | Ga0105251_10038544 | Ga0105251_100385443 | 215 |
| 873 | 3300009098 | Ga0105245_10318533 | Ga0105245_103185332 | 215 |
| 874 | 3300009101 | Ga0105247_10434617 | Ga0105247_104346171 | 215 |
| 875 | 3300009148 | Ga0105243_10172160 | Ga0105243_101721602 | 215 |
| 876 | 3300009174 | Ga0105241_10025006 | Ga0105241_100250063 | 215 |
| 877 | 3300009177 | Ga0105248_10301804 | Ga0105248_103018042 | 215 |
| 878 | 3300010375 | Ga0105239_10801024 | Ga0105239_108010242 | 215 |
| 879 | 3300013100 | Ga0157373_10108422 | Ga0157373_101084222 | 215 |
| 880 | 3300013102 | Ga0157371_10144150 | Ga0157371_101441502 | 215 |
| 881 | 3300013306 | Ga0163162_10242903 | Ga0163162_102429032 | 215 |
| 882 | 3300013308 | Ga0157375_10415587 | Ga0157375_104155872 | 215 |
| 883 | 3300014745 | Ga0157377_10021133 | Ga0157377_100211332 | 215 |
| 884 | 3300017792 | Ga0163161_10148005 | Ga0163161_101480052 | 215 |
| 885 | 3300021388 | Ga0213875_10000581 | Ga0213875_1000058127 | 215 |
| 886 | 3300024227 | Ga0228598_1008076 | Ga0228598_10080762 | 215 |
| 887 | 3300025885 | Ga0207653_10012826 | Ga0207653_100128263 | 215 |
| 888 | 3300025898 | Ga0207692_10004147 | Ga0207692_100041475 | 215 |
| 889 | 3300025903 | Ga0207680_10080712 | Ga0207680_100807122 | 215 |
| 890 | 3300025906 | Ga0207699_10006367 | Ga0207699_100063674 | 215 |
| 891 | 3300025907 | Ga0207645_10212328 | Ga0207645_102123282 | 215 |
| 892 | 3300025908 | Ga0207643_10013681 | Ga0207643_100136812 | 215 |
| 893 | 3300025910 | Ga0207684_10242680 | Ga0207684_102426802 | 215 |
| 894 | 3300025913 | Ga0207695_10155254 | Ga0207695_101552542 | 215 |
| 895 | 3300025915 | Ga0207693_10201086 | Ga0207693_102010862 | 215 |
| 896 | 3300025915 | Ga0207693_10682345 | Ga0207693_106823451 | 215 |
| 897 | 3300025916 | Ga0207663_10030188 | Ga0207663_100301882 | 215 |
| 898 | 3300025918 | Ga0207662_10021583 | Ga0207662_100215832 | 215 |
| 899 | 3300025927 | Ga0207687_10393208 | Ga0207687_103932082 | 215 |
| 900 | 3300025928 | Ga0207700_10104821 | Ga0207700_101048212 | 215 |
| 901 | 3300025929 | Ga0207664_10006691 | Ga0207664_100066919 | 215 |
| 902 | 3300025929 | Ga0207664_10142175 | Ga0207664_101421752 | 215 |
| 903 | 3300025929 | Ga0207664_10149634 | Ga0207664_101496342 | 215 |
| 904 | 3300025931 | Ga0207644_10326064 | Ga0207644_103260642 | 215 |
| 905 | 3300025933 | Ga0207706_10067450 | Ga0207706_100674502 | 215 |
| 906 | 3300025935 | Ga0207709_10045428 | Ga0207709_100454283 | 215 |
| 907 | 3300025939 | Ga0207665_10019328 | Ga0207665_100193285 | 215 |
| 908 | 3300025942 | Ga0207689_10103585 | Ga0207689_101035854 | 215 |
| 909 | 3300025944 | Ga0207661_10100823 | Ga0207661_101008232 | 215 |
| 910 | 3300025945 | Ga0207679_10104168 | Ga0207679_101041682 | 215 |
| 911 | 3300025960 | Ga0207651_10111139 | Ga0207651_101111392 | 215 |
| 912 | 3300025961 | Ga0207712_10505561 | Ga0207712_105055612 | 215 |
| 913 | 3300026023 | Ga0207677_10031401 | Ga0207677_100314012 | 215 |
| 914 | 3300026035 | Ga0207703_10118434 | Ga0207703_101184342 | 215 |
