F488834

General Info

Members Datasets Scaffolds Average Seq Length
1041 414 2082 86

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10013961|Ga0105239_100139615
Length 95
Sequence VESHAEFLRAVTLDEGLADAIYKGEWRTADITDAERVMLSYVETLTKHPARVQREDLDDLRAAGFDDKAILQINLIASWFNYINRVADGLGVGRE

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
90 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
91 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
92 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
93 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
106 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
107 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
122 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
123 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
124 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
125 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
134 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
138 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
141 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
142 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
143 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
144 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
145 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
146 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
217 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
218 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
219 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
223 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
224 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
230 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
231 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
232 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
233 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
234 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
235 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
236 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
237 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
238 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
239 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
240 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
241 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
242 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
243 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
244 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
245 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
246 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
247 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
248 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
249 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
250 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
251 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
252 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
253 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
254 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
255 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
256 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
257 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
258 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
259 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
260 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
261 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
262 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
263 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
264 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
265 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
266 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
267 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
268 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
269 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
270 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
271 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
272 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
273 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
274 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
275 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
276 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
277 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
278 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
279 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
280 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
281 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
282 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
283 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
284 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
285 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
286 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
287 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
288 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
289 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
290 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
291 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
292 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
293 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
294 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
295 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
296 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
297 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
298 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
299 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
300 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
301 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
302 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
303 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
304 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
305 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
306 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
307 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
308 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
309 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
310 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
311 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
312 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
313 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
314 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
315 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
316 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
317 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
318 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
319 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
320 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
321 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
322 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
323 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
324 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
325 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
326 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
327 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
328 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
329 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
330 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
331 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
332 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
333 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
334 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
335 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
336 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
337 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
338 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
339 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
340 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
341 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
342 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
343 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
344 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
345 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
346 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
352 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
353 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
354 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
355 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
356 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
357 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
358 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
359 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
360 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
361 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
362 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
363 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
364 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
365 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
366 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
367 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
368 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
369 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
370 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
371 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
372 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
373 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
374 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
375 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
376 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
377 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
378 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
379 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
380 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
381 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
382 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
383 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
384 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
385 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
386 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
387 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
388 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
389 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
390 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
391 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
392 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
393 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
394 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
395 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
396 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
397 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
