F488985

General Info

Members Datasets Scaffolds Average Seq Length
1047 655 799 343

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0014216|Ga0501031_0014216_2014_3129
Length 361
Sequence MACSAPKTSSGFDAMTNQTLIPAGDFRSTYAADTTIFPTVTSRNAAITGVILLCAAPYLLSEYWLSLLIQIGMYGIAALGLNILVGFTGQISIGHAAFFLFGAFTSAYLSSKIGIPAFFSIPLSGVVTALVGLIFGLPATRLKGLYLAIATLAAQYILLDFFARAEWFTGGSVPSMAEPFSLFGHVFQGDRQYFYVVLANLMRSRDGRALVAVRDHYLSAEIMGINLTKYRTLSFGLAAFFAGIGGGLYAHYQLVVSYEGFGIERSILFLAMIIIGGTGSIMGTLMGTAFVVLLPEAMEWLTTALSGGAIDHALGLKTNITFLREIAIGVIIILFLVFEPDGLAHRWRQIKAYWKLYPFSH

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
7 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
8 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
9 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
10 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
11 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
12 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
13 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
14 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
15 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
16 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
17 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
18 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
19 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
20 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
21 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
22 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
23 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
24 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
25 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
26 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
27 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
28 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
29 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
30 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
31 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
32 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
33 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
34 2643221651 Afipia sp. Root123D2 Isolate Unclassified
35 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
36 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
37 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
38 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
39 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
40 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
41 2791355199
42 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
43 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
44 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
45 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
46 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
47 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
48 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
49 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
50 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
51 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
52 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
53 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
54 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
55 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
56 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
57 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
58 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
59 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
60 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
61 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
62 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
63 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
64 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
65 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
66 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
67 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
68 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
69 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
70 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
71 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
72 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
73 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
74 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
75 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
76 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
77 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
78 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
79 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
80 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
81 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
82 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
83 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
84 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
85 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
86 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
87 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
88 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
89 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
90 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
91 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
92 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
93 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
94 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
95 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
96 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
97 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
98 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
99 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
100 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
101 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
102 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
103 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
104 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
105 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
106 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
107 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
108 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
109 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
110 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
111 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
112 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
113 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
114 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
115 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
116 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
117 2904699407
118 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
119 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
120 2906610324
121 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
122 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
123 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
124 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
125 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
126 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
127 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
128 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
129 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
130 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
131 2922368715
132 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
133 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
134 2922425934
135 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
136 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
137 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
138 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
139 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
140 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
141 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
142 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
143 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
144 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
145 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
146 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
147 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
148 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
149 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
150 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
151 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
152 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
153 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
154 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
155 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
156 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
157 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
158 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
159 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
160 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
161 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
162 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
163 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
164 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
165 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
166 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
167 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
168 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
169 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
170 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
171 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
172 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
173 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
174 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
175 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
176 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
177 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
178 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
179 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
180 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
181 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
182 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
183 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
184 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
185 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
186 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
187 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
188 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
189 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
190 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
191 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
192 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
193 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
194 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
195 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
196 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
197 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
198 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
199 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
200 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
201 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
202 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
203 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
204 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
205 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
206 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
207 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
208 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
209 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
210 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
211 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
212 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
213 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
214 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
215 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
216 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
217 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
218 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
219 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
220 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
221 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
222 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
223 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
224 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
225 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
226 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
227 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
228 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
229 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
230 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
231 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
232 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
233 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
234 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
235 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
236 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
237 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
238 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
239 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
240 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
241 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
242 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
243 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
244 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
245 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
246 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
247 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
248 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
249 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
250 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
251 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
252 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
253 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
254 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
255 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
256 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
257 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
258 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
259 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
260 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
261 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
262 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
263 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
264 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
265 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
266 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
267 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
268 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
269 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
270 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
271 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
272 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
273 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
274 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
275 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
276 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
277 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
278 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
279 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
280 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
281 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
282 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
283 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
284 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
285 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
286 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
287 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
288 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
289 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
290 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
291 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
292 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
293 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
294 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