| 915 | 3300026067 | Ga0207678_10026101 | Ga0207678_100261013 | 215 |
| 916 | 3300026088 | Ga0207641_10556957 | Ga0207641_105569572 | 215 |
| 917 | 3300026089 | Ga0207648_10071777 | Ga0207648_100717772 | 215 |
| 918 | 3300026095 | Ga0207676_10330023 | Ga0207676_103300232 | 215 |
| 919 | 3300026116 | Ga0207674_10080197 | Ga0207674_100801972 | 215 |
| 920 | 3300028379 | Ga0268266_10165609 | Ga0268266_101656092 | 215 |
| 921 | 3300028381 | Ga0268264_10029721 | Ga0268264_100297214 | 215 |
| 922 | 3300028800 | Ga0265338_10105408 | Ga0265338_101054084 | 215 |
| 923 | 3300030763 | Ga0265763_1008822 | Ga0265763_10088222 | 215 |
| 924 | 3300031090 | Ga0265760_10098872 | Ga0265760_100988721 | 215 |
| 925 | 3300034817 | Ga0373948_0044771 | Ga0373948_0044771_196_912 | 215 |
| 926 | 3300034819 | Ga0373958_0007049 | Ga0373958_0007049_327_1043 | 215 |
| 927 | 3300035083 | Ga0373926_0001220 | Ga0373926_0001220_4235_4951 | 215 |
| 928 | 3300035086 | Ga0373934_0008907 | Ga0373934_0008907_1274_1990 | 215 |
| 929 | 3300035089 | Ga0373944_0001982 | Ga0373944_0001982_2637_3353 | 215 |
| 930 | 3300035091 | Ga0373951_0015400 | Ga0373951_0015400_210_926 | 215 |
| 931 | 3300035113 | Ga0373936_0003112 | Ga0373936_0003112_4640_5356 | 215 |
| 932 | 3300035115 | Ga0373941_0012172 | Ga0373941_0012172_476_1192 | 215 |
| 933 | 3300035117 | Ga0373953_0022413 | Ga0373953_0022413_315_1031 | 215 |
| 934 | 3300035118 | Ga0373954_0005554 | Ga0373954_0005554_4616_5332 | 215 |
| 935 | 3300035118 | Ga0373954_0088703 | Ga0373954_0088703_702_1418 | 215 |
| 936 | 3300035119 | Ga0373956_0036895 | Ga0373956_0036895_1327_2043 | 215 |
| 937 | 3300035170 | Ga0373943_0015748 | Ga0373943_0015748_736_1452 | 215 |
| 938 | 3300035171 | Ga0373946_0001302 | Ga0373946_0001302_5579_6295 | 215 |
| 939 | 3300035172 | Ga0373955_0058866 | Ga0373955_0058866_543_1259 | 215 |
| 940 | 3300035172 | Ga0373955_0058950 | Ga0373955_0058950_415_1131 | 215 |
| 941 | 3300035410 | Ga0373924_0010280 | Ga0373924_0010280_1139_1855 | 215 |
| 942 | 3300035691 | Ga0373931_0104520 | Ga0373931_0104520_836_1552 | 215 |
| 943 | 3300035724 | Ga0373933_0014869 | Ga0373933_0014869_494_1210 | 215 |
| 944 | 3300035724 | Ga0373933_0339844 | Ga0373933_0339844_233_949 | 215 |
| 945 | 3300035725 | Ga0373947_0013077 | Ga0373947_0013077_1833_2549 | 215 |
| 946 | 3300036401 | Ga0373937_0038642 | Ga0373937_0038642_3291_4007 | 215 |
| 947 | 3300036401 | Ga0373937_0142161 | Ga0373937_0142161_505_1221 | 215 |
| 948 | 3300036401 | Ga0373937_0500507 | Ga0373937_0500507_49_765 | 215 |
| 949 | 3300037068 | Ga0373925_0000356 | Ga0373925_0000356_29138_29863 | 215 |
| 950 | 3300037068 | Ga0373925_0007590 | Ga0373925_0007590_4262_4978 | 215 |
| 951 | 3300037068 | Ga0373925_0022582 | Ga0373925_0022582_986_1702 | 215 |
| 952 | 3300037853 | Ga0436364_0658848 | Ga0436364_0658848_81781_82497 | 215 |
| 953 | 3300046454 | Ga0495592_0012171 | Ga0495592_0012171_241_957 | 215 |
| 954 | 3300046454 | Ga0495592_0025810 | Ga0495592_0025810_1772_2488 | 215 |