398 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
399 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
400 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
401 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
402 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
403 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
404 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
405 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
406 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
407 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
408 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
409 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
410 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
411 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
414 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.94
Metatranscriptomes 1.06
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 0
Rhizoplane 3.75
Rhizosphere 95
Stem 0
Stem Tuber 0
Unclassified 5.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10013961 3300010375 Bacteria 8919
2 JGI24752J21851_1001370 3300001976 Bacteria 3293
3 JGI24737J22298_10064035 3300001990 Bacteria 1103
4 JGI24743J22301_10013372 3300001991 Bacteria 1502
5 JGI24738J21930_10021070 3300002075 Bacteria 1353
6 JGI24749J21850_1006675 3300002076 Bacteria 1605
7 JGI24749J21850_1042097 3300002076 Bacteria 670
8 JGI24033J26618_1029825 3300002155 Bacteria 730
9 JGI24751J29686_10032319 3300002459 Bacteria 1085
10 JGI26145J50221_1005361 3300003371 Bacteria 1053
11 Ga0065712_10523892 3300005290 Bacteria 634
12 Ga0065715_10004356 3300005293 Bacteria 3575
13 Ga0065715_10008776 3300005293 Bacteria 4034
14 Ga0065715_10516458 3300005293 Bacteria 767
15 Ga0065715_10763570 3300005293 Bacteria 625
16 Ga0065707_10153382 3300005295 Bacteria 1634
17 Ga0065707_10282636 3300005295 Bacteria 1044
18 Ga0065707_10552181 3300005295 Bacteria 720
19 Ga0065707_11153193 3300005295 Bacteria 504
20 Ga0070658_11064371 3300005327 Bacteria 703
21 Ga0070676_10029914 3300005328 Bacteria 3101
22 Ga0070683_100008333 3300005329 Bacteria 8807
23 Ga0070683_100013335 3300005329 Bacteria 7166
24 Ga0070690_100000510 3300005330 Bacteria 19462
25 Ga0070690_100003500 3300005330 Bacteria 8593
26 Ga0070690_100308327 3300005330 Bacteria 1137
27 Ga0070690_100777523 3300005330 Bacteria 741
28 Ga0070670_100045108 3300005331 Bacteria 3789
29 Ga0070670_100229888 3300005331 Bacteria 1614
30 Ga0070677_10010578 3300005333 Bacteria 3160
31 Ga0068869_100062281 3300005334 Bacteria 2738
32 Ga0068869_100211759 3300005334 Bacteria 1532
33 Ga0068869_100387819 3300005334 Bacteria 1146
34 Ga0070666_10206887 3300005335 Bacteria 1381
35 Ga0070680_100026533 3300005336 Bacteria 4633
36 Ga0070680_100707312 3300005336 Bacteria 867
37 Ga0070682_100005322 3300005337 Bacteria 7162
38 Ga0070682_100211003 3300005337 Bacteria 1376
39 Ga0070682_101528907 3300005337 Unclassified 575
40 Ga0068868_100046695 3300005338 Bacteria 3390
41 Ga0068868_100356494 3300005338 Bacteria 1254
42 Ga0070660_100271769 3300005339 Bacteria 1385
43 Ga0070689_100000221 3300005340 Bacteria 34041
44 Ga0070689_100005017 3300005340 Bacteria 8994
45 Ga0070689_100008986 3300005340 Bacteria 7073
46 Ga0070689_100057437 3300005340 Bacteria 3020
47 Ga0070691_10286931 3300005341 Bacteria 895
48 Ga0070687_100009239 3300005343 Bacteria 4216
49 Ga0070687_100079958 3300005343 Bacteria 1781
50 Ga0070687_100196716 3300005343 Bacteria 1219
51 Ga0070687_101118217 3300005343 Bacteria 577
52 Ga0070687_101428988 3300005343 Bacteria 518
53 Ga0070661_100002326 3300005344 Bacteria 13050
54 Ga0070661_100147615 3300005344 Bacteria 1776
55 Ga0070692_10048014 3300005345 Bacteria 2210
56 Ga0070668_100044449 3300005347 Bacteria 3407
57 Ga0070668_100814044 3300005347 Bacteria 830
58 Ga0070669_100155963 3300005353 Bacteria 1770
59 Ga0070669_100259263 3300005353 Bacteria 1387
60 Ga0070669_101886076 3300005353 Bacteria 522
61 Ga0070675_100051224 3300005354 Bacteria 3392
62 Ga0070675_100304234 3300005354 Bacteria 1405
63 Ga0070675_100935287 3300005354 Bacteria 795
64 Ga0070675_101590376 3300005354 Bacteria 603
65 Ga0070671_100058014 3300005355 Bacteria 3222
66 Ga0070671_100394526 3300005355 Bacteria 1183
67 Ga0070674_100873608 3300005356 Bacteria 781
68 Ga0070673_100012713 3300005364 Bacteria 5790
69 Ga0070673_100100683 3300005364 Bacteria 2379
70 Ga0070673_100227981 3300005364 Bacteria 1615
71 Ga0070673_101147523 3300005364 Bacteria 727
72 Ga0070673_101796664 3300005364 Bacteria 581
73 Ga0070688_100009648 3300005365 Bacteria 5293
74 Ga0070688_100102589 3300005365 Bacteria 1888
75 Ga0070688_100945422 3300005365 Bacteria 682
76 Ga0070688_101465350 3300005365 Bacteria 555
77 Ga0070688_101557545 3300005365 Bacteria 539
78 Ga0070659_100009440 3300005366 Bacteria 7164
79 Ga0070659_100040700 3300005366 Bacteria 3631
80 Ga0070667_100001438 3300005367 Bacteria 21358
81 Ga0070667_100325115 3300005367 Bacteria 1388
82 Ga0070703_10001454 3300005406 Bacteria 7138
83 Ga0070703_10156904 3300005406 Bacteria 860
84 Ga0070709_10011844 3300005434 Bacteria 4870
85 Ga0070709_10508510 3300005434 Bacteria 916
86 Ga0070709_10910026 3300005434 Bacteria 696
87 Ga0070709_11459082 3300005434 Bacteria 555
88 Ga0070709_11525372 3300005434 Bacteria 543
89 Ga0070714_100006947 3300005435 Bacteria 8775
90 Ga0070714_100028956 3300005435 Unclassified 4600
91 Ga0070714_100090916 3300005435 Bacteria 2674
92 Ga0070714_100374660 3300005435 Bacteria 1341
93 Ga0070713_100001561 3300005436 Bacteria 14655
94 Ga0070713_100009794 3300005436 Bacteria 6888
95 Ga0070713_100010487 3300005436 Bacteria 6694
96 Ga0070713_100010661 3300005436 Bacteria 6652
97 Ga0070713_100081836 3300005436 Bacteria 2756
98 Ga0070713_100090717 3300005436 Bacteria 2627
99 Ga0070713_100243350 3300005436 Bacteria 1639
100 Ga0070713_102133380 3300005436 Bacteria 543
101 Ga0070710_10061410 3300005437 Unclassified 2140
102 Ga0070710_10062865 3300005437 Bacteria 2119
103 Ga0070710_11111247 3300005437 Bacteria 581
104 Ga0070701_10011441 3300005438 Bacteria 3967
105 Ga0070701_10068288 3300005438 Bacteria 1893
106 Ga0070701_10199315 3300005438 Bacteria 1182
107 Ga0070701_11079784 3300005438 Bacteria 564
108 Ga0070701_11176672 3300005438 Bacteria 543
109 Ga0070711_100000024 3300005439 Bacteria 117125
110 Ga0070711_100017593 3300005439 Unclassified 4553
111 Ga0070711_100029735 3300005439 Bacteria 3609
112 Ga0070711_100321417 3300005439 Bacteria 1236
113 Ga0070711_100368082 3300005439 Bacteria 1159
114 Ga0070711_101873368 3300005439 Bacteria 527
115 Ga0070705_100008261 3300005440 Bacteria 5151
116 Ga0070705_100042749 3300005440 Bacteria 2592
117 Ga0070705_100101795 3300005440 Bacteria 1815
118 Ga0070705_100107511 3300005440 Bacteria 1775
119 Ga0070705_100115691 3300005440 Bacteria 1722
120 Ga0070705_100518894 3300005440 Bacteria 908
121 Ga0070705_101746282 3300005440 Bacteria 527
122 Ga0070700_100174924 3300005441 Bacteria 1489
123 Ga0070700_100531430 3300005441 Bacteria 910
124 Ga0070700_101255562 3300005441 Bacteria 621
125 Ga0070694_100021036 3300005444 Bacteria 4165
126 Ga0070694_100294507 3300005444 Bacteria 1241
127 Ga0070694_101152994 3300005444 Bacteria 648
128 Ga0070708_100005024 3300005445 Bacteria 10466
129 Ga0070708_100486703 3300005445 Bacteria 1164
130 Ga0070708_100934144 3300005445 Bacteria 814
131 Ga0070708_100984936 3300005445 Bacteria 791
132 Ga0070663_100003824 3300005455 Bacteria 8764
133 Ga0070663_100006350 3300005455 Bacteria 7099
134 Ga0070662_100066219 3300005457 Bacteria 2650
135 Ga0070662_100853997 3300005457 Bacteria 775
136 Ga0070681_10000628 3300005458 Bacteria 28955
137 Ga0070681_10056908 3300005458 Bacteria 3890
138 Ga0068867_100383811 3300005459 Bacteria 1181
139 Ga0068867_101676161 3300005459 Bacteria 596
140 Ga0068867_101888106 3300005459 Bacteria 563
141 Ga0070685_10001512 3300005466 Bacteria 12248
142 Ga0070685_10440997 3300005466 Bacteria 910
143 Ga0070685_10883456 3300005466 Bacteria 664
144 Ga0070685_10935014 3300005466 Bacteria 647
145 Ga0070706_100015419 3300005467 Bacteria 7059
146 Ga0070706_100071990 3300005467 Bacteria 3198
147 Ga0070706_100255836 3300005467 Bacteria 1635
148 Ga0070706_100281468 3300005467 Bacteria 1552
149 Ga0070706_100752241 3300005467 Bacteria 903
150 Ga0070706_101285815 3300005467 Bacteria 671
151 Ga0070706_101624609 3300005467 Unclassified 589
152 Ga0070707_100011239 3300005468 Bacteria 8345
153 Ga0070707_100013201 3300005468 Bacteria 7721
154 Ga0070707_100045096 3300005468 Bacteria 4220
155 Ga0070707_100800838 3300005468 Bacteria 906
156 Ga0070707_101329829 3300005468 Bacteria 685
157 Ga0070698_100013918 3300005471 Bacteria 8509
158 Ga0070698_100241731 3300005471 Bacteria 1739
159 Ga0070699_100002636 3300005518 Bacteria 16022
160 Ga0070699_100012511 3300005518 Bacteria 7324
161 Ga0070699_100033105 3300005518 Bacteria 4465
162 Ga0070699_100264416 3300005518 Bacteria 1539
163 Ga0070699_101149333 3300005518 Bacteria 712
164 Ga0070679_100004322 3300005530 Bacteria 13117
165 Ga0070679_100010597 3300005530 Bacteria 8748
166 Ga0070684_100000714 3300005535 Bacteria 23012
167 Ga0070684_100019008 3300005535 Bacteria 5676
168 Ga0070684_100213922 3300005535 Bacteria 1757
169 Ga0070697_100000085 3300005536 Bacteria 77098
170 Ga0070697_100002034 3300005536 Bacteria 15482
171 Ga0070697_100032421 3300005536 Bacteria 4205
172 Ga0070697_100080438 3300005536 Bacteria 2684
173 Ga0070697_100598466 3300005536 Bacteria 969
174 Ga0070697_101052304 3300005536 Bacteria 724
175 Ga0070697_101769229 3300005536 Bacteria 553
176 Ga0068853_100025908 3300005539 Bacteria 4922
177 Ga0068853_101512769 3300005539 Bacteria 650
178 Ga0070672_100001813 3300005543 Bacteria 13343
179 Ga0070672_100005505 3300005543 Bacteria 8398
180 Ga0070672_100271080 3300005543 Bacteria 1433
181 Ga0070686_100015653 3300005544 Bacteria 4399
182 Ga0070686_100025551 3300005544 Bacteria 3555
183 Ga0070686_100028153 3300005544 Bacteria 3406
184 Ga0070686_100085494 3300005544 Bacteria 2098
185 Ga0070686_100192087 3300005544 Bacteria 1458
186 Ga0070686_100233317 3300005544 Bacteria 1336
187 Ga0070695_100001515 3300005545 Bacteria 12905
188 Ga0070695_100210977 3300005545 Bacteria 1394
189 Ga0070695_100243808 3300005545 Bacteria 1305
190 Ga0070695_100499311 3300005545 Bacteria 941
191 Ga0070695_101620330 3300005545 Bacteria 540
192 Ga0070696_100031072 3300005546 Bacteria 3659
193 Ga0070696_100054927 3300005546 Unclassified 2777
194 Ga0070696_100120987 3300005546 Bacteria 1895
195 Ga0070696_100259999 3300005546 Bacteria 1316
196 Ga0070696_100402370 3300005546 Bacteria 1071
197 Ga0070696_101541828 3300005546 Bacteria 570
198 Ga0070696_101793076 3300005546 Bacteria 530
199 Ga0070693_100000261 3300005547 Bacteria 24757
200 Ga0070693_100024362 3300005547 Bacteria 3245
201 Ga0070693_100042884 3300005547 Bacteria 2552
202 Ga0070693_100050270 3300005547 Bacteria 2382
203 Ga0070693_100150658 3300005547 Bacteria 1473
204 Ga0070665_100032977 3300005548 Bacteria 5211
205 Ga0070665_101994389 3300005548 Bacteria 586
206 Ga0070665_102235481 3300005548 Bacteria 550
207 Ga0070704_100010849 3300005549 Bacteria 5558
208 Ga0070704_100122050 3300005549 Bacteria 2004
209 Ga0070704_100148379 3300005549 Bacteria 1841