295 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
296 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
297 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
298 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
299 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
300 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
301 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
302 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
303 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
304 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
305 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
306 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
307 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
308 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
309 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
310 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
311 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
312 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
313 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
314 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
315 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
316 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
317 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
318 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
319 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
320 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
321 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
322 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
362 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
364 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
368 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
369 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
370 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
371 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
372 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
373 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
375 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
376 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
377 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
378 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
379 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
380 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
381 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
382 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
383 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
384 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
385 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
386 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
387 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
388 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
389 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
390 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
391 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
392 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
393 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
394 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
395 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
396 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
397 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
398 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
399 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
400 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
401 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
402 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
403 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
404 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
405 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
406 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
407 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
408 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
409 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
410 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
411 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
412 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
413 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
414 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
415 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
416 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
417 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
418 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
419 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
420 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
421 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
422 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
423 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
424 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
425 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
426 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
427 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
428 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
429 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
430 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
431 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
432 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
433 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
434 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
435 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
436 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
437 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
438 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
439 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
440 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
441 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
442 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
443 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
444 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
445 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
446 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
447 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
448 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
449 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
450 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
451 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
452 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
453 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
454 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
455 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
456 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
457 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
458 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
459 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
460 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
461 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
462 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
463 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
464 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
465 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
466 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
467 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
468 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
469 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
470 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
471 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
472 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
473 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
474 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
475 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
476 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
477 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
478 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
479 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
480 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
481 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
482 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
483 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
484 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
485 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
486 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
487 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
488 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
489 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
490 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
491 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
492 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
493 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
494 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
495 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
496 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
497 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
498 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
499 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
500 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
501 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
502 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
503 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
504 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
505 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
506 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
507 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
508 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
509 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
510 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
511 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
512 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
513 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
514 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
515 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
516 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
517 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
518 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
519 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
520 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
521 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
522 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
523 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
524 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
525 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
526 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
527 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
528 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
529 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
530 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
531 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
532 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
533 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
534 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
535 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
536 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
537 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
538 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
539 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
540 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
541 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
542 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
543 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
544 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
545 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
546 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
547 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
548 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
549 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
550 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
551 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
552 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
553 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
554 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
555 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
556 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
557 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
558 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
559 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
560 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
561 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
562 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
563 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
564 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
565 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
566 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
567 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
568 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
569 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
570 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
571 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
572 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
573 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
574 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
575 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
576 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
577 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
578 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
579 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
580 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
581 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
582 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
583 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
584 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
585 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
586 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
587 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
588 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
589 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
590 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
591 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
592 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
593 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
594 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
595 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
596 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
597 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
598 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
599 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
600 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
601 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
602 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
603 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
604 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
605 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
606 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
607 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
608 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
609 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
610 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
611 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
612 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
613 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
614 641522639 Methylobacterium sp. 4-46 Isolate Nodule
615 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
616 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
617 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
618 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
619 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
620 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
621 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
622 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
623 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
624 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
625 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
626 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
627 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
628 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
629 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
630 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
631 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
632 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