| 955 | 3300046454 | Ga0495592_0130129 | Ga0495592_0130129_814_1530 | 215 |
| 956 | 3300046459 | Ga0495629_0007439 | Ga0495629_0007439_5065_5781 | 215 |
| 957 | 3300046461 | Ga0495641_0024166 | Ga0495641_0024166_709_1425 | 215 |
| 958 | 3300046462 | Ga0495651_0004947 | Ga0495651_0004947_4072_4788 | 215 |
| 959 | 3300046462 | Ga0495651_0026690 | Ga0495651_0026690_888_1604 | 215 |
| 960 | 3300046462 | Ga0495651_0051177 | Ga0495651_0051177_995_1711 | 215 |
| 961 | 3300046462 | Ga0495651_0081505 | Ga0495651_0081505_1034_1750 | 215 |
| 962 | 3300046463 | Ga0495653_0028278 | Ga0495653_0028278_3126_3842 | 215 |
| 963 | 3300046463 | Ga0495653_0044277 | Ga0495653_0044277_766_1482 | 215 |
| 964 | 3300046472 | Ga0495580_0083237 | Ga0495580_0083237_1280_1996 | 215 |
| 965 | 3300046473 | Ga0495582_0000907 | Ga0495582_0000907_1475_2191 | 215 |
| 966 | 3300046476 | Ga0495662_0004199 | Ga0495662_0004199_3416_4132 | 215 |
| 967 | 3300046477 | Ga0495664_0020804 | Ga0495664_0020804_1037_1753 | 215 |
| 968 | 3300046499 | Ga0495594_0034844 | Ga0495594_0034844_1505_2221 | 215 |
| 969 | 3300046511 | Ga0495608_0006951 | Ga0495608_0006951_2173_2889 | 215 |
| 970 | 3300046511 | Ga0495608_0032001 | Ga0495608_0032001_2353_3069 | 215 |
| 971 | 3300046511 | Ga0495608_0141641 | Ga0495608_0141641_477_1193 | 215 |
| 972 | 3300046514 | Ga0495618_0005709 | Ga0495618_0005709_5132_5848 | 215 |
| 973 | 3300046514 | Ga0495618_0025527 | Ga0495618_0025527_22_738 | 215 |
| 974 | 3300046516 | Ga0495628_0036053 | Ga0495628_0036053_1722_2438 | 215 |
| 975 | 3300046516 | Ga0495628_0038761 | Ga0495628_0038761_1558_2274 | 215 |
| 976 | 3300046517 | Ga0495630_0027118 | Ga0495630_0027118_1558_2274 | 215 |
| 977 | 3300046517 | Ga0495630_0164729 | Ga0495630_0164729_818_1534 | 215 |
| 978 | 3300046526 | Ga0495666_0050392 | Ga0495666_0050392_807_1523 | 215 |
| 979 | 3300046529 | Ga0495652_0027329 | Ga0495652_0027329_2773_3489 | 215 |
| 980 | 3300046529 | Ga0495652_0031835 | Ga0495652_0031835_461_1177 | 215 |
| 981 | 3300046529 | Ga0495652_0394374 | Ga0495652_0394374_97_813 | 215 |
| 982 | 3300046531 | Ga0495665_0020853 | Ga0495665_0020853_799_1515 | 215 |
| 983 | 3300046533 | Ga0495640_0154943 | Ga0495640_0154943_138_854 | 215 |
| 984 | 3300046535 | Ga0495586_0015609 | Ga0495586_0015609_2964_3680 | 215 |
| 985 | 3300046536 | Ga0495587_0001951 | Ga0495587_0001951_5286_6002 | 215 |
| 986 | 3300046536 | Ga0495587_0005871 | Ga0495587_0005871_5526_6242 | 215 |
| 987 | 3300046543 | Ga0495645_0009211 | Ga0495645_0009211_3667_4383 | 215 |
| 988 | 3300046543 | Ga0495645_0011886 | Ga0495645_0011886_3885_4601 | 215 |
| 989 | 3300046559 | Ga0495667_0002860 | Ga0495667_0002860_3565_4281 | 215 |
| 990 | 3300046559 | Ga0495667_0022779 | Ga0495667_0022779_1914_2630 | 215 |
| 991 | 3300046642 | Ga0495634_0056867 | Ga0495634_0056867_766_1482 | 215 |
| 992 | 3300046663 | Ga0495635_0010805 | Ga0495635_0010805_3667_4383 | 215 |
| 993 | 3300046663 | Ga0495635_0011344 | Ga0495635_0011344_5018_5734 | 215 |