210 Ga0070704_100165684 3300005549 Bacteria 1752
211 Ga0070704_100190219 3300005549 Bacteria 1649
212 Ga0070704_100202319 3300005549 Bacteria 1604
213 Ga0070704_100238899 3300005549 Bacteria 1486
214 Ga0070704_100256378 3300005549 Bacteria 1439
215 Ga0070704_100295663 3300005549 Bacteria 1347
216 Ga0070704_100374327 3300005549 Bacteria 1208
217 Ga0070704_100505100 3300005549 Bacteria 1050
218 Ga0070704_101242983 3300005549 Bacteria 680
219 Ga0068855_100010248 3300005563 Bacteria 11299
220 Ga0068855_100883630 3300005563 Bacteria 945
221 Ga0070664_100009531 3300005564 Bacteria 7874
222 Ga0070664_100113012 3300005564 Bacteria 2372
223 Ga0070664_100143895 3300005564 Bacteria 2101
224 Ga0070664_101271309 3300005564 Bacteria 695
225 Ga0068857_100000458 3300005577 Bacteria 29155
226 Ga0068857_100003244 3300005577 Bacteria 13510
227 Ga0068857_100079845 3300005577 Bacteria 2921
228 Ga0068854_101050209 3300005578 Bacteria 724
229 Ga0068856_100036812 3300005614 Bacteria 4798
230 Ga0068856_100083255 3300005614 Bacteria 3176
231 Ga0068856_101008307 3300005614 Bacteria 851
232 Ga0068856_101862338 3300005614 Bacteria 613
233 Ga0070702_100379355 3300005615 Bacteria 1005
234 Ga0068852_100067100 3300005616 Bacteria 3136
235 Ga0068852_100373448 3300005616 Bacteria 1397
236 Ga0068852_100558294 3300005616 Bacteria 1146
237 Ga0068852_100728739 3300005616 Bacteria 1003
238 Ga0068852_101537808 3300005616 Bacteria 688
239 Ga0068859_100007767 3300005617 Bacteria 10891
240 Ga0068859_100008839 3300005617 Bacteria 10174
241 Ga0068859_100018202 3300005617 Bacteria 7062
242 Ga0068859_100067372 3300005617 Bacteria 3614
243 Ga0068859_100068388 3300005617 Bacteria 3586
244 Ga0068859_100089904 3300005617 Bacteria 3121
245 Ga0068859_100101560 3300005617 Bacteria 2933
246 Ga0068859_100177776 3300005617 Bacteria 2210
247 Ga0068859_100699792 3300005617 Bacteria 1104
248 Ga0068859_101569576 3300005617 Bacteria 727
249 Ga0068864_100139680 3300005618 Bacteria 2184
250 Ga0068864_100159646 3300005618 Bacteria 2049
251 Ga0068864_100303956 3300005618 Bacteria 1494
252 Ga0068864_100527927 3300005618 Bacteria 1139
253 Ga0068864_101204912 3300005618 Bacteria 756
254 Ga0068864_101349801 3300005618 Bacteria 714
255 Ga0068866_10001785 3300005718 Bacteria 9055
256 Ga0068866_10053636 3300005718 Bacteria 2062
257 Ga0068866_10840811 3300005718 Bacteria 641
258 Ga0068861_100008366 3300005719 Bacteria 7118
259 Ga0068861_100322022 3300005719 Bacteria 1347
260 Ga0068861_100528084 3300005719 Bacteria 1071
261 Ga0068861_101430805 3300005719 Bacteria 676
262 Ga0068851_10021757 3300005834 Bacteria 3115
263 Ga0068870_10002068 3300005840 Bacteria 8302
264 Ga0068870_10053717 3300005840 Bacteria 2140
265 Ga0068870_10127123 3300005840 Bacteria 1476
266 Ga0068863_100003714 3300005841 Bacteria 15098
267 Ga0068863_100003751 3300005841 Bacteria 15034
268 Ga0068863_100104785 3300005841 Bacteria 2690
269 Ga0068863_100139177 3300005841 Bacteria 2319
270 Ga0068863_100262781 3300005841 Bacteria 1669
271 Ga0068863_100329362 3300005841 Bacteria 1485
272 Ga0068863_100571377 3300005841 Bacteria 1117
273 Ga0068863_100595977 3300005841 Bacteria 1093
274 Ga0068863_101737895 3300005841 Bacteria 633
275 Ga0068858_100004561 3300005842 Bacteria 13564
276 Ga0068858_100011407 3300005842 Bacteria 8390
277 Ga0068858_100067611 3300005842 Bacteria 3310
278 Ga0068858_100203252 3300005842 Bacteria 1874
279 Ga0068858_100231134 3300005842 Bacteria 1753
280 Ga0068860_100003387 3300005843 Bacteria 16400
281 Ga0068860_100008434 3300005843 Bacteria 10264
282 Ga0068860_100087609 3300005843 Bacteria 2964
283 Ga0068860_100486514 3300005843 Bacteria 1230
284 Ga0068860_101117852 3300005843 Bacteria 807
285 Ga0068860_101158781 3300005843 Bacteria 793
286 Ga0068862_100020761 3300005844 Bacteria 5487
287 Ga0068862_100039286 3300005844 Bacteria 4018
288 Ga0068862_100288410 3300005844 Bacteria 1506
289 Ga0068862_100586333 3300005844 Bacteria 1069
290 Ga0068862_100878210 3300005844 Bacteria 880
291 Ga0068862_101212830 3300005844 Unclassified 753
292 Ga0081455_10027748 3300005937 Bacteria 5184
293 Ga0081539_10000372 3300005985 Bacteria 98410
294 Ga0081539_10089374 3300005985 Unclassified 1595
295 Ga0081539_10436593 3300005985 Bacteria 543
296 Ga0070717_10001393 3300006028 Bacteria 16645
297 Ga0070717_10018131 3300006028 Bacteria 5492
298 Ga0070717_10025779 3300006028 Unclassified 4682
299 Ga0070717_10066155 3300006028 Bacteria 3006
300 Ga0070717_10638696 3300006028 Unclassified 966
301 Ga0070717_10740608 3300006028 Bacteria 893
302 Ga0070717_11613926 3300006028 Bacteria 588
303 Ga0075432_10279984 3300006058 Bacteria 686
304 Ga0070715_10043143 3300006163 Bacteria 1900
305 Ga0070715_10046581 3300006163 Bacteria 1844
306 Ga0070715_10600337 3300006163 Bacteria 645
307 Ga0070716_100011174 3300006173 Unclassified 4519
308 Ga0070716_100206622 3300006173 Bacteria 1309
309 Ga0070716_100380616 3300006173 Bacteria 1008
310 Ga0070716_100437607 3300006173 Bacteria 950
311 Ga0070716_100606788 3300006173 Bacteria 824
312 Ga0070716_100703045 3300006173 Bacteria 772
313 Ga0070716_100744057 3300006173 Bacteria 754
314 Ga0070716_100941907 3300006173 Bacteria 679
315 Ga0070712_100008222 3300006175 Bacteria 6553
316 Ga0070712_100027970 3300006175 Unclassified 3768
317 Ga0070712_100057257 3300006175 Bacteria 2737
318 Ga0070712_100133337 3300006175 Bacteria 1885
319 Ga0070712_101039471 3300006175 Unclassified 710
320 Ga0097621_100142981 3300006237 Bacteria 2046
321 Ga0097621_100318745 3300006237 Bacteria 1376
322 Ga0097621_100473255 3300006237 Bacteria 1131
323 Ga0097621_100750725 3300006237 Bacteria 901
324 Ga0068871_100040299 3300006358 Bacteria 3741
325 Ga0068871_100069710 3300006358 Bacteria 2888
326 Ga0068871_100072844 3300006358 Bacteria 2830
327 Ga0068871_100165264 3300006358 Unclassified 1894
328 Ga0075428_100018168 3300006844 Bacteria 7769
329 Ga0075428_100063313 3300006844 Bacteria 4049
330 Ga0075428_100357292 3300006844 Bacteria 1568
331 Ga0075430_100142903 3300006846 Bacteria 1993
332 Ga0075430_100323572 3300006846 Bacteria 1274
333 Ga0075430_100434665 3300006846 Bacteria 1083
334 Ga0075430_100741316 3300006846 Bacteria 810
335 Ga0075431_100027963 3300006847 Bacteria 5788
336 Ga0075431_100053313 3300006847 Bacteria 4170
337 Ga0075431_100100532 3300006847 Bacteria 2983
338 Ga0075431_100592809 3300006847 Bacteria 1093
339 Ga0075431_101075062 3300006847 Bacteria 770
340 Ga0075431_101941220 3300006847 Bacteria 544
341 Ga0075433_10003157 3300006852 Bacteria 12689
342 Ga0075433_10055806 3300006852 Bacteria 3449
343 Ga0075433_10168479 3300006852 Bacteria 1949
344 Ga0075433_10878981 3300006852 Bacteria 782
345 Ga0075433_11879926 3300006852 Bacteria 514
346 Ga0075433_11962051 3300006852 Bacteria 502
347 Ga0075434_100002458 3300006871 Bacteria 16308
348 Ga0075434_100047157 3300006871 Bacteria 4277
349 Ga0075434_100205241 3300006871 Bacteria 1991
350 Ga0075434_100983245 3300006871 Bacteria 858
351 Ga0075429_100044043 3300006880 Bacteria 3882
352 Ga0075429_100130868 3300006880 Bacteria 2195
353 Ga0075429_100823797 3300006880 Bacteria 812
354 Ga0075429_101884545 3300006880 Bacteria 518
355 Ga0068865_100079346 3300006881 Bacteria 2351
356 Ga0068865_100224677 3300006881 Bacteria 1470
357 Ga0068865_100337240 3300006881 Bacteria 1217
358 Ga0075436_100000006 3300006914 Bacteria 306066
359 Ga0075436_100004257 3300006914 Bacteria 9821
360 Ga0075436_100014840 3300006914 Bacteria 5339
361 Ga0075436_100046099 3300006914 Bacteria 3007
362 Ga0075436_100119572 3300006914 Bacteria 1842
363 Ga0075436_100541020 3300006914 Bacteria 854
364 Ga0097620_100007767 3300006931 Bacteria 10891
365 Ga0097620_100008839 3300006931 Bacteria 10174
366 Ga0097620_100018200 3300006931 Bacteria 7062
367 Ga0097620_100067372 3300006931 Bacteria 3614
368 Ga0097620_100068388 3300006931 Bacteria 3586
369 Ga0097620_100089897 3300006931 Bacteria 3121
370 Ga0097620_100101559 3300006931 Bacteria 2933
371 Ga0097620_100177779 3300006931 Bacteria 2210
372 Ga0097620_100699923 3300006931 Bacteria 1104
373 Ga0097620_101569868 3300006931 Bacteria 727
374 Ga0075435_100000208 3300007076 Bacteria 35592
375 Ga0075435_100002224 3300007076 Bacteria 12802
376 Ga0075435_100011737 3300007076 Bacteria 6463
377 Ga0075435_100034002 3300007076 Bacteria 4035
378 Ga0075435_100111041 3300007076 Bacteria 2280
379 Ga0075435_100131685 3300007076 Bacteria 2093
380 Ga0075435_100906514 3300007076 Bacteria 769
381 Ga0075435_100923967 3300007076 Bacteria 761
382 Ga0099794_10039718 3300007265 Bacteria 2235
383 Ga0099794_10785498 3300007265 Unclassified 509
384 Ga0105250_10016389 3300009092 Bacteria 3020
385 Ga0105240_10501485 3300009093 Bacteria 1349
386 Ga0105240_10689236 3300009093 Bacteria 1116
387 Ga0111539_10093149 3300009094 Bacteria 3539
388 Ga0111539_10195196 3300009094 Bacteria 2361
389 Ga0111539_10504577 3300009094 Bacteria 1409
390 Ga0111539_10802672 3300009094 Bacteria 1095
391 Ga0111539_11244804 3300009094 Bacteria 864
392 Ga0111539_11565949 3300009094 Bacteria 764
393 Ga0105245_10000459 3300009098 Bacteria 37271
394 Ga0105245_10359897 3300009098 Bacteria 1444
395 Ga0105245_10365088 3300009098 Bacteria 1434
396 Ga0105245_11327456 3300009098 Bacteria 768
397 Ga0105247_10031048 3300009101 Bacteria 3241
398 Ga0105247_10033260 3300009101 Bacteria 3136
399 Ga0114129_10017604 3300009147 Bacteria 10172
400 Ga0114129_10019322 3300009147 Bacteria 9703
401 Ga0114129_10498969 3300009147 Bacteria 1590
402 Ga0114129_11146592 3300009147 Bacteria 971
403 Ga0114129_11413815 3300009147 Bacteria 858
404 Ga0114129_12089047 3300009147 Bacteria 684
405 Ga0105243_10019614 3300009148 Bacteria 5126
406 Ga0105243_10064246 3300009148 Bacteria 2945
407 Ga0105241_10394738 3300009174 Bacteria 1212
408 Ga0105241_11962730 3300009174 Bacteria 575
409 Ga0105242_10043669 3300009176 Bacteria 3626
410 Ga0105242_10049780 3300009176 Bacteria 3410
411 Ga0105242_10529916 3300009176 Bacteria 1125
412 Ga0105242_13247022 3300009176 Bacteria 505
413 Ga0105248_10000853 3300009177 Bacteria 34296
414 Ga0105248_10108059 3300009177 Bacteria 3137
415 Ga0105248_10237063 3300009177 Bacteria 2054
416 Ga0105248_10323273 3300009177 Bacteria 1738
417 Ga0105248_11169299 3300009177 Bacteria 870
418 Ga0105248_12705276 3300009177 Bacteria 566
419 Ga0105237_10055269 3300009545 Bacteria 3977
420 Ga0105237_10084846 3300009545 Bacteria 3157
421 Ga0105237_10122841 3300009545 Bacteria 2591
422 Ga0105249_10002956 3300009553 Bacteria 14668
423 Ga0105249_10328173 3300009553 Bacteria 1543
424 Ga0105249_10892570 3300009553 Bacteria 956
425 Ga0099796_10027135 3300010159 Bacteria 1826
426 Ga0099796_10155468 3300010159 Bacteria 903
427 Ga0099796_10206176 3300010159 Bacteria 800
428 Ga0105239_10038997 3300010375 Bacteria 5204
429 Ga0105239_10508565 3300010375 Bacteria 1370
430 Ga0105246_10000754 3300011119 Bacteria 18474
431 Ga0157339_1046162 3300012505 Bacteria 562
432 Ga0157327_1016425 3300012512 Bacteria 783
433 Ga0157373_10001555 3300013100 Bacteria 17499
434 Ga0157373_10167709 3300013100 Bacteria 1545
435 Ga0157371_10040688 3300013102 Bacteria 3318
436 Ga0157371_10131370 3300013102 Bacteria 1781
437 Ga0157370_10693250 3300013104 Bacteria 930
438 Ga0157369_10008401 3300013105 Bacteria 11840
439 Ga0157369_10072421 3300013105 Bacteria 3699
440 Ga0157374_10057091 3300013296 Bacteria 3645
441 Ga0157374_10761910 3300013296 Bacteria 983
442 Ga0157374_12371419 3300013296 Bacteria 558
443 Ga0157378_10005394 3300013297 Bacteria 11210
444 Ga0157378_10031884 3300013297 Bacteria 4654
445 Ga0157378_10074414 3300013297 Bacteria 3056
446 Ga0157378_10135952 3300013297 Unclassified 2279
447 Ga0157378_10352501 3300013297 Bacteria 1438
448 Ga0157378_10524276 3300013297 Bacteria 1187
449 Ga0157378_10674041 3300013297 Bacteria 1051
450 Ga0157378_11156845 3300013297 Bacteria 812
451 Ga0157378_11777157 3300013297 Bacteria 664
452 Ga0163162_10072843 3300013306 Bacteria 3491
453 Ga0163162_10514989 3300013306 Bacteria 1326
454 Ga0163162_10704477 3300013306 Bacteria 1131
455 Ga0163162_11186451 3300013306 Bacteria 866
456 Ga0163162_11464828 3300013306 Unclassified 777
457 Ga0163162_11900098 3300013306 Bacteria 681
458 Ga0157372_10048135 3300013307 Bacteria 4739
459 Ga0157372_10131424 3300013307 Bacteria 2880
460 Ga0157372_10219656 3300013307 Bacteria 2203
461 Ga0157375_10004816 3300013308 Bacteria 11721
462 Ga0157375_10200378 3300013308 Bacteria 2152
463 Ga0157375_10495397 3300013308 Bacteria 1386
464 Ga0157375_10498765 3300013308 Bacteria 1381
465 Ga0157375_11521854 3300013308 Bacteria 790
466 Ga0163163_10002279 3300014325 Bacteria 16185
467 Ga0163163_10197092 3300014325 Bacteria 2062
468 Ga0163163_10209260 3300014325 Bacteria 1999
469 Ga0163163_10276514 3300014325 Bacteria 1730
470 Ga0163163_10769529 3300014325 Bacteria 1026
471 Ga0163163_11223394 3300014325 Bacteria 814
472 Ga0163163_12522901 3300014325 Bacteria 572
473 Ga0157380_10006815 3300014326 Bacteria 8073
474 Ga0157380_10031991 3300014326 Bacteria 4042
475 Ga0157380_10105520 3300014326 Bacteria 2355
476 Ga0157380_10481450 3300014326 Bacteria 1200
477 Ga0157380_10509148 3300014326 Bacteria 1171
478 Ga0157380_10587480 3300014326 Bacteria 1099
479 Ga0157377_10001557 3300014745 Bacteria 9974
480 Ga0157377_10304399 3300014745 Bacteria 1053
481 Ga0157377_10499937 3300014745 Bacteria 849
482 Ga0157377_11025823 3300014745 Bacteria 627
483 Ga0157379_10002003 3300014968 Bacteria 16873
484 Ga0157379_10022536 3300014968 Bacteria 5579
485 Ga0157379_10305271 3300014968 Bacteria 1451
486 Ga0157379_10595915 3300014968 Bacteria 1031
487 Ga0157379_10831616 3300014968 Bacteria 873
488 Ga0157376_10003544 3300014969 Bacteria 10757
489 Ga0157376_10005281 3300014969 Bacteria 9024
490 Ga0157376_10007032 3300014969 Bacteria 7988
491 Ga0157376_13021674 3300014969 Bacteria 509
492 Ga0157376_13093454 3300014969 Bacteria 504
493 Ga0182007_10123605 3300015262 Bacteria 867
494 Ga0182005_1071217 3300015265 Bacteria 955
495 Ga0163161_10013005 3300017792 Bacteria 5784
496 Ga0213876_10501081 3300021384 Bacteria 646
497 Ga0213875_10388296 3300021388 Bacteria 665
498 Ga0224570_102025 3300022730 Bacteria 1398
499 Ga0224569_103170 3300022732 Unclassified 1296
500 Ga0224569_107731 3300022732 Bacteria 775
501 Ga0224572_1015371 3300024225 Bacteria 1465
502 Ga0224572_1049634 3300024225 Bacteria 783
503 Ga0228598_1002757 3300024227 Bacteria 3804
504 Ga0228598_1003988 3300024227 Bacteria 3144
505 Ga0207656_10125581 3300025321 Bacteria 1198
506 Ga0207653_10045891 3300025885 Bacteria 1444
507 Ga0207692_10056894 3300025898 Bacteria 2008
508 Ga0207692_10240459 3300025898 Bacteria 1081
509 Ga0207692_10931245 3300025898 Bacteria 572
510 Ga0207642_10082098 3300025899 Bacteria 1568
511 Ga0207642_10675459 3300025899 Bacteria 649
512 Ga0207710_10001514 3300025900 Bacteria 11523
513 Ga0207710_10407001 3300025900 Bacteria 699
514 Ga0207688_10283529 3300025901 Unclassified 1010
515 Ga0207680_10003388 3300025903 Bacteria 7511
516 Ga0207680_10054392 3300025903 Bacteria 2408
517 Ga0207685_10045618 3300025905 Unclassified 1663
518 Ga0207685_10071586 3300025905 Bacteria 1407
519 Ga0207699_10024914 3300025906 Bacteria 3278
520 Ga0207699_10026450 3300025906 Bacteria 3199
521 Ga0207699_10067210 3300025906 Bacteria 2178
522 Ga0207699_10298542 3300025906 Bacteria 1124
523 Ga0207699_10376458 3300025906 Bacteria 1007
524 Ga0207699_10446581 3300025906 Bacteria 927
525 Ga0207699_10783105 3300025906 Bacteria 701
526 Ga0207699_11316611 3300025906 Unclassified 535
527 Ga0207645_10652757 3300025907 Unclassified 715
528 Ga0207643_10029402 3300025908 Bacteria 3055
529 Ga0207705_11226921 3300025909 Bacteria 575
530 Ga0207684_10006682 3300025910 Bacteria 10479
531 Ga0207684_10112281 3300025910 Bacteria 2333
532 Ga0207684_10146110 3300025910 Bacteria 2034
533 Ga0207684_10217943 3300025910 Bacteria 1647
534 Ga0207684_10929765 3300025910 Bacteria 730
535 Ga0207684_11036264 3300025910 Bacteria 685
536 Ga0207684_11073629 3300025910 Bacteria 671
537 Ga0207684_11321077 3300025910 Bacteria 593
538 Ga0207654_11092261 3300025911 Bacteria 581
539 Ga0207707_10050960 3300025912 Bacteria 3604
540 Ga0207671_10263486 3300025914 Bacteria 1357
541 Ga0207693_10014559 3300025915 Bacteria 6320
542 Ga0207693_10023103 3300025915 Bacteria 4938
543 Ga0207693_10027652 3300025915 Bacteria 4483
544 Ga0207693_10132200 3300025915 Bacteria 1962
545 Ga0207693_10160782 3300025915 Bacteria 1767
546 Ga0207693_10321870 3300025915 Bacteria 1210
547 Ga0207693_10339827 3300025915 Bacteria 1175
548 Ga0207693_10817728 3300025915 Unclassified 718
549 Ga0207663_10000012 3300025916 Bacteria 167739
550 Ga0207663_10013866 3300025916 Bacteria 4395
551 Ga0207663_10015875 3300025916 Bacteria 4165
552 Ga0207663_10032717 3300025916 Bacteria 3090
553 Ga0207663_10038001 3300025916 Unclassified 2906
554 Ga0207663_10074110 3300025916 Bacteria 2205
555 Ga0207663_10368906 3300025916 Unclassified 1091
556 Ga0207663_10603765 3300025916 Bacteria 862
557 Ga0207660_10147884 3300025917 Bacteria 1802
558 Ga0207662_10018489 3300025918 Bacteria 3955
559 Ga0207662_10222893 3300025918 Bacteria 1229
560 Ga0207662_10262942 3300025918 Bacteria 1136
561 Ga0207649_10071640 3300025920 Bacteria 2214
562 Ga0207652_10010254 3300025921 Bacteria 7540
563 Ga0207646_10016155 3300025922 Bacteria 7016
564 Ga0207646_10282602 3300025922 Bacteria 1500
565 Ga0207646_10838838 3300025922 Bacteria 817
566 Ga0207646_11396366 3300025922 Bacteria 609
567 Ga0207681_10357466 3300025923 Bacteria 1170
568 Ga0207659_10137924 3300025926 Bacteria 1890
569 Ga0207659_10315139 3300025926 Bacteria 1289
570 Ga0207659_11382971 3300025926 Bacteria 603
571 Ga0207687_10513860 3300025927 Bacteria 1001
572 Ga0207687_10811630 3300025927 Bacteria 798
573 Ga0207687_11098638 3300025927 Bacteria 683
574 Ga0207687_11334782 3300025927 Unclassified 616
575 Ga0207700_10091089 3300025928 Unclassified 2408
576 Ga0207700_10142038 3300025928 Bacteria 1974
577 Ga0207700_10184032 3300025928 Bacteria 1751
578 Ga0207700_10189130 3300025928 Unclassified 1729
579 Ga0207700_10204019 3300025928 Bacteria 1668
580 Ga0207700_10298882 3300025928 Bacteria 1389
581 Ga0207700_10557107 3300025928 Unclassified 1018
582 Ga0207700_10784944 3300025928 Bacteria 852
583 Ga0207700_11146929 3300025928 Bacteria 694
584 Ga0207700_11529710 3300025928 Bacteria 591
585 Ga0207700_12007198 3300025928 Bacteria 505
586 Ga0207664_10000414 3300025929 Bacteria 30456
587 Ga0207664_10245777 3300025929 Bacteria 1560
588 Ga0207664_10505984 3300025929 Bacteria 1082
589 Ga0207664_10587141 3300025929 Bacteria 1000
590 Ga0207644_10007767 3300025931 Bacteria 7003
591 Ga0207690_10064497 3300025932 Bacteria 2501
592 Ga0207706_10248891 3300025933 Bacteria 1553
593 Ga0207706_11002273 3300025933 Bacteria 702
594 Ga0207686_10038558 3300025934 Bacteria 2892
595 Ga0207709_10121833 3300025935 Bacteria 1762
596 Ga0207670_10010271 3300025936 Bacteria 5383
597 Ga0207670_10044061 3300025936 Bacteria 2950
598 Ga0207670_10622882 3300025936 Bacteria 888
599 Ga0207670_11014268 3300025936 Bacteria 699
600 Ga0207670_11621504 3300025936 Bacteria 550
601 Ga0207669_10477464 3300025937 Bacteria 993
602 Ga0207704_10028556 3300025938 Bacteria 3097
603 Ga0207704_10044275 3300025938 Bacteria 2636
604 Ga0207665_10082870 3300025939 Unclassified 2211
605 Ga0207665_10104804 3300025939 Bacteria 1980
606 Ga0207665_10237223 3300025939 Bacteria 1342
607 Ga0207665_10521074 3300025939 Bacteria 920
608 Ga0207665_10618634 3300025939 Bacteria 847
609 Ga0207691_10001037 3300025940 Bacteria 27553
610 Ga0207711_10000935 3300025941 Bacteria 28165
611 Ga0207711_10056830 3300025941 Unclassified 3363
612 Ga0207711_10083837 3300025941 Bacteria 2789
613 Ga0207689_10049909 3300025942 Bacteria 3452
614 Ga0207689_10249642 3300025942 Bacteria 1467
615 Ga0207661_10015665 3300025944 Bacteria 5586
616 Ga0207661_10556794 3300025944 Bacteria 1051
617 Ga0207679_10008311 3300025945 Bacteria 6611
618 Ga0207679_10068571 3300025945 Bacteria 2665
619 Ga0207679_11208877 3300025945 Bacteria 694
620 Ga0207667_10843176 3300025949 Bacteria 911
621 Ga0207651_10020459 3300025960 Bacteria 3995
622 Ga0207651_11061296 3300025960 Bacteria 725
623 Ga0207712_10036123 3300025961 Bacteria 3363
624 Ga0207712_10106572 3300025961 Bacteria 2094
625 Ga0207640_10287798 3300025981 Bacteria 1294
626 Ga0207658_10009300 3300025986 Bacteria 6666
627 Ga0207677_11062314 3300026023 Unclassified 737
628 Ga0207703_10018763 3300026035 Bacteria 5403
629 Ga0207703_10046715 3300026035 Bacteria 3488
630 Ga0207703_10064634 3300026035 Bacteria 3004
631 Ga0207703_10321916 3300026035 Bacteria 1416
632 Ga0207703_11078206 3300026035 Bacteria 771
633 Ga0207703_11094228 3300026035 Bacteria 765
634 Ga0207639_10154891 3300026041 Bacteria 1924
635 Ga0207639_10208075 3300026041 Bacteria 1682
636 Ga0207639_11190780 3300026041 Bacteria 715
637 Ga0207678_10056349 3300026067 Bacteria 3383
638 Ga0207708_10000069 3300026075 Bacteria 82187
639 Ga0207708_10021754 3300026075 Bacteria 4839
640 Ga0207702_12049734 3300026078 Bacteria 562
641 Ga0207641_10001205 3300026088 Bacteria 25890
642 Ga0207641_10050845 3300026088 Bacteria 3508
643 Ga0207641_10065409 3300026088 Bacteria 3110
644 Ga0207641_10337033 3300026088 Bacteria 1434
645 Ga0207641_10420782 3300026088 Bacteria 1286
646 Ga0207641_10895167 3300026088 Bacteria 881
647 Ga0207641_11876676 3300026088 Bacteria 601
648 Ga0207648_10061684 3300026089 Bacteria 3269
649 Ga0207648_10397074 3300026089 Bacteria 1249
650 Ga0207648_11148962 3300026089 Bacteria 729
651 Ga0207676_10088217 3300026095 Bacteria 2539
652 Ga0207676_10200590 3300026095 Bacteria 1762
653 Ga0207676_10419268 3300026095 Bacteria 1255
654 Ga0207676_10459315 3300026095 Bacteria 1202
655 Ga0207676_10744589 3300026095 Bacteria 953
656 Ga0207676_10933669 3300026095 Bacteria 852
657 Ga0207674_10009159 3300026116 Bacteria 11351
658 Ga0207674_10060231 3300026116 Bacteria 3839
659 Ga0207674_11282245 3300026116 Bacteria 702
660 Ga0207674_11616998 3300026116 Bacteria 616
661 Ga0207674_11743723 3300026116 Bacteria 590
662 Ga0207675_100157351 3300026118 Bacteria 2165
663 Ga0207675_101496707 3300026118 Unclassified 696
664 Ga0207675_101596947 3300026118 Bacteria 673
665 Ga0207675_102062569 3300026118 Bacteria 587
666 Ga0207683_10038774 3300026121 Unclassified 4155
667 Ga0207683_11470542 3300026121 Bacteria 629
668 Ga0207698_10164332 3300026142 Bacteria 1946
669 Ga0207698_10786312 3300026142 Bacteria 953
670 Ga0207698_11219707 3300026142 Bacteria 766
671 Ga0209969_1022447 3300027360 Bacteria 944
672 Ga0209967_1002634 3300027364 Bacteria 2335
673 Ga0209984_1009060 3300027424 Bacteria 1260
674 Ga0209982_1028457 3300027552 Bacteria 874
675 Ga0209970_1003733 3300027614 Bacteria 2547
676 Ga0209983_1006090 3300027665 Bacteria 2485
677 Ga0209588_1029927 3300027671 Bacteria 1738
678 Ga0209971_1000378 3300027682 Bacteria 12213
679 Ga0209998_10078205 3300027717 Bacteria 798
680 Ga0209974_10003477 3300027876 Bacteria 5678
681 Ga0207428_10324698 3300027907 Bacteria 1136
682 Ga0265354_1000039 3300028016 Bacteria 20785
683 Ga0265354_1001570 3300028016 Bacteria 3209
684 Ga0265356_1001687 3300028017 Bacteria 3166
685 Ga0268266_11755732 3300028379 Bacteria 595
686 Ga0268265_10336655 3300028380 Bacteria 1372
687 Ga0268265_10501134 3300028380 Bacteria 1144
688 Ga0268264_10004885 3300028381 Bacteria 11362
689 Ga0268264_10005088 3300028381 Bacteria 11138
690 Ga0268264_10028827 3300028381 Bacteria 4544
691 Ga0268264_10068035 3300028381 Bacteria 3008
692 Ga0268264_10205733 3300028381 Bacteria 1803
693 Ga0307515_10567002 3300028794 Bacteria 745
694 Ga0265338_10109817 3300028800 Bacteria 2224
695 Ga0265338_10146395 3300028800 Bacteria 1842
696 Ga0265762_1005527 3300030760 Unclassified 2266
697 Ga0265762_1005995 3300030760 Bacteria 2178
698 Ga0265770_1000264 3300030878 Bacteria 7059
699 Ga0265770_1026498 3300030878 Unclassified 949
700 Ga0265765_1001199 3300030879 Bacteria 2338
701 Ga0265771_1022763 3300031010 Bacteria 555
702 Ga0265760_10000901 3300031090 Bacteria 8590
703 Ga0265760_10013103 3300031090 Bacteria 2373
704 Ga0265760_10013432 3300031090 Bacteria 2344
705 Ga0265330_10224299 3300031235 Bacteria 793
706 Ga0265320_10115274 3300031240 Bacteria 1229
707 Ga0265325_10072163 3300031241 Unclassified 1731
708 Ga0265329_10230796 3300031242 Bacteria 614
709 Ga0265329_10352374 3300031242 Bacteria 504
710 Ga0265340_10138745 3300031247 Bacteria 1113
711 Ga0265339_10094837 3300031249 Bacteria 1559
712 Ga0265316_10155506 3300031344 Bacteria 1711
713 Ga0265316_10438088 3300031344 Unclassified 938
714 Ga0307408_100005310 3300031548 Bacteria 8628
715 Ga0307408_100039537 3300031548 Bacteria 3335
716 Ga0307408_101057137 3300031548 Bacteria 751
717 Ga0307405_10028451 3300031731 Bacteria 3255
718 Ga0307405_11118852 3300031731 Bacteria 678
719 Ga0307405_11807806 3300031731 Unclassified 543
720 Ga0307413_10022513 3300031824 Bacteria 3398
721 Ga0307413_10850727 3300031824 Bacteria 771
722 Ga0307410_10100823 3300031852 Bacteria 2069
723 Ga0307410_10764446 3300031852 Bacteria 819
724 Ga0307406_10009237 3300031901 Bacteria 5523
725 Ga0307406_10010237 3300031901 Bacteria 5284
726 Ga0307406_10469191 3300031901 Bacteria 1014
727 Ga0307406_12089184 3300031901 Bacteria 507
728 Ga0307407_10085878 3300031903 Bacteria 1916
729 Ga0307407_10123921 3300031903 Bacteria 1643
730 Ga0307412_10029021 3300031911 Bacteria 3468
731 Ga0307412_10696356 3300031911 Bacteria 871
732 Ga0307409_100022252 3300031995 Bacteria 4366
733 Ga0307416_100028414 3300032002 Bacteria 4158
734 Ga0307416_101616276 3300032002 Unclassified 753
735 Ga0307416_102905572 3300032002 Bacteria 573
736 Ga0307414_10005762 3300032004 Bacteria 6846
737 Ga0307414_10237862 3300032004 Bacteria 1506
738 Ga0307414_10484733 3300032004 Bacteria 1091
739 Ga0307411_10057116 3300032005 Bacteria 2576
740 Ga0307415_100016151 3300032126 Bacteria 4441
741 Ga0307415_101050017 3300032126 Bacteria 760
742 Ga0316214_1018564 3300033545 Bacteria 967
743 Ga0373926_0206267 3300035083 Unclassified 757
744 Ga0373934_0166694 3300035086 Bacteria 904
745 Ga0373951_0000661 3300035091 Bacteria 9474
746 Ga0373923_0143907 3300035111 Bacteria 1079
747 Ga0373939_0171195 3300035114 Bacteria 804
748 Ga0373941_0136418 3300035115 Bacteria 889
749 Ga0373945_0356438 3300035116 Bacteria 635
750 Ga0373954_0081313 3300035118 Bacteria 1548
751 Ga0373957_0212272 3300035120 Bacteria 809
752 Ga0373957_0444764 3300035120 Bacteria 561
753 Ga0373946_0480493 3300035171 Bacteria 635
754 Ga0373955_0169916 3300035172 Bacteria 1290
755 Ga0373955_0474990 3300035172 Bacteria 763
756 Ga0373962_0285711 3300035242 Bacteria 582
757 Ga0373931_0383171 3300035691 Bacteria 887
758 Ga0373935_0026755 3300035692 Bacteria 3564
759 Ga0373935_0948509 3300035692 Bacteria 638
760 Ga0373933_0858238 3300035724 Bacteria 598
761 Ga0373947_0575528 3300035725 Bacteria 767
762 Ga0373937_0022663 3300036401 Bacteria 5648
763 Ga0373937_0061717 3300036401 Bacteria 3446
764 Ga0373937_0536667 3300036401 Bacteria 1111
765 Ga0373937_0552784 3300036401 Bacteria 1093
766 Ga0373937_0667536 3300036401 Bacteria 985
767 Ga0373937_0718878 3300036401 Bacteria 946
768 Ga0373937_0812738 3300036401 Unclassified 883
769 Ga0373937_0914258 3300036401 Bacteria 826
770 Ga0373925_0053127 3300037068 Bacteria 3028
771 Ga0373925_0061199 3300037068 Bacteria 2827
772 Ga0373925_0969931 3300037068 Bacteria 700
773 Ga0373925_1145272 3300037068 Bacteria 640
774 Ga0373925_1313470 3300037068 Bacteria 593
775 Ga0395900_1923030 3300037418 Bacteria 502
776 Ga0436364_0146677 3300037853 Bacteria 1036
777 Ga0436364_0665176 3300037853 Bacteria 887
778 Ga0436365_1781985 3300039437 Bacteria 2944
779 Ga0436363_0447153 3300039450 Unclassified 593
780 Ga0436363_1250188 3300039450 Bacteria 1658
781 Ga0436362_0129872 3300039453 Unclassified 1149
782 Ga0436362_0703980 3300039453 Bacteria 909
783 Ga0439446_0054435 3300042156 Bacteria 1200
784 Ga0439458_0060519 3300042157 Bacteria 945
785 Ga0439434_0194138 3300042435 Bacteria 683
786 Ga0439435_0066522 3300042436 Bacteria 1060
787 Ga0451577_0058927 3300042876 Bacteria 3424
788 Ga0451577_0313842 3300042876 Bacteria 1421
789 Ga0453683_0015421 3300044673 Bacteria 4948
790 Ga0453683_0109833 3300044673 Bacteria 1734
791 Ga0453684_0103109 3300044712 Bacteria 3487
792 Ga0466957_0678901 3300044842 Bacteria 726
793 Ga0466959_0506928 3300045049 Bacteria 815
794 Ga0451576_0001567 3300045051 Bacteria 38466
795 Ga0451576_0016211 3300045051 Bacteria 8229
796 Ga0451576_1651827 3300045051 Bacteria 664
797 Ga0451576_2177124 3300045051 Bacteria 569
798 Ga0495592_0476639 3300046454 Bacteria 778
799 Ga0495603_0242081 3300046455 Bacteria 1039
800 Ga0495603_0294666 3300046455 Bacteria 932
801 Ga0495629_0031492 3300046459 Bacteria 3755
802 Ga0495629_0068770 3300046459 Bacteria 2471
803 Ga0495629_0149802 3300046459 Bacteria 1622
804 Ga0495641_0126636 3300046461 Bacteria 1140
805 Ga0495641_0127946 3300046461 Bacteria 1134
806 Ga0495641_0540474 3300046461 Unclassified 532
807 Ga0495651_0190092 3300046462 Bacteria 1446
808 Ga0495653_0941988 3300046463 Bacteria 513
809 Ga0495580_0000884 3300046472 Bacteria 25998
810 Ga0495580_0035202 3300046472 Bacteria 3601
811 Ga0495580_0084552 3300046472 Bacteria 2210
812 Ga0495580_0085744 3300046472 Bacteria 2193
813 Ga0495580_0359867 3300046472 Bacteria 985
814 Ga0495580_0461892 3300046472 Bacteria 851
815 Ga0495580_0637235 3300046472 Bacteria 702
816 Ga0495582_0002998 3300046473 Bacteria 9458
817 Ga0495582_0008287 3300046473 Bacteria 5738
818 Ga0495582_0018591 3300046473 Bacteria 3799
819 Ga0495582_0605895 3300046473 Bacteria 634
820 Ga0495639_0011262 3300046475 Bacteria 3853
821 Ga0495662_0034510 3300046476 Bacteria 2441
822 Ga0495662_0277175 3300046476 Bacteria 825
823 Ga0495664_0397099 3300046477 Bacteria 828
824 Ga0495664_0416717 3300046477 Bacteria 806
825 Ga0495594_0053871 3300046499 Unclassified 2216
826 Ga0495594_0554470 3300046499 Bacteria 652
827 Ga0495628_0183274 3300046516 Bacteria 1583
828 Ga0495630_0074755 3300046517 Bacteria 2552
829 Ga0495630_0105690 3300046517 Bacteria 2132
830 Ga0495630_0109651 3300046517 Bacteria 2091
831 Ga0495630_0599246 3300046517 Bacteria 845
832 Ga0495666_0185091 3300046526 Bacteria 961
833 Ga0495665_0049429 3300046531 Bacteria 2230
834 Ga0495640_0023606 3300046533 Bacteria 4477
835 Ga0495587_0004706 3300046536 Bacteria 8955
836 Ga0495609_0325055 3300046538 Bacteria 623
837 Ga0495667_0314671 3300046559 Bacteria 991
838 Ga0495634_0302337 3300046642 Bacteria 967
839 Ga0495635_0025502 3300046663 Bacteria 4119
840 Ga0495588_0173889 3300046674 Bacteria 1139
841 Ga0495599_0469779 3300046678 Bacteria 743
842 Ga0495646_0245235 3300046680 Unclassified 961
843 Ga0495646_0538351 3300046680 Bacteria 597
844 Ga0495647_0072714 3300046681 Bacteria 1380
845 Ga0495647_0449039 3300046681 Bacteria 596
846 Ga0495658_0004678 3300046683 Bacteria 6733
847 Ga0495658_0134053 3300046683 Bacteria 1510
848 Ga0495669_0208677 3300046684 Bacteria 935
849 Ga0495613_0037945 3300046689 Bacteria 3571
850 Ga0495613_0425365 3300046689 Bacteria 903
851 Ga0495624_0062326 3300046690 Bacteria 2333
852 Ga0495581_0019044 3300047315 Bacteria 3984
853 Ga0495604_0328989 3300047317 Bacteria 1020
854 Ga0495636_0540916 3300047318 Bacteria 566
855 Ga0495674_0019406 3300047319 Bacteria 6310
856 Ga0495674_0032471 3300047319 Unclassified 4734
857 Ga0495674_0228304 3300047319 Bacteria 1537
858 Ga0495674_0443257 3300047319 Bacteria 1044
859 Ga0495676_0011240 3300047321 Bacteria 8093
860 Ga0495684_0014336 3300047471 Bacteria 6100
861 Ga0495593_0049667 3300047673 Bacteria 2225
862 Ga0495602_0122759 3300048088 Bacteria 2087
863 Ga0495602_1067708 3300048088 Bacteria 530
864 Ga0495614_0268594 3300048089 Bacteria 783
865 Ga0496100_0111491 3300048903 Bacteria 1901
866 Ga0496101_0027450 3300048904 Bacteria 3966
867 Ga0496101_0150002 3300048904 Bacteria 1783
868 Ga0496101_0540814 3300048904 Unclassified 921
869 Ga0496101_0827565 3300048904 Bacteria 730
870 Ga0496101_1460355 3300048904 Bacteria 533
871 Ga0496102_0006821 3300048905 Bacteria 9745
872 Ga0496102_0103188 3300048905 Bacteria 2652
873 Ga0496102_0734770 3300048905 Bacteria 910
874 Ga0496103_0115363 3300048906 Bacteria 1708
875 Ga0496104_0196182 3300048907 Bacteria 1931
876 Ga0496104_0344277 3300048907 Bacteria 1404
877 Ga0496104_1218111 3300048907 Unclassified 656
878 Ga0496105_0359877 3300048908 Bacteria 1161
879 Ga0496106_0007155 3300048909 Bacteria 8240
880 Ga0496107_0385582 3300048910 Unclassified 1042
881 Ga0496108_0402198 3300048911 Bacteria 1196
882 Ga0496108_1294243 3300048911 Bacteria 613
883 Ga0496109_0348750 3300048912 Bacteria 1398
884 Ga0496109_0812861 3300048912 Bacteria 873
885 Ga0496109_0936655 3300048912 Bacteria 804
886 Ga0496109_1055260 3300048912 Bacteria 750
887 Ga0496110_0001699 3300048913 Bacteria 16184
888 Ga0496110_0566969 3300048913 Bacteria 1031
889 Ga0496111_0094438 3300048914 Bacteria 2193
890 Ga0496111_0312718 3300048914 Bacteria 1164
891 Ga0496111_0761614 3300048914 Bacteria 702
892 Ga0496112_0012258 3300048915 Bacteria 7873
893 Ga0496112_0086230 3300048915 Bacteria 3107
894 Ga0496112_0580934 3300048915 Bacteria 1053
895 Ga0496113_0055112 3300048916 Bacteria 2979
896 Ga0496113_0095544 3300048916 Bacteria 2297
897 Ga0496114_0128097 3300048917 Bacteria 2190
898 Ga0496114_0142271 3300048917 Unclassified 2078
899 Ga0496114_0167138 3300048917 Bacteria 1916
900 Ga0496114_0560319 3300048917 Bacteria 1009
901 Ga0496115_0050263 3300048918 Bacteria 3339
902 Ga0496115_0214259 3300048918 Bacteria 1590
903 Ga0496115_0326249 3300048918 Bacteria 1255
904 Ga0501291_047150 3300049514 Bacteria 774
905 Ga0501292_002003 3300049515 Bacteria 2577
906 Ga0501292_016627 3300049515 Bacteria 1158
907 Ga0501294_009608 3300049517 Bacteria 951
908 Ga0501296_028780 3300049519 Bacteria 740
909 Ga0501297_052839 3300049520 Bacteria 602
910 Ga0501298_000932 3300049521 Bacteria 4137
911 Ga0501298_002478 3300049521 Bacteria 2793
912 Ga0501299_038448 3300049522 Bacteria 951
913 Ga0501299_044524 3300049522 Bacteria 900
914 Ga0501300_030841 3300049523 Bacteria 791
915 Ga0501303_010875 3300049526 Bacteria 858
916 Ga0501036_0243084 3300049572 Bacteria 1509
917 Ga0501040_0081711 3300049576 Bacteria 2240
918 Ga0501042_0018941 3300049578 Bacteria 4774
919 Ga0501046_0278015 3300049580 Bacteria 1227
920 Ga0501048_0018653 3300049582 Bacteria 5101
921 Ga0501071_0072310 3300049587 Bacteria 2515
922 Ga0501072_0016705 3300049588 Bacteria 5639
923 Ga0501072_0265102 3300049588 Bacteria 1367
924 Ga0501073_0114979 3300049589 Bacteria 1865
925 Ga0501074_0777100 3300049590 Bacteria 675
926 Ga0501075_0622445 3300049591 Bacteria 823
927 Ga0501075_1197591 3300049591 Bacteria 576
928 Ga0501076_0103872 3300049592 Bacteria 2292
929 Ga0501076_1167447 3300049592 Bacteria 634
930 Ga0501077_0221105 3300049593 Bacteria 1204
931 Ga0501077_0383093 3300049593 Bacteria 898
932 Ga0501077_0517450 3300049593 Bacteria 765
933 Ga0501198_017890 3300049649 Bacteria 1106
934 Ga0501201_010358 3300049651 Bacteria 912
935 Ga0501202_075286 3300049652 Bacteria 785
936 Ga0501206_009156 3300049653 Bacteria 1314
937 Ga0501207_027635 3300049654 Bacteria 940
938 Ga0501208_002866 3300049655 Bacteria 1856
939 Ga0501216_003443 3300049660 Bacteria 2305
940 Ga0501216_027308 3300049660 Bacteria 1035
941 Ga0501217_039245 3300049661 Bacteria 1199
942 Ga0501223_014334 3300049663 Bacteria 1573
943 Ga0501224_009202 3300049664 Bacteria 1444
944 Ga0501227_188331 3300049665 Bacteria 582
945 Ga0501233_026217 3300049668 Bacteria 1286
946 Ga0501235_120393 3300049669 Bacteria 656
947 Ga0501236_033958 3300049670 Bacteria 819
948 Ga0501236_045766 3300049670 Bacteria 738
949 Ga0501239_028470 3300049672 Bacteria 722
950 Ga0501247_054979 3300049677 Bacteria 599
951 Ga0501250_040593 3300049680 Bacteria 681
952 Ga0501251_050812 3300049681 Bacteria 657
953 Ga0501253_008801 3300049683 Bacteria 1466
954 Ga0501257_027320 3300049686 Bacteria 1365
955 Ga0501225_0013235 3300049705 Bacteria 2312
956 Ga0501225_0041074 3300049705 Bacteria 1275
957 Ga0501234_016085 3300049707 Bacteria 1179
958 Ga0501245_040573 3300049708 Bacteria 799
959 Ga0501079_0084731 3300049741 Bacteria 2452
960 Ga0501079_0143254 3300049741 Bacteria 1862
961 Ga0501079_0823783 3300049741 Bacteria 731
962 Ga0501079_1453030 3300049741 Bacteria 539
963 Ga0501080_0270324 3300049742 Bacteria 1547
964 Ga0501080_0400828 3300049742 Bacteria 1234
965 Ga0501081_0281144 3300049743 Bacteria 1218
966 Ga0501081_0565956 3300049743 Bacteria 850
967 Ga0501265_044399 3300049762 Bacteria 681
968 Ga0501266_005176 3300049763 Bacteria 1624
969 Ga0501268_026969 3300049765 Bacteria 1018
970 Ga0501271_002776 3300049768 Bacteria 1586
971 Ga0501271_017240 3300049768 Bacteria 818
972 Ga0501272_063634 3300049769 Bacteria 530
973 Ga0501276_042035 3300049773 Bacteria 512
974 Ga0501279_052759 3300049775 Bacteria 649
975 Ga0501283_023191 3300049779 Bacteria 1005
976 Ga0501045_0054048 3300049824 Bacteria 2936
977 Ga0501045_0132220 3300049824 Bacteria 1855
978 Ga0501212_020123 3300049851 Bacteria 1026
979 nmdc:mga03683_168186_c1 3300050489 Bacteria 995
980 nmdc:mga05p37_1232508_c1 3300050507 Bacteria 769
981 nmdc:mga05p37_214884_c1 3300050507 Bacteria 2323
982 nmdc:mga05p37_380954_c1 3300050507 Bacteria 1653
983 nmdc:mga05p37_91616_c1 3300050507 Bacteria 3746
984 nmdc:mga09592_349221_c1 3300050508 Bacteria 1280
985 nmdc:mga09592_662346_c1 3300050508 Bacteria 891
986 nmdc:mga09592_731819_c1 3300050508 Bacteria 840
987 nmdc:mga09592_84724_c1 3300050508 Bacteria 2703
988 nmdc:mga0qj67_1341195_c1 3300050509 Unclassified 553
989 nmdc:mga0qj67_501687_c1 3300050509 Bacteria 975
990 nmdc:mga0qj67_674083_c1 3300050509 Bacteria 824
991 nmdc:mga0qj67_923987_c1 3300050509 Bacteria 687
992 nmdc:mga06r32_1014675_c1 3300050510 Bacteria 782
993 nmdc:mga06r32_11647_c1 3300050510 Bacteria 7916
994 nmdc:mga06r32_1542296_c1 3300050510 Bacteria 604
995 nmdc:mga06r32_44023_c1 3300050510 Bacteria 4249
996 nmdc:mga06r32_590053_c1 3300050510 Bacteria 1083
997 nmdc:mga06r32_655479_c1 3300050510 Bacteria 1018
998 nmdc:mga08y16_135652_c1 3300050511 Bacteria 2558
999 nmdc:mga08y16_1373031_c1 3300050511 Bacteria 671
1000 nmdc:mga08y16_166691_c1 3300050511 Unclassified 2288
1001 nmdc:mga08y16_2147175_c1 3300050511 Unclassified 505
1002 nmdc:mga08y16_762669_c1 3300050511 Bacteria 963
1003 nmdc:mga0n895_1087938_c1 3300050512 Bacteria 777
1004 nmdc:mga0n895_23134_c1 3300050512 Bacteria 5836
1005 nmdc:mga0n895_26033_c1 3300050512 Bacteria 5534
1006 nmdc:mga0n895_366827_c1 3300050512 Bacteria 1458
1007 nmdc:mga0n895_426874_c1 3300050512 Bacteria 1340
1008 nmdc:mga0rr50_10965_c1 3300050513 Bacteria 5782
1009 nmdc:mga0rr50_1234562_c1 3300050513 Bacteria 635
1010 nmdc:mga0rr50_1300772_c1 3300050513 Bacteria 617
1011 nmdc:mga0rr50_1329920_c1 3300050513 Bacteria 609
1012 nmdc:mga0rr50_64361_c2 3300050513 Bacteria 2221
1013 nmdc:mga0rr50_676071_c1 3300050513 Bacteria 881
1014 nmdc:mga0rr50_697_c1 3300050513 Bacteria 18007
1015 nmdc:mga08x19_13_c1 3300050514 Bacteria 366166
1016 nmdc:mga08x19_18447_c1 3300050514 Bacteria 4275
1017 nmdc:mga08x19_18973_c1 3300050514 Bacteria 4217
1018 nmdc:mga08x19_2039_c1 3300050514 Bacteria 5973
1019 nmdc:mga08x19_244085_c1 3300050514 Bacteria 1239
1020 nmdc:mga08x19_610207_c1 3300050514 Bacteria 773
1021 nmdc:mga08x19_6418_c1 3300050514 Bacteria 6963
1022 nmdc:mga08x19_734266_c1 3300050514 Bacteria 701
1023 nmdc:mga08x19_7_c1 3300050514 Bacteria 437351
1024 nmdc:mga0a205_1172327_c1 3300050515 Bacteria 616
1025 nmdc:mga0a205_12631_c1 3300050515 Bacteria 7819
1026 nmdc:mga0a205_16287_c1 3300050515 Bacteria 6961
1027 nmdc:mga0a205_27689_c1 3300050515 Bacteria 5413
1028 nmdc:mga0a205_61788_c1 3300050515 Bacteria 3619
1029 nmdc:mga0a205_70025_c1 3300050515 Bacteria 3387
1030 Ga0495601_0983145 3300053077 Bacteria 531
1031 Ga0495612_0046543 3300053078 Bacteria 1777
1032 Ga0495612_0232523 3300053078 Bacteria 818
1033 Ga0495619_0026834 3300053085 Bacteria 3708
1034 Ga0500583_0539801 3300053092 Bacteria 543
1035 Ga0500555_025101 3300053103 Bacteria 1706
1036 Ga0500562_144446 3300053108 Bacteria 648
1037 Ga0501084_1430373 3300054114 Bacteria 579
1038 Ga0587073_0324538 3300059492 Bacteria 509
1039 Ga0587114_072110 3300059655 Bacteria 627
1040 Ga0501082_0789647 3300060353 Bacteria 831
1041 Ga0530510_0166890 3300061734 Bacteria 1630
1042 Ga0105239_10013961
1043 JGI24752J21851_1001370
1044 JGI24737J22298_10064035
1045 JGI24743J22301_10013372
1046 JGI24738J21930_10021070
1047 JGI24749J21850_1006675
1048 JGI24749J21850_1042097
1049 JGI24033J26618_1029825
1050 JGI24751J29686_10032319
1051 JGI26145J50221_1005361
1052 Ga0065712_10523892
1053 Ga0065715_10004356
1054 Ga0065715_10008776
1055 Ga0065715_10516458
1056 Ga0065715_10763570
1057 Ga0065707_10153382
1058 Ga0065707_10282636
1059 Ga0065707_10552181
1060 Ga0065707_11153193
1061 Ga0070658_11064371
1062 Ga0070676_10029914
1063 Ga0070683_100008333
1064 Ga0070683_100013335
1065 Ga0070690_100000510
1066 Ga0070690_100003500
1067 Ga0070690_100308327
1068 Ga0070690_100777523
1069 Ga0070670_100045108
1070 Ga0070670_100229888
1071 Ga0070677_10010578
1072 Ga0068869_100062281
1073 Ga0068869_100211759
1074 Ga0068869_100387819
1075 Ga0070666_10206887
1076 Ga0070680_100026533
1077 Ga0070680_100707312
1078 Ga0070682_100005322
1079 Ga0070682_100211003
1080 Ga0070682_101528907
1081 Ga0068868_100046695
1082 Ga0068868_100356494
1083 Ga0070660_100271769
1084 Ga0070689_100000221
1085 Ga0070689_100005017
1086 Ga0070689_100008986
1087 Ga0070689_100057437
1088 Ga0070691_10286931
1089 Ga0070687_100009239
1090 Ga0070687_100079958
1091 Ga0070687_100196716
1092 Ga0070687_101118217
1093 Ga0070687_101428988
1094 Ga0070661_100002326
1095 Ga0070661_100147615
1096 Ga0070692_10048014
1097 Ga0070668_100044449
1098 Ga0070668_100814044
1099 Ga0070669_100155963
1100 Ga0070669_100259263
1101 Ga0070669_101886076
1102 Ga0070675_100051224
1103 Ga0070675_100304234
1104 Ga0070675_100935287
1105 Ga0070675_101590376
1106 Ga0070671_100058014
1107 Ga0070671_100394526
1108 Ga0070674_100873608
1109 Ga0070673_100012713
1110 Ga0070673_100100683
1111 Ga0070673_100227981
1112 Ga0070673_101147523
1113 Ga0070673_101796664
1114 Ga0070688_100009648
1115 Ga0070688_100102589
1116 Ga0070688_100945422
1117 Ga0070688_101465350
1118 Ga0070688_101557545
1119 Ga0070659_100009440
1120 Ga0070659_100040700
1121 Ga0070667_100001438
1122 Ga0070667_100325115
1123 Ga0070703_10001454
1124 Ga0070703_10156904
1125 Ga0070709_10011844
1126 Ga0070709_10508510
1127 Ga0070709_10910026
1128 Ga0070709_11459082
1129 Ga0070709_11525372
1130 Ga0070714_100006947
1131 Ga0070714_100028956
1132 Ga0070714_100090916
1133 Ga0070714_100374660
1134 Ga0070713_100001561
1135 Ga0070713_100009794
1136 Ga0070713_100010487
1137 Ga0070713_100010661
1138 Ga0070713_100081836
1139 Ga0070713_100090717
1140 Ga0070713_100243350
1141 Ga0070713_102133380
1142 Ga0070710_10061410
1143 Ga0070710_10062865
1144 Ga0070710_11111247
1145 Ga0070701_10011441
1146 Ga0070701_10068288
1147 Ga0070701_10199315
1148 Ga0070701_11079784
1149 Ga0070701_11176672
1150 Ga0070711_100000024
1151 Ga0070711_100017593
1152 Ga0070711_100029735
1153 Ga0070711_100321417
1154 Ga0070711_100368082
1155 Ga0070711_101873368
1156 Ga0070705_100008261
1157 Ga0070705_100042749
1158 Ga0070705_100101795
1159 Ga0070705_100107511
1160 Ga0070705_100115691
1161 Ga0070705_100518894
1162 Ga0070705_101746282
1163 Ga0070700_100174924
1164 Ga0070700_100531430
1165 Ga0070700_101255562
1166 Ga0070694_100021036
1167 Ga0070694_100294507
1168 Ga0070694_101152994
1169 Ga0070708_100005024
1170 Ga0070708_100486703
1171 Ga0070708_100934144
1172 Ga0070708_100984936
1173 Ga0070663_100003824
1174 Ga0070663_100006350
1175 Ga0070662_100066219
1176 Ga0070662_100853997
1177 Ga0070681_10000628
1178 Ga0070681_10056908
1179 Ga0068867_100383811
1180 Ga0068867_101676161
1181 Ga0068867_101888106
1182 Ga0070685_10001512
1183 Ga0070685_10440997
1184 Ga0070685_10883456
1185 Ga0070685_10935014
1186 Ga0070706_100015419
1187 Ga0070706_100071990
1188 Ga0070706_100255836
1189 Ga0070706_100281468
1190 Ga0070706_100752241
1191 Ga0070706_101285815
1192 Ga0070706_101624609
1193 Ga0070707_100011239
1194 Ga0070707_100013201
1195 Ga0070707_100045096
1196 Ga0070707_100800838
1197 Ga0070707_101329829
1198 Ga0070698_100013918
1199 Ga0070698_100241731
1200 Ga0070699_100002636
1201 Ga0070699_100012511
1202 Ga0070699_100033105
1203 Ga0070699_100264416
1204 Ga0070699_101149333
1205 Ga0070679_100004322
1206 Ga0070679_100010597
1207 Ga0070684_100000714
1208 Ga0070684_100019008
1209 Ga0070684_100213922
1210 Ga0070697_100000085
1211 Ga0070697_100002034
1212 Ga0070697_100032421
1213 Ga0070697_100080438
1214 Ga0070697_100598466
1215 Ga0070697_101052304
1216 Ga0070697_101769229
1217 Ga0068853_100025908
1218 Ga0068853_101512769
1219 Ga0070672_100001813
1220 Ga0070672_100005505
1221 Ga0070672_100271080
1222 Ga0070686_100015653
1223 Ga0070686_100025551
1224 Ga0070686_100028153
1225 Ga0070686_100085494
1226 Ga0070686_100192087
1227 Ga0070686_100233317
1228 Ga0070695_100001515
1229 Ga0070695_100210977
1230 Ga0070695_100243808
1231 Ga0070695_100499311
1232 Ga0070695_101620330
1233 Ga0070696_100031072
1234 Ga0070696_100054927
1235 Ga0070696_100120987
1236 Ga0070696_100259999
1237 Ga0070696_100402370
1238 Ga0070696_101541828
1239 Ga0070696_101793076
1240 Ga0070693_100000261
1241 Ga0070693_100024362
1242 Ga0070693_100042884
1243 Ga0070693_100050270
1244 Ga0070693_100150658
1245 Ga0070665_100032977
1246 Ga0070665_101994389
1247 Ga0070665_102235481
1248 Ga0070704_100010849
1249 Ga0070704_100122050
1250 Ga0070704_100148379
1251 Ga0070704_100165684
1252 Ga0070704_100190219
1253 Ga0070704_100202319
1254 Ga0070704_100238899
1255 Ga0070704_100256378
1256 Ga0070704_100295663
1257 Ga0070704_100374327
1258 Ga0070704_100505100
1259 Ga0070704_101242983
1260 Ga0068855_100010248
1261 Ga0068855_100883630
1262 Ga0070664_100009531
1263 Ga0070664_100113012
1264 Ga0070664_100143895
1265 Ga0070664_101271309
1266 Ga0068857_100000458
1267 Ga0068857_100003244
1268 Ga0068857_100079845
1269 Ga0068854_101050209
1270 Ga0068856_100036812
1271 Ga0068856_100083255
1272 Ga0068856_101008307
1273 Ga0068856_101862338
1274 Ga0070702_100379355
1275 Ga0068852_100067100
1276 Ga0068852_100373448
1277 Ga0068852_100558294
1278 Ga0068852_100728739
1279 Ga0068852_101537808
1280 Ga0068859_100007767
1281 Ga0068859_100008839
1282 Ga0068859_100018202
1283 Ga0068859_100067372
1284 Ga0068859_100068388
1285 Ga0068859_100089904
1286 Ga0068859_100101560
1287 Ga0068859_100177776
1288 Ga0068859_100699792
1289 Ga0068859_101569576
1290 Ga0068864_100139680
1291 Ga0068864_100159646
1292 Ga0068864_100303956
1293 Ga0068864_100527927
1294 Ga0068864_101204912
1295 Ga0068864_101349801
1296 Ga0068866_10001785
1297 Ga0068866_10053636
1298 Ga0068866_10840811
1299 Ga0068861_100008366
1300 Ga0068861_100322022
1301 Ga0068861_100528084
1302 Ga0068861_101430805
1303 Ga0068851_10021757
1304 Ga0068870_10002068
1305 Ga0068870_10053717
1306 Ga0068870_10127123
1307 Ga0068863_100003714
1308 Ga0068863_100003751
1309 Ga0068863_100104785
1310 Ga0068863_100139177
1311 Ga0068863_100262781
1312 Ga0068863_100329362
1313 Ga0068863_100571377
1314 Ga0068863_100595977
1315 Ga0068863_101737895
1316 Ga0068858_100004561
1317 Ga0068858_100011407
1318 Ga0068858_100067611
1319 Ga0068858_100203252
1320 Ga0068858_100231134
1321 Ga0068860_100003387
1322 Ga0068860_100008434
1323 Ga0068860_100087609
1324 Ga0068860_100486514
1325 Ga0068860_101117852
1326 Ga0068860_101158781
1327 Ga0068862_100020761
1328 Ga0068862_100039286
1329 Ga0068862_100288410
1330 Ga0068862_100586333
1331 Ga0068862_100878210
1332 Ga0068862_101212830
1333 Ga0081455_10027748
1334 Ga0081539_10000372
1335 Ga0081539_10089374
1336 Ga0081539_10436593
1337 Ga0070717_10001393
1338 Ga0070717_10018131
1339 Ga0070717_10025779
1340 Ga0070717_10066155
1341 Ga0070717_10638696
1342 Ga0070717_10740608
1343 Ga0070717_11613926
1344 Ga0075432_10279984
1345 Ga0070715_10043143
1346 Ga0070715_10046581
1347 Ga0070715_10600337
1348 Ga0070716_100011174
1349 Ga0070716_100206622
1350 Ga0070716_100380616
1351 Ga0070716_100437607
1352 Ga0070716_100606788
1353 Ga0070716_100703045
1354 Ga0070716_100744057
1355 Ga0070716_100941907
1356 Ga0070712_100008222
1357 Ga0070712_100027970
1358 Ga0070712_100057257
1359 Ga0070712_100133337
1360 Ga0070712_101039471
1361 Ga0097621_100142981
1362 Ga0097621_100318745
1363 Ga0097621_100473255
1364 Ga0097621_100750725
1365 Ga0068871_100040299
1366 Ga0068871_100069710
1367 Ga0068871_100072844
1368 Ga0068871_100165264
1369 Ga0075428_100018168
1370 Ga0075428_100063313
1371 Ga0075428_100357292
1372 Ga0075430_100142903
1373 Ga0075430_100323572
1374 Ga0075430_100434665
1375 Ga0075430_100741316
1376 Ga0075431_100027963
1377 Ga0075431_100053313
1378 Ga0075431_100100532
1379 Ga0075431_100592809
1380 Ga0075431_101075062
1381 Ga0075431_101941220
1382 Ga0075433_10003157
1383 Ga0075433_10055806
1384 Ga0075433_10168479
1385 Ga0075433_10878981
1386 Ga0075433_11879926
1387 Ga0075433_11962051
1388 Ga0075434_100002458
1389 Ga0075434_100047157
1390 Ga0075434_100205241
1391 Ga0075434_100983245
1392 Ga0075429_100044043
1393 Ga0075429_100130868
1394 Ga0075429_100823797
1395 Ga0075429_101884545
1396 Ga0068865_100079346
1397 Ga0068865_100224677
1398 Ga0068865_100337240
1399 Ga0075436_100000006
1400 Ga0075436_100004257
1401 Ga0075436_100014840
1402 Ga0075436_100046099
1403 Ga0075436_100119572
1404 Ga0075436_100541020
1405 Ga0097620_100007767
1406 Ga0097620_100008839
1407 Ga0097620_100018200
1408 Ga0097620_100067372
1409 Ga0097620_100068388
1410 Ga0097620_100089897
1411 Ga0097620_100101559
1412 Ga0097620_100177779
1413 Ga0097620_100699923
1414 Ga0097620_101569868
1415 Ga0075435_100000208
1416 Ga0075435_100002224
1417 Ga0075435_100011737
1418 Ga0075435_100034002
1419 Ga0075435_100111041
1420 Ga0075435_100131685
1421 Ga0075435_100906514
1422 Ga0075435_100923967
1423 Ga0099794_10039718
1424 Ga0099794_10785498
1425 Ga0105250_10016389
1426 Ga0105240_10501485
1427 Ga0105240_10689236
1428 Ga0111539_10093149
1429 Ga0111539_10195196
1430 Ga0111539_10504577
1431 Ga0111539_10802672
1432 Ga0111539_11244804
1433 Ga0111539_11565949
1434 Ga0105245_10000459
1435 Ga0105245_10359897
1436 Ga0105245_10365088
1437 Ga0105245_11327456
1438 Ga0105247_10031048
1439 Ga0105247_10033260
1440 Ga0114129_10017604
1441 Ga0114129_10019322
1442 Ga0114129_10498969
1443 Ga0114129_11146592
1444 Ga0114129_11413815
1445 Ga0114129_12089047
1446 Ga0105243_10019614
1447 Ga0105243_10064246
1448 Ga0105241_10394738
1449 Ga0105241_11962730
1450 Ga0105242_10043669
1451 Ga0105242_10049780
1452 Ga0105242_10529916
1453 Ga0105242_13247022
1454 Ga0105248_10000853
1455 Ga0105248_10108059
1456 Ga0105248_10237063
1457 Ga0105248_10323273
1458 Ga0105248_11169299
1459 Ga0105248_12705276
1460 Ga0105237_10055269
1461 Ga0105237_10084846
1462 Ga0105237_10122841
1463 Ga0105249_10002956
1464 Ga0105249_10328173
1465 Ga0105249_10892570
1466 Ga0099796_10027135
1467 Ga0099796_10155468
1468 Ga0099796_10206176
1469 Ga0105239_10038997
1470 Ga0105239_10508565
1471 Ga0105246_10000754
1472 Ga0157339_1046162
1473 Ga0157327_1016425
1474 Ga0157373_10001555
1475 Ga0157373_10167709
1476 Ga0157371_10040688
1477 Ga0157371_10131370
1478 Ga0157370_10693250
1479 Ga0157369_10008401
1480 Ga0157369_10072421
1481 Ga0157374_10057091
1482 Ga0157374_10761910
1483 Ga0157374_12371419
1484 Ga0157378_10005394
1485 Ga0157378_10031884
1486 Ga0157378_10074414
1487 Ga0157378_10135952
1488 Ga0157378_10352501
1489 Ga0157378_10524276
1490 Ga0157378_10674041
1491 Ga0157378_11156845
1492 Ga0157378_11777157
1493 Ga0163162_10072843
1494 Ga0163162_10514989
1495 Ga0163162_10704477
1496 Ga0163162_11186451
1497 Ga0163162_11464828
1498 Ga0163162_11900098
1499 Ga0157372_10048135
1500 Ga0157372_10131424
1501 Ga0157372_10219656
1502 Ga0157375_10004816
1503 Ga0157375_10200378
1504 Ga0157375_10495397
1505 Ga0157375_10498765
1506 Ga0157375_11521854
1507 Ga0163163_10002279
1508 Ga0163163_10197092
1509 Ga0163163_10209260
1510 Ga0163163_10276514
1511 Ga0163163_10769529
1512 Ga0163163_11223394
1513 Ga0163163_12522901
1514 Ga0157380_10006815
1515 Ga0157380_10031991
1516 Ga0157380_10105520
1517 Ga0157380_10481450
1518 Ga0157380_10509148
1519 Ga0157380_10587480
1520 Ga0157377_10001557
1521 Ga0157377_10304399
1522 Ga0157377_10499937
1523 Ga0157377_11025823
1524 Ga0157379_10002003
1525 Ga0157379_10022536
1526 Ga0157379_10305271
1527 Ga0157379_10595915
1528 Ga0157379_10831616
1529 Ga0157376_10003544
1530 Ga0157376_10005281
1531 Ga0157376_10007032
1532 Ga0157376_13021674
1533 Ga0157376_13093454
1534 Ga0182007_10123605
1535 Ga0182005_1071217
1536 Ga0163161_10013005
1537 Ga0213876_10501081
1538 Ga0213875_10388296
1539 Ga0224570_102025
1540 Ga0224569_103170
1541 Ga0224569_107731
1542 Ga0224572_1015371
1543 Ga0224572_1049634
1544 Ga0228598_1002757
1545 Ga0228598_1003988
1546 Ga0207656_10125581
1547 Ga0207653_10045891
1548 Ga0207692_10056894
1549 Ga0207692_10240459
1550 Ga0207692_10931245
1551 Ga0207642_10082098
1552 Ga0207642_10675459
1553 Ga0207710_10001514
1554 Ga0207710_10407001
1555 Ga0207688_10283529
1556 Ga0207680_10003388
1557 Ga0207680_10054392
1558 Ga0207685_10045618
1559 Ga0207685_10071586
1560 Ga0207699_10024914
1561 Ga0207699_10026450
1562 Ga0207699_10067210
1563 Ga0207699_10298542
1564 Ga0207699_10376458
1565 Ga0207699_10446581
1566 Ga0207699_10783105
1567 Ga0207699_11316611
1568 Ga0207645_10652757
1569 Ga0207643_10029402
1570 Ga0207705_11226921
1571 Ga0207684_10006682
1572 Ga0207684_10112281
1573 Ga0207684_10146110
1574 Ga0207684_10217943
1575 Ga0207684_10929765
1576 Ga0207684_11036264
1577 Ga0207684_11073629
1578 Ga0207684_11321077
1579 Ga0207654_11092261
1580 Ga0207707_10050960
1581 Ga0207671_10263486
1582 Ga0207693_10014559
1583 Ga0207693_10023103
1584 Ga0207693_10027652
1585 Ga0207693_10132200
1586 Ga0207693_10160782
1587 Ga0207693_10321870
1588 Ga0207693_10339827
1589 Ga0207693_10817728
1590 Ga0207663_10000012
1591 Ga0207663_10013866
1592 Ga0207663_10015875
1593 Ga0207663_10032717
1594 Ga0207663_10038001
1595 Ga0207663_10074110
1596 Ga0207663_10368906
1597 Ga0207663_10603765
1598 Ga0207660_10147884
1599 Ga0207662_10018489
1600 Ga0207662_10222893
1601 Ga0207662_10262942
1602 Ga0207649_10071640
1603 Ga0207652_10010254
1604 Ga0207646_10016155
1605 Ga0207646_10282602
1606 Ga0207646_10838838
1607 Ga0207646_11396366
1608 Ga0207681_10357466
1609 Ga0207659_10137924
1610 Ga0207659_10315139
1611 Ga0207659_11382971
1612 Ga0207687_10513860
1613 Ga0207687_10811630
1614 Ga0207687_11098638
1615 Ga0207687_11334782
1616 Ga0207700_10091089
1617 Ga0207700_10142038
1618 Ga0207700_10184032
1619 Ga0207700_10189130
1620 Ga0207700_10204019
1621 Ga0207700_10298882
1622 Ga0207700_10557107
1623 Ga0207700_10784944
1624 Ga0207700_11146929
1625 Ga0207700_11529710
1626 Ga0207700_12007198
1627 Ga0207664_10000414
1628 Ga0207664_10245777
1629 Ga0207664_10505984
1630 Ga0207664_10587141
1631 Ga0207644_10007767
1632 Ga0207690_10064497
1633 Ga0207706_10248891
1634 Ga0207706_11002273
1635 Ga0207686_10038558
1636 Ga0207709_10121833
1637 Ga0207670_10010271
1638 Ga0207670_10044061
1639 Ga0207670_10622882
1640 Ga0207670_11014268
1641 Ga0207670_11621504
1642 Ga0207669_10477464
1643 Ga0207704_10028556
1644 Ga0207704_10044275
1645 Ga0207665_10082870
1646 Ga0207665_10104804
1647 Ga0207665_10237223
1648 Ga0207665_10521074
1649 Ga0207665_10618634
1650 Ga0207691_10001037
1651 Ga0207711_10000935
1652 Ga0207711_10056830
1653 Ga0207711_10083837
1654 Ga0207689_10049909
1655 Ga0207689_10249642
1656 Ga0207661_10015665
1657 Ga0207661_10556794
1658 Ga0207679_10008311
1659 Ga0207679_10068571
1660 Ga0207679_11208877
1661 Ga0207667_10843176
1662 Ga0207651_10020459
1663 Ga0207651_11061296
1664 Ga0207712_10036123
1665 Ga0207712_10106572
1666 Ga0207640_10287798
1667 Ga0207658_10009300
1668 Ga0207677_11062314
1669 Ga0207703_10018763
1670 Ga0207703_10046715
1671 Ga0207703_10064634
1672 Ga0207703_10321916
1673 Ga0207703_11078206
1674 Ga0207703_11094228
1675 Ga0207639_10154891
1676 Ga0207639_10208075
1677 Ga0207639_11190780
1678 Ga0207678_10056349
1679 Ga0207708_10000069
1680 Ga0207708_10021754
1681 Ga0207702_12049734
1682 Ga0207641_10001205
1683 Ga0207641_10050845
1684 Ga0207641_10065409
1685 Ga0207641_10337033
1686 Ga0207641_10420782
1687 Ga0207641_10895167
1688 Ga0207641_11876676
1689 Ga0207648_10061684
1690 Ga0207648_10397074
1691 Ga0207648_11148962
1692 Ga0207676_10088217
1693 Ga0207676_10200590
1694 Ga0207676_10419268
1695 Ga0207676_10459315
1696 Ga0207676_10744589
1697 Ga0207676_10933669
1698 Ga0207674_10009159
1699 Ga0207674_10060231
1700 Ga0207674_11282245
1701 Ga0207674_11616998
1702 Ga0207674_11743723
1703 Ga0207675_100157351
1704 Ga0207675_101496707
1705 Ga0207675_101596947
1706 Ga0207675_102062569
1707 Ga0207683_10038774
1708 Ga0207683_11470542
1709 Ga0207698_10164332
1710 Ga0207698_10786312
1711 Ga0207698_11219707
1712 Ga0209969_1022447
1713 Ga0209967_1002634
1714 Ga0209984_1009060
1715 Ga0209982_1028457
1716 Ga0209970_1003733
1717 Ga0209983_1006090
1718 Ga0209588_1029927
1719 Ga0209971_1000378
1720 Ga0209998_10078205
1721 Ga0209974_10003477
1722 Ga0207428_10324698
1723 Ga0265354_1000039
1724 Ga0265354_1001570
1725 Ga0265356_1001687
1726 Ga0268266_11755732
1727 Ga0268265_10336655
1728 Ga0268265_10501134
1729 Ga0268264_10004885
1730 Ga0268264_10005088
1731 Ga0268264_10028827
1732 Ga0268264_10068035
1733 Ga0268264_10205733
1734 Ga0307515_10567002
1735 Ga0265338_10109817
1736 Ga0265338_10146395
1737 Ga0265762_1005527
1738 Ga0265762_1005995
1739 Ga0265770_1000264
1740 Ga0265770_1026498
1741 Ga0265765_1001199
1742 Ga0265771_1022763
1743 Ga0265760_10000901
1744 Ga0265760_10013103
1745 Ga0265760_10013432
1746 Ga0265330_10224299
1747 Ga0265320_10115274
1748 Ga0265325_10072163
1749 Ga0265329_10230796
1750 Ga0265329_10352374
1751 Ga0265340_10138745
1752 Ga0265339_10094837
1753 Ga0265316_10155506
1754 Ga0265316_10438088
1755 Ga0307408_100005310
1756 Ga0307408_100039537
1757 Ga0307408_101057137
1758 Ga0307405_10028451
1759 Ga0307405_11118852
1760 Ga0307405_11807806
1761 Ga0307413_10022513
1762 Ga0307413_10850727
1763 Ga0307410_10100823
1764 Ga0307410_10764446
1765 Ga0307406_10009237
1766 Ga0307406_10010237
1767 Ga0307406_10469191
1768 Ga0307406_12089184
1769 Ga0307407_10085878
1770 Ga0307407_10123921
1771 Ga0307412_10029021
1772 Ga0307412_10696356
1773 Ga0307409_100022252
1774 Ga0307416_100028414
1775 Ga0307416_101616276
1776 Ga0307416_102905572
1777 Ga0307414_10005762
1778 Ga0307414_10237862
1779 Ga0307414_10484733
1780 Ga0307411_10057116
1781 Ga0307415_100016151
1782 Ga0307415_101050017
1783 Ga0316214_1018564
1784 Ga0373926_0206267
1785 Ga0373934_0166694
1786 Ga0373951_0000661
1787 Ga0373923_0143907
1788 Ga0373939_0171195
1789 Ga0373941_0136418
1790 Ga0373945_0356438
1791 Ga0373954_0081313
1792 Ga0373957_0212272
1793 Ga0373957_0444764
1794 Ga0373946_0480493
1795 Ga0373955_0169916
1796 Ga0373955_0474990
1797 Ga0373962_0285711
1798 Ga0373931_0383171
1799 Ga0373935_0026755
1800 Ga0373935_0948509
1801 Ga0373933_0858238
1802 Ga0373947_0575528
1803 Ga0373937_0022663
1804 Ga0373937_0061717
1805 Ga0373937_0536667
1806 Ga0373937_0552784
1807 Ga0373937_0667536
1808 Ga0373937_0718878
1809 Ga0373937_0812738
1810 Ga0373937_0914258
1811 Ga0373925_0053127
1812 Ga0373925_0061199
1813 Ga0373925_0969931
1814 Ga0373925_1145272
1815 Ga0373925_1313470
1816 Ga0395900_1923030
1817 Ga0436364_0146677
1818 Ga0436364_0665176
1819 Ga0436365_1781985
1820 Ga0436363_0447153
1821 Ga0436363_1250188
1822 Ga0436362_0129872
1823 Ga0436362_0703980
1824 Ga0439446_0054435
1825 Ga0439458_0060519
1826 Ga0439434_0194138
1827 Ga0439435_0066522
1828 Ga0451577_0058927
1829 Ga0451577_0313842
1830 Ga0453683_0015421
1831 Ga0453683_0109833
1832 Ga0453684_0103109
1833 Ga0466957_0678901
1834 Ga0466959_0506928
1835 Ga0451576_0001567
1836 Ga0451576_0016211
1837 Ga0451576_1651827
1838 Ga0451576_2177124
1839 Ga0495592_0476639
1840 Ga0495603_0242081
1841 Ga0495603_0294666
1842 Ga0495629_0031492
1843 Ga0495629_0068770
1844 Ga0495629_0149802
1845 Ga0495641_0126636
1846 Ga0495641_0127946
1847 Ga0495641_0540474
1848 Ga0495651_0190092
1849 Ga0495653_0941988
1850 Ga0495580_0000884
1851 Ga0495580_0035202
1852 Ga0495580_0084552
1853 Ga0495580_0085744
1854 Ga0495580_0359867
1855 Ga0495580_0461892
1856 Ga0495580_0637235
1857 Ga0495582_0002998
1858 Ga0495582_0008287
1859 Ga0495582_0018591
1860 Ga0495582_0605895
1861 Ga0495639_0011262
1862 Ga0495662_0034510
1863 Ga0495662_0277175
1864 Ga0495664_0397099
1865 Ga0495664_0416717
1866 Ga0495594_0053871
1867 Ga0495594_0554470
1868 Ga0495628_0183274
1869 Ga0495630_0074755
1870 Ga0495630_0105690
1871 Ga0495630_0109651
1872 Ga0495630_0599246
1873 Ga0495666_0185091
1874 Ga0495665_0049429
1875 Ga0495640_0023606
1876 Ga0495587_0004706
1877 Ga0495609_0325055
1878 Ga0495667_0314671
1879 Ga0495634_0302337
1880 Ga0495635_0025502
1881 Ga0495588_0173889
1882 Ga0495599_0469779
1883 Ga0495646_0245235
1884 Ga0495646_0538351
1885 Ga0495647_0072714
1886 Ga0495647_0449039
1887 Ga0495658_0004678
1888 Ga0495658_0134053
1889 Ga0495669_0208677
1890 Ga0495613_0037945
1891 Ga0495613_0425365
1892 Ga0495624_0062326
1893 Ga0495581_0019044
1894 Ga0495604_0328989
1895 Ga0495636_0540916
1896 Ga0495674_0019406
1897 Ga0495674_0032471
1898 Ga0495674_0228304
1899 Ga0495674_0443257
1900 Ga0495676_0011240
1901 Ga0495684_0014336
1902 Ga0495593_0049667
1903 Ga0495602_0122759
1904 Ga0495602_1067708
1905 Ga0495614_0268594
1906 Ga0496100_0111491
1907 Ga0496101_0027450
1908 Ga0496101_0150002
1909 Ga0496101_0540814
1910 Ga0496101_0827565
1911 Ga0496101_1460355
1912 Ga0496102_0006821
1913 Ga0496102_0103188
1914 Ga0496102_0734770
1915 Ga0496103_0115363
1916 Ga0496104_0196182
1917 Ga0496104_0344277
1918 Ga0496104_1218111
1919 Ga0496105_0359877
1920 Ga0496106_0007155
1921 Ga0496107_0385582
1922 Ga0496108_0402198
1923 Ga0496108_1294243
1924 Ga0496109_0348750
1925 Ga0496109_0812861
1926 Ga0496109_0936655
1927 Ga0496109_1055260
1928 Ga0496110_0001699
1929 Ga0496110_0566969
1930 Ga0496111_0094438
1931 Ga0496111_0312718
1932 Ga0496111_0761614
1933 Ga0496112_0012258
1934 Ga0496112_0086230
1935 Ga0496112_0580934
1936 Ga0496113_0055112
1937 Ga0496113_0095544
1938 Ga0496114_0128097
1939 Ga0496114_0142271
1940 Ga0496114_0167138
1941 Ga0496114_0560319
1942 Ga0496115_0050263
1943 Ga0496115_0214259
1944 Ga0496115_0326249
1945 Ga0501291_047150
1946 Ga0501292_002003
1947 Ga0501292_016627
1948 Ga0501294_009608
1949 Ga0501296_028780
1950 Ga0501297_052839
1951 Ga0501298_000932
1952 Ga0501298_002478
1953 Ga0501299_038448
1954 Ga0501299_044524
1955 Ga0501300_030841
1956 Ga0501303_010875
1957 Ga0501036_0243084
1958 Ga0501040_0081711
1959 Ga0501042_0018941
1960 Ga0501046_0278015
1961 Ga0501048_0018653
1962 Ga0501071_0072310
1963 Ga0501072_0016705
1964 Ga0501072_0265102
1965 Ga0501073_0114979
1966 Ga0501074_0777100
1967 Ga0501075_0622445
1968 Ga0501075_1197591
1969 Ga0501076_0103872
1970 Ga0501076_1167447
1971 Ga0501077_0221105
1972 Ga0501077_0383093
1973 Ga0501077_0517450
1974 Ga0501198_017890
1975 Ga0501201_010358
1976 Ga0501202_075286
1977 Ga0501206_009156
1978 Ga0501207_027635
1979 Ga0501208_002866
1980 Ga0501216_003443
1981 Ga0501216_027308
1982 Ga0501217_039245
1983 Ga0501223_014334
1984 Ga0501224_009202
1985 Ga0501227_188331
1986 Ga0501233_026217
1987 Ga0501235_120393
1988 Ga0501236_033958
1989 Ga0501236_045766
1990 Ga0501239_028470
1991 Ga0501247_054979
1992 Ga0501250_040593
1993 Ga0501251_050812
1994 Ga0501253_008801
1995 Ga0501257_027320
1996 Ga0501225_0013235
1997 Ga0501225_0041074
1998 Ga0501234_016085
1999 Ga0501245_040573
2000 Ga0501079_0084731
2001 Ga0501079_0143254
2002 Ga0501079_0823783
2003 Ga0501079_1453030
2004 Ga0501080_0270324
2005 Ga0501080_0400828
2006 Ga0501081_0281144
2007 Ga0501081_0565956
2008 Ga0501265_044399
2009 Ga0501266_005176
2010 Ga0501268_026969
2011 Ga0501271_002776
2012 Ga0501271_017240
2013 Ga0501272_063634
2014 Ga0501276_042035
2015 Ga0501279_052759
2016 Ga0501283_023191
2017 Ga0501045_0054048
2018 Ga0501045_0132220
2019 Ga0501212_020123
2020 nmdc:mga03683_168186_c1
2021 nmdc:mga05p37_1232508_c1
2022 nmdc:mga05p37_214884_c1
2023 nmdc:mga05p37_380954_c1
2024 nmdc:mga05p37_91616_c1
2025 nmdc:mga09592_349221_c1
2026 nmdc:mga09592_662346_c1
2027 nmdc:mga09592_731819_c1
2028 nmdc:mga09592_84724_c1
2029 nmdc:mga0qj67_1341195_c1
2030 nmdc:mga0qj67_501687_c1
2031 nmdc:mga0qj67_674083_c1
2032 nmdc:mga0qj67_923987_c1
2033 nmdc:mga06r32_1014675_c1
2034 nmdc:mga06r32_11647_c1
2035 nmdc:mga06r32_1542296_c1
2036 nmdc:mga06r32_44023_c1
2037 nmdc:mga06r32_590053_c1
2038 nmdc:mga06r32_655479_c1
2039 nmdc:mga08y16_135652_c1
2040 nmdc:mga08y16_1373031_c1
2041 nmdc:mga08y16_166691_c1
2042 nmdc:mga08y16_2147175_c1
2043 nmdc:mga08y16_762669_c1
2044 nmdc:mga0n895_1087938_c1
2045 nmdc:mga0n895_23134_c1
2046 nmdc:mga0n895_26033_c1
2047 nmdc:mga0n895_366827_c1
2048 nmdc:mga0n895_426874_c1
2049 nmdc:mga0rr50_10965_c1
2050 nmdc:mga0rr50_1234562_c1
2051 nmdc:mga0rr50_1300772_c1
2052 nmdc:mga0rr50_1329920_c1
2053 nmdc:mga0rr50_64361_c2
2054 nmdc:mga0rr50_676071_c1
2055 nmdc:mga0rr50_697_c1
2056 nmdc:mga08x19_13_c1
2057 nmdc:mga08x19_18447_c1
2058 nmdc:mga08x19_18973_c1
2059 nmdc:mga08x19_2039_c1
2060 nmdc:mga08x19_244085_c1
2061 nmdc:mga08x19_610207_c1
2062 nmdc:mga08x19_6418_c1
2063 nmdc:mga08x19_734266_c1
2064 nmdc:mga08x19_7_c1
2065 nmdc:mga0a205_1172327_c1
2066 nmdc:mga0a205_12631_c1
2067 nmdc:mga0a205_16287_c1
2068 nmdc:mga0a205_27689_c1
2069 nmdc:mga0a205_61788_c1
2070 nmdc:mga0a205_70025_c1
2071 Ga0495601_0983145
2072 Ga0495612_0046543
2073 Ga0495612_0232523
2074 Ga0495619_0026834
2075 Ga0500583_0539801
2076 Ga0500555_025101
2077 Ga0500562_144446
2078 Ga0501084_1430373
2079 Ga0587073_0324538
2080 Ga0587114_072110
2081 Ga0501082_0789647
2082 Ga0530510_0166890

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c1l-assembly2.cif.gz_J crystal structure of an antioxidant defense protein (mlr4105) from mesorhizobium loti maff303099 at 2.00 a resolution 0.9647 2 76
2pfx-assembly1.cif.gz_A crystal structure of uncharacterized peroxidase-related protein (yp_614459.1) from silicibacter sp. tm1040 at 1.70 a resolution 0.9642 2 76
3c1l-assembly1.cif.gz_B crystal structure of an antioxidant defense protein (mlr4105) from mesorhizobium loti maff303099 at 2.00 a resolution 0.9624 2 76
2oyo-assembly1.cif.gz_A crystal structure of uncharacterized peroxidase-related protein (yp_604910.1) from deinococcus geothermalis dsm 11300 at 1.51 a resolution 0.9532 2 76
6k40-assembly5.cif.gz_K crystal structure of alkyl hydroperoxide reductase from d. radiodurans r1 0.9494 2 76
ID Description Score Start End Superfamily
2oyoB02 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9101 2 83 1.20.1290.10
3c1lB02 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8766 6 77 1.20.1290.10
3c1lA02 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8746 6 77 1.20.1290.10
2oyoB02 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8689 2 83 1.20.1290.10
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8523 3 73 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A7C7XN66-F1-model_v4 Peroxidase 1.001 26 75 GO:0004601
AF-A0A7J3U4F1-F1-model_v4 Peroxidase 0.9963 18 79 GO:0004601
AF-A0A2E8HFQ9-F1-model_v4 Peroxidase 0.9957 24 79
AF-A0A317HBX9-F1-model_v4 Peroxidase 0.9945 18 80
AF-A0A7W0UWJ0-F1-model_v4 Peroxidase 0.9937 6 67 GO:0004601

Map