633 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
634 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
635 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
636 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
637 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
638 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
639 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
640 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
641 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
642 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
643 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
644 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
645 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
646 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
647 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
648 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
649 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
650 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
651 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
652 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
653 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
654 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
655 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 76.68
Metatranscriptomes 0
Isolates 23.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.28
Nodule 17.48
Rhizoplane 4.68
Rhizosphere 51.96
Stem 0
Stem Tuber 0
Unclassified 12.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1002679 3300001977 Bacteria 2807
2 JGI25406J46586_10000098 3300003203 Bacteria 38289
3 JGI25406J46586_10001340 3300003203 Bacteria 11591
4 JGI25406J46586_10012413 3300003203 Bacteria 3697
5 JGI25153J46596_10001032 3300003215 Bacteria 16967
6 JGI25153J46596_10005706 3300003215 Bacteria 6490
7 JGI25153J46596_10014449 3300003215 Bacteria 3280
8 JGI25153J46596_10014714 3300003215 Bacteria 3235
9 JGI25160J50197_1000569 3300003354 Bacteria 20815
10 JGI25160J50197_1010011 3300003354 Bacteria 3463
11 JGI25404J52841_10000140 3300003659 Bacteria 7828
12 JGI25404J52841_10003134 3300003659 Bacteria 3232
13 Ga0055542_1007822 3300003762 Bacteria 2134
14 Ga0055526_1014213 3300003771 Bacteria 3293
15 Ga0055531_10010836 3300003794 Bacteria 4480
16 Ga0065165_1000976 3300005262 Bacteria 35638
17 Ga0065165_1002262 3300005262 Bacteria 16998
18 Ga0065165_1008807 3300005262 Bacteria 4646
19 Ga0065165_1022054 3300005262 Bacteria 2194
20 Ga0070658_10143928 3300005327 Bacteria 1992
21 Ga0070683_100042581 3300005329 Bacteria 4182
22 Ga0070680_100033285 3300005336 Bacteria 4153
23 Ga0070680_100066333 3300005336 Bacteria 2959
24 Ga0068868_100179534 3300005338 Bacteria 1756
25 Ga0070660_100021943 3300005339 Bacteria 4715
26 Ga0070661_100114892 3300005344 Bacteria 2012
27 Ga0070692_10081621 3300005345 Bacteria 1742
28 Ga0070668_100064069 3300005347 Bacteria 2849
29 Ga0070668_100069520 3300005347 Bacteria 2739
30 Ga0070668_100077400 3300005347 Bacteria 2600
31 Ga0070668_100381582 3300005347 Bacteria 1199
32 Ga0070669_100093547 3300005353 Bacteria 2258
33 Ga0070675_100210389 3300005354 Bacteria 1690
34 Ga0070675_100239370 3300005354 Bacteria 1586
35 Ga0070674_100262231 3300005356 Bacteria 1362
36 Ga0070667_100172973 3300005367 Bacteria 1907
37 Ga0070709_10003148 3300005434 Bacteria 8851
38 Ga0070709_10012015 3300005434 Bacteria 4841
39 Ga0070709_10012724 3300005434 Bacteria 4714
40 Ga0070709_10087358 3300005434 Bacteria 2049
41 Ga0070714_100003971 3300005435 Bacteria 11124
42 Ga0070714_100006003 3300005435 Bacteria 9325
43 Ga0070714_100265546 3300005435 Bacteria 1590
44 Ga0070713_100006762 3300005436 Bacteria 7990
45 Ga0070713_100023073 3300005436 Bacteria 4820
46 Ga0070713_100032660 3300005436 Bacteria 4160
47 Ga0070710_10003837 3300005437 Bacteria 7110
48 Ga0070710_10011932 3300005437 Bacteria 4306
49 Ga0070710_10016002 3300005437 Bacteria 3807
50 Ga0070710_10079844 3300005437 Bacteria 1907
51 Ga0070710_10091643 3300005437 Bacteria 1794
52 Ga0070711_100005284 3300005439 Bacteria 7708
53 Ga0070711_100006654 3300005439 Bacteria 6986
54 Ga0070700_100175141 3300005441 Bacteria 1488
55 Ga0070700_100181090 3300005441 Bacteria 1467
56 Ga0070663_100095407 3300005455 Bacteria 2211
57 Ga0070663_100214260 3300005455 Bacteria 1509
58 Ga0070681_10052047 3300005458 Bacteria 4084
59 Ga0070681_10082806 3300005458 Bacteria 3163
60 Ga0070679_100034454 3300005530 Bacteria 5018
61 Ga0070679_100152798 3300005530 Bacteria 2285
62 Ga0070684_100009500 3300005535 Bacteria 7663
63 Ga0070684_100012459 3300005535 Bacteria 6817
64 Ga0070684_100207566 3300005535 Bacteria 1785
65 Ga0070697_100096555 3300005536 Bacteria 2452
66 Ga0068853_100087403 3300005539 Bacteria 2735
67 Ga0070693_100110547 3300005547 Bacteria 1690
68 Ga0070665_100049040 3300005548 Bacteria 4238
69 Ga0070665_100117654 3300005548 Bacteria 2660
70 Ga0070665_100137573 3300005548 Bacteria 2445
71 Ga0070665_100190408 3300005548 Bacteria 2052
72 Ga0068855_100095713 3300005563 Bacteria 3422
73 Ga0068855_100147364 3300005563 Bacteria 2678
74 Ga0068855_100155701 3300005563 Bacteria 2596
75 Ga0068855_100231903 3300005563 Bacteria 2067
76 Ga0068857_100003563 3300005577 Bacteria 13022
77 Ga0068857_100126560 3300005577 Bacteria 2302
78 Ga0068857_100221395 3300005577 Bacteria 1729
79 Ga0068856_100134340 3300005614 Bacteria 2479
80 Ga0068852_100024599 3300005616 Bacteria 4870
81 Ga0068852_100030142 3300005616 Bacteria 4463
82 Ga0068852_100082573 3300005616 Bacteria 2856
83 Ga0068859_100459265 3300005617 Bacteria 1370
84 Ga0068864_100168642 3300005618 Bacteria 1995
85 Ga0068864_100189111 3300005618 Bacteria 1886
86 Ga0068861_100086582 3300005719 Bacteria 2463
87 Ga0068861_100163041 3300005719 Bacteria 1840
88 Ga0068861_100323646 3300005719 Bacteria 1343
89 Ga0068870_10150987 3300005840 Bacteria 1368
90 Ga0068863_100197810 3300005841 Bacteria 1932
91 Ga0068858_100121431 3300005842 Bacteria 2443
92 Ga0068858_100165530 3300005842 Bacteria 2083
93 Ga0068860_100000409 3300005843 Bacteria 55861
94 Ga0068860_100006930 3300005843 Bacteria 11357
95 Ga0068862_100154195 3300005844 Bacteria 2046
96 Ga0081455_10005477 3300005937 Bacteria 13918
97 Ga0081455_10010230 3300005937 Bacteria 9540
98 Ga0081455_10019837 3300005937 Bacteria 6349
99 Ga0081455_10034747 3300005937 Bacteria 4513
100 Ga0081455_10054253 3300005937 Bacteria 3418
101 Ga0081455_10082635 3300005937 Bacteria 2627
102 Ga0081538_10032460 3300005981 Bacteria 3497
103 Ga0081540_1000143 3300005983 Bacteria 74581
104 Ga0081540_1001530 3300005983 Bacteria 19855
105 Ga0081540_1002641 3300005983 Bacteria 14575
106 Ga0081540_1008750 3300005983 Bacteria 7039
107 Ga0081540_1009531 3300005983 Bacteria 6684
108 Ga0081540_1011495 3300005983 Bacteria 5915
109 Ga0081540_1016307 3300005983 Bacteria 4654
110 Ga0081540_1018862 3300005983 Bacteria 4215
111 Ga0081540_1040159 3300005983 Bacteria 2442
112 Ga0081539_10000008 3300005985 Bacteria 525071
113 Ga0081539_10000224 3300005985 Bacteria 133057
114 Ga0081539_10000584 3300005985 Bacteria 74942
115 Ga0081539_10002100 3300005985 Bacteria 29689
116 Ga0081539_10061688 3300005985 Bacteria 2053
117 Ga0070717_10007389 3300006028 Bacteria 8159
118 Ga0070717_10151647 3300006028 Bacteria 2005
119 Ga0075365_10036728 3300006038 Bacteria 3176
120 Ga0075365_10057128 3300006038 Bacteria 2596
121 Ga0075365_10081333 3300006038 Bacteria 2194
122 Ga0075365_10081533 3300006038 Bacteria 2192
123 Ga0075365_10090014 3300006038 Bacteria 2090
124 Ga0075365_10150373 3300006038 Bacteria 1619
125 Ga0075365_10210542 3300006038 Bacteria 1363
126 Ga0075368_10005111 3300006042 Bacteria 4494
127 Ga0075368_10016155 3300006042 Bacteria 2779
128 Ga0075368_10031576 3300006042 Bacteria 2054
129 Ga0075363_100003347 3300006048 Bacteria 6807
130 Ga0075363_100050519 3300006048 Bacteria 2216
131 Ga0075364_10106164 3300006051 Bacteria 1871
132 Ga0075432_10010619 3300006058 Bacteria 3129
133 Ga0070715_10012959 3300006163 Bacteria 3050
134 Ga0070716_100002714 3300006173 Bacteria 8205
135 Ga0070716_100012559 3300006173 Bacteria 4296
136 Ga0070712_100002999 3300006175 Bacteria 10450
137 Ga0070712_100020073 3300006175 Bacteria 4368
138 Ga0070712_100055938 3300006175 Bacteria 2765
139 Ga0075367_10220276 3300006178 Bacteria 1187
140 Ga0075369_10033669 3300006186 Bacteria 2172
141 Ga0075369_10034421 3300006186 Bacteria 2150
142 Ga0075369_10047843 3300006186 Bacteria 1845
143 Ga0075366_10016666 3300006195 Bacteria 4224
144 Ga0075366_10085197 3300006195 Bacteria 1890
145 Ga0097621_100057722 3300006237 Bacteria 3175
146 Ga0075370_10066683 3300006353 Bacteria 2053
147 Ga0075370_10068678 3300006353 Bacteria 2024
148 Ga0068871_100098196 3300006358 Bacteria 2450
149 Ga0075428_100158802 3300006844 Bacteria 2455
150 Ga0075433_10062843 3300006852 Bacteria 3252
151 Ga0075434_100080966 3300006871 Bacteria 3244
152 Ga0097620_100459267 3300006931 Bacteria 1370
153 Ga0099824_1013173 3300006942 Bacteria 8700
154 Ga0099822_1009601 3300006943 Bacteria 12155
155 Ga0075435_100039215 3300007076 Bacteria 3779
156 Ga0075435_100311532 3300007076 Bacteria 1347
157 Ga0099794_10017790 3300007265 Bacteria 3175
158 Ga0099795_10026157 3300007788 Bacteria 1963
159 Ga0105251_10098380 3300009011 Bacteria 1339
160 Ga0105240_10009010 3300009093 Bacteria 14174
161 Ga0105240_10227997 3300009093 Bacteria 2166
162 Ga0105240_10483493 3300009093 Bacteria 1380
163 Ga0111539_10289684 3300009094 Bacteria 1905
164 Ga0105245_10142445 3300009098 Bacteria 2259
165 Ga0105245_10293728 3300009098 Bacteria 1593
166 Ga0105245_10405647 3300009098 Bacteria 1363
167 Ga0105247_10102792 3300009101 Bacteria 1829
168 Ga0105247_10197266 3300009101 Bacteria 1351
169 Ga0114129_10034963 3300009147 Bacteria 7098
170 Ga0114129_10646588 3300009147 Bacteria 1365
171 Ga0105243_10062607 3300009148 Bacteria 2979
172 Ga0105248_10448998 3300009177 Bacteria 1453
173 Ga0105237_10022765 3300009545 Bacteria 6429
174 Ga0105237_10029941 3300009545 Bacteria 5530
175 Ga0105237_10095886 3300009545 Bacteria 2956
176 Ga0105237_10194442 3300009545 Bacteria 2028
177 Ga0105238_10001542 3300009551 Bacteria 23084
178 Ga0105238_10053840 3300009551 Bacteria 4043
179 Ga0105238_10058526 3300009551 Bacteria 3862
180 Ga0099796_10070327 3300010159 Bacteria 1262
181 Ga0105239_10041673 3300010375 Bacteria 5031
182 Ga0105239_10080676 3300010375 Bacteria 3580
183 Ga0105239_10155102 3300010375 Bacteria 2557
184 Ga0105239_10369926 3300010375 Bacteria 1620
185 Ga0105239_10588883 3300010375 Bacteria 1268
186 Ga0105246_10191271 3300011119 Bacteria 1584
187 Ga0157371_10030941 3300013102 Bacteria 3857
188 Ga0157371_10138509 3300013102 Bacteria 1733
189 Ga0157370_10067112 3300013104 Bacteria 3391
190 Ga0157370_10204169 3300013104 Bacteria 1833
191 Ga0157370_10409101 3300013104 Bacteria 1248
192 Ga0157369_10015619 3300013105 Bacteria 8557
193 Ga0157369_10218148 3300013105 Bacteria 1997
194 Ga0157374_10154188 3300013296 Bacteria 2235
195 Ga0157374_10180434 3300013296 Bacteria 2062
196 Ga0157378_10041519 3300013297 Bacteria 4081
197 Ga0163162_10032812 3300013306 Bacteria 5157
198 Ga0163162_10366826 3300013306 Bacteria 1573
199 Ga0157372_10093667 3300013307 Bacteria 3419
200 Ga0157372_10757154 3300013307 Bacteria 1129
201 Ga0157375_10126465 3300013308 Bacteria 2671
202 Ga0157375_10311245 3300013308 Bacteria 1739
203 Ga0157375_10607721 3300013308 Bacteria 1252
204 Ga0163163_10040222 3300014325 Bacteria 4565
205 Ga0163163_10133407 3300014325 Bacteria 2524
206 Ga0157376_10253779 3300014969 Bacteria 1644
207 Ga0163161_10115340 3300017792 Bacteria 2013
208 Ga0214542_1000196 3300021321 Bacteria 95225
209 Ga0214545_1000028 3300021324 Bacteria 127957
210 Ga0214543_1000044 3300021327 Bacteria 158132
211 Ga0213872_10029908 3300021361 Bacteria 2498
212 Ga0213876_10008302 3300021384 Bacteria 5618
213 Ga0213875_10117911 3300021388 Bacteria 1240
214 Ga0209563_101069 3300025230 Bacteria 7896
215 Ga0209148_1000680 3300025254 Bacteria 28419
216 Ga0209233_1005329 3300025261 Bacteria 4276
217 Ga0209233_1012988 3300025261 Bacteria 2393
218 Ga0209455_1004574 3300025272 Bacteria 4488
219 Ga0209676_1000089 3300025292 Bacteria 260196
220 Ga0209564_1000248 3300025295 Bacteria 116617
221 Ga0209564_1003584 3300025295 Bacteria 10363
222 Ga0209758_1000075 3300025297 Bacteria 271585
223 Ga0209758_1000187 3300025297 Bacteria 138759
224 Ga0209758_1000482 3300025297 Bacteria 65578
225 Ga0209758_1007361 3300025297 Bacteria 7527
226 Ga0209758_1041958 3300025297 Bacteria 1702
227 Ga0209758_1065595 3300025297 Bacteria 1171
228 Ga0209758_1065826 3300025297 Bacteria 1167
229 Ga0209256_1004509 3300025299 Bacteria 8695
230 Ga0207426_1000160 3300025302 Bacteria 174540
231 Ga0207426_1000527 3300025302 Bacteria 55514
232 Ga0207426_1004914 3300025302 Bacteria 6310
233 Ga0207426_1008174 3300025302 Bacteria 4263
234 Ga0209257_1000652 3300025304 Bacteria 55125
235 Ga0209257_1016414 3300025304 Bacteria 2997
236 Ga0207697_10058258 3300025315 Bacteria 1604
237 Ga0207692_10001716 3300025898 Bacteria 8291
238 Ga0207692_10043736 3300025898 Bacteria 2230
239 Ga0207692_10069322 3300025898 Bacteria 1852
240 Ga0207692_10133223 3300025898 Bacteria 1406
241 Ga0207692_10166178 3300025898 Bacteria 1275
242 Ga0207642_10087554 3300025899 Bacteria 1530
243 Ga0207710_10035294 3300025900 Bacteria 2200
244 Ga0207647_10057974 3300025904 Bacteria 2373
245 Ga0207685_10000370 3300025905 Bacteria 7381
246 Ga0207685_10029419 3300025905 Bacteria 1944
247 Ga0207699_10008612 3300025906 Bacteria 5043
248 Ga0207699_10011543 3300025906 Bacteria 4466
249 Ga0207699_10012867 3300025906 Bacteria 4263
250 Ga0207699_10081798 3300025906 Bacteria 2004
251 Ga0207643_10030614 3300025908 Bacteria 2996
252 Ga0207705_10131790 3300025909 Bacteria 1861
253 Ga0207654_10050669 3300025911 Bacteria 2387
254 Ga0207707_10012676 3300025912 Bacteria 7327
255 Ga0207707_10043088 3300025912 Bacteria 3938
256 Ga0207707_10047521 3300025912 Bacteria 3737
257 Ga0207707_10202468 3300025912 Bacteria 1731
258 Ga0207695_10000029 3300025913 Bacteria 548364
259 Ga0207695_10101655 3300025913 Bacteria 2869
260 Ga0207695_10145264 3300025913 Bacteria 2317
261 Ga0207695_10327502 3300025913 Bacteria 1421
262 Ga0207671_10007217 3300025914 Bacteria 9678
263 Ga0207671_10013888 3300025914 Bacteria 6394
264 Ga0207671_10044783 3300025914 Bacteria 3272
265 Ga0207671_10283878 3300025914 Bacteria 1306
266 Ga0207693_10006044 3300025915 Bacteria 10031
267 Ga0207693_10008819 3300025915 Bacteria 8240
268 Ga0207693_10015510 3300025915 Bacteria 6114
269 Ga0207693_10025336 3300025915 Bacteria 4704
270 Ga0207693_10031467 3300025915 Bacteria 4192
271 Ga0207663_10000668 3300025916 Bacteria 15149
272 Ga0207663_10003518 3300025916 Bacteria 7684
273 Ga0207663_10003711 3300025916 Bacteria 7517
274 Ga0207663_10006392 3300025916 Bacteria 6026
275 Ga0207660_10002329 3300025917 Bacteria 12499
276 Ga0207662_10036703 3300025918 Bacteria 2866
277 Ga0207657_10010305 3300025919 Bacteria 9332
278 Ga0207657_10021011 3300025919 Bacteria 6155
279 Ga0207657_10220593 3300025919 Bacteria 1519
280 Ga0207652_10069916 3300025921 Bacteria 3048
281 Ga0207652_10212412 3300025921 Bacteria 1742
282 Ga0207694_10007305 3300025924 Bacteria 8383
283 Ga0207694_10111904 3300025924 Bacteria 2172
284 Ga0207659_10161754 3300025926 Bacteria 1758
285 Ga0207700_10012590 3300025928 Bacteria 5464
286 Ga0207700_10405877 3300025928 Bacteria 1195
287 Ga0207664_10025318 3300025929 Bacteria 4468
288 Ga0207664_10037677 3300025929 Bacteria 3744
289 Ga0207664_10064839 3300025929 Bacteria 2923
290 Ga0207644_10118806 3300025931 Bacteria 2009
291 Ga0207690_10035970 3300025932 Bacteria 3203
292 Ga0207706_10030695 3300025933 Bacteria 4793
293 Ga0207706_10225236 3300025933 Bacteria 1641
294 Ga0207704_10165015 3300025938 Bacteria 1581
295 Ga0207665_10004713 3300025939 Bacteria 9056
296 Ga0207665_10005550 3300025939 Bacteria 8414
297 Ga0207665_10014910 3300025939 Bacteria 5107
298 Ga0207665_10063280 3300025939 Bacteria 2512
299 Ga0207711_10097879 3300025941 Bacteria 2591
300 Ga0207711_10137684 3300025941 Bacteria 2194
301 Ga0207711_10216709 3300025941 Bacteria 1750
302 Ga0207689_10080092 3300025942 Bacteria 2684
303 Ga0207661_10077945 3300025944 Bacteria 2726
304 Ga0207661_10093278 3300025944 Bacteria 2512
305 Ga0207661_10309971 3300025944 Bacteria 1417
306 Ga0207679_10351217 3300025945 Bacteria 1285
307 Ga0207667_10008692 3300025949 Bacteria 12035
308 Ga0207668_10351118 3300025972 Bacteria 1233
309 Ga0207677_10076318 3300026023 Bacteria 2385
310 Ga0207703_10021262 3300026035 Bacteria 5080
311 Ga0207703_10075215 3300026035 Bacteria 2798
312 Ga0207703_10107005 3300026035 Bacteria 2380
313 Ga0207639_10046162 3300026041 Bacteria 3286
314 Ga0207639_10092244 3300026041 Bacteria 2427
315 Ga0207678_10086984 3300026067 Bacteria 2671
316 Ga0207678_10089992 3300026067 Bacteria 2623
317 Ga0207678_10107385 3300026067 Bacteria 2381
318 Ga0207678_10128582 3300026067 Bacteria 2160
319 Ga0207678_10140481 3300026067 Bacteria 2061
320 Ga0207678_10303655 3300026067 Bacteria 1372
321 Ga0207708_10201092 3300026075 Bacteria 1590
322 Ga0207702_10077467 3300026078 Bacteria 2876
323 Ga0207702_10547217 3300026078 Bacteria 1132
324 Ga0207641_10090874 3300026088 Bacteria 2671
325 Ga0207676_10081038 3300026095 Bacteria 2636
326 Ga0207676_10241773 3300026095 Bacteria 1620
327 Ga0207674_10253451 3300026116 Bacteria 1707
328 Ga0207683_10084732 3300026121 Bacteria 2818
329 Ga0207683_10087636 3300026121 Bacteria 2769
330 Ga0207683_10157923 3300026121 Bacteria 2049
331 Ga0207683_10419355 3300026121 Bacteria 1233
332 Ga0207698_10017272 3300026142 Bacteria 4891
333 Ga0207698_10099578 3300026142 Bacteria 2405
334 Ga0209389_1000003 3300027296 Bacteria 268927
335 Ga0209389_1000365 3300027296 Bacteria 27120
336 Ga0209589_1000004 3300027357 Bacteria 578529
337 Ga0209589_1003813 3300027357 Bacteria 26265
338 Ga0209489_100004 3300027361 Bacteria 578529
339 Ga0209489_100022 3300027361 Bacteria 202016
340 Ga0209489_100498 3300027361 Bacteria 73687
341 Ga0209700_100004 3300027363 Bacteria 578529
342 Ga0209700_100023 3300027363 Bacteria 229662
343 Ga0209813_10001106 3300027866 Bacteria 6023
344 Ga0207428_10090650 3300027907 Bacteria 2374
345 Ga0268266_10005789 3300028379 Bacteria 11444
346 Ga0268266_10154932 3300028379 Bacteria 2068
347 Ga0268266_10223603 3300028379 Bacteria 1731
348 Ga0268266_10351815 3300028379 Bacteria 1384
349 Ga0268265_10066069 3300028380 Bacteria 2794
350 Ga0268265_10123962 3300028380 Bacteria 2134
351 Ga0268265_10301957 3300028380 Bacteria 1442
352 Ga0268265_10468347 3300028380 Bacteria 1180
353 Ga0268264_10000020 3300028381 Bacteria 483593
354 Ga0268264_10025570 3300028381 Bacteria 4824
355 Ga0268264_10268069 3300028381 Bacteria 1594
356 Ga0268264_10299856 3300028381 Bacteria 1512
357 Ga0265337_1003562 3300028556 Bacteria 6708
358 Ga0265326_10001476 3300028558 Bacteria 8262
359 Ga0265319_1003347 3300028563 Bacteria 8400
360 Ga0265318_10003706 3300028577 Bacteria 7628
361 Ga0265323_10000837 3300028653 Bacteria 16432
362 Ga0265322_10005262 3300028654 Bacteria 3829
363 Ga0265336_10000593 3300028666 Bacteria 20297
364 Ga0307517_10000154 3300028786 Bacteria 109811
365 Ga0307515_10137583 3300028794 Bacteria 2643
366 Ga0307515_10269511 3300028794 Bacteria 1426
367 Ga0265338_10000013 3300028800 Bacteria 379065
368 Ga0265324_10003161 3300029957 Bacteria 7987
369 Ga0307511_10070683 3300030521 Bacteria 2553
370 Ga0265330_10031111 3300031235 Bacteria 2393
371 Ga0265340_10026179 3300031247 Bacteria 2950
372 Ga0265339_10004949 3300031249 Bacteria 8972
373 Ga0265331_10071375 3300031250 Bacteria 1624
374 Ga0265316_10166183 3300031344 Bacteria 1648
375 Ga0307513_10028934 3300031456 Bacteria 6327
376 Ga0307509_10149046 3300031507 Bacteria 2259
377 Ga0265313_10094738 3300031595 Bacteria 1334
378 Ga0307508_10000419 3300031616 Bacteria 50420
379 Ga0307508_10014811 3300031616 Bacteria 7110
380 Ga0307508_10098897 3300031616 Bacteria 2511
381 Ga0307508_10161516 3300031616 Bacteria 1844
382 Ga0316579_10003937 3300031691 Bacteria 5855
383 Ga0265314_10019152 3300031711 Bacteria 5308
384 Ga0265342_10011246 3300031712 Bacteria 6139
385 Ga0316578_10007661 3300031728 Bacteria 5437
386 Ga0307516_10015558 3300031730 Bacteria 8000
387 Ga0307516_10165234 3300031730 Bacteria 1959
388 Ga0307516_10315328 3300031730 Bacteria 1236
389 Ga0307413_10057713 3300031824 Bacteria 2375
390 Ga0307406_10379386 3300031901 Bacteria 1114
391 Ga0307407_10055024 3300031903 Bacteria 2298
392 Ga0307412_10078953 3300031911 Bacteria 2269
393 Ga0307412_10117566 3300031911 Bacteria 1909
394 Ga0316583_10001219 3300032133 Bacteria 8464
395 Ga0307510_10079808 3300033180 Bacteria 3187
396 Ga0307510_10098533 3300033180 Bacteria 2727
397 Ga0307510_10198073 3300033180 Bacteria 1547
398 Ga0315911_1000014 3300033442 Bacteria 207605
399 Ga0373926_0023684 3300035083 Bacteria 2133
400 Ga0373928_0010298 3300035084 Bacteria 1836
401 Ga0373940_0027603 3300035088 Bacteria 1493
402 Ga0373936_0001567 3300035113 Bacteria 8340
403 Ga0373936_0022563 3300035113 Bacteria 2451
404 Ga0373945_0012471 3300035116 Bacteria 2824
405 Ga0373945_0021562 3300035116 Bacteria 2214
406 Ga0373956_0071927 3300035119 Bacteria 1579
407 Ga0373943_0005860 3300035170 Bacteria 5519
408 Ga0373955_0218631 3300035172 Bacteria 1137
409 Ga0316574_0004370 3300035398 Bacteria 7392
410 Ga0373931_0003484 3300035691 Bacteria 7076
411 Ga0373935_0006166 3300035692 Bacteria 7136
412 Ga0373935_0016197 3300035692 Bacteria 4511
413 Ga0373935_0037872 3300035692 Bacteria 3018
414 Ga0373935_0082894 3300035692 Bacteria 2087
415 Ga0373935_0103599 3300035692 Bacteria 1879
416 Ga0373935_0301199 3300035692 Bacteria 1133
417 Ga0373927_0005443 3300035695 Bacteria 8776
418 Ga0373927_0015544 3300035695 Bacteria 5027
419 Ga0373927_0029068 3300035695 Bacteria 3602
420 Ga0373927_0042045 3300035695 Bacteria 2963
421 Ga0373927_0055373 3300035695 Bacteria 2565
422 Ga0373927_0068689 3300035695 Bacteria 2293
423 Ga0373927_0075323 3300035695 Bacteria 2185
424 Ga0373927_0178538 3300035695 Bacteria 1392
425 Ga0373933_0000631 3300035724 Bacteria 21995
426 Ga0373947_0000357 3300035725 Bacteria 25961
427 Ga0373947_0009942 3300035725 Bacteria 5465
428 Ga0373947_0017397 3300035725 Bacteria 4134
429 Ga0373937_0073505 3300036401 Bacteria 3154
430 Ga0373937_0117080 3300036401 Bacteria 2482
431 Ga0316582_0260087 3300036647 Unclassified 1190
432 Ga0316584_0000478 3300036712 Bacteria 21056
433 Ga0316584_0004182 3300036712 Bacteria 9532
434 Ga0373925_0002728 3300037068 Bacteria 13967
435 Ga0395900_0081910 3300037418 Bacteria 3315
436 Ga0395900_0120982 3300037418 Bacteria 2686
437 Ga0395898_0315357 3300037466 Bacteria 1492
438 Ga0395898_0349966 3300037466 Bacteria 1409
439 Ga0395905_0048924 3300037471 Bacteria 3961
440 Ga0436364_1318252 3300037853 Bacteria 1926
441 Ga0436365_0127446 3300039437 Bacteria 1893
442 Ga0436365_0260840 3300039437 Bacteria 28419
443 Ga0436360_0713070 3300039438 Bacteria 1286
444 Ga0436360_1094903 3300039438 Bacteria 1657
445 Ga0436360_1133513 3300039438 Bacteria 3209
446 Ga0436361_0246237 3300039447 Bacteria 8868
447 Ga0436361_0931732 3300039447 Bacteria 2610
448 Ga0436363_0587633 3300039450 Bacteria 2044
449 Ga0439465_0037857 3300041413 Bacteria 1552
450 Ga0439433_0022619 3300041999 Bacteria 1412
451 Ga0451577_0020383 3300042876 Bacteria 6086
452 Ga0466969_0034850 3300044656 Bacteria 2549
453 Ga0453683_0075326 3300044673 Bacteria 2113
454 Ga0466966_0000539 3300044684 Bacteria 24089
455 Ga0466961_0000084 3300044693 Bacteria 58908
456 Ga0466968_0009336 3300044735 Bacteria 3771
457 Ga0466968_0030769 3300044735 Bacteria 2225
458 Ga0466960_0021965 3300044901 Bacteria 2847
459 Ga0466959_0002035 3300045049 Bacteria 12774
460 Ga0451576_0000675 3300045051 Bacteria 69506
461 Ga0451576_0002840 3300045051 Bacteria 24916
462 Ga0451576_0190737 3300045051 Bacteria 2140
463 Ga0451576_0252779 3300045051 Bacteria 1842
464 Ga0466967_0050811 3300045976 Bacteria 3631
465 Ga0495592_0086330 3300046454 Bacteria 2260
466 Ga0495603_0001156 3300046455 Bacteria 15378
467 Ga0495603_0032943 3300046455 Bacteria 3118
468 Ga0495603_0034410 3300046455 Bacteria 3045
469 Ga0495603_0053980 3300046455 Bacteria 2383
470 Ga0495603_0083870 3300046455 Bacteria 1866
471 Ga0495603_0096115 3300046455 Bacteria 1731
472 Ga0495629_0021124 3300046459 Bacteria 4646
473 Ga0495638_0003384 3300046460 Bacteria 12564
474 Ga0495638_0003687 3300046460 Bacteria 11923
475 Ga0495638_0034645 3300046460 Bacteria 3223
476 Ga0495641_0006609 3300046461 Bacteria 7468
477 Ga0495653_0072908 3300046463 Bacteria 2563
478 Ga0495653_0159842 3300046463 Bacteria 1565
479 Ga0495580_0001379 3300046472 Bacteria 21303
480 Ga0495580_0036934 3300046472 Bacteria 3507
481 Ga0495582_0002621 3300046473 Bacteria 10015
482 Ga0495605_0101875 3300046474 Bacteria 1319
483 Ga0495639_0004522 3300046475 Bacteria 5964
484 Ga0495639_0050665 3300046475 Bacteria 1886
485 Ga0495662_0010347 3300046476 Bacteria 4570
486 Ga0495664_0028973 3300046477 Bacteria 3236
487 Ga0495594_0011407 3300046499 Bacteria 4618
488 Ga0495596_0031813 3300046500 Bacteria 2105
489 Ga0495583_0061520 3300046506 Bacteria 1675
490 Ga0495606_0000915 3300046507 Bacteria 43659
491 Ga0495606_0133990 3300046507 Bacteria 1469
492 Ga0495606_0139428 3300046507 Bacteria 1433
493 Ga0495610_0098976 3300046512 Bacteria 1309
494 Ga0495616_0073376 3300046513 Bacteria 1651
495 Ga0495630_0023249 3300046517 Bacteria 4581
496 Ga0495643_0006431 3300046522 Bacteria 7748
497 Ga0495648_0022205 3300046524 Bacteria 4374
498 Ga0495648_0022628 3300046524 Bacteria 4321
499 Ga0495648_0096940 3300046524 Bacteria 1637
500 Ga0495652_0025060 3300046529 Bacteria 5279
501 Ga0495652_0085963 3300046529 Bacteria 2583
502 Ga0495652_0145781 3300046529 Bacteria 1856
503 Ga0495665_0004182 3300046531 Bacteria 7787
504 Ga0495665_0080270 3300046531 Bacteria 1716
505 Ga0495665_0091256 3300046531 Bacteria 1600
506 Ga0495586_0014415 3300046535 Bacteria 4199
507 Ga0495587_0059760 3300046536 Bacteria 2236
508 Ga0495645_0048130 3300046543 Bacteria 3106
509 Ga0495622_0008472 3300046557 Bacteria 4761
510 Ga0495622_0021964 3300046557 Bacteria 2973
511 Ga0495622_0029881 3300046557 Bacteria 2546
512 Ga0495667_0136112 3300046559 Bacteria 1583
513 Ga0495667_0203262 3300046559 Bacteria 1267
514 Ga0495656_0010059 3300046615 Bacteria 3425
515 Ga0495668_0064492 3300046616 Bacteria 2016
516 Ga0495668_0090678 3300046616 Bacteria 1675
517 Ga0495668_0158982 3300046616 Bacteria 1238
518 Ga0495634_0096188 3300046642 Bacteria 1918
519 Ga0495611_0044678 3300046648 Bacteria 1982
520 Ga0495635_0011796 3300046663 Bacteria 6128
521 Ga0495635_0228492 3300046663 Bacteria 1257
522 Ga0495659_0087958 3300046664 Bacteria 1189
523 Ga0495661_0074465 3300046665 Bacteria 1976
524 Ga0495588_0009668 3300046674 Bacteria 4467
525 Ga0495588_0020620 3300046674 Bacteria 3243
526 Ga0495657_0072974 3300046675 Bacteria 2237
527 Ga0495599_0033724 3300046678 Bacteria 3218
528 Ga0495623_0059057 3300046679 Bacteria 2410
529 Ga0495646_0055716 3300046680 Bacteria 2373
530 Ga0495647_0004395 3300046681 Bacteria 4578
531 Ga0495658_0014086 3300046683 Bacteria 4077
532 Ga0495658_0033660 3300046683 Bacteria 2808
533 Ga0495658_0049662 3300046683 Bacteria 2370
534 Ga0495624_0017956 3300046690 Bacteria 4740
535 Ga0495624_0024747 3300046690 Bacteria 3948
536 Ga0495600_0032362 3300046809 Bacteria 3393
537 Ga0495581_0007938 3300047315 Bacteria 6147
538 Ga0495604_0054408 3300047317 Bacteria 3088
539 Ga0495674_0036834 3300047319 Bacteria 4399
540 Ga0495674_0118923 3300047319 Bacteria 2234
541 Ga0495674_0190461 3300047319 Bacteria 1705
542 Ga0495672_0014637 3300047320 Bacteria 5360
543 Ga0495672_0028729 3300047320 Bacteria 3512
544 Ga0495683_0050250 3300047323 Bacteria 2087
545 Ga0495687_092213 3300047443 Bacteria 1157
546 Ga0495675_0105392 3300047444 Bacteria 1762
547 Ga0495675_0206660 3300047444 Bacteria 1193
548 Ga0495673_0023720 3300047469 Bacteria 2978
549 Ga0495673_0037806 3300047469 Bacteria 2202
550 Ga0495686_0060038 3300047472 Bacteria 2365
551 Ga0495686_0065927 3300047472 Bacteria 2238
552 Ga0495686_0111965 3300047472 Bacteria 1636
553 Ga0495686_0130758 3300047472 Bacteria 1488
554 Ga0495602_0141611 3300048088 Bacteria 1903
555 Ga0496100_0050000 3300048903 Bacteria 2706
556 Ga0496101_0054059 3300048904 Bacteria 2899
557 Ga0496101_0116840 3300048904 Bacteria 2013
558 Ga0496101_0139653 3300048904 Bacteria 1846
559 Ga0496102_0020797 3300048905 Bacteria 5800
560 Ga0496102_0034487 3300048905 Bacteria 4552
561 Ga0496102_0094482 3300048905 Bacteria 2770
562 Ga0496103_0022924 3300048906 Bacteria 3762
563 Ga0496103_0102334 3300048906 Bacteria 1814
564 Ga0496104_0022058 3300048907 Bacteria 5852
565 Ga0496104_0043507 3300048907 Bacteria 4218
566 Ga0496104_0099651 3300048907 Bacteria 2781
567 Ga0496104_0261422 3300048907 Bacteria 1643
568 Ga0496104_0397463 3300048907 Bacteria 1290
569 Ga0496104_0429520 3300048907 Bacteria 1233
570 Ga0496104_0475188 3300048907 Bacteria 1161
571 Ga0496105_0010496 3300048908 Bacteria 7285
572 Ga0496105_0012602 3300048908 Bacteria 6696
573 Ga0496105_0052003 3300048908 Bacteria 3383
574 Ga0496105_0073130 3300048908 Bacteria 2832
575 Ga0496105_0082390 3300048908 Bacteria 2657
576 Ga0496106_0049104 3300048909 Bacteria 3178
577 Ga0496106_0080730 3300048909 Bacteria 2498
578 Ga0496106_0089882 3300048909 Bacteria 2369
579 Ga0496106_0215634 3300048909 Bacteria 1530
580 Ga0496106_0244351 3300048909 Bacteria 1434
581 Ga0496107_0102341 3300048910 Bacteria 2100
582 Ga0496108_0079506 3300048911 Bacteria 2776
583 Ga0496108_0132244 3300048911 Bacteria 2145
584 Ga0496108_0180566 3300048911 Bacteria 1827
585 Ga0496108_0268769 3300048911 Bacteria 1484
586 Ga0496109_0080717 3300048912 Bacteria 2997
587 Ga0496109_0286813 3300048912 Bacteria 1552
588 Ga0496109_0287796 3300048912 Bacteria 1549
589 Ga0496110_0018247 3300048913 Bacteria 5881
590 Ga0496110_0205744 3300048913 Bacteria 1789
591 Ga0496112_0000008 3300048915 Bacteria 310323
592 Ga0496112_0051959 3300048915 Bacteria 4021
593 Ga0496112_0064228 3300048915 Bacteria 3622
594 Ga0496112_0097737 3300048915 Bacteria 2906
595 Ga0496113_0083920 3300048916 Bacteria 2445
596 Ga0496113_0086884 3300048916 Bacteria 2403
597 Ga0496114_0088302 3300048917 Bacteria 2630
598 Ga0496115_0035668 3300048918 Bacteria 3936
599 Ga0496115_0123862 3300048918 Bacteria 2128
600 Ga0496115_0199125 3300048918 Bacteria 1655
601 Ga0496115_0223619 3300048918 Bacteria 1553
602 Ga0496116_0000507 3300048919 Bacteria 52709
603 Ga0496116_0081596 3300048919 Bacteria 2004
604 Ga0496117_0054251 3300048920 Bacteria 2809
605 Ga0496117_0068929 3300048920 Bacteria 2385
606 Ga0496118_0013737 3300048921 Bacteria 7637
607 Ga0496118_0095301 3300048921 Bacteria 2032
608 Ga0496119_0108248 3300048922 Bacteria 1548
609 Ga0496120_0039898 3300048923 Bacteria 2765
610 Ga0496121_0001584 3300048924 Bacteria 37864
611 Ga0496121_0001681 3300048924 Bacteria 36391
612 Ga0496121_0018524 3300048924 Bacteria 7015
613 Ga0496121_0046502 3300048924 Bacteria 3714
614 Ga0496121_0054703 3300048924 Bacteria 3332
615 Ga0496121_0106915 3300048924 Bacteria 2144
616 Ga0496121_0200831 3300048924 Bacteria 1421
617 Ga0496121_0236935 3300048924 Bacteria 1274
618 Ga0496122_0107819 3300048925 Bacteria 1839
619 Ga0496123_0111754 3300048926 Bacteria 1560
620 Ga0496124_0023656 3300048927 Bacteria 5605
621 Ga0496125_0000341 3300048928 Bacteria 89076
622 Ga0496125_0004754 3300048928 Bacteria 15477
623 Ga0496125_0014211 3300048928 Bacteria 7763
624 Ga0496125_0154903 3300048928 Bacteria 1567
625 Ga0496125_0176522 3300048928 Bacteria 1428
626 Ga0496126_0003467 3300048929 Bacteria 19900
627 Ga0496126_0005826 3300048929 Bacteria 13933
628 Ga0496126_0014444 3300048929 Bacteria 7981
629 Ga0496126_0015961 3300048929 Bacteria 7531
630 Ga0496126_0024893 3300048929 Bacteria 5771
631 Ga0496126_0082013 3300048929 Bacteria 2850
632 Ga0496126_0086358 3300048929 Bacteria 2765
633 Ga0496126_0108955 3300048929 Bacteria 2414
634 Ga0496126_0126243 3300048929 Bacteria 2214
635 Ga0496126_0237087 3300048929 Bacteria 1526
636 Ga0496126_0345309 3300048929 Bacteria 1218
637 Ga0496126_0357417 3300048929 Bacteria 1193
638 Ga0495682_0023822 3300049460 Bacteria 2284
639 Ga0501031_0004326 3300049568 Bacteria 9193
640 Ga0501031_0014216 3300049568 Bacteria 5178
641 Ga0501032_0000235 3300049569 Bacteria 46101
642 Ga0501032_0000252 3300049569 Bacteria 44619
643 Ga0501033_0000082 3300049570 Bacteria 89837
644 Ga0501033_0000857 3300049570 Bacteria 27827
645 Ga0501034_0000577 3300049571 Bacteria 58019
646 Ga0501034_0004374 3300049571 Bacteria 15744
647 Ga0501034_0226288 3300049571 Bacteria 1821
648 Ga0501036_0000153 3300049572 Bacteria 45334
649 Ga0501036_0002272 3300049572 Bacteria 15021
650 Ga0501037_0000261 3300049573 Bacteria 45475
651 Ga0501037_0000636 3300049573 Bacteria 27158
652 Ga0501038_0000234 3300049574 Bacteria 46892
653 Ga0501038_0002144 3300049574 Bacteria 18321
654 Ga0501038_0164323 3300049574 Bacteria 1802
655 Ga0501038_0251549 3300049574 Bacteria 1400
656 Ga0501039_0000123 3300049575 Bacteria 53579
657 Ga0501039_0000161 3300049575 Bacteria 46280
658 Ga0501042_0042212 3300049578 Bacteria 3246
659 Ga0501042_0124527 3300049578 Bacteria 1856
660 Ga0501043_0000368 3300049579 Bacteria 40763
661 Ga0501043_0001192 3300049579 Bacteria 22870
662 Ga0501046_0000434 3300049580 Bacteria 41950
663 Ga0501046_0001142 3300049580 Bacteria 25829
664 Ga0501046_0064273 3300049580 Bacteria 2865
665 Ga0501046_0221752 3300049580 Bacteria 1399
666 Ga0501047_0000131 3300049581 Bacteria 91079
667 Ga0501047_0000803 3300049581 Bacteria 32797
668 Ga0501047_0188753 3300049581 Bacteria 1925
669 Ga0501048_0000170 3300049582 Bacteria 40800
670 Ga0501048_0000727 3300049582 Bacteria 24124
671 Ga0501048_0011399 3300049582 Bacteria 6630
672 Ga0501067_0000327 3300049583 Bacteria 25973
673 Ga0501068_0000080 3300049584 Bacteria 39376
674 Ga0501070_0000293 3300049586 Bacteria 46678
675 Ga0501070_0007703 3300049586 Bacteria 9128
676 Ga0501070_0077806 3300049586 Bacteria 2745
677 Ga0501071_0008990 3300049587 Bacteria 6630
678 Ga0501071_0291421 3300049587 Bacteria 1236
679 Ga0501071_0440722 3300049587 Bacteria 997
680 Ga0501072_0000393 3300049588 Bacteria 31319
681 Ga0501072_0025839 3300049588 Bacteria 4576
682 Ga0501073_0000062 3300049589 Bacteria 66884
683 Ga0501074_0013235 3300049590 Bacteria 5998
684 Ga0501075_0009514 3300049591 Bacteria 6802
685 Ga0501076_0076832 3300049592 Bacteria 2679
686 Ga0501076_0247726 3300049592 Bacteria 1458
687 Ga0501077_0004617 3300049593 Bacteria 8365
688 Ga0501079_0005504 3300049741 Bacteria 9438
689 Ga0501079_0104189 3300049741 Bacteria 2201
690 Ga0501080_0000149 3300049742 Bacteria 49826
691 Ga0501080_0002104 3300049742 Bacteria 17281
692 Ga0501081_0088475 3300049743 Bacteria 2176
693 Ga0501083_0000199 3300049744 Bacteria 38479
694 Ga0501035_0000123 3300049822 Bacteria 93734
695 Ga0501035_0000630 3300049822 Bacteria 38810
696 Ga0501035_0185989 3300049822 Bacteria 1788
697 Ga0501035_0336231 3300049822 Bacteria 1266
698 Ga0501044_0000100 3300049823 Bacteria 106729
699 Ga0501044_0001013 3300049823 Bacteria 33753
700 Ga0501045_0014413 3300049824 Bacteria 5602
701 Ga0501045_0135618 3300049824 Bacteria 1830
702 nmdc:mga03n38_118464_c1 3300050490 Bacteria 1298
703 nmdc:mga03n38_127320_c1 3300050490 Bacteria 1258
704 nmdc:mga03n38_134114_c1 3300050490 Bacteria 1230
705 nmdc:mga03n38_28282_c1 3300050490 Bacteria 2335
706 nmdc:mga03n38_9103_c1 3300050490 Bacteria 3594
707 nmdc:mga0yw44_111005_c1 3300050492 Bacteria 1757
708 nmdc:mga0yw44_118577_c1 3300050492 Bacteria 1703
709 nmdc:mga0yw44_137871_c1 3300050492 Bacteria 1584
710 nmdc:mga0yw44_141502_c1 3300050492 Bacteria 1564
711 nmdc:mga0yw44_211379_c1 3300050492 Bacteria 1283
712 nmdc:mga0yw44_243365_c1 3300050492 Bacteria 1196
713 nmdc:mga0yw44_35980_c1 3300050492 Bacteria 2915
714 nmdc:mga0k408_8719_c1 3300050493 Bacteria 5454
715 nmdc:mga06z11_1910_c1 3300050494 Bacteria 7857
716 nmdc:mga04h51_14290_c1 3300050495 Bacteria 2266
717 nmdc:mga07m45_7298_c1 3300050496 Bacteria 5639
718 nmdc:mga05p37_131547_c1 3300050507 Bacteria 3070
719 nmdc:mga05p37_63178_c1 3300050507 Bacteria 4557
720 nmdc:mga08y16_228722_c1 3300050511 Bacteria 1924
721 nmdc:mga0n895_130152_c1 3300050512 Bacteria 2541
722 nmdc:mga0n895_135097_c1 3300050512 Bacteria 2493
723 nmdc:mga0n895_158076_c1 3300050512 Bacteria 2298
724 nmdc:mga0n895_89040_c1 3300050512 Bacteria 3087
725 nmdc:mga0n895_96750_c1 3300050512 Bacteria 2957
726 nmdc:mga0rr50_277655_c1 3300050513 Bacteria 1397
727 nmdc:mga0a205_40815_c1 3300050515 Bacteria 4468
728 nmdc:mga0sz30_4137_c1 3300050516 Bacteria 5230
729 nmdc:mga0sz30_50119_c1 3300050516 Bacteria 1770
730 Ga0495601_0073290 3300053077 Bacteria 2189
731 Ga0500635_0011224 3300053080 Bacteria 2541
732 Ga0500578_0124247 3300053086 Bacteria 1621
733 Ga0500643_000060 3300053087 Bacteria 128090
734 Ga0500643_018539 3300053087 Bacteria 2308
735 Ga0500647_0084337 3300053091 Bacteria 1524
736 Ga0500583_0136965 3300053092 Bacteria 1216
737 Ga0500651_0059748 3300053093 Bacteria 2383
738 Ga0500651_0079460 3300053093 Bacteria 2033
739 Ga0500566_0000232 3300053094 Bacteria 29876
740 Ga0500566_0000433 3300053094 Bacteria 23328
741 Ga0500566_0007612 3300053094 Bacteria 6419
742 Ga0500640_030286 3300053095 Bacteria 2369
743 Ga0500641_0002368 3300053096 Bacteria 6675
744 Ga0500641_0109134 3300053096 Bacteria 1191
745 Ga0500650_0014961 3300053098 Bacteria 3295
746 Ga0500650_0031116 3300053098 Bacteria 2425
747 Ga0500554_005904 3300053102 Bacteria 2710
748 Ga0500555_001513 3300053103 Bacteria 7034
749 Ga0500556_0001798 3300053104 Bacteria 7945
750 Ga0500557_000007 3300053105 Bacteria 136781
751 Ga0500562_031312 3300053108 Bacteria 1403
752 Ga0500569_020939 3300053109 Bacteria 1723
753 Ga0500569_035451 3300053109 Bacteria 1430
754 Ga0500572_000629 3300053111 Bacteria 11778
755 Ga0500592_001762 3300053116 Bacteria 3503
756 Ga0500595_000218 3300053119 Bacteria 39105
757 Ga0500595_001290 3300053119 Bacteria 13627
758 Ga0500595_001733 3300053119 Bacteria 11381
759 Ga0500595_012205 3300053119 Bacteria 3330
760 Ga0500595_014301 3300053119 Bacteria 3015
761 Ga0500595_019339 3300053119 Bacteria 2472
762 Ga0500618_012220 3300053125 Bacteria 2252
763 Ga0500642_0000025 3300053130 Bacteria 130425
764 Ga0500642_0000045 3300053130 Bacteria 82793
765 Ga0500642_0010800 3300053130 Bacteria 3237
766 Ga0500652_002688 3300053131 Bacteria 5372
767 Ga0500559_0000490 3300053136 Bacteria 27901
768 Ga0500559_0009309 3300053136 Bacteria 4257
769 Ga0500564_011638 3300053138 Bacteria 3890
770 Ga0500568_0017499 3300053139 Bacteria 3163
771 Ga0500568_0032475 3300053139 Bacteria 2147
772 Ga0500577_0005024 3300053142 Bacteria 3532
773 Ga0500586_000915 3300053145 Bacteria 6074
774 Ga0500604_0004699 3300053151 Bacteria 3616
775 Ga0500616_0000031 3300053153 Bacteria 415013
776 Ga0500616_0000034 3300053153 Bacteria 396651
777 Ga0500622_0000112 3300053156 Bacteria 83558
778 Ga0500627_0027450 3300053158 Bacteria 2356
779 Ga0500627_0040081 3300053158 Bacteria 2009
780 Ga0500638_041545 3300053162 Bacteria 2233
781 Ga0500638_110289 3300053162 Bacteria 1271
782 Ga0500639_054422 3300053163 Bacteria 2078
783 Ga0500636_0006944 3300053177 Bacteria 6525
784 Ga0500636_0022256 3300053177 Bacteria 3751
785 Ga0500637_0003356 3300053178 Bacteria 7377
786 Ga0500637_0010467 3300053178 Bacteria 4757
787 Ga0500637_0082022 3300053178 Bacteria 1863
788 Ga0500611_012197 3300053727 Bacteria 1444
789 Ga0500625_002900 3300053729 Bacteria 6602
790 Ga0500645_043212 3300053730 Bacteria 1327
791 Ga0500596_007374 3300053735 Bacteria 1805
792 Ga0500601_000071 3300053737 Bacteria 20922
793 Ga0501084_0011027 3300054114 Bacteria 7486
794 Ga0501084_0018642 3300054114 Bacteria 5777
795 Ga0501084_0356024 3300054114 Bacteria 1237
796 Ga0500661_005718 3300055283 Bacteria 2318
797 Ga0500661_009160 3300055283 Bacteria 1816
798 Ga0501082_0006842 3300060353 Bacteria 9858
799 Ga0501082_0022697 3300060353 Bacteria 5404

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8019629233 8019636290 235
2 3300009011 Ga0105251_10098380 Ga0105251_100983801 261
3 3300048912 Ga0496109_0286813 Ga0496109_0286813_616_1533 268
4 3300049587 Ga0501071_0440722 Ga0501071_0440722_32_958 271
5 3300035084 Ga0373928_0010298 Ga0373928_0010298_864_1808 274
6 3300049822 Ga0501035_0336231 Ga0501035_0336231_17_931 279
7 3300006852 Ga0075433_10062843 Ga0075433_100628433 283
8 3300006871 Ga0075434_100080966 Ga0075434_1000809663 283
9 3300009094 Ga0111539_10289684 Ga0111539_102896842 283
10 3300009147 Ga0114129_10034963 Ga0114129_100349633 283
11 3300027907 Ga0207428_10090650 Ga0207428_100906502 283
12 3300050507 nmdc:mga05p37_63178_c1 nmdc:mga05p37_63178_c1_1311_2384 283
13 3300050511 nmdc:mga08y16_228722_c1 nmdc:mga08y16_228722_c1_556_1629 283
14 3300050512 nmdc:mga0n895_158076_c1 nmdc:mga0n895_158076_c1_79_1152 283
15 3300050515 nmdc:mga0a205_40815_c1 nmdc:mga0a205_40815_c1_3325_4398 283
16 3300053162 Ga0500638_110289 Ga0500638_110289_25_993 284
17 3300060353 Ga0501082_0022697 Ga0501082_0022697_4406_5386 284
18 iso_pu_bacteria 8016522445 8016523186 286
19 3300046557 Ga0495622_0008472 Ga0495622_0008472_3759_4739 287
20 3300053077 Ga0495601_0073290 Ga0495601_0073290_1187_2170 287
21 3300003659 JGI25404J52841_10003134 JGI25404J52841_100031342 289
22 3300035172 Ga0373955_0218631 Ga0373955_0218631_111_1106 291
23 3300005843 Ga0068860_100006930 Ga0068860_1000069305 293
24 3300026095 Ga0207676_10241773 Ga0207676_102417732 293
25 3300028381 Ga0268264_10025570 Ga0268264_100255703 293
26 3300045051 Ga0451576_0190737 Ga0451576_0190737_659_1663 293
27 3300025292 Ga0209676_1000089 Ga0209676_100008997 298
28 3300031911 Ga0307412_10078953 Ga0307412_100789532 299
29 3300003659 JGI25404J52841_10000140 JGI25404J52841_100001403 301
30 3300005983 Ga0081540_1000143 Ga0081540_10001439 301
31 iso_pu_bacteria 2904699407 2904705351 302
32 3300005617 Ga0068859_100459265 Ga0068859_1004592652 303
33 3300006931 Ga0097620_100459267 Ga0097620_1004592672 303
34 3300026035 Ga0207703_10107005 Ga0207703_101070052 303
35 3300048911 Ga0496108_0132244 Ga0496108_0132244_131_1204 303
36 3300048913 Ga0496110_0205744 Ga0496110_0205744_80_1153 303
37 3300045051 Ga0451576_0002840 Ga0451576_0002840_17834_18904 304
38 3300036712 Ga0316584_0004182 Ga0316584_0004182_5316_6335 308
39 3300044673 Ga0453683_0075326 Ga0453683_0075326_426_1478 309
40 3300005354 Ga0070675_100239370 Ga0070675_1002393702 312
41 3300026067 Ga0207678_10107385 Ga0207678_101073852 312
42 3300039437 Ga0436365_0127446 Ga0436365_0127446_339_1397 312
43 3300046615 Ga0495656_0010059 Ga0495656_0010059_899_1972 312
44 3300047472 Ga0495686_0111965 Ga0495686_0111965_65_1138 312
45 3300005983 Ga0081540_1009531 Ga0081540_10095313 313
46 3300026121 Ga0207683_10087636 Ga0207683_100876363 313
47 3300005983 Ga0081540_1011495 Ga0081540_10114953 314
48 3300025919 Ga0207657_10220593 Ga0207657_102205932 314
49 3300005434 Ga0070709_10087358 Ga0070709_100873582 315
50 3300005437 Ga0070710_10079844 Ga0070710_100798441 315
51 3300005439 Ga0070711_100006654 Ga0070711_1000066544 315
52 3300005841 Ga0068863_100197810 Ga0068863_1001978102 315
53 3300005937 Ga0081455_10010230 Ga0081455_100102309 315
54 3300005983 Ga0081540_1001530 Ga0081540_10015302 315
55 3300005983 Ga0081540_1040159 Ga0081540_10401592 315
56 3300006175 Ga0070712_100002999 Ga0070712_1000029992 315
57 3300006844 Ga0075428_100158802 Ga0075428_1001588022 315
58 3300025905 Ga0207685_10029419 Ga0207685_100294192 315
59 3300025906 Ga0207699_10081798 Ga0207699_100817981 315
60 3300025915 Ga0207693_10006044 Ga0207693_100060444 315
61 3300025916 Ga0207663_10006392 Ga0207663_100063924 315
62 3300031456 Ga0307513_10028934 Ga0307513_100289345 315
63 3300031730 Ga0307516_10165234 Ga0307516_101652342 315
64 3300035083 Ga0373926_0023684 Ga0373926_0023684_286_1362 315
65 3300035113 Ga0373936_0001567 Ga0373936_0001567_1250_2326 315
66 3300035116 Ga0373945_0021562 Ga0373945_0021562_234_1310 315
67 3300035692 Ga0373935_0037872 Ga0373935_0037872_221_1297 315
68 3300035695 Ga0373927_0005443 Ga0373927_0005443_3799_4875 315
69 3300035725 Ga0373947_0000357 Ga0373947_0000357_15445_16521 315
70 3300037068 Ga0373925_0002728 Ga0373925_0002728_3830_4906 315
71 3300046455 Ga0495603_0034410 Ga0495603_0034410_659_1735 315
72 3300046472 Ga0495580_0001379 Ga0495580_0001379_18103_19179 315
73 3300046531 Ga0495665_0080270 Ga0495665_0080270_31_1107 315
74 3300046535 Ga0495586_0014415 Ga0495586_0014415_1128_2204 315
75 3300046557 Ga0495622_0029881 Ga0495622_0029881_488_1561 315
76 3300046674 Ga0495588_0020620 Ga0495588_0020620_121_1197 315
77 3300046681 Ga0495647_0004395 Ga0495647_0004395_54_1130 315
78 3300046683 Ga0495658_0014086 Ga0495658_0014086_1154_2230 315
79 3300049578 Ga0501042_0042212 Ga0501042_0042212_1115_2188 315
80 3300049580 Ga0501046_0064273 Ga0501046_0064273_1562_2635 315
81 3300049582 Ga0501048_0011399 Ga0501048_0011399_3984_5057 315
82 3300049588 Ga0501072_0025839 Ga0501072_0025839_2409_3482 315
83 3300049591 Ga0501075_0009514 Ga0501075_0009514_3154_4227 315
84 3300049592 Ga0501076_0076832 Ga0501076_0076832_1246_2319 315
85 3300049593 Ga0501077_0004617 Ga0501077_0004617_5095_6168 315
86 3300049741 Ga0501079_0005504 Ga0501079_0005504_3107_4180 315
87 3300049743 Ga0501081_0088475 Ga0501081_0088475_185_1258 315
88 3300049824 Ga0501045_0135618 Ga0501045_0135618_14_1087 315
89 3300054114 Ga0501084_0018642 Ga0501084_0018642_3720_4793 315
90 3300005338 Ga0068868_100179534 Ga0068868_1001795342 316
91 3300005354 Ga0070675_100210389 Ga0070675_1002103892 316
92 3300005367 Ga0070667_100172973 Ga0070667_1001729732 316
93 3300005441 Ga0070700_100181090 Ga0070700_1001810902 316
94 3300005547 Ga0070693_100110547 Ga0070693_1001105472 316
95 3300005548 Ga0070665_100117654 Ga0070665_1001176542 316
96 3300005563 Ga0068855_100095713 Ga0068855_1000957133 316
97 3300005577 Ga0068857_100221395 Ga0068857_1002213952 316
98 3300005614 Ga0068856_100134340 Ga0068856_1001343402 316
99 3300005618 Ga0068864_100168642 Ga0068864_1001686422 316
100 3300005719 Ga0068861_100163041 Ga0068861_1001630412 316
101 3300005840 Ga0068870_10150987 Ga0068870_101509871 316
102 3300005842 Ga0068858_100165530 Ga0068858_1001655302 316
103 3300006042 Ga0075368_10031576 Ga0075368_100315762 316
104 3300006195 Ga0075366_10085197 Ga0075366_100851972 316
105 3300006237 Ga0097621_100057722 Ga0097621_1000577223 316
106 3300006358 Ga0068871_100098196 Ga0068871_1000981962 316
107 3300007076 Ga0075435_100039215 Ga0075435_1000392153 316
108 3300009098 Ga0105245_10142445 Ga0105245_101424452 316
109 3300010375 Ga0105239_10155102 Ga0105239_101551022 316
110 3300013308 Ga0157375_10607721 Ga0157375_106077211 316
111 3300025908 Ga0207643_10030614 Ga0207643_100306143 316
112 3300025912 Ga0207707_10043088 Ga0207707_100430883 316
113 3300025913 Ga0207695_10101655 Ga0207695_101016552 316
114 3300025918 Ga0207662_10036703 Ga0207662_100367033 316
115 3300026035 Ga0207703_10021262 Ga0207703_100212625 316
116 3300026095 Ga0207676_10081038 Ga0207676_100810382 316
117 3300026121 Ga0207683_10157923 Ga0207683_101579232 316
118 3300042876 Ga0451577_0020383 Ga0451577_0020383_2303_3379 316
119 3300045051 Ga0451576_0000675 Ga0451576_0000675_4261_5337 316
120 3300048920 Ga0496117_0054251 Ga0496117_0054251_1585_2658 316
121 3300048928 Ga0496125_0154903 Ga0496125_0154903_65_1138 316
122 3300048929 Ga0496126_0082013 Ga0496126_0082013_976_2049 316
123 3300050490 nmdc:mga03n38_28282_c1 nmdc:mga03n38_28282_c1_1249_2322 316
124 3300050512 nmdc:mga0n895_89040_c1 nmdc:mga0n895_89040_c1_137_1210 316
125 3300003203 JGI25406J46586_10001340 JGI25406J46586_100013409 317
126 3300003203 JGI25406J46586_10012413 JGI25406J46586_100124134 317
127 3300003215 JGI25153J46596_10001032 JGI25153J46596_100010322 317
128 3300003215 JGI25153J46596_10014714 JGI25153J46596_100147142 317
129 3300003354 JGI25160J50197_1010011 JGI25160J50197_10100113 317
130 3300003794 Ga0055531_10010836 Ga0055531_100108364 317
131 3300005262 Ga0065165_1008807 Ga0065165_10088073 317
132 3300005329 Ga0070683_100042581 Ga0070683_1000425814 317
133 3300005336 Ga0070680_100033285 Ga0070680_1000332852 317
134 3300005336 Ga0070680_100066333 Ga0070680_1000663332 317
135 3300005339 Ga0070660_100021943 Ga0070660_1000219434 317
136 3300005344 Ga0070661_100114892 Ga0070661_1001148922 317
137 3300005345 Ga0070692_10081621 Ga0070692_100816212 317
138 3300005434 Ga0070709_10003148 Ga0070709_100031483 317
139 3300005435 Ga0070714_100265546 Ga0070714_1002655462 317
140 3300005437 Ga0070710_10016002 Ga0070710_100160022 317
141 3300005458 Ga0070681_10052047 Ga0070681_100520472 317
142 3300005458 Ga0070681_10082806 Ga0070681_100828062 317
143 3300005530 Ga0070679_100034454 Ga0070679_1000344543 317
144 3300005535 Ga0070684_100009500 Ga0070684_1000095006 317
145 3300005535 Ga0070684_100012459 Ga0070684_1000124593 317
146 3300005535 Ga0070684_100207566 Ga0070684_1002075661 317
147 3300005536 Ga0070697_100096555 Ga0070697_1000965551 317
148 3300005539 Ga0068853_100087403 Ga0068853_1000874032 317
149 3300005563 Ga0068855_100155701 Ga0068855_1001557012 317
150 3300005563 Ga0068855_100231903 Ga0068855_1002319032 317
151 3300005577 Ga0068857_100003563 Ga0068857_1000035632 317
152 3300005577 Ga0068857_100126560 Ga0068857_1001265602 317
153 3300005616 Ga0068852_100024599 Ga0068852_1000245993 317
154 3300005616 Ga0068852_100082573 Ga0068852_1000825732 317
155 3300005618 Ga0068864_100189111 Ga0068864_1001891112 317
156 3300005843 Ga0068860_100000409 Ga0068860_10000040910 317
157 3300005937 Ga0081455_10019837 Ga0081455_100198374 317
158 3300005985 Ga0081539_10000008 Ga0081539_10000008141 317
159 3300005985 Ga0081539_10000584 Ga0081539_1000058470 317
160 3300005985 Ga0081539_10061688 Ga0081539_100616882 317
161 3300006028 Ga0070717_10151647 Ga0070717_101516472 317
162 3300006038 Ga0075365_10036728 Ga0075365_100367283 317
163 3300006173 Ga0070716_100012559 Ga0070716_1000125593 317
164 3300006175 Ga0070712_100055938 Ga0070712_1000559382 317
165 3300006178 Ga0075367_10220276 Ga0075367_102202761 317
166 3300006943 Ga0099822_1009601 Ga0099822_100960111 317
167 3300007265 Ga0099794_10017790 Ga0099794_100177904 317
168 3300009093 Ga0105240_10227997 Ga0105240_102279973 317
169 3300009093 Ga0105240_10483493 Ga0105240_104834932 317
170 3300009098 Ga0105245_10293728 Ga0105245_102937282 317
171 3300009101 Ga0105247_10197266 Ga0105247_101972662 317
172 3300009148 Ga0105243_10062607 Ga0105243_100626072 317
173 3300009177 Ga0105248_10448998 Ga0105248_104489982 317
174 3300009545 Ga0105237_10022765 Ga0105237_100227654 317
175 3300009551 Ga0105238_10001542 Ga0105238_100015426 317
176 3300009551 Ga0105238_10058526 Ga0105238_100585264 317
177 3300010159 Ga0099796_10070327 Ga0099796_100703272 317
178 3300010375 Ga0105239_10041673 Ga0105239_100416733 317
179 3300010375 Ga0105239_10080676 Ga0105239_100806762 317
180 3300011119 Ga0105246_10191271 Ga0105246_101912712 317
181 3300013105 Ga0157369_10015619 Ga0157369_100156198 317
182 3300013105 Ga0157369_10218148 Ga0157369_102181482 317
183 3300013296 Ga0157374_10180434 Ga0157374_101804342 317
184 3300013297 Ga0157378_10041519 Ga0157378_100415192 317
185 3300013306 Ga0163162_10366826 Ga0163162_103668262 317
186 3300013307 Ga0157372_10757154 Ga0157372_107571541 317
187 3300013308 Ga0157375_10126465 Ga0157375_101264652 317
188 3300013308 Ga0157375_10311245 Ga0157375_103112452 317
189 3300014325 Ga0163163_10133407 Ga0163163_101334072 317
190 3300014969 Ga0157376_10253779 Ga0157376_102537792 317
191 3300017792 Ga0163161_10115340 Ga0163161_101153401 317
192 3300021321 Ga0214542_1000196 Ga0214542_100019664 317
193 3300021324 Ga0214545_1000028 Ga0214545_100002827 317
194 3300021327 Ga0214543_1000044 Ga0214543_1000044137 317
195 3300021361 Ga0213872_10029908 Ga0213872_100299082 317
196 3300021384 Ga0213876_10008302 Ga0213876_100083025 317
197 3300021388 Ga0213875_10117911 Ga0213875_101179112 317
198 3300025261 Ga0209233_1005329 Ga0209233_10053292 317
199 3300025295 Ga0209564_1003584 Ga0209564_10035847 317
200 3300025297 Ga0209758_1000075 Ga0209758_1000075185 317
201 3300025297 Ga0209758_1000187 Ga0209758_100018772 317
202 3300025299 Ga0209256_1004509 Ga0209256_10045097 317
203 3300025302 Ga0207426_1008174 Ga0207426_10081742 317
204 3300025304 Ga0209257_1000652 Ga0209257_100065227 317
205 3300025898 Ga0207692_10043736 Ga0207692_100437362 317
206 3300025898 Ga0207692_10133223 Ga0207692_101332231 317
207 3300025899 Ga0207642_10087554 Ga0207642_100875542 317
208 3300025912 Ga0207707_10012676 Ga0207707_100126763 317
209 3300025912 Ga0207707_10047521 Ga0207707_100475213 317
210 3300025912 Ga0207707_10202468 Ga0207707_102024682 317
211 3300025913 Ga0207695_10145264 Ga0207695_101452642 317
212 3300025913 Ga0207695_10327502 Ga0207695_103275022 317
213 3300025914 Ga0207671_10013888 Ga0207671_100138882 317
214 3300025915 Ga0207693_10031467 Ga0207693_100314672 317
215 3300025916 Ga0207663_10003711 Ga0207663_100037114 317
216 3300025917 Ga0207660_10002329 Ga0207660_100023298 317
217 3300025919 Ga0207657_10010305 Ga0207657_100103053 317
218 3300025921 Ga0207652_10069916 Ga0207652_100699162 317
219 3300025924 Ga0207694_10007305 Ga0207694_100073052 317
220 3300025924 Ga0207694_10111904 Ga0207694_101119042 317
221 3300025928 Ga0207700_10405877 Ga0207700_104058771 317
222 3300025929 Ga0207664_10037677 Ga0207664_100376773 317
223 3300025932 Ga0207690_10035970 Ga0207690_100359703 317
224 3300025938 Ga0207704_10165015 Ga0207704_101650152 317
225 3300025939 Ga0207665_10014910 Ga0207665_100149104 317
226 3300025941 Ga0207711_10137684 Ga0207711_101376842 317
227 3300025942 Ga0207689_10080092 Ga0207689_100800922 317
228 3300025944 Ga0207661_10077945 Ga0207661_100779452 317
229 3300025944 Ga0207661_10093278 Ga0207661_100932782 317
230 3300025944 Ga0207661_10309971 Ga0207661_103099711 317
231 3300025945 Ga0207679_10351217 Ga0207679_103512171 317
232 3300025949 Ga0207667_10008692 Ga0207667_100086922 317
233 3300026023 Ga0207677_10076318 Ga0207677_100763182 317
234 3300026041 Ga0207639_10092244 Ga0207639_100922442 317
235 3300026067 Ga0207678_10089992 Ga0207678_100899922 317
236 3300026067 Ga0207678_10128582 Ga0207678_101285822 317
237 3300026075 Ga0207708_10201092 Ga0207708_102010922 317
238 3300026088 Ga0207641_10090874 Ga0207641_100908742 317
239 3300026121 Ga0207683_10084732 Ga0207683_100847322 317
240 3300026121 Ga0207683_10419355 Ga0207683_104193551 317
241 3300027357 Ga0209589_1000004 Ga0209589_100000492 317
242 3300027361 Ga0209489_100004 Ga0209489_10000492 317
243 3300027363 Ga0209700_100004 Ga0209700_10000492 317
244 3300028381 Ga0268264_10000020 Ga0268264_1000002022 317
245 3300028556 Ga0265337_1003562 Ga0265337_10035624 317
246 3300028558 Ga0265326_10001476 Ga0265326_100014764 317
247 3300028563 Ga0265319_1003347 Ga0265319_10033472 317
248 3300028577 Ga0265318_10003706 Ga0265318_100037063 317
249 3300028653 Ga0265323_10000837 Ga0265323_100008374 317
250 3300028654 Ga0265322_10005262 Ga0265322_100052624 317
251 3300028666 Ga0265336_10000593 Ga0265336_1000059312 317
252 3300028800 Ga0265338_10000013 Ga0265338_1000001327 317
253 3300029957 Ga0265324_10003161 Ga0265324_100031615 317
254 3300030521 Ga0307511_10070683 Ga0307511_100706832 317
255 3300031235 Ga0265330_10031111 Ga0265330_100311112 317
256 3300031247 Ga0265340_10026179 Ga0265340_100261794 317
257 3300031344 Ga0265316_10166183 Ga0265316_101661832 317
258 3300031595 Ga0265313_10094738 Ga0265313_100947381 317
259 3300031616 Ga0307508_10000419 Ga0307508_100004192 317
260 3300031616 Ga0307508_10014811 Ga0307508_100148112 317
261 3300031616 Ga0307508_10098897 Ga0307508_100988972 317
262 3300031730 Ga0307516_10015558 Ga0307516_100155584 317
263 3300031730 Ga0307516_10315328 Ga0307516_103153281 317
264 3300033180 Ga0307510_10198073 Ga0307510_101980732 317
265 3300033442 Ga0315911_1000014 Ga0315911_100001465 317
266 3300035088 Ga0373940_0027603 Ga0373940_0027603_16_1089 317
267 3300035116 Ga0373945_0012471 Ga0373945_0012471_1667_2740 317
268 3300035119 Ga0373956_0071927 Ga0373956_0071927_78_1151 317
269 3300035691 Ga0373931_0003484 Ga0373931_0003484_237_1310 317
270 3300035692 Ga0373935_0016197 Ga0373935_0016197_1213_2286 317
271 3300035692 Ga0373935_0082894 Ga0373935_0082894_298_1371 317
272 3300035692 Ga0373935_0103599 Ga0373935_0103599_318_1391 317
273 3300035692 Ga0373935_0301199 Ga0373935_0301199_13_1086 317
274 3300035695 Ga0373927_0015544 Ga0373927_0015544_3609_4682 317
275 3300035695 Ga0373927_0029068 Ga0373927_0029068_704_1777 317
276 3300035695 Ga0373927_0042045 Ga0373927_0042045_811_1884 317
277 3300035695 Ga0373927_0068689 Ga0373927_0068689_526_1599 317
278 3300035695 Ga0373927_0075323 Ga0373927_0075323_383_1456 317
279 3300035724 Ga0373933_0000631 Ga0373933_0000631_1054_2127 317
280 3300035725 Ga0373947_0017397 Ga0373947_0017397_1879_2952 317
281 3300037466 Ga0395898_0315357 Ga0395898_0315357_362_1435 317
282 3300037853 Ga0436364_1318252 Ga0436364_1318252_126_1199 317
283 3300039437 Ga0436365_0260840 Ga0436365_0260840_4205_5278 317
284 3300039438 Ga0436360_0713070 Ga0436360_0713070_165_1238 317
285 3300039438 Ga0436360_1094903 Ga0436360_1094903_222_1295 317
286 3300039438 Ga0436360_1133513 Ga0436360_1133513_1833_2906 317
287 3300039447 Ga0436361_0246237 Ga0436361_0246237_5176_6249 317
288 3300039450 Ga0436363_0587633 Ga0436363_0587633_783_1856 317
289 3300046454 Ga0495592_0086330 Ga0495592_0086330_777_1850 317
290 3300046455 Ga0495603_0053980 Ga0495603_0053980_1212_2285 317
291 3300046455 Ga0495603_0096115 Ga0495603_0096115_133_1206 317
292 3300046463 Ga0495653_0072908 Ga0495653_0072908_1104_2177 317
293 3300046472 Ga0495580_0036934 Ga0495580_0036934_1369_2442 317
294 3300046475 Ga0495639_0050665 Ga0495639_0050665_16_1089 317
295 3300046477 Ga0495664_0028973 Ga0495664_0028973_1858_2931 317
296 3300046507 Ga0495606_0000915 Ga0495606_0000915_7880_8953 317
297 3300046517 Ga0495630_0023249 Ga0495630_0023249_1046_2119 317
298 3300046524 Ga0495648_0022628 Ga0495648_0022628_1900_2973 317
299 3300046529 Ga0495652_0085963 Ga0495652_0085963_999_2072 317
300 3300046531 Ga0495665_0091256 Ga0495665_0091256_506_1579 317
301 3300046543 Ga0495645_0048130 Ga0495645_0048130_200_1273 317
302 3300046559 Ga0495667_0136112 Ga0495667_0136112_59_1132 317
303 3300046559 Ga0495667_0203262 Ga0495667_0203262_72_1145 317
304 3300046642 Ga0495634_0096188 Ga0495634_0096188_406_1479 317
305 3300046663 Ga0495635_0228492 Ga0495635_0228492_154_1227 317
306 3300046675 Ga0495657_0072974 Ga0495657_0072974_299_1372 317
307 3300046680 Ga0495646_0055716 Ga0495646_0055716_1146_2219 317
308 3300046683 Ga0495658_0049662 Ga0495658_0049662_39_1112 317
309 3300046690 Ga0495624_0024747 Ga0495624_0024747_1853_2926 317
310 3300047319 Ga0495674_0190461 Ga0495674_0190461_411_1484 317
311 3300047320 Ga0495672_0014637 Ga0495672_0014637_3132_4205 317
312 3300047444 Ga0495675_0206660 Ga0495675_0206660_50_1123 317
313 3300047469 Ga0495673_0023720 Ga0495673_0023720_513_1586 317
314 3300048088 Ga0495602_0141611 Ga0495602_0141611_383_1456 317
315 3300048903 Ga0496100_0050000 Ga0496100_0050000_1201_2274 317
316 3300048904 Ga0496101_0054059 Ga0496101_0054059_1127_2200 317
317 3300048905 Ga0496102_0034487 Ga0496102_0034487_3253_4326 317
318 3300048906 Ga0496103_0102334 Ga0496103_0102334_405_1478 317
319 3300048907 Ga0496104_0099651 Ga0496104_0099651_1097_2170 317
320 3300048908 Ga0496105_0012602 Ga0496105_0012602_3317_4390 317
321 3300048909 Ga0496106_0049104 Ga0496106_0049104_892_1965 317
322 3300048909 Ga0496106_0215634 Ga0496106_0215634_47_1120 317
323 3300048911 Ga0496108_0079506 Ga0496108_0079506_899_1972 317
324 3300048911 Ga0496108_0268769 Ga0496108_0268769_359_1432 317
325 3300048912 Ga0496109_0080717 Ga0496109_0080717_1166_2239 317
326 3300048912 Ga0496109_0287796 Ga0496109_0287796_69_1142 317
327 3300048915 Ga0496112_0000008 Ga0496112_0000008_213127_214200 317
328 3300048915 Ga0496112_0051959 Ga0496112_0051959_899_1972 317
329 3300048915 Ga0496112_0064228 Ga0496112_0064228_961_2034 317
330 3300048916 Ga0496113_0083920 Ga0496113_0083920_1197_2270 317
331 3300048917 Ga0496114_0088302 Ga0496114_0088302_329_1402 317
332 3300048918 Ga0496115_0035668 Ga0496115_0035668_192_1265 317
333 3300048918 Ga0496115_0223619 Ga0496115_0223619_170_1243 317
334 3300048921 Ga0496118_0013737 Ga0496118_0013737_92_1165 317
335 3300048921 Ga0496118_0095301 Ga0496118_0095301_284_1357 317
336 3300048922 Ga0496119_0108248 Ga0496119_0108248_94_1167 317
337 3300048924 Ga0496121_0001584 Ga0496121_0001584_35485_36558 317
338 3300048924 Ga0496121_0001681 Ga0496121_0001681_20500_21573 317
339 3300048924 Ga0496121_0046502 Ga0496121_0046502_1285_2358 317
340 3300048926 Ga0496123_0111754 Ga0496123_0111754_278_1351 317
341 3300048927 Ga0496124_0023656 Ga0496124_0023656_1856_2929 317
342 3300048928 Ga0496125_0176522 Ga0496125_0176522_256_1329 317
343 3300048929 Ga0496126_0003467 Ga0496126_0003467_14073_15146 317
344 3300048929 Ga0496126_0014444 Ga0496126_0014444_5019_6092 317
345 3300048929 Ga0496126_0015961 Ga0496126_0015961_5603_6676 317
346 3300048929 Ga0496126_0024893 Ga0496126_0024893_342_1415 317
347 3300048929 Ga0496126_0086358 Ga0496126_0086358_1163_2236 317
348 3300048929 Ga0496126_0237087 Ga0496126_0237087_117_1190 317
349 3300049586 Ga0501070_0077806 Ga0501070_0077806_1640_2698 317
350 3300050490 nmdc:mga03n38_127320_c1 nmdc:mga03n38_127320_c1_82_1155 317
351 3300050492 nmdc:mga0yw44_141502_c1 nmdc:mga0yw44_141502_c1_374_1447 317
352 3300053091 Ga0500647_0084337 Ga0500647_0084337_186_1259 317
353 3300053092 Ga0500583_0136965 Ga0500583_0136965_129_1202 317
354 3300053093 Ga0500651_0059748 Ga0500651_0059748_711_1784 317
355 3300053094 Ga0500566_0000232 Ga0500566_0000232_27395_28468 317
356 3300053096 Ga0500641_0002368 Ga0500641_0002368_2353_3426 317
357 3300053096 Ga0500641_0109134 Ga0500641_0109134_38_1111 317
358 3300053119 Ga0500595_000218 Ga0500595_000218_20519_21592 317
359 3300053119 Ga0500595_001290 Ga0500595_001290_278_1351 317
360 3300053119 Ga0500595_001733 Ga0500595_001733_9718_10791 317
361 3300053119 Ga0500595_014301 Ga0500595_014301_259_1332 317
362 3300053119 Ga0500595_019339 Ga0500595_019339_760_1833 317
363 3300053139 Ga0500568_0032475 Ga0500568_0032475_323_1396 317
364 3300053162 Ga0500638_041545 Ga0500638_041545_34_1107 317
365 3300053163 Ga0500639_054422 Ga0500639_054422_765_1838 317
366 3300053178 Ga0500637_0003356 Ga0500637_0003356_1037_2110 317
367 3300053735 Ga0500596_007374 Ga0500596_007374_59_1132 317
368 3300054114 Ga0501084_0356024 Ga0501084_0356024_103_1176 317
369 3300055283 Ga0500661_009160 Ga0500661_009160_10_1083 317
370 3300003354 JGI25160J50197_1000569 JGI25160J50197_10005696 318
371 3300005353 Ga0070669_100093547 Ga0070669_1000935471 318
372 3300005548 Ga0070665_100137573 Ga0070665_1001375732 318
373 3300005719 Ga0068861_100086582 Ga0068861_1000865822 318
374 3300005937 Ga0081455_10054253 Ga0081455_100542533 318
375 3300005983 Ga0081540_1018862 Ga0081540_10188623 318
376 3300006038 Ga0075365_10081333 Ga0075365_100813332 318
377 3300006038 Ga0075365_10150373 Ga0075365_101503731 318
378 3300006038 Ga0075365_10210542 Ga0075365_102105422 318
379 3300009545 Ga0105237_10029941 Ga0105237_100299414 318
380 3300009551 Ga0105238_10053840 Ga0105238_100538402 318
381 3300013296 Ga0157374_10154188 Ga0157374_101541882 318
382 3300025302 Ga0207426_1000160 Ga0207426_1000160151 318
383 3300025914 Ga0207671_10044783 Ga0207671_100447832 318
384 3300025933 Ga0207706_10030695 Ga0207706_100306953 318
385 3300026067 Ga0207678_10086984 Ga0207678_100869842 318
386 3300028379 Ga0268266_10351815 Ga0268266_103518152 318
387 3300028794 Ga0307515_10137583 Ga0307515_101375831 318
388 3300028794 Ga0307515_10269511 Ga0307515_102695111 318
389 3300035170 Ga0373943_0005860 Ga0373943_0005860_1832_2905 318
390 3300035692 Ga0373935_0006166 Ga0373935_0006166_2471_3544 318
391 3300035695 Ga0373927_0178538 Ga0373927_0178538_22_1095 318
392 3300035725 Ga0373947_0009942 Ga0373947_0009942_216_1289 318
393 3300036401 Ga0373937_0117080 Ga0373937_0117080_17_1090 318
394 3300039447 Ga0436361_0931732 Ga0436361_0931732_508_1581 318
395 3300041413 Ga0439465_0037857 Ga0439465_0037857_238_1311 318
396 3300045051 Ga0451576_0252779 Ga0451576_0252779_238_1311 318
397 3300046455 Ga0495603_0001156 Ga0495603_0001156_12194_13267 318
398 3300046459 Ga0495629_0021124 Ga0495629_0021124_3560_4633 318
399 3300046461 Ga0495641_0006609 Ga0495641_0006609_2469_3542 318
400 3300046473 Ga0495582_0002621 Ga0495582_0002621_4608_5681 318
401 3300046475 Ga0495639_0004522 Ga0495639_0004522_224_1297 318
402 3300046476 Ga0495662_0010347 Ga0495662_0010347_26_1099 318
403 3300046499 Ga0495594_0011407 Ga0495594_0011407_35_1108 318
404 3300046529 Ga0495652_0025060 Ga0495652_0025060_2887_3960 318
405 3300046531 Ga0495665_0004182 Ga0495665_0004182_108_1181 318
406 3300046663 Ga0495635_0011796 Ga0495635_0011796_4843_5916 318
407 3300046674 Ga0495588_0009668 Ga0495588_0009668_1413_2486 318
408 3300046678 Ga0495599_0033724 Ga0495599_0033724_963_2036 318
409 3300046683 Ga0495658_0033660 Ga0495658_0033660_1623_2696 318
410 3300047315 Ga0495581_0007938 Ga0495581_0007938_4850_5923 318
411 3300047319 Ga0495674_0036834 Ga0495674_0036834_2924_3997 318
412 3300048918 Ga0496115_0199125 Ga0496115_0199125_84_1157 318
413 3300048928 Ga0496125_0014211 Ga0496125_0014211_6045_7118 318
414 3300050490 nmdc:mga03n38_118464_c1 nmdc:mga03n38_118464_c1_79_1152 318
415 3300050492 nmdc:mga0yw44_111005_c1 nmdc:mga0yw44_111005_c1_128_1201 318
416 3300050512 nmdc:mga0n895_96750_c1 nmdc:mga0n895_96750_c1_1586_2659 318
417 3300003762 Ga0055542_1007822 Ga0055542_10078222 319
418 3300003771 Ga0055526_1014213 Ga0055526_10142132 319
419 3300005262 Ga0065165_1000976 Ga0065165_100097630 319
420 3300005262 Ga0065165_1002262 Ga0065165_10022621 319
421 3300005327 Ga0070658_10143928 Ga0070658_101439281 319
422 3300005347 Ga0070668_100069520 Ga0070668_1000695202 319
423 3300005455 Ga0070663_100214260 Ga0070663_1002142602 319
424 3300005548 Ga0070665_100049040 Ga0070665_1000490402 319
425 3300005616 Ga0068852_100030142 Ga0068852_1000301422 319
426 3300005842 Ga0068858_100121431 Ga0068858_1001214312 319
427 3300005983 Ga0081540_1002641 Ga0081540_100264114 319
428 3300005983 Ga0081540_1008750 Ga0081540_10087505 319
429 3300005983 Ga0081540_1016307 Ga0081540_10163072 319
430 3300006038 Ga0075365_10081533 Ga0075365_100815332 319
431 3300006042 Ga0075368_10005111 Ga0075368_100051114 319
432 3300006048 Ga0075363_100003347 Ga0075363_1000033474 319
433 3300006051 Ga0075364_10106164 Ga0075364_101061642 319
434 3300006186 Ga0075369_10034421 Ga0075369_100344212 319
435 3300006195 Ga0075366_10016666 Ga0075366_100166663 319
436 3300006353 Ga0075370_10066683 Ga0075370_100666832 319
437 3300006353 Ga0075370_10068678 Ga0075370_100686782 319
438 3300006942 Ga0099824_1013173 Ga0099824_10131735 319
439 3300007788 Ga0099795_10026157 Ga0099795_100261572 319
440 3300009093 Ga0105240_10009010 Ga0105240_100090105 319
441 3300009098 Ga0105245_10405647 Ga0105245_104056472 319
442 3300009101 Ga0105247_10102792 Ga0105247_101027922 319
443 3300009545 Ga0105237_10095886 Ga0105237_100958862 319
444 3300009545 Ga0105237_10194442 Ga0105237_101944422 319
445 3300010375 Ga0105239_10369926 Ga0105239_103699262 319
446 3300025230 Ga0209563_101069 Ga0209563_1010699 319
447 3300025254 Ga0209148_1000680 Ga0209148_100068020 319
448 3300025261 Ga0209233_1012988 Ga0209233_10129883 319
449 3300025272 Ga0209455_1004574 Ga0209455_10045743 319
450 3300025295 Ga0209564_1000248 Ga0209564_1000248111 319
451 3300025297 Ga0209758_1007361 Ga0209758_10073615 319
452 3300025297 Ga0209758_1041958 Ga0209758_10419582 319
453 3300025297 Ga0209758_1065826 Ga0209758_10658261 319
454 3300025302 Ga0207426_1000527 Ga0207426_100052730 319
455 3300025302 Ga0207426_1004914 Ga0207426_10049143 319
456 3300025304 Ga0209257_1016414 Ga0209257_10164143 319
457 3300025315 Ga0207697_10058258 Ga0207697_100582582 319
458 3300025900 Ga0207710_10035294 Ga0207710_100352942 319
459 3300025904 Ga0207647_10057974 Ga0207647_100579741 319
460 3300025909 Ga0207705_10131790 Ga0207705_101317902 319
461 3300025911 Ga0207654_10050669 Ga0207654_100506692 319
462 3300025913 Ga0207695_10000029 Ga0207695_10000029373 319
463 3300025914 Ga0207671_10007217 Ga0207671_100072172 319
464 3300025914 Ga0207671_10283878 Ga0207671_102838781 319
465 3300025926 Ga0207659_10161754 Ga0207659_101617542 319
466 3300025931 Ga0207644_10118806 Ga0207644_101188062 319
467 3300025933 Ga0207706_10225236 Ga0207706_102252362 319
468 3300025941 Ga0207711_10097879 Ga0207711_100978792 319
469 3300025972 Ga0207668_10351118 Ga0207668_103511181 319
470 3300026035 Ga0207703_10075215 Ga0207703_100752152 319
471 3300026078 Ga0207702_10077467 Ga0207702_100774672 319
472 3300026116 Ga0207674_10253451 Ga0207674_102534512 319
473 3300026142 Ga0207698_10017272 Ga0207698_100172724 319
474 3300026142 Ga0207698_10099578 Ga0207698_100995782 319
475 3300027296 Ga0209389_1000003 Ga0209389_1000003102 319
476 3300027296 Ga0209389_1000365 Ga0209389_10003655 319
477 3300027357 Ga0209589_1003813 Ga0209589_10038135 319
478 3300027361 Ga0209489_100022 Ga0209489_10002278 319
479 3300027361 Ga0209489_100498 Ga0209489_10049819 319
480 3300027363 Ga0209700_100023 Ga0209700_100023101 319
481 3300027866 Ga0209813_10001106 Ga0209813_100011062 319
482 3300028379 Ga0268266_10005789 Ga0268266_100057892 319
483 3300028380 Ga0268265_10301957 Ga0268265_103019571 319
484 3300028381 Ga0268264_10299856 Ga0268264_102998562 319
485 3300031616 Ga0307508_10161516 Ga0307508_101615162 319
486 3300031911 Ga0307412_10117566 Ga0307412_101175662 319
487 3300033180 Ga0307510_10079808 Ga0307510_100798083 319
488 3300033180 Ga0307510_10098533 Ga0307510_100985332 319
489 3300035113 Ga0373936_0022563 Ga0373936_0022563_98_1171 319
490 3300041999 Ga0439433_0022619 Ga0439433_0022619_233_1291 319
491 3300044656 Ga0466969_0034850 Ga0466969_0034850_827_1900 319
492 3300044684 Ga0466966_0000539 Ga0466966_0000539_16198_17271 319
493 3300044693 Ga0466961_0000084 Ga0466961_0000084_45983_47056 319
494 3300044735 Ga0466968_0009336 Ga0466968_0009336_1708_2781 319
495 3300044735 Ga0466968_0030769 Ga0466968_0030769_861_1934 319
496 3300044901 Ga0466960_0021965 Ga0466960_0021965_872_1945 319
497 3300045049 Ga0466959_0002035 Ga0466959_0002035_10273_11346 319
498 3300045976 Ga0466967_0050811 Ga0466967_0050811_1418_2491 319
499 3300046455 Ga0495603_0032943 Ga0495603_0032943_676_1749 319
500 3300046460 Ga0495638_0003687 Ga0495638_0003687_1153_2226 319
501 3300046506 Ga0495583_0061520 Ga0495583_0061520_386_1459 319
502 3300046507 Ga0495606_0133990 Ga0495606_0133990_302_1375 319
503 3300046507 Ga0495606_0139428 Ga0495606_0139428_96_1169 319
504 3300046522 Ga0495643_0006431 Ga0495643_0006431_6531_7604 319
505 3300046524 Ga0495648_0022205 Ga0495648_0022205_2464_3537 319
506 3300046524 Ga0495648_0096940 Ga0495648_0096940_113_1186 319
507 3300046529 Ga0495652_0145781 Ga0495652_0145781_588_1661 319
508 3300046557 Ga0495622_0021964 Ga0495622_0021964_984_2057 319
509 3300046616 Ga0495668_0064492 Ga0495668_0064492_400_1473 319
510 3300046616 Ga0495668_0158982 Ga0495668_0158982_31_1104 319
511 3300046648 Ga0495611_0044678 Ga0495611_0044678_126_1199 319
512 3300046665 Ga0495661_0074465 Ga0495661_0074465_782_1855 319
513 3300047317 Ga0495604_0054408 Ga0495604_0054408_904_1977 319
514 3300047323 Ga0495683_0050250 Ga0495683_0050250_264_1337 319
515 3300047469 Ga0495673_0037806 Ga0495673_0037806_522_1595 319
516 3300047472 Ga0495686_0065927 Ga0495686_0065927_626_1699 319
517 3300047472 Ga0495686_0130758 Ga0495686_0130758_317_1390 319
518 3300048904 Ga0496101_0116840 Ga0496101_0116840_587_1660 319
519 3300048905 Ga0496102_0094482 Ga0496102_0094482_897_1970 319
520 3300048906 Ga0496103_0022924 Ga0496103_0022924_2477_3550 319
521 3300048907 Ga0496104_0022058 Ga0496104_0022058_4638_5711 319
522 3300048907 Ga0496104_0261422 Ga0496104_0261422_110_1183 319
523 3300048907 Ga0496104_0429520 Ga0496104_0429520_36_1109 319
524 3300048907 Ga0496104_0475188 Ga0496104_0475188_32_1105 319
525 3300048908 Ga0496105_0052003 Ga0496105_0052003_1164_2237 319
526 3300048908 Ga0496105_0073130 Ga0496105_0073130_1196_2269 319
527 3300048908 Ga0496105_0082390 Ga0496105_0082390_1372_2445 319
528 3300048909 Ga0496106_0244351 Ga0496106_0244351_262_1335 319
529 3300048911 Ga0496108_0180566 Ga0496108_0180566_393_1466 319
530 3300048916 Ga0496113_0086884 Ga0496113_0086884_104_1177 319
531 3300048919 Ga0496116_0081596 Ga0496116_0081596_27_1100 319
532 3300048923 Ga0496120_0039898 Ga0496120_0039898_939_2012 319
533 3300048924 Ga0496121_0054703 Ga0496121_0054703_2228_3301 319
534 3300048924 Ga0496121_0200831 Ga0496121_0200831_213_1286 319
535 3300048924 Ga0496121_0236935 Ga0496121_0236935_82_1155 319
536 3300048928 Ga0496125_0004754 Ga0496125_0004754_10342_11415 319
537 3300048929 Ga0496126_0108955 Ga0496126_0108955_634_1707 319
538 3300048929 Ga0496126_0357417 Ga0496126_0357417_56_1129 319
539 3300050490 nmdc:mga03n38_9103_c1 nmdc:mga03n38_9103_c1_168_1241 319
540 3300050492 nmdc:mga0yw44_118577_c1 nmdc:mga0yw44_118577_c1_516_1589 319
541 3300050492 nmdc:mga0yw44_211379_c1 nmdc:mga0yw44_211379_c1_61_1134 319
542 3300050492 nmdc:mga0yw44_243365_c1 nmdc:mga0yw44_243365_c1_110_1183 319
543 3300050493 nmdc:mga0k408_8719_c1 nmdc:mga0k408_8719_c1_2043_3116 319
544 3300050494 nmdc:mga06z11_1910_c1 nmdc:mga06z11_1910_c1_2887_3960 319
545 3300050495 nmdc:mga04h51_14290_c1 nmdc:mga04h51_14290_c1_272_1345 319
546 3300050496 nmdc:mga07m45_7298_c1 nmdc:mga07m45_7298_c1_1757_2830 319
547 3300050512 nmdc:mga0n895_130152_c1 nmdc:mga0n895_130152_c1_134_1207 319
548 3300050513 nmdc:mga0rr50_277655_c1 nmdc:mga0rr50_277655_c1_246_1319 319
549 3300050516 nmdc:mga0sz30_4137_c1 nmdc:mga0sz30_4137_c1_3258_4331 319
550 3300053080 Ga0500635_0011224 Ga0500635_0011224_106_1179 319
551 3300053087 Ga0500643_000060 Ga0500643_000060_86755_87828 319
552 3300053093 Ga0500651_0079460 Ga0500651_0079460_95_1168 319
553 3300053094 Ga0500566_0000433 Ga0500566_0000433_5282_6355 319
554 3300053094 Ga0500566_0007612 Ga0500566_0007612_5251_6324 319
555 3300053095 Ga0500640_030286 Ga0500640_030286_1283_2356 319
556 3300053102 Ga0500554_005904 Ga0500554_005904_1304_2377 319
557 3300053103 Ga0500555_001513 Ga0500555_001513_4606_5679 319
558 3300053105 Ga0500557_000007 Ga0500557_000007_59483_60556 319
559 3300053108 Ga0500562_031312 Ga0500562_031312_170_1243 319
560 3300053109 Ga0500569_020939 Ga0500569_020939_323_1396 319
561 3300053109 Ga0500569_035451 Ga0500569_035451_138_1211 319
562 3300053119 Ga0500595_012205 Ga0500595_012205_937_2010 319
563 3300053125 Ga0500618_012220 Ga0500618_012220_835_1908 319
564 3300053130 Ga0500642_0000045 Ga0500642_0000045_7498_8571 319
565 3300053130 Ga0500642_0010800 Ga0500642_0010800_808_1881 319
566 3300053136 Ga0500559_0000490 Ga0500559_0000490_5617_6690 319
567 3300053138 Ga0500564_011638 Ga0500564_011638_1501_2574 319
568 3300053145 Ga0500586_000915 Ga0500586_000915_3651_4724 319
569 3300053158 Ga0500627_0040081 Ga0500627_0040081_271_1344 319
570 3300053177 Ga0500636_0006944 Ga0500636_0006944_4467_5540 319
571 3300053177 Ga0500636_0022256 Ga0500636_0022256_1491_2564 319
572 3300053178 Ga0500637_0010467 Ga0500637_0010467_616_1689 319
573 3300053178 Ga0500637_0082022 Ga0500637_0082022_314_1387 319
574 3300053729 Ga0500625_002900 Ga0500625_002900_1271_2344 319
575 3300053730 Ga0500645_043212 Ga0500645_043212_81_1154 319
576 3300053737 Ga0500601_000071 Ga0500601_000071_8123_9196 319
577 3300003215 JGI25153J46596_10005706 JGI25153J46596_100057066 320
578 3300005347 Ga0070668_100064069 Ga0070668_1000640693 320
579 3300005347 Ga0070668_100077400 Ga0070668_1000774002 320
580 3300005347 Ga0070668_100381582 Ga0070668_1003815821 320
581 3300005434 Ga0070709_10012724 Ga0070709_100127242 320
582 3300005441 Ga0070700_100175141 Ga0070700_1001751412 320
583 3300005548 Ga0070665_100190408 Ga0070665_1001904082 320
584 3300005719 Ga0068861_100323646 Ga0068861_1003236461 320
585 3300005844 Ga0068862_100154195 Ga0068862_1001541952 320
586 3300005981 Ga0081538_10032460 Ga0081538_100324602 320
587 3300010375 Ga0105239_10588883 Ga0105239_105888831 320
588 3300025297 Ga0209758_1065595 Ga0209758_10655951 320
589 3300025906 Ga0207699_10012867 Ga0207699_100128672 320
590 3300026067 Ga0207678_10303655 Ga0207678_103036552 320
591 3300028379 Ga0268266_10154932 Ga0268266_101549322 320
592 3300028379 Ga0268266_10223603 Ga0268266_102236032 320
593 3300028380 Ga0268265_10066069 Ga0268265_100660692 320
594 3300028380 Ga0268265_10123962 Ga0268265_101239622 320
595 3300028380 Ga0268265_10468347 Ga0268265_104683471 320
596 3300028381 Ga0268264_10268069 Ga0268264_102680692 320
597 3300028786 Ga0307517_10000154 Ga0307517_1000015411 320
598 3300031507 Ga0307509_10149046 Ga0307509_101490462 320
599 3300031824 Ga0307413_10057713 Ga0307413_100577132 320
600 3300031903 Ga0307407_10055024 Ga0307407_100550242 320
601 3300037418 Ga0395900_0120982 Ga0395900_0120982_1560_2633 320
602 3300046455 Ga0495603_0083870 Ga0495603_0083870_177_1250 320
603 3300046460 Ga0495638_0034645 Ga0495638_0034645_1001_2074 320
604 3300046474 Ga0495605_0101875 Ga0495605_0101875_79_1152 320
605 3300046500 Ga0495596_0031813 Ga0495596_0031813_881_1954 320
606 3300047443 Ga0495687_092213 Ga0495687_092213_17_1090 320
607 3300049460 Ga0495682_0023822 Ga0495682_0023822_319_1392 320
608 3300049574 Ga0501038_0164323 Ga0501038_0164323_10_1083 320
609 3300050492 nmdc:mga0yw44_35980_c1 nmdc:mga0yw44_35980_c1_753_1826 320
610 3300050507 nmdc:mga05p37_131547_c1 nmdc:mga05p37_131547_c1_48_1121 320
611 3300053087 Ga0500643_018539 Ga0500643_018539_620_1693 320
612 3300053098 Ga0500650_0031116 Ga0500650_0031116_532_1605 320
613 3300055283 Ga0500661_005718 Ga0500661_005718_104_1177 320
614 3300006058 Ga0075432_10010619 Ga0075432_100106192 321
615 3300013102 Ga0157371_10030941 Ga0157371_100309415 321
616 3300013104 Ga0157370_10067112 Ga0157370_100671123 321
617 3300013307 Ga0157372_10093667 Ga0157372_100936672 321
618 3300026078 Ga0207702_10547217 Ga0207702_105472171 321
619 3300049568 Ga0501031_0004326 Ga0501031_0004326_629_1699 321
620 3300049569 Ga0501032_0000235 Ga0501032_0000235_25372_26442 321
621 3300049570 Ga0501033_0000857 Ga0501033_0000857_6467_7537 321
622 3300049571 Ga0501034_0004374 Ga0501034_0004374_7993_9063 321
623 3300049572 Ga0501036_0000153 Ga0501036_0000153_13577_14647 321
624 3300049573 Ga0501037_0000261 Ga0501037_0000261_19062_20132 321
625 3300049574 Ga0501038_0002144 Ga0501038_0002144_3828_4898 321
626 3300049575 Ga0501039_0000161 Ga0501039_0000161_19839_20909 321
627 3300049579 Ga0501043_0000368 Ga0501043_0000368_20897_21967 321
628 3300049580 Ga0501046_0001142 Ga0501046_0001142_8491_9561 321
629 3300049581 Ga0501047_0000803 Ga0501047_0000803_11452_12522 321
630 3300049582 Ga0501048_0000727 Ga0501048_0000727_16342_17412 321
631 3300049586 Ga0501070_0000293 Ga0501070_0000293_20263_21333 321
632 3300049587 Ga0501071_0008990 Ga0501071_0008990_3688_4758 321
633 3300049590 Ga0501074_0013235 Ga0501074_0013235_4809_5879 321
634 3300049741 Ga0501079_0104189 Ga0501079_0104189_196_1266 321
635 3300049742 Ga0501080_0000149 Ga0501080_0000149_23386_24456 321
636 3300049822 Ga0501035_0000630 Ga0501035_0000630_24292_25362 321
637 3300049823 Ga0501044_0001013 Ga0501044_0001013_7312_8382 321
638 3300049824 Ga0501045_0014413 Ga0501045_0014413_598_1668 321
639 3300006042 Ga0075368_10016155 Ga0075368_100161552 322
640 3300025941 Ga0207711_10216709 Ga0207711_102167092 322
641 3300031250 Ga0265331_10071375 Ga0265331_100713752 322
642 3300031711 Ga0265314_10019152 Ga0265314_100191524 322
643 3300031712 Ga0265342_10011246 Ga0265342_100112463 322
644 3300036401 Ga0373937_0073505 Ga0373937_0073505_861_1934 322
645 3300047320 Ga0495672_0028729 Ga0495672_0028729_102_1175 322
646 3300047472 Ga0495686_0060038 Ga0495686_0060038_513_1586 322
647 3300048904 Ga0496101_0139653 Ga0496101_0139653_326_1399 322
648 3300048929 Ga0496126_0005826 Ga0496126_0005826_969_2042 322
649 3300048929 Ga0496126_0345309 Ga0496126_0345309_114_1187 322
650 3300049578 Ga0501042_0124527 Ga0501042_0124527_124_1197 322
651 3300049586 Ga0501070_0007703 Ga0501070_0007703_6966_8039 322
652 3300049587 Ga0501071_0291421 Ga0501071_0291421_101_1174 322
653 3300053142 Ga0500577_0005024 Ga0500577_0005024_976_2049 322
654 iso_pu_bacteria 2929199973 2929204983 322
655 3300006038 Ga0075365_10057128 Ga0075365_100571282 323
656 3300006048 Ga0075363_100050519 Ga0075363_1000505192 323
657 3300006186 Ga0075369_10033669 Ga0075369_100336692 323
658 3300031249 Ga0265339_10004949 Ga0265339_100049497 323
659 3300046460 Ga0495638_0003384 Ga0495638_0003384_1064_2137 323
660 3300046463 Ga0495653_0159842 Ga0495653_0159842_225_1298 323
661 3300046512 Ga0495610_0098976 Ga0495610_0098976_75_1148 323
662 3300046513 Ga0495616_0073376 Ga0495616_0073376_22_1095 323
663 3300046536 Ga0495587_0059760 Ga0495587_0059760_142_1215 323
664 3300046616 Ga0495668_0090678 Ga0495668_0090678_195_1268 323
665 3300046679 Ga0495623_0059057 Ga0495623_0059057_528_1601 323
666 3300046809 Ga0495600_0032362 Ga0495600_0032362_534_1607 323
667 3300047319 Ga0495674_0118923 Ga0495674_0118923_458_1531 323
668 3300047444 Ga0495675_0105392 Ga0495675_0105392_148_1221 323
669 3300048919 Ga0496116_0000507 Ga0496116_0000507_50862_51935 323
670 3300048920 Ga0496117_0068929 Ga0496117_0068929_498_1571 323
671 3300048924 Ga0496121_0018524 Ga0496121_0018524_1491_2564 323
672 3300048924 Ga0496121_0106915 Ga0496121_0106915_489_1562 323
673 3300048925 Ga0496122_0107819 Ga0496122_0107819_635_1708 323
674 3300048928 Ga0496125_0000341 Ga0496125_0000341_10771_11844 323
675 3300048929 Ga0496126_0126243 Ga0496126_0126243_503_1576 323
676 3300049568 Ga0501031_0014216 Ga0501031_0014216_2014_3129 323
677 3300049569 Ga0501032_0000252 Ga0501032_0000252_9301_10416 323
678 3300049570 Ga0501033_0000082 Ga0501033_0000082_57475_58590 323
679 3300049571 Ga0501034_0000577 Ga0501034_0000577_14830_15945 323
680 3300049572 Ga0501036_0002272 Ga0501036_0002272_12142_13257 323
681 3300049573 Ga0501037_0000636 Ga0501037_0000636_12855_13970 323
682 3300049574 Ga0501038_0000234 Ga0501038_0000234_35289_36404 323
683 3300049575 Ga0501039_0000123 Ga0501039_0000123_28060_29175 323
684 3300049579 Ga0501043_0001192 Ga0501043_0001192_9336_10451 323
685 3300049580 Ga0501046_0000434 Ga0501046_0000434_33116_34231 323
686 3300049581 Ga0501047_0000131 Ga0501047_0000131_65147_66262 323
687 3300049582 Ga0501048_0000170 Ga0501048_0000170_35281_36396 323
688 3300049583 Ga0501067_0000327 Ga0501067_0000327_11765_12880 323
689 3300049584 Ga0501068_0000080 Ga0501068_0000080_8312_9427 323
690 3300049588 Ga0501072_0000393 Ga0501072_0000393_734_1849 323
691 3300049589 Ga0501073_0000062 Ga0501073_0000062_35566_36681 323
692 3300049592 Ga0501076_0247726 Ga0501076_0247726_302_1417 323
693 3300049742 Ga0501080_0002104 Ga0501080_0002104_14830_15945 323
694 3300049744 Ga0501083_0000199 Ga0501083_0000199_18924_20039 323
695 3300049822 Ga0501035_0000123 Ga0501035_0000123_50226_51341 323
696 3300049823 Ga0501044_0000100 Ga0501044_0000100_98909_100024 323
697 3300050490 nmdc:mga03n38_134114_c1 nmdc:mga03n38_134114_c1_114_1187 323
698 3300050492 nmdc:mga0yw44_137871_c1 nmdc:mga0yw44_137871_c1_361_1434 323
699 3300050516 nmdc:mga0sz30_50119_c1 nmdc:mga0sz30_50119_c1_421_1494 323
700 3300053086 Ga0500578_0124247 Ga0500578_0124247_168_1241 323
701 3300053098 Ga0500650_0014961 Ga0500650_0014961_1307_2380 323
702 3300053104 Ga0500556_0001798 Ga0500556_0001798_5400_6473 323
703 3300053116 Ga0500592_001762 Ga0500592_001762_1455_2528 323
704 3300053130 Ga0500642_0000025 Ga0500642_0000025_124443_125516 323
705 3300053131 Ga0500652_002688 Ga0500652_002688_3863_4936 323
706 3300053139 Ga0500568_0017499 Ga0500568_0017499_1524_2597 323
707 3300053151 Ga0500604_0004699 Ga0500604_0004699_1409_2482 323
708 3300053153 Ga0500616_0000031 Ga0500616_0000031_195380_196453 323
709 3300053156 Ga0500622_0000112 Ga0500622_0000112_17690_18763 323
710 3300053158 Ga0500627_0027450 Ga0500627_0027450_82_1155 323
711 3300053727 Ga0500611_012197 Ga0500611_012197_162_1235 323
712 3300054114 Ga0501084_0011027 Ga0501084_0011027_5239_6354 323
713 3300060353 Ga0501082_0006842 Ga0501082_0006842_6985_8100 323
714 3300005455 Ga0070663_100095407 Ga0070663_1000954072 324
715 3300013306 Ga0163162_10032812 Ga0163162_100328124 324
716 3300014325 Ga0163163_10040222 Ga0163163_100402223 324
717 3300026067 Ga0207678_10140481 Ga0207678_101404812 324
718 3300031691 Ga0316579_10003937 Ga0316579_100039373 324
719 3300032133 Ga0316583_10001219 Ga0316583_100012193 324
720 3300036647 Ga0316582_0260087 Ga0316582_0260087_12_1082 324
721 3300037471 Ga0395905_0048924 Ga0395905_0048924_2777_3850 324
722 3300046690 Ga0495624_0017956 Ga0495624_0017956_177_1250 324
723 3300048907 Ga0496104_0043507 Ga0496104_0043507_2744_3817 324
724 3300048909 Ga0496106_0080730 Ga0496106_0080730_433_1506 324
725 3300048913 Ga0496110_0018247 Ga0496110_0018247_2234_3307 324
726 3300048915 Ga0496112_0097737 Ga0496112_0097737_595_1668 324
727 iso_pu_bacteria 2883577096 2883577804 324
728 3300005985 Ga0081539_10002100 Ga0081539_100021009 325
729 3300025915 Ga0207693_10015510 Ga0207693_100155103 325
730 iso_pu_bacteria 2828305725 2828309278 325
731 iso_pu_bacteria 8055909800 8055913088 325
732 3300003203 JGI25406J46586_10000098 JGI25406J46586_1000009813 326
733 3300005356 Ga0070674_100262231 Ga0070674_1002622311 326
734 3300005937 Ga0081455_10082635 Ga0081455_100826352 326
735 3300005985 Ga0081539_10000224 Ga0081539_1000022448 326
736 3300031901 Ga0307406_10379386 Ga0307406_103793861 326
737 iso_pu_bacteria 2842333319 2842335677 326
738 iso_pu_bacteria 2904690495 2904697352 326
739 3300005435 Ga0070714_100006003 Ga0070714_1000060034 327
740 3300005436 Ga0070713_100032660 Ga0070713_1000326601 327
741 3300005437 Ga0070710_10003837 Ga0070710_100038374 327
742 3300005439 Ga0070711_100005284 Ga0070711_1000052844 327
743 3300006028 Ga0070717_10007389 Ga0070717_100073894 327
744 3300006173 Ga0070716_100002714 Ga0070716_1000027145 327
745 3300007076 Ga0075435_100311532 Ga0075435_1003115321 327
746 3300009147 Ga0114129_10646588 Ga0114129_106465882 327
747 3300025898 Ga0207692_10166178 Ga0207692_101661782 327
748 3300025905 Ga0207685_10000370 Ga0207685_100003703 327
749 3300025906 Ga0207699_10011543 Ga0207699_100115432 327
750 3300025915 Ga0207693_10008819 Ga0207693_100088196 327
751 3300025916 Ga0207663_10003518 Ga0207663_100035184 327
752 3300025928 Ga0207700_10012590 Ga0207700_100125905 327
753 3300025929 Ga0207664_10025318 Ga0207664_100253183 327
754 3300025939 Ga0207665_10005550 Ga0207665_100055505 327
755 3300037418 Ga0395900_0081910 Ga0395900_0081910_1736_2794 327
756 3300037466 Ga0395898_0349966 Ga0395898_0349966_176_1234 327
757 3300048905 Ga0496102_0020797 Ga0496102_0020797_2701_3774 327
758 3300050512 nmdc:mga0n895_135097_c1 nmdc:mga0n895_135097_c1_951_2024 327
759 iso_pu_bacteria 2513237087 2513590600 327
760 iso_pu_bacteria 2507262055 2507510300 328
761 iso_pu_bacteria 2508501009 2508544310 328
762 iso_pu_bacteria 2508501042 2508697748 328
763 iso_pu_bacteria 2508501128 2509154045 328
764 iso_pu_bacteria 2511231028 2511400975 328
765 iso_pu_bacteria 2511231221 2512036053 328
766 iso_pu_bacteria 2513237092 2513628593 328
767 iso_pu_bacteria 2513237094 2513640295 328
768 iso_pu_bacteria 2513237095 2513648694 328
769 iso_pu_bacteria 2513237096 2513659079 328
770 iso_pu_bacteria 2513237098 2513677959 328
771 iso_pu_bacteria 2513237101 2513698943 328
772 iso_pu_bacteria 2513237102 2513705322 328
773 iso_pu_bacteria 2513237104 2513715972 328
774 iso_pu_bacteria 2513237137 2513862245 328
775 iso_pu_bacteria 2513237139 2513878639 328
776 iso_pu_bacteria 2513237141 2513893816 328
777 iso_pu_bacteria 2513237145 2513921342 328
778 iso_pu_bacteria 2513237161 2514013510 328
779 iso_pu_bacteria 2515154112 2515630503 328
780 iso_pu_bacteria 2517093001 2517105641 328
781 iso_pu_bacteria 2517572143 2517894226 328
782 iso_pu_bacteria 2522572158 2523107660 328
783 iso_pu_bacteria 2524023205 2524441708 328
784 iso_pu_bacteria 2524023210 2524466039 328
785 iso_pu_bacteria 2524023228 2524541858 328
786 iso_pu_bacteria 2528768022 2528855190 328
787 iso_pu_bacteria 2545555834 2545677944 328
788 iso_pu_bacteria 2597490356 2599103686 328
789 iso_pu_bacteria 2602042107 2603861323 328
790 iso_pu_bacteria 2617270735 2617349885 328
791 iso_pu_bacteria 2617270741 2617379240 328
792 iso_pu_bacteria 2643221651 2644287511 328
793 iso_pu_bacteria 2667528175 2671123534 328
794 iso_pu_bacteria 2721755755 2723847421 328
795 iso_pu_bacteria 2728368998 2728748665 328
796 iso_pu_bacteria 2744054633 2745075029 328
797 iso_pu_bacteria 2791355196 2793065810 328
798 iso_pu_bacteria 2791355197 2793071470 328
799 iso_pu_bacteria 2791355199 2793083693 328
800 iso_pu_bacteria 2802429603 2805917230 328
801 iso_pu_bacteria 2816332527 2818241890 328
802 iso_pu_bacteria 2824600985 2824606664 328
803 iso_pu_bacteria 2824609381 2824612461 328
804 iso_pu_bacteria 2824617872 2824621194 328
805 iso_pu_bacteria 2824626560 2824629693 328
806 iso_pu_bacteria 2824635225 2824637002 328
807 iso_pu_bacteria 2824644064 2824646015 328
808 iso_pu_bacteria 2824653114 2824656871 328
809 iso_pu_bacteria 2824661429 2824664640 328
810 iso_pu_bacteria 2824671348 2824673074 328
811 iso_pu_bacteria 2824679649 2824679975 328
812 iso_pu_bacteria 2824687955 2824689716 328
813 iso_pu_bacteria 2824696289 2824698745 328
814 iso_pu_bacteria 2824704595 2824709606 328
815 iso_pu_bacteria 2824714736 2824717362 328
816 iso_pu_bacteria 2824723954 2824725433 328
817 iso_pu_bacteria 2824732956 2824735400 328
818 iso_pu_bacteria 2824746037 2824749912 328
819 iso_pu_bacteria 2824753945 2824755339 328
820 iso_pu_bacteria 2824763712 2824771114 328
821 iso_pu_bacteria 2824773399 2824778426 328
822 iso_pu_bacteria 2838122688 2838125507 328
823 iso_pu_bacteria 2841941048 2841941830 328
824 iso_pu_bacteria 2841949485 2841951259 328
825 iso_pu_bacteria 2841957949 2841959175 328
826 iso_pu_bacteria 2841966195 2841968747 328
827 iso_pu_bacteria 2841974524 2841976054 328
828 iso_pu_bacteria 2841983080 2841989091 328
829 iso_pu_bacteria 2842038055 2842045220 328
830 iso_pu_bacteria 2842045827 2842049118 328
831 iso_pu_bacteria 2844315083 2844317440 328
832 iso_pu_bacteria 2846952575 2846957370 328
833 iso_pu_bacteria 2847930680 2847934223 328
834 iso_pu_bacteria 2847939898 2847944806 328
835 iso_pu_bacteria 2848858292 2848863305 328
836 iso_pu_bacteria 2849076700 2849080981 328
837 iso_pu_bacteria 2857509624 2857509661 328
838 iso_pu_bacteria 2857524615 2857530088 328
839 iso_pu_bacteria 2874590934 2874594835 328
840 iso_pu_bacteria 2874604998 2874609886 328
841 iso_pu_bacteria 2874612657 2874614175 328
842 iso_pu_bacteria 2874620515 2874620949 328
843 iso_pu_bacteria 2874628541 2874632834 328
844 iso_pu_bacteria 2874645413 2874646631 328
845 iso_pu_bacteria 2876761206 2876769500 328
846 iso_pu_bacteria 2876771140 2876774323 328
847 iso_pu_bacteria 2876808645 2876811161 328
848 iso_pu_bacteria 2876818435 2876822887 328
849 iso_pu_bacteria 2879074833 2879078478 328
850 iso_pu_bacteria 2879083081 2879086799 328
851 iso_pu_bacteria 2879099564 2879109873 328
852 iso_pu_bacteria 2879110137 2879114832 328
853 iso_pu_bacteria 2879127579 2879128908 328
854 iso_pu_bacteria 2879142872 2879144263 328
855 iso_pu_bacteria 2881364244 2881368040 328
856 iso_pu_bacteria 2881665667 2881672676 328
857 iso_pu_bacteria 2885366525 2885367502 328
858 iso_pu_bacteria 2885374607 2885377229 328
859 iso_pu_bacteria 2885383462 2885385791 328
860 iso_pu_bacteria 2885409591 2885414069 328
861 iso_pu_bacteria 2888378607 2888382133 328
862 iso_pu_bacteria 2888388044 2888388551 328
863 iso_pu_bacteria 2888419890 2888422738 328
864 iso_pu_bacteria 2889033259 2889042121 328
865 iso_pu_bacteria 2893066018 2893071691 328
866 iso_pu_bacteria 2897803580 2897807195 328
867 iso_pu_bacteria 2903727486 2903733180 328
868 iso_pu_bacteria 2903748898 2903754150 328
869 iso_pu_bacteria 2903768456 2903772814 328
870 iso_pu_bacteria 2904666416 2904667087 328
871 iso_pu_bacteria 2904711408 2904718795 328
872 iso_pu_bacteria 2906602504 2906604024 328
873 iso_pu_bacteria 2906610324 2906611038 328
874 iso_pu_bacteria 2906626472 2906628695 328
875 iso_pu_bacteria 2906635258 2906637148 328
876 iso_pu_bacteria 2906643746 2906647474 328
877 iso_pu_bacteria 2906660503 2906661835 328
878 iso_pu_bacteria 2908739725 2908744553 328
879 iso_pu_bacteria 2908756301 2908762316 328
880 iso_pu_bacteria 2908775508 2908778416 328
881 iso_pu_bacteria 2916178963 2916181820 328
882 iso_pu_bacteria 2919073203 2919076905 328
883 iso_pu_bacteria 2922361189 2922368667 328
884 iso_pu_bacteria 2922368715 2922372208 328
885 iso_pu_bacteria 2922386360 2922388685 328
886 iso_pu_bacteria 2922393267 2922399190 328
887 iso_pu_bacteria 2922425934 2922428275 328
888 iso_pu_bacteria 2929615660 2929616585 328
889 iso_pu_bacteria 2929624759 2929625329 328
890 iso_pu_bacteria 2932784394 2932786737 328
891 iso_pu_bacteria 2932794094 2932798858 328
892 iso_pu_bacteria 2932801729 2932803540 328
893 iso_pu_bacteria 2932809354 2932817895 328
894 iso_pu_bacteria 2932818245 2932827292 328
895 iso_pu_bacteria 2932828146 2932837431 328
896 iso_pu_bacteria 2933577622 2933578132 328
897 iso_pu_bacteria 2935608549 2935610781 328
898 iso_pu_bacteria 2935616580 2935624889 328
899 iso_pu_bacteria 2935630451 2935635891 328
900 iso_pu_bacteria 2935638405 2935646869 328
901 iso_pu_bacteria 2935648319 2935654554 328
902 iso_pu_bacteria 2935656913 2935663434 328
903 iso_pu_bacteria 2935665750 2935671338 328
904 iso_pu_bacteria 2935675223 2935684369 328
905 iso_pu_bacteria 2935684952 2935692002 328
906 iso_pu_bacteria 2935694250 2935695054 328
907 iso_pu_bacteria 2935703347 2935707975 328
908 iso_pu_bacteria 2935713505 2935721841 328
909 iso_pu_bacteria 2935722832 2935731161 328
910 iso_pu_bacteria 2935732158 2935738977 328
911 iso_pu_bacteria 2935741537 2935747838 328
912 iso_pu_bacteria 2935750917 2935756422 328
913 iso_pu_bacteria 2935760218 2935761595 328
914 iso_pu_bacteria 2935769743 2935774419 328
915 iso_pu_bacteria 2935777560 2935783458 328
916 iso_pu_bacteria 2935785616 2935790562 328
917 iso_pu_bacteria 2935793552 2935799030 328
918 iso_pu_bacteria 2935801545 2935804902 328
919 iso_pu_bacteria 2935810662 2935812088 328
920 iso_pu_bacteria 2935819856 2935820265 328
921 iso_pu_bacteria 2935827899 2935836136 328
922 iso_pu_bacteria 2935837841 2935846929 328
923 iso_pu_bacteria 2935847175 2935849725 328
924 iso_pu_bacteria 2935855204 2935863520 328
925 iso_pu_bacteria 2935864058 2935872723 328
926 iso_pu_bacteria 2935873716 2935882664 328
927 iso_pu_bacteria 2935883170 2935889263 328
928 iso_pu_bacteria 2935908558 2935915989 328
929 iso_pu_bacteria 2935916978 2935919138 328
930 iso_pu_bacteria 2935926038 2935933392 328
931 iso_pu_bacteria 2935934488 2935941877 328
932 iso_pu_bacteria 2935942939 2935950267 328
933 iso_pu_bacteria 2935951376 2935958883 328
934 iso_pu_bacteria 2935959822 2935966043 328
935 iso_pu_bacteria 2935967501 2935970308 328
936 iso_pu_bacteria 2935975950 2935979812 328
937 iso_pu_bacteria 2935984226 2935992022 328
938 iso_pu_bacteria 2935992306 2935997507 328
939 iso_pu_bacteria 2936002035 2936005286 328
940 iso_pu_bacteria 2936011229 2936017633 328
941 iso_pu_bacteria 2936019824 2936026136 328
942 iso_pu_bacteria 2936028420 2936034934 328
943 iso_pu_bacteria 2936037263 2936038682 328
944 iso_pu_bacteria 2936046547 2936053035 328
945 iso_pu_bacteria 2936055302 2936061895 328
946 iso_pu_bacteria 2940556831 2940562336 328
947 iso_pu_bacteria 2941507105 2941512522 328
948 iso_pu_bacteria 2941515067 2941520223 328
949 iso_pu_bacteria 2941523033 2941528381 328
950 iso_pu_bacteria 2941531003 2941535227 328
951 iso_pu_bacteria 2941538514 2941539560 328
952 iso_pu_bacteria 3005474847 3005478260 328
953 iso_pu_bacteria 3005483717 3005486589 328
954 iso_pu_bacteria 3005506211 3005512262 328
955 iso_pu_bacteria 3005587118 3005593582 328
956 iso_pu_bacteria 3005594810 3005597160 328
957 iso_pu_bacteria 3005710791 3005713195 328
958 iso_pu_bacteria 3005718088 3005720558 328
959 iso_pu_bacteria 641522639 641642532 328
960 iso_pu_bacteria 643348564 643598080 328
961 iso_pu_bacteria 8006926726 8006933378 328
962 iso_pu_bacteria 8006933436 8006942957 328
963 iso_pu_bacteria 8006964411 8006969842 328
964 iso_pu_bacteria 8006973647 8006982677 328
965 iso_pu_bacteria 8006984368 8006990474 328
966 iso_pu_bacteria 8006994254 8006994417 328
967 iso_pu_bacteria 8016511872 8016515504 328
968 iso_pu_bacteria 8016539877 8016540943 328
969 iso_pu_bacteria 8016548790 8016552305 328
970 iso_pu_bacteria 8016557553 8016560692 328
971 iso_pu_bacteria 8016566248 8016566332 328
972 iso_pu_bacteria 8016575299 8016579088 328
973 iso_pu_bacteria 8016583857 8016590503 328
974 iso_pu_bacteria 8016595262 8016598574 328
975 iso_pu_bacteria 8016603502 8016612531 328
976 iso_pu_bacteria 8016613128 8016621282 328
977 iso_pu_bacteria 8016622563 8016628744 328
978 iso_pu_bacteria 8016630954 8016632884 328
979 iso_pu_bacteria 8017057580 8017060979 328
980 iso_pu_bacteria 8019530166 8019536368 328
981 iso_pu_bacteria 8019547302 8019555830 328
982 iso_pu_bacteria 8019555841 8019558747 328
983 iso_pu_bacteria 8019565922 8019566562 328
984 iso_pu_bacteria 8019576017 8019580420 328
985 iso_pu_bacteria 8019586578 8019588144 328
986 iso_pu_bacteria 8019597564 8019603198 328
987 iso_pu_bacteria 8019648815 8019656167 328
988 iso_pu_bacteria 8019659431 8019664073 328
989 iso_pu_bacteria 8019668869 8019673683 328
990 iso_pu_bacteria 8019678201 8019682444 328
991 iso_pu_bacteria 8019687851 8019688089 328
992 iso_pu_bacteria 8054002106 8054002644 328
993 iso_pu_bacteria 8055742211 8055748231 328
994 iso_pu_bacteria 8056673599 8056681155 328
995 iso_pu_bacteria 8056681323 8056684391 328
996 iso_pu_bacteria 8056689827 8056694339 328
997 iso_pu_bacteria 8056967851 8056969041 328
998 3300031728 Ga0316578_10007661 Ga0316578_100076614 330
999 3300035398 Ga0316574_0004370 Ga0316574_0004370_6047_7120 330
1000 3300036712 Ga0316584_0000478 Ga0316584_0000478_13246_14319 330
1001 3300013102 Ga0157371_10138509 Ga0157371_101385092 331
1002 3300013104 Ga0157370_10204169 Ga0157370_102041692 331
1003 3300025919 Ga0207657_10021011 Ga0207657_100210115 331
1004 3300026041 Ga0207639_10046162 Ga0207639_100461622 331
1005 3300053153 Ga0500616_0000034 Ga0500616_0000034_46994_48064 331
1006 3300003215 JGI25153J46596_10014449 JGI25153J46596_100144492 332
1007 3300005262 Ga0065165_1022054 Ga0065165_10220542 332
1008 3300005434 Ga0070709_10012015 Ga0070709_100120153 332
1009 3300005435 Ga0070714_100003971 Ga0070714_10000397110 332
1010 3300005436 Ga0070713_100006762 Ga0070713_1000067626 332
1011 3300005436 Ga0070713_100023073 Ga0070713_1000230732 332
1012 3300005437 Ga0070710_10011932 Ga0070710_100119322 332
1013 3300005437 Ga0070710_10091643 Ga0070710_100916432 332
1014 3300005530 Ga0070679_100152798 Ga0070679_1001527982 332
1015 3300005563 Ga0068855_100147364 Ga0068855_1001473642 332
1016 3300005937 Ga0081455_10005477 Ga0081455_1000547716 332
1017 3300005937 Ga0081455_10034747 Ga0081455_100347472 332
1018 3300006163 Ga0070715_10012959 Ga0070715_100129592 332
1019 3300006175 Ga0070712_100020073 Ga0070712_1000200733 332
1020 3300006186 Ga0075369_10047843 Ga0075369_100478432 332
1021 3300013104 Ga0157370_10409101 Ga0157370_104091012 332
1022 3300025297 Ga0209758_1000482 Ga0209758_100048240 332
1023 3300025898 Ga0207692_10001716 Ga0207692_100017163 332
1024 3300025898 Ga0207692_10069322 Ga0207692_100693222 332
1025 3300025906 Ga0207699_10008612 Ga0207699_100086124 332
1026 3300025915 Ga0207693_10025336 Ga0207693_100253363 332
1027 3300025916 Ga0207663_10000668 Ga0207663_100006685 332
1028 3300025921 Ga0207652_10212412 Ga0207652_102124122 332
1029 3300025929 Ga0207664_10064839 Ga0207664_100648393 332
1030 3300025939 Ga0207665_10004713 Ga0207665_100047133 332
1031 3300025939 Ga0207665_10063280 Ga0207665_100632802 332
1032 3300035695 Ga0373927_0055373 Ga0373927_0055373_521_1594 332
1033 3300048909 Ga0496106_0089882 Ga0496106_0089882_952_2025 332
1034 3300048910 Ga0496107_0102341 Ga0496107_0102341_965_2038 332
1035 3300049571 Ga0501034_0226288 Ga0501034_0226288_404_1477 332
1036 3300049574 Ga0501038_0251549 Ga0501038_0251549_12_1085 332
1037 3300049580 Ga0501046_0221752 Ga0501046_0221752_257_1330 332
1038 3300049581 Ga0501047_0188753 Ga0501047_0188753_316_1389 332
1039 3300049822 Ga0501035_0185989 Ga0501035_0185989_431_1504 332
1040 3300053111 Ga0500572_000629 Ga0500572_000629_9003_10076 332
1041 3300053136 Ga0500559_0009309 Ga0500559_0009309_2227_3300 332
1042 3300001977 JGI24746J21847_1002679 JGI24746J21847_10026792 333
1043 3300006038 Ga0075365_10090014 Ga0075365_100900142 333
1044 3300046664 Ga0495659_0087958 Ga0495659_0087958_23_1087 333
1045 3300048907 Ga0496104_0397463 Ga0496104_0397463_143_1207 333
1046 3300048908 Ga0496105_0010496 Ga0496105_0010496_3872_4936 333
1047 3300048918 Ga0496115_0123862 Ga0496115_0123862_41_1105 333

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

63

337

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lb8-assembly1.cif.gz_B structure of a ferrichrome importer fhucdb from e. coli 0.3083 37 304
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.2907 37 320
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.2877 37 320
7voj-assembly1.cif.gz_B al-bound structure of the atalmt1 mutant m60a 0.2678 28 248
3vvn-assembly1.cif.gz_A crystal structure of mate in the straight conformation 0.2626 36 311
ID Description Score Start End Superfamily
af_Q58666_4_320_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7248 29 310 1.10.3470.10
af_P32720_52_318_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6541 52 305 1.10.3470.10
af_Q58666_4_320_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6488 29 310 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6479 40 310 1.10.3470.10
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6456 52 306 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A3B9A437-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9423 53 333 GO:0005886
GO:0015658
AF-A0A535BF59-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9401 93 320 GO:0005886
GO:0015658
AF-A0A1F9D8M3-F1-model_v4 ABC transporter permease 0.9352 24 327 GO:0005886
GO:0015658
AF-A0A2D9HWN8-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.933 21 333 GO:0005886
GO:0015658
AF-A0A7Y5HYS6-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9326 70 333 GO:0005886
GO:0015658

Feature Viewer

pLDDT pTM Quality
81.36 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map