| 994 | 3300046663 | Ga0495635_0045742 | Ga0495635_0045742_766_1482 | 215 |
| 995 | 3300046675 | Ga0495657_0022664 | Ga0495657_0022664_1956_2672 | 215 |
| 996 | 3300046678 | Ga0495599_0020987 | Ga0495599_0020987_1895_2611 | 215 |
| 997 | 3300046678 | Ga0495599_0030559 | Ga0495599_0030559_2294_3010 | 215 |
| 998 | 3300046679 | Ga0495623_0030187 | Ga0495623_0030187_2450_3166 | 215 |
| 999 | 3300046680 | Ga0495646_0016238 | Ga0495646_0016238_3633_4349 | 215 |
| 1000 | 3300046680 | Ga0495646_0033405 | Ga0495646_0033405_766_1482 | 215 |
| 1001 | 3300046683 | Ga0495658_0033231 | Ga0495658_0033231_519_1235 | 215 |
| 1002 | 3300046689 | Ga0495613_0026308 | Ga0495613_0026308_1647_2363 | 215 |
| 1003 | 3300046690 | Ga0495624_0109557 | Ga0495624_0109557_830_1546 | 215 |
| 1004 | 3300046809 | Ga0495600_0033670 | Ga0495600_0033670_765_1481 | 215 |
| 1005 | 3300047315 | Ga0495581_0020613 | Ga0495581_0020613_2311_3027 | 215 |
| 1006 | 3300047317 | Ga0495604_0004620 | Ga0495604_0004620_5043_5759 | 215 |
| 1007 | 3300047317 | Ga0495604_0362145 | Ga0495604_0362145_196_912 | 215 |
| 1008 | 3300047319 | Ga0495674_0011092 | Ga0495674_0011092_6661_7377 | 215 |
| 1009 | 3300047319 | Ga0495674_0053595 | Ga0495674_0053595_1973_2689 | 215 |
| 1010 | 3300047319 | Ga0495674_0400227 | Ga0495674_0400227_106_822 | 215 |
| 1011 | 3300047321 | Ga0495676_0042197 | Ga0495676_0042197_1687_2403 | 215 |
| 1012 | 3300047322 | Ga0495680_0013421 | Ga0495680_0013421_2009_2725 | 215 |
| 1013 | 3300047322 | Ga0495680_0035099 | Ga0495680_0035099_1987_2703 | 215 |
| 1014 | 3300047322 | Ga0495680_0046247 | Ga0495680_0046247_41_757 | 215 |
| 1015 | 3300047444 | Ga0495675_0006549 | Ga0495675_0006549_960_1676 | 215 |
| 1016 | 3300047471 | Ga0495684_0049908 | Ga0495684_0049908_765_1481 | 215 |
| 1017 | 3300047471 | Ga0495684_0118252 | Ga0495684_0118252_1083_1799 | 215 |
| 1018 | 3300047471 | Ga0495684_0257696 | Ga0495684_0257696_384_1100 | 215 |
| 1019 | 3300047673 | Ga0495593_0013548 | Ga0495593_0013548_1856_2572 | 215 |
| 1020 | 3300048088 | Ga0495602_0034148 | Ga0495602_0034148_1539_2255 | 215 |
| 1021 | 3300048088 | Ga0495602_0048619 | Ga0495602_0048619_2534_3250 | 215 |
| 1022 | 3300048089 | Ga0495614_0034222 | Ga0495614_0034222_943_1659 | 215 |
| 1023 | 3300048903 | Ga0496100_0070371 | Ga0496100_0070371_500_1225 | 215 |
| 1024 | 3300048904 | Ga0496101_0032749 | Ga0496101_0032749_1750_2466 | 215 |
| 1025 | 3300048904 | Ga0496101_0464546 | Ga0496101_0464546_173_898 | 215 |
| 1026 | 3300048905 | Ga0496102_0179842 | Ga0496102_0179842_462_1187 | 215 |
| 1027 | 3300048906 | Ga0496103_0018046 | Ga0496103_0018046_1178_1894 | 215 |
| 1028 | 3300048907 | Ga0496104_0002120 | Ga0496104_0002120_9417_10142 | 215 |
| 1029 | 3300048907 | Ga0496104_0200131 | Ga0496104_0200131_986_1702 | 215 |
| 1030 | 3300048908 | Ga0496105_0209434 | Ga0496105_0209434_427_1143 | 215 |
| 1031 | 3300048908 | Ga0496105_0351814 | Ga0496105_0351814_81_797 | 215 |
| 1032 | 3300048909 | Ga0496106_0053974 | Ga0496106_0053974_339_1055 | 215 |
| 1033 | 3300048910 | Ga0496107_0037326 | Ga0496107_0037326_2345_3061 | 215 |
| 1034 | 3300048911 | Ga0496108_0040495 | Ga0496108_0040495_1616_2341 | 215 |
| 1035 | 3300048911 | Ga0496108_0133704 | Ga0496108_0133704_962_1678 | 215 |
| 1036 | 3300048911 | Ga0496108_0142449 | Ga0496108_0142449_407_1123 | 215 |
| 1037 | 3300048912 | Ga0496109_0129474 | Ga0496109_0129474_1324_2049 | 215 |
| 1038 | 3300048918 | Ga0496115_0027281 | Ga0496115_0027281_1328_2044 | 215 |
| 1039 | 3300048918 | Ga0496115_0106461 | Ga0496115_0106461_551_1276 | 215 |
| 1040 | 3300050512 | nmdc:mga0n895_412860_c1 | nmdc:mga0n895_412860_c1_399_1115 | 215 |
| 1041 | 3300050513 | nmdc:mga0rr50_223956_c1 | nmdc:mga0rr50_223956_c1_379_1095 | 215 |
| 1042 | 3300053077 | Ga0495601_0019751 | Ga0495601_0019751_2114_2830 | 215 |
| 1043 | 3300053077 | Ga0495601_0237103 | Ga0495601_0237103_174_890 | 215 |
| 1044 | 3300053078 | Ga0495612_0082824 | Ga0495612_0082824_371_1087 | 215 |
| 1045 | 3300053084 | Ga0495595_0013219 | Ga0495595_0013219_886_1602 | 215 |
| 1046 | 3300053084 | Ga0495595_0013691 | Ga0495595_0013691_1832_2548 | 215 |
| 1047 | 3300053085 | Ga0495619_0031537 | Ga0495619_0031537_2406_3122 | 215 |
| 1048 | 3300053085 | Ga0495619_0054149 | Ga0495619_0054149_1795_2511 | 215 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3m1a-assembly4.cif.gz_D | the crystal structure of a short-chain dehydrogenase from streptomyces avermitilis to 2a | 0.9019 | 5 | 159 |
| 6uhx-assembly1.cif.gz_A | crystal structure of yir035c short chain dehydrogenases/reductase from saccharomyces cerevisiae | 0.8955 | 7 | 159 |
| 3sju-assembly1.cif.gz_A | hedamycin polyketide ketoreductase bound to nadph | 0.8937 | 7 | 159 |
| 2q2v-assembly2.cif.gz_D | structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida | 0.89 | 7 | 159 |
| 4lvu-assembly1.cif.gz_A-2 | crystal structure of a putative short chain dehydrogenase from burkholderia thailandensis | 0.8899 | 7 | 159 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_B4FAP3_11_264_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9241 | 5 | 159 | 3.40.50.720 |
| af_A0A1D6ED38_49_231_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9183 | 5 | 159 | 3.40.50.720 |
| af_A0A1D8PJ12_2_249_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9142 | 6 | 159 | 3.40.50.720 |
| af_Q54IQ3_9_285_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9071 | 5 | 159 | 3.40.50.720 |
| af_A0A0P0WB25_64_301_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9067 | 30 | 159 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2U0XY21-F1-model_v4 | deleted | 0.9762 | 1 | 126 |
|
| AF-I5CMQ8-F1-model_v4 | deleted | 0.9747 | 4 | 110 |
|
| AF-A0A8A6L033-F1-model_v4 | deleted | 0.9746 | 6 | 112 |
|
| AF-A0A7I8CZV1-F1-model_v4 | Gluconate 5-dehydrogenase | 0.9608 | 4 | 159 |
GO:0016616
GO:0030497 |
| AF-A0A520JEG2-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9551 | 6 | 159 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar