F488811
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1040 | 320 | 1040 | 246 |
Family's Representative Sequence
| Representative Sequence | 3300005981|Ga0081538_10000427|Ga0081538_1000042712 |
| Length | 249 |
| Sequence | MATVPEHKIGTREEWQAARDELAKLEAQQAERNEEIKRKRRGLPWVPVEKEYEFDTQEGKKRLAELFDGRSQLLAYNIMYGPDYTVGACPGCTNLADGFDATTLLHLNKRDVTMICFSRAPIDRLTAYRERMGWGFPYVSTYGTDFPWDFGLALTEEQARQIPAVSQMVDNPPEWLRFWASQVGAELKDGLRENPSYIAFAKDNGTVYHTYTVSAPDPFVAPYFSFLLDRTPKEQPEEPLNYRKDEYPD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 66 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 67 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 68 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 82 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 83 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 84 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 100 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 101 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 120 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 121 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 173 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 177 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 178 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 179 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 180 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 181 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 185 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 186 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 187 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 188 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 191 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 192 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 193 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 194 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 196 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 197 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 199 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 200 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 201 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 202 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 203 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 204 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 205 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 206 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 207 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 208 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 209 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 210 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 211 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 212 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 213 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 214 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 215 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 216 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 217 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 218 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 219 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 220 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 221 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 222 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 278 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 279 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 280 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 281 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 282 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 283 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 286 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 287 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 288 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 289 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 290 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 291 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 299 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 300 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 301 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 302 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 303 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 304 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 320 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.75 |
| Metatranscriptomes | 1.25 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.92 |
| Nodule | 0 |
| Rhizoplane | 8.75 |
| Rhizosphere | 88.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25407J50210_10001507 | 3300003373 | Bacteria | 5288 |
| 2 | JGI25407J50210_10008973 | 3300003373 | Bacteria | 2526 |
| 3 | JGI25407J50210_10011522 | 3300003373 | Bacteria | 2260 |
| 4 | JGI25407J50210_10047189 | 3300003373 | Bacteria | 1095 |
| 5 | Ga0070658_10115835 | 3300005327 | Bacteria | 2223 |
| 6 | Ga0070683_100013253 | 3300005329 | Bacteria | 7185 |
| 7 | Ga0070683_100044886 | 3300005329 | Bacteria | 4078 |
| 8 | Ga0070683_100047910 | 3300005329 | Bacteria | 3950 |
| 9 | Ga0070683_100113734 | 3300005329 | Bacteria | 2554 |
| 10 | Ga0070683_100513861 | 3300005329 | Bacteria | 1145 |
| 11 | Ga0070683_100939499 | 3300005329 | Bacteria | 830 |
| 12 | Ga0070690_100045622 | 3300005330 | Bacteria | 2785 |
| 13 | Ga0068869_100104383 | 3300005334 | Bacteria | 2148 |
| 14 | Ga0070680_100023564 | 3300005336 | Bacteria | 4910 |
| 15 | Ga0070680_100057319 | 3300005336 | Bacteria | 3185 |
| 16 | Ga0070680_100093720 | 3300005336 | Unclassified | 2488 |
| 17 | Ga0070680_100287394 | 3300005336 | Bacteria | 1394 |
| 18 | Ga0070682_100026173 | 3300005337 | Bacteria | 3489 |
| 19 | Ga0070682_100062012 | 3300005337 | Bacteria | 2367 |
| 20 | Ga0070682_100367311 | 3300005337 | Bacteria | 1078 |
| 21 | Ga0068868_100284876 | 3300005338 | Bacteria | 1399 |
| 22 | Ga0070660_100005554 | 3300005339 | Bacteria | 8736 |
| 23 | Ga0070660_100008896 | 3300005339 | Bacteria | 7041 |
| 24 | Ga0070661_100029503 | 3300005344 | Bacteria | 3960 |
| 25 | Ga0070661_100163728 | 3300005344 | Bacteria | 1685 |
| 26 | Ga0070692_10003017 | 3300005345 | Bacteria | 6709 |
| 27 | Ga0070692_10046853 | 3300005345 | Unclassified | 2236 |
| 28 | Ga0070668_100005321 | 3300005347 | Bacteria | 9556 |
| 29 | Ga0070668_100090989 | 3300005347 | Bacteria | 2404 |
| 30 | Ga0070668_100148982 | 3300005347 | Bacteria | 1891 |
| 31 | Ga0070668_100203341 | 3300005347 | Bacteria | 1627 |
| 32 | Ga0070669_100621992 | 3300005353 | Unclassified | 906 |
| 33 | Ga0070675_100030266 | 3300005354 | Bacteria | 4369 |
| 34 | Ga0070675_100299541 | 3300005354 | Unclassified | 1416 |
| 35 | Ga0070671_100151973 | 3300005355 | Unclassified | 1955 |
| 36 | Ga0070671_100462487 | 3300005355 | Unclassified | 1089 |
| 37 | Ga0070674_100042039 | 3300005356 | Bacteria | 3102 |
| 38 | Ga0070674_100194634 | 3300005356 | Bacteria | 1561 |
| 39 | Ga0070674_100487106 | 3300005356 | Unclassified | 1025 |
| 40 | Ga0070688_100010646 | 3300005365 | Bacteria | 5080 |
| 41 | Ga0070659_100004504 | 3300005366 | Bacteria | 9952 |
| 42 | Ga0070659_100054848 | 3300005366 | Bacteria | 3140 |
| 43 | Ga0070659_100554391 | 3300005366 | Bacteria | 984 |
| 44 | Ga0070667_100245436 | 3300005367 | Bacteria | 1600 |
| 45 | Ga0070709_10048625 | 3300005434 | Unclassified | 2647 |
| 46 | Ga0070709_10052381 | 3300005434 | Bacteria | 2565 |
| 47 | Ga0070709_10054046 | 3300005434 | Bacteria | 2530 |
| 48 | Ga0070714_100005053 | 3300005435 | Bacteria | 10033 |
| 49 | Ga0070714_100010256 | 3300005435 | Bacteria | 7396 |
| 50 | Ga0070714_100103275 | 3300005435 | Bacteria | 2514 |
| 51 | Ga0070714_100113766 | 3300005435 | Unclassified | 2400 |
| 52 | Ga0070714_100450171 | 3300005435 | Archaea | 1223 |
| 53 | Ga0070714_100460668 | 3300005435 | Bacteria | 1209 |
| 54 | Ga0070714_100857541 | 3300005435 | Unclassified | 881 |
| 55 | Ga0070713_100043272 | 3300005436 | Plasmid | 3681 |
| 56 | Ga0070713_100062584 | 3300005436 | Bacteria | 3117 |
| 57 | Ga0070713_100087824 | 3300005436 | Bacteria | 2667 |
| 58 | Ga0070713_100133794 | 3300005436 | Unclassified | 2189 |
| 59 | Ga0070713_100280041 | 3300005436 | Unclassified | 1530 |
| 60 | Ga0070713_100705421 | 3300005436 | Bacteria | 963 |
| 61 | Ga0070710_10015128 | 3300005437 | Bacteria | 3898 |
| 62 | Ga0070710_10091091 | 3300005437 | Bacteria | 1799 |
| 63 | Ga0070710_10172943 | 3300005437 | Bacteria | 1347 |
| 64 | Ga0070710_10276796 | 3300005437 | Bacteria | 1087 |
| 65 | Ga0070701_10028242 | 3300005438 | Unclassified | 2757 |
| 66 | Ga0070701_10205805 | 3300005438 | Bacteria | 1166 |
| 67 | Ga0070711_100005462 | 3300005439 | Bacteria | 7603 |
| 68 | Ga0070711_100037574 | 3300005439 | Bacteria | 3250 |
| 69 | Ga0070711_100079539 | 3300005439 | Bacteria | 2332 |
| 70 | Ga0070711_100188482 | 3300005439 | Bacteria | 1583 |
| 71 | Ga0070711_100481169 | 3300005439 | Unclassified | 1020 |
| 72 | Ga0070711_100565915 | 3300005439 | Bacteria | 944 |
| 73 | Ga0070705_100021223 | 3300005440 | Bacteria | 3451 |
| 74 | Ga0070705_100318368 | 3300005440 | Bacteria | 1122 |
| 75 | Ga0070700_100019120 | 3300005441 | Bacteria | 3949 |
| 76 | Ga0070700_100047266 | 3300005441 | Bacteria | 2663 |
| 77 | Ga0070700_100137042 | 3300005441 | Bacteria | 1659 |
| 78 | Ga0070700_100178438 | 3300005441 | Bacteria | 1476 |
| 79 | Ga0070708_100037038 | 3300005445 | Bacteria | 4254 |
| 80 | Ga0070708_100079609 | 3300005445 | Bacteria | 2965 |
| 81 | Ga0070708_100154856 | 3300005445 | Bacteria | 2133 |
| 82 | Ga0070708_100162787 | 3300005445 | Bacteria | 2080 |
| 83 | Ga0070708_100241101 | 3300005445 | Bacteria | 1697 |
| 84 | Ga0070708_100285405 | 3300005445 | Bacteria | 1554 |
| 85 | Ga0070708_100321166 | 3300005445 | Bacteria | 1458 |
| 86 | Ga0070708_100462749 | 3300005445 | Unclassified | 1196 |
| 87 | Ga0070678_100004320 | 3300005456 | Bacteria | 8039 |
| 88 | Ga0070662_100186375 | 3300005457 | Bacteria | 1638 |
| 89 | Ga0070662_100210571 | 3300005457 | Bacteria | 1547 |
| 90 | Ga0070681_10003999 | 3300005458 | Bacteria | 13908 |
| 91 | Ga0070681_10007241 | 3300005458 | Bacteria | 10826 |
| 92 | Ga0070681_10026548 | 3300005458 | Bacteria | 5821 |
| 93 | Ga0070681_10235521 | 3300005458 | Bacteria | 1745 |
| 94 | Ga0068867_100057511 | 3300005459 | Bacteria | 2880 |
| 95 | Ga0068867_100090980 | 3300005459 | Bacteria | 2316 |
| 96 | Ga0070685_10002573 | 3300005466 | Bacteria | 9288 |
| 97 | Ga0070706_100000355 | 3300005467 | Bacteria | 55169 |
| 98 | Ga0070706_100003262 | 3300005467 | Bacteria | 16043 |
| 99 | Ga0070706_100003466 | 3300005467 | Bacteria | 15529 |
| 100 | Ga0070706_100038316 | 3300005467 | Bacteria | 4425 |
| 101 | Ga0070706_100110440 | 3300005467 | Bacteria | 2559 |
| 102 | Ga0070706_100203845 | 3300005467 | Bacteria | 1848 |
| 103 | Ga0070706_100210914 | 3300005467 | Bacteria | 1814 |
| 104 | Ga0070706_100285776 | 3300005467 | Bacteria | 1539 |
| 105 | Ga0070707_100015988 | 3300005468 | Bacteria | 7042 |
| 106 | Ga0070707_100060696 | 3300005468 | Bacteria | 3626 |
| 107 | Ga0070707_100085492 | 3300005468 | Bacteria | 3049 |
| 108 | Ga0070707_100094045 | 3300005468 | Bacteria | 2902 |
| 109 | Ga0070707_100127246 | 3300005468 | Bacteria | 2475 |
| 110 | Ga0070707_100218182 | 3300005468 | Bacteria | 1858 |
| 111 | Ga0070698_100000877 | 3300005471 | Bacteria | 33070 |
| 112 | Ga0070698_100003968 | 3300005471 | Bacteria | 16281 |
| 113 | Ga0070698_100008006 | 3300005471 | Bacteria | 11428 |
| 114 | Ga0070698_100010517 | 3300005471 | Bacteria | 9864 |
| 115 | Ga0070698_100010654 | 3300005471 | Bacteria | 9797 |
| 116 | Ga0070698_100019558 | 3300005471 | Bacteria | 7106 |
| 117 | Ga0070698_100039520 | 3300005471 | Bacteria | 4855 |
| 118 | Ga0070698_100061762 | 3300005471 | Bacteria | 3781 |
| 119 | Ga0070698_100067691 | 3300005471 | Bacteria | 3590 |
| 120 | Ga0070698_100072849 | 3300005471 | Bacteria | 3442 |
| 121 | Ga0070698_100148510 | 3300005471 | Bacteria | 2293 |
| 122 | Ga0070698_100156240 | 3300005471 | Bacteria | 2226 |
| 123 | Ga0070698_100535091 | 3300005471 | Unclassified | 1110 |
| 124 | Ga0070698_100689082 | 3300005471 | Bacteria | 964 |
| 125 | Ga0070698_100771940 | 3300005471 | Bacteria | 905 |
| 126 | Ga0070699_100000462 | 3300005518 | Bacteria | 38841 |
| 127 | Ga0070699_100000530 | 3300005518 | Bacteria | 36055 |
| 128 | Ga0070699_100000709 | 3300005518 | Bacteria | 30905 |
| 129 | Ga0070699_100000806 | 3300005518 | Bacteria | 28959 |
| 130 | Ga0070699_100031673 | 3300005518 | Bacteria | 4566 |
| 131 | Ga0070699_100131023 | 3300005518 | Unclassified | 2210 |
| 132 | Ga0070699_100498837 | 3300005518 | Bacteria | 1106 |
| 133 | Ga0070699_100540861 | 3300005518 | Bacteria | 1060 |
| 134 | Ga0070679_100009018 | 3300005530 | Bacteria | 9410 |
| 135 | Ga0070679_100017027 | 3300005530 | Bacteria | 7027 |
| 136 | Ga0070679_100095839 | 3300005530 | Bacteria | 2955 |
| 137 | Ga0070679_100129973 | 3300005530 | Bacteria | 2500 |
| 138 | Ga0070679_100192735 | 3300005530 | Bacteria | 2006 |
| 139 | Ga0070679_100376282 | 3300005530 | Unclassified | 1367 |
| 140 | Ga0070684_100185372 | 3300005535 | Bacteria | 1892 |
| 141 | Ga0070684_100185386 | 3300005535 | Bacteria | 1892 |
| 142 | Ga0070684_100498416 | 3300005535 | Bacteria | 1128 |
| 143 | Ga0070684_100560062 | 3300005535 | Bacteria | 1061 |
| 144 | Ga0070684_100832321 | 3300005535 | Bacteria | 863 |
| 145 | Ga0070697_100000066 | 3300005536 | Bacteria | 83881 |
| 146 | Ga0070697_100002722 | 3300005536 | Bacteria | 13622 |
| 147 | Ga0070697_100006497 | 3300005536 | Bacteria | 9052 |
| 148 | Ga0070697_100050318 | 3300005536 | Bacteria | 3381 |
| 149 | Ga0070697_100060774 | 3300005536 | Bacteria | 3080 |
| 150 | Ga0068853_100207035 | 3300005539 | Bacteria | 1787 |
| 151 | Ga0068853_100303761 | 3300005539 | Bacteria | 1476 |
| 152 | Ga0070672_100057173 | 3300005543 | Unclassified | 3061 |
| 153 | Ga0070686_100002093 | 3300005544 | Bacteria | 11008 |
| 154 | Ga0070695_100063594 | 3300005545 | Bacteria | 2399 |
| 155 | Ga0070695_100259151 | 3300005545 | Bacteria | 1269 |
| 156 | Ga0070696_100003739 | 3300005546 | Bacteria | 10164 |
| 157 | Ga0070696_100010458 | 3300005546 | Bacteria | 6219 |
| 158 | Ga0070696_100031550 | 3300005546 | Bacteria | 3632 |
| 159 | Ga0070693_100025536 | 3300005547 | Bacteria | 3181 |
| 160 | Ga0070693_100026449 | 3300005547 | Bacteria | 3133 |
| 161 | Ga0070665_100034039 | 3300005548 | Bacteria | 5123 |
| 162 | Ga0070665_100159951 | 3300005548 | Bacteria | 2254 |
| 163 | Ga0070665_100664774 | 3300005548 | Bacteria | 1055 |
| 164 | Ga0070704_100123440 | 3300005549 | Bacteria | 1994 |
| 165 | Ga0070704_100257264 | 3300005549 | Bacteria | 1436 |
| 166 | Ga0068855_100011061 | 3300005563 | Bacteria | 10887 |
| 167 | Ga0068855_100076710 | 3300005563 | Bacteria | 3878 |
| 168 | Ga0068855_100112342 | 3300005563 | Bacteria | 3126 |
| 169 | Ga0068855_100204031 | 3300005563 | Bacteria | 2225 |
| 170 | Ga0068855_100254819 | 3300005563 | Bacteria | 1956 |
| 171 | Ga0068855_100476220 | 3300005563 | Unclassified | 1360 |
| 172 | Ga0068855_100612133 | 3300005563 | Bacteria | 1173 |
| 173 | Ga0070664_100063839 | 3300005564 | Bacteria | 3140 |
| 174 | Ga0070664_100110841 | 3300005564 | Bacteria | 2395 |
| 175 | Ga0070664_100513122 | 3300005564 | Bacteria | 1106 |
| 176 | Ga0070664_100546534 | 3300005564 | Bacteria | 1071 |
| 177 | Ga0068857_100020142 | 3300005577 | Bacteria | 5864 |
| 178 | Ga0068857_100033886 | 3300005577 | Bacteria | 4518 |
| 179 | Ga0068856_100048306 | 3300005614 | Bacteria | 4193 |
| 180 | Ga0068856_100083216 | 3300005614 | Bacteria | 3177 |
| 181 | Ga0068856_100155779 | 3300005614 | Bacteria | 2294 |
| 182 | Ga0068856_100233260 | 3300005614 | Bacteria | 1855 |
| 183 | Ga0068856_100544559 | 3300005614 | Bacteria | 1182 |
| 184 | Ga0068856_100799862 | 3300005614 | Bacteria | 963 |
| 185 | Ga0070702_100007158 | 3300005615 | Bacteria | 5330 |
| 186 | Ga0070702_100052707 | 3300005615 | Bacteria | 2334 |
| 187 | Ga0068852_100048901 | 3300005616 | Bacteria | 3615 |
| 188 | Ga0068852_100061986 | 3300005616 | Bacteria | 3251 |
| 189 | Ga0068864_100000066 | 3300005618 | Bacteria | 116383 |
| 190 | Ga0068866_10001604 | 3300005718 | Bacteria | 9581 |
| 191 | Ga0068861_100007679 | 3300005719 | Bacteria | 7403 |
| 192 | Ga0068861_100024683 | 3300005719 | Unclassified | 4350 |
| 193 | Ga0068861_100080645 | 3300005719 | Bacteria | 2546 |
| 194 | Ga0068861_100189546 | 3300005719 | Bacteria | 1718 |
| 195 | Ga0068858_100104722 | 3300005842 | Bacteria | 2640 |
| 196 | Ga0068862_100139398 | 3300005844 | Bacteria | 2152 |
| 197 | Ga0081455_10010429 | 3300005937 | Bacteria | 9433 |
| 198 | Ga0081455_10024962 | 3300005937 | Bacteria | 5523 |
| 199 | Ga0081455_10047229 | 3300005937 | Bacteria | 3730 |
| 200 | Ga0081455_10073577 | 3300005937 | Bacteria | 2825 |
| 201 | Ga0081455_10231564 | 3300005937 | Bacteria | 1363 |
| 202 | Ga0081455_10245484 | 3300005937 | Bacteria | 1313 |
| 203 | Ga0081538_10000404 | 3300005981 | Bacteria | 48911 |
| 204 | Ga0081538_10000427 | 3300005981 | Bacteria | 47287 |
| 205 | Ga0081538_10001017 | 3300005981 | Bacteria | 29941 |
| 206 | Ga0081538_10001921 | 3300005981 | Bacteria | 20817 |
| 207 | Ga0081538_10002722 | 3300005981 | Bacteria | 16990 |
| 208 | Ga0081538_10003377 | 3300005981 | Bacteria | 15107 |
| 209 | Ga0081538_10007198 | 3300005981 | Bacteria | 9657 |
| 210 | Ga0081538_10013713 | 3300005981 | Bacteria | 6403 |
| 211 | Ga0081538_10015810 | 3300005981 | Bacteria | 5821 |
| 212 | Ga0081538_10023872 | 3300005981 | Bacteria | 4378 |
| 213 | Ga0081538_10027775 | 3300005981 | Bacteria | 3911 |
| 214 | Ga0081538_10040020 | 3300005981 | Bacteria | 2996 |
| 215 | Ga0081538_10059173 | 3300005981 | Bacteria | 2215 |
| 216 | Ga0081540_1001071 | 3300005983 | Bacteria | 24309 |
| 217 | Ga0081540_1020136 | 3300005983 | Bacteria | 4024 |
| 218 | Ga0081540_1094091 | 3300005983 | Bacteria | 1310 |
| 219 | Ga0081539_10001078 | 3300005985 | Bacteria | 49685 |
| 220 | Ga0081539_10003725 | 3300005985 | Bacteria | 18161 |
| 221 | Ga0081539_10035593 | 3300005985 | Bacteria | 2989 |
| 222 | Ga0081539_10050885 | 3300005985 | Bacteria | 2340 |
| 223 | Ga0081539_10085440 | 3300005985 | Bacteria | 1646 |
| 224 | Ga0070717_10000222 | 3300006028 | Bacteria | 39400 |
| 225 | Ga0070717_10019069 | 3300006028 | Bacteria | 5371 |
| 226 | Ga0070717_10020643 | 3300006028 | Bacteria | 5185 |
| 227 | Ga0070717_10092904 | 3300006028 | Bacteria | 2550 |
| 228 | Ga0070717_10166311 | 3300006028 | Bacteria | 1916 |
| 229 | Ga0070717_10199875 | 3300006028 | Bacteria | 1750 |
| 230 | Ga0075365_10005495 | 3300006038 | Bacteria | 6842 |
| 231 | Ga0075365_10020554 | 3300006038 | Bacteria | 4095 |
| 232 | Ga0075365_10026753 | 3300006038 | Bacteria | 3665 |
| 233 | Ga0075365_10048811 | 3300006038 | Unclassified | 2787 |
| 234 | Ga0075365_10084269 | 3300006038 | Bacteria | 2157 |
| 235 | Ga0075363_100012817 | 3300006048 | Bacteria | 4047 |
| 236 | Ga0075364_10040774 | 3300006051 | Bacteria | 3012 |
| 237 | Ga0075364_10070702 | 3300006051 | Unclassified | 2298 |
| 238 | Ga0075432_10100803 | 3300006058 | Unclassified | 1067 |
| 239 | Ga0070715_10005321 | 3300006163 | Bacteria | 4285 |
| 240 | Ga0070715_10059786 | 3300006163 | Bacteria | 1668 |
| 241 | Ga0070715_10111478 | 3300006163 | Unclassified | 1291 |
| 242 | Ga0070715_10242015 | 3300006163 | Bacteria | 939 |
| 243 | Ga0070716_100009187 | 3300006173 | Bacteria | 4922 |
| 244 | Ga0070716_100056525 | 3300006173 | Bacteria | 2251 |
| 245 | Ga0070716_100161929 | 3300006173 | Unclassified | 1451 |
| 246 | Ga0070712_100006792 | 3300006175 | Bacteria | 7120 |
| 247 | Ga0070712_100040717 | 3300006175 | Bacteria | 3186 |
| 248 | Ga0070712_100040830 | 3300006175 | Bacteria | 3182 |
| 249 | Ga0070712_100052581 | 3300006175 | Bacteria | 2841 |
| 250 | Ga0070712_100064706 | 3300006175 | Bacteria | 2594 |
| 251 | Ga0070712_100259747 | 3300006175 | Bacteria | 1391 |
| 252 | Ga0097621_100013985 | 3300006237 | Bacteria | 5994 |
| 253 | Ga0097621_100333682 | 3300006237 | Bacteria | 1345 |
| 254 | Ga0068871_100005996 | 3300006358 | Bacteria | 8554 |
| 255 | Ga0068871_100062847 | 3300006358 | Bacteria | 3035 |
| 256 | Ga0068871_100895731 | 3300006358 | Unclassified | 822 |
| 257 | Ga0075428_100008845 | 3300006844 | Bacteria | 11172 |
| 258 | Ga0075428_100011990 | 3300006844 | Bacteria | 9642 |
| 259 | Ga0075428_100080455 | 3300006844 | Bacteria | 3556 |
| 260 | Ga0075428_100241992 | 3300006844 | Bacteria | 1946 |
| 261 | Ga0075428_100370617 | 3300006844 | Bacteria | 1535 |
| 262 | Ga0075430_100022119 | 3300006846 | Bacteria | 5405 |
| 263 | Ga0075430_100022646 | 3300006846 | Bacteria | 5346 |
| 264 | Ga0075431_100022301 | 3300006847 | Bacteria | 6472 |
| 265 | Ga0075431_100050949 | 3300006847 | Bacteria | 4269 |
| 266 | Ga0075431_100063042 | 3300006847 | Plasmid | 3825 |
| 267 | Ga0075431_100157001 | 3300006847 | Bacteria | 2340 |
| 268 | Ga0075431_100282525 | 3300006847 | Bacteria | 1680 |
| 269 | Ga0075431_100328964 | 3300006847 | Bacteria | 1540 |
| 270 | Ga0075431_100716023 | 3300006847 | Bacteria | 978 |
| 271 | Ga0075433_10005390 | 3300006852 | Bacteria | 10051 |
| 272 | Ga0075433_10007855 | 3300006852 | Bacteria | 8482 |
| 273 | Ga0075433_10172213 | 3300006852 | Unclassified | 1926 |
| 274 | Ga0075433_10333777 | 3300006852 | Bacteria | 1340 |
| 275 | Ga0075433_10439096 | 3300006852 | Bacteria | 1151 |
| 276 | Ga0075434_100019182 | 3300006871 | Bacteria | 6615 |
| 277 | Ga0075434_100112062 | 3300006871 | Bacteria | 2739 |
| 278 | Ga0075434_100205984 | 3300006871 | Bacteria | 1987 |
| 279 | Ga0075434_100239583 | 3300006871 | Bacteria | 1834 |
| 280 | Ga0075434_100288626 | 3300006871 | Bacteria | 1660 |
| 281 | Ga0075429_100033200 | 3300006880 | Bacteria | 4484 |
| 282 | Ga0075429_100152578 | 3300006880 | Bacteria | 2023 |
| 283 | Ga0075429_100236639 | 3300006880 | Bacteria | 1599 |
| 284 | Ga0068865_100003911 | 3300006881 | Bacteria | 8936 |
| 285 | Ga0068865_100071854 | 3300006881 | Bacteria | 2456 |
| 286 | Ga0075436_100019126 | 3300006914 | Unclassified | 4692 |
| 287 | Ga0075436_100019793 | 3300006914 | Bacteria | 4615 |
| 288 | Ga0075436_100158914 | 3300006914 | Bacteria | 1593 |
| 289 | Ga0075436_100181955 | 3300006914 | Bacteria | 1486 |
| 290 | Ga0075435_100002620 | 3300007076 | Bacteria | 11988 |
| 291 | Ga0075435_100004257 | 3300007076 | Bacteria | 9830 |
| 292 | Ga0075435_100173399 | 3300007076 | Bacteria | 1820 |
| 293 | Ga0075435_100212235 | 3300007076 | Bacteria | 1643 |
| 294 | Ga0099794_10020916 | 3300007265 | Bacteria | 2967 |
| 295 | Ga0099794_10141424 | 3300007265 | Bacteria | 1219 |
| 296 | Ga0099794_10263762 | 3300007265 | Unclassified | 889 |
| 297 | Ga0105244_10181059 | 3300009036 | Bacteria | 999 |
| 298 | Ga0105240_10048754 | 3300009093 | Bacteria | 5351 |
| 299 | Ga0105240_10165245 | 3300009093 | Unclassified | 2626 |
| 300 | Ga0105240_10212995 | 3300009093 | Bacteria | 2256 |
| 301 | Ga0111539_10004613 | 3300009094 | Bacteria | 17992 |
| 302 | Ga0111539_10096335 | 3300009094 | Bacteria | 3475 |
| 303 | Ga0111539_10212532 | 3300009094 | Bacteria | 2254 |
| 304 | Ga0111539_10228140 | 3300009094 | Bacteria | 2169 |
| 305 | Ga0111539_10615886 | 3300009094 | Bacteria | 1264 |
| 306 | Ga0105245_10008994 | 3300009098 | Bacteria | 8711 |
| 307 | Ga0105245_10033307 | 3300009098 | Bacteria | 4565 |
| 308 | Ga0105245_10103796 | 3300009098 | Unclassified | 2634 |
| 309 | Ga0105245_10140748 | 3300009098 | Bacteria | 2272 |
| 310 | Ga0105245_10171360 | 3300009098 | Bacteria | 2067 |
| 311 | Ga0105245_10306255 | 3300009098 | Bacteria | 1561 |
| 312 | Ga0105247_10049508 | 3300009101 | Bacteria | 2584 |
| 313 | Ga0114129_10008186 | 3300009147 | Bacteria | 14901 |
| 314 | Ga0114129_10014902 | 3300009147 | Bacteria | 11076 |
| 315 | Ga0114129_10019240 | 3300009147 | Bacteria | 9727 |
| 316 | Ga0114129_10032040 | 3300009147 | Bacteria | 7430 |
| 317 | Ga0114129_10032163 | 3300009147 | Bacteria | 7416 |
| 318 | Ga0114129_10056990 | 3300009147 | Bacteria | 5470 |
| 319 | Ga0114129_10188525 | 3300009147 | Bacteria | 2802 |
| 320 | Ga0114129_10248910 | 3300009147 | Bacteria | 2387 |
| 321 | Ga0114129_10252578 | 3300009147 | Bacteria | 2366 |
| 322 | Ga0114129_10254074 | 3300009147 | Bacteria | 2358 |
| 323 | Ga0114129_10300192 | 3300009147 | Bacteria | 2141 |
| 324 | Ga0114129_10691269 | 3300009147 | Bacteria | 1312 |
| 325 | Ga0114129_10789464 | 3300009147 | Archaea | 1212 |
| 326 | Ga0114129_11165672 | 3300009147 | Unclassified | 961 |
| 327 | Ga0105243_10002113 | 3300009148 | Bacteria | 16802 |
| 328 | Ga0105241_10086572 | 3300009174 | Bacteria | 2465 |
| 329 | Ga0105241_10236160 | 3300009174 | Unclassified | 1543 |
| 330 | Ga0105242_10001082 | 3300009176 | Bacteria | 21400 |
| 331 | Ga0105242_10299352 | 3300009176 | Bacteria | 1467 |
| 332 | Ga0105242_10833080 | 3300009176 | Unclassified | 916 |
| 333 | Ga0105248_10013215 | 3300009177 | Bacteria | 9089 |
| 334 | Ga0105248_11593278 | 3300009177 | Bacteria | 740 |
| 335 | Ga0105237_10000602 | 3300009545 | Bacteria | 50128 |
| 336 | Ga0105237_10280461 | 3300009545 | Bacteria | 1669 |
| 337 | Ga0105238_10048578 | 3300009551 | Bacteria | 4276 |
| 338 | Ga0105238_10146274 | 3300009551 | Bacteria | 2340 |
| 339 | Ga0105238_10320119 | 3300009551 | Bacteria | 1537 |
| 340 | Ga0105249_10012750 | 3300009553 | Bacteria | 7410 |
| 341 | Ga0105249_10099165 | 3300009553 | Bacteria | 2737 |
| 342 | Ga0105249_10152752 | 3300009553 | Bacteria | 2224 |
| 343 | Ga0105249_10190204 | 3300009553 | Unclassified | 2003 |
| 344 | Ga0105249_10302900 | 3300009553 | Bacteria | 1604 |
| 345 | Ga0105249_10706918 | 3300009553 | Bacteria | 1068 |
| 346 | Ga0105239_10012439 | 3300010375 | Bacteria | 9479 |
| 347 | Ga0105239_10023482 | 3300010375 | Bacteria | 6792 |
| 348 | Ga0105239_10056542 | 3300010375 | Bacteria | 4303 |
| 349 | Ga0105239_10083085 | 3300010375 | Bacteria | 3527 |
| 350 | Ga0105239_10102031 | 3300010375 | Bacteria | 3175 |
| 351 | Ga0105239_10148987 | 3300010375 | Bacteria | 2611 |
| 352 | Ga0105246_10027163 | 3300011119 | Bacteria | 3747 |
| 353 | Ga0105246_10403761 | 3300011119 | Unclassified | 1135 |
| 354 | Ga0157320_1000926 | 3300012481 | Bacteria | 1350 |
| 355 | Ga0157320_1004889 | 3300012481 | Bacteria | 873 |
| 356 | Ga0157338_1002151 | 3300012515 | Bacteria | 1518 |
| 357 | Ga0157373_10096136 | 3300013100 | Bacteria | 2085 |
| 358 | Ga0157370_10077775 | 3300013104 | Bacteria | 3125 |
| 359 | Ga0157370_10089679 | 3300013104 | Bacteria | 2888 |
| 360 | Ga0157370_10288776 | 3300013104 | Bacteria | 1515 |
| 361 | Ga0157370_10402652 | 3300013104 | Bacteria | 1259 |
| 362 | Ga0157369_10001368 | 3300013105 | Bacteria | 30050 |
| 363 | Ga0157369_10065657 | 3300013105 | Bacteria | 3905 |
| 364 | Ga0157369_10135210 | 3300013105 | Bacteria | 2611 |
| 365 | Ga0157369_10565498 | 3300013105 | Bacteria | 1175 |
| 366 | Ga0157374_10025602 | 3300013296 | Bacteria | 5300 |
| 367 | Ga0157374_10291155 | 3300013296 | Unclassified | 1614 |
| 368 | Ga0157378_10002101 | 3300013297 | Bacteria | 17759 |
| 369 | Ga0163162_10004455 | 3300013306 | Bacteria | 13495 |
| 370 | Ga0163162_10023935 | 3300013306 | Bacteria | 6027 |
| 371 | Ga0163162_10044727 | 3300013306 | Bacteria | 4435 |
| 372 | Ga0157372_10015118 | 3300013307 | Bacteria | 8262 |
| 373 | Ga0157372_10082053 | 3300013307 | Bacteria | 3650 |
| 374 | Ga0157372_10282379 | 3300013307 | Bacteria | 1930 |
| 375 | Ga0157375_10050642 | 3300013308 | Bacteria | 4074 |
| 376 | Ga0157375_10115988 | 3300013308 | Bacteria | 2782 |
| 377 | Ga0157375_10127111 | 3300013308 | Unclassified | 2665 |
| 378 | Ga0157380_10004538 | 3300014326 | Bacteria | 9638 |
| 379 | Ga0182008_10067232 | 3300014497 | Unclassified | 1763 |
| 380 | Ga0182008_10138916 | 3300014497 | Bacteria | 1215 |
| 381 | Ga0157377_10030221 | 3300014745 | Bacteria | 2933 |
| 382 | Ga0157377_10098342 | 3300014745 | Bacteria | 1739 |
| 383 | Ga0157376_10036102 | 3300014969 | Bacteria | 4001 |
| 384 | Ga0197907_10720580 | 3300020069 | Bacteria | 1211 |
| 385 | Ga0206356_10343528 | 3300020070 | Bacteria | 2235 |
| 386 | Ga0206356_11354009 | 3300020070 | Unclassified | 2036 |
| 387 | Ga0206356_11431924 | 3300020070 | Bacteria | 1062 |
| 388 | Ga0206349_1954011 | 3300020075 | Bacteria | 1015 |
| 389 | Ga0206350_10340442 | 3300020080 | Bacteria | 921 |
| 390 | Ga0206350_11395722 | 3300020080 | Bacteria | 1140 |
| 391 | Ga0206354_10696187 | 3300020081 | Bacteria | 1061 |
| 392 | Ga0206354_11114285 | 3300020081 | Unclassified | 2503 |
| 393 | Ga0206353_11645146 | 3300020082 | Bacteria | 6259 |
| 394 | Ga0206353_11985042 | 3300020082 | Bacteria | 2256 |
| 395 | Ga0213873_10048531 | 3300021358 | Unclassified | 1117 |
| 396 | Ga0213876_10010928 | 3300021384 | Bacteria | 4862 |
| 397 | Ga0213876_10014059 | 3300021384 | Bacteria | 4245 |
| 398 | Ga0224712_10012585 | 3300022467 | Bacteria | 2668 |
| 399 | Ga0207692_10006355 | 3300025898 | Bacteria | 4789 |
| 400 | Ga0207692_10028495 | 3300025898 | Bacteria | 2642 |
| 401 | Ga0207692_10104794 | 3300025898 | Bacteria | 1559 |
| 402 | Ga0207692_10113633 | 3300025898 | Bacteria | 1505 |
| 403 | Ga0207642_10000449 | 3300025899 | Bacteria | 12518 |
| 404 | Ga0207710_10070883 | 3300025900 | Unclassified | 1598 |
| 405 | Ga0207688_10092682 | 3300025901 | Bacteria | 1736 |
| 406 | Ga0207688_10182197 | 3300025901 | Unclassified | 1253 |
| 407 | Ga0207688_10309293 | 3300025901 | Bacteria | 967 |
| 408 | Ga0207680_10184258 | 3300025903 | Unclassified | 1414 |
| 409 | Ga0207685_10026495 | 3300025905 | Bacteria | 2017 |
| 410 | Ga0207685_10043960 | 3300025905 | Unclassified | 1686 |
| 411 | Ga0207685_10065683 | 3300025905 | Bacteria | 1453 |
| 412 | Ga0207685_10273744 | 3300025905 | Unclassified | 826 |
| 413 | Ga0207699_10005052 | 3300025906 | Bacteria | 6310 |
| 414 | Ga0207699_10010075 | 3300025906 | Bacteria | 4728 |
| 415 | Ga0207699_10036227 | 3300025906 | Unclassified | 2811 |
| 416 | Ga0207699_10120033 | 3300025906 | Bacteria | 1699 |
| 417 | Ga0207699_10121786 | 3300025906 | Bacteria | 1688 |
| 418 | Ga0207705_10476007 | 3300025909 | Unclassified | 969 |
| 419 | Ga0207684_10000006 | 3300025910 | Bacteria | 688605 |
| 420 | Ga0207684_10000111 | 3300025910 | Bacteria | 153495 |
| 421 | Ga0207684_10079026 | 3300025910 | Bacteria | 2798 |
| 422 | Ga0207684_10198572 | 3300025910 | Bacteria | 1730 |
| 423 | Ga0207684_10218558 | 3300025910 | Bacteria | 1645 |
| 424 | Ga0207707_10009759 | 3300025912 | Bacteria | 8328 |
| 425 | Ga0207707_10014965 | 3300025912 | Bacteria | 6755 |
| 426 | Ga0207695_10046851 | 3300025913 | Bacteria | 4580 |
| 427 | Ga0207695_10157193 | 3300025913 | Unclassified | 2208 |
| 428 | Ga0207695_10608627 | 3300025913 | Bacteria | 974 |
| 429 | Ga0207671_10355848 | 3300025914 | Bacteria | 1161 |
| 430 | Ga0207693_10003431 | 3300025915 | Bacteria | 13522 |
| 431 | Ga0207693_10003498 | 3300025915 | Bacteria | 13403 |
| 432 | Ga0207693_10005467 | 3300025915 | Bacteria | 10593 |
| 433 | Ga0207693_10027024 | 3300025915 | Bacteria | 4538 |
| 434 | Ga0207693_10400015 | 3300025915 | Bacteria | 1074 |
| 435 | Ga0207663_10005457 | 3300025916 | Bacteria | 6404 |
| 436 | Ga0207663_10007121 | 3300025916 | Bacteria | 5779 |
| 437 | Ga0207663_10012312 | 3300025916 | Bacteria | 4622 |
| 438 | Ga0207663_10016317 | 3300025916 | Bacteria | 4115 |
| 439 | Ga0207663_10023726 | 3300025916 | Unclassified | 3525 |
| 440 | Ga0207663_10024453 | 3300025916 | Bacteria | 3479 |
| 441 | Ga0207663_10064746 | 3300025916 | Bacteria | 2334 |
| 442 | Ga0207663_10094323 | 3300025916 | Unclassified | 1994 |
| 443 | Ga0207663_10182669 | 3300025916 | Bacteria | 1499 |
| 444 | Ga0207663_10285765 | 3300025916 | Bacteria | 1227 |
| 445 | Ga0207663_10730871 | 3300025916 | Bacteria | 785 |
| 446 | Ga0207660_10004077 | 3300025917 | Bacteria | 9522 |
| 447 | Ga0207660_10029108 | 3300025917 | Bacteria | 3785 |
| 448 | Ga0207660_10242118 | 3300025917 | Bacteria | 1421 |
| 449 | Ga0207660_10356751 | 3300025917 | Bacteria | 1172 |
| 450 | Ga0207662_10026943 | 3300025918 | Unclassified | 3317 |
| 451 | Ga0207657_10008674 | 3300025919 | Bacteria | 10293 |
| 452 | Ga0207657_10009303 | 3300025919 | Bacteria | 9894 |
| 453 | Ga0207657_10013621 | 3300025919 | Bacteria | 7974 |
| 454 | Ga0207657_10014003 | 3300025919 | Bacteria | 7847 |
| 455 | Ga0207657_10110399 | 3300025919 | Bacteria | 2272 |
| 456 | Ga0207652_10017330 | 3300025921 | Bacteria | 5894 |
| 457 | Ga0207652_10035210 | 3300025921 | Bacteria | 4224 |
| 458 | Ga0207652_10183337 | 3300025921 | Unclassified | 1882 |
| 459 | Ga0207646_10000746 | 3300025922 | Bacteria | 42261 |
| 460 | Ga0207646_10009937 | 3300025922 | Bacteria | 9358 |
| 461 | Ga0207646_10014914 | 3300025922 | Bacteria | 7356 |
| 462 | Ga0207646_10017090 | 3300025922 | Bacteria | 6795 |
| 463 | Ga0207646_10025038 | 3300025922 | Bacteria | 5462 |
| 464 | Ga0207646_10035652 | 3300025922 | Bacteria | 4493 |
| 465 | Ga0207646_10043965 | 3300025922 | Bacteria | 4010 |
| 466 | Ga0207646_10113169 | 3300025922 | Bacteria | 2436 |
| 467 | Ga0207646_10187402 | 3300025922 | Bacteria | 1869 |
| 468 | Ga0207646_10559207 | 3300025922 | Unclassified | 1028 |
| 469 | Ga0207659_10171696 | 3300025926 | Unclassified | 1711 |
| 470 | Ga0207659_10319407 | 3300025926 | Bacteria | 1281 |
| 471 | Ga0207687_10005452 | 3300025927 | Bacteria | 8416 |
| 472 | Ga0207687_10007651 | 3300025927 | Bacteria | 7101 |
| 473 | Ga0207687_10163194 | 3300025927 | Unclassified | 1712 |
| 474 | Ga0207687_10320327 | 3300025927 | Bacteria | 1255 |
| 475 | Ga0207687_10519551 | 3300025927 | Unclassified | 996 |
| 476 | Ga0207700_10006621 | 3300025928 | Bacteria | 7020 |
| 477 | Ga0207700_10023694 | 3300025928 | Bacteria | 4239 |
| 478 | Ga0207700_10250028 | 3300025928 | Bacteria | 1514 |
| 479 | Ga0207700_10304288 | 3300025928 | Bacteria | 1377 |
| 480 | Ga0207700_10832602 | 3300025928 | Unclassified | 826 |
| 481 | Ga0207664_10003470 | 3300025929 | Bacteria | 10518 |
| 482 | Ga0207664_10005864 | 3300025929 | Bacteria | 8400 |
| 483 | Ga0207664_10010381 | 3300025929 | Bacteria | 6577 |
| 484 | Ga0207664_10013689 | 3300025929 | Bacteria | 5832 |
| 485 | Ga0207664_10052039 | 3300025929 | Bacteria | 3237 |
| 486 | Ga0207664_10159446 | 3300025929 | Bacteria | 1923 |
| 487 | Ga0207664_10401410 | 3300025929 | Bacteria | 1219 |
| 488 | Ga0207664_10410661 | 3300025929 | Bacteria | 1205 |
| 489 | Ga0207664_10671385 | 3300025929 | Unclassified | 932 |
| 490 | Ga0207664_10701832 | 3300025929 | Archaea | 910 |
| 491 | Ga0207644_10020755 | 3300025931 | Bacteria | 4469 |
| 492 | Ga0207644_10633882 | 3300025931 | Unclassified | 889 |
| 493 | Ga0207690_10371340 | 3300025932 | Bacteria | 1135 |
| 494 | Ga0207690_10436351 | 3300025932 | Bacteria | 1050 |
| 495 | Ga0207706_10003766 | 3300025933 | Bacteria | 14468 |
| 496 | Ga0207706_10186011 | 3300025933 | Bacteria | 1824 |
| 497 | Ga0207706_10333307 | 3300025933 | Bacteria | 1320 |
| 498 | Ga0207686_10001941 | 3300025934 | Bacteria | 11414 |
| 499 | Ga0207709_10001307 | 3300025935 | Bacteria | 17736 |
| 500 | Ga0207709_10068350 | 3300025935 | Bacteria | 2245 |
| 501 | Ga0207709_10097111 | 3300025935 | Bacteria | 1939 |
| 502 | Ga0207709_10134650 | 3300025935 | Bacteria | 1689 |
| 503 | Ga0207709_10688459 | 3300025935 | Unclassified | 817 |
| 504 | Ga0207670_10221494 | 3300025936 | Unclassified | 1449 |
| 505 | Ga0207669_10003552 | 3300025937 | Bacteria | 6754 |
| 506 | Ga0207669_10008329 | 3300025937 | Bacteria | 4860 |
| 507 | Ga0207669_10100834 | 3300025937 | Bacteria | 1908 |
| 508 | Ga0207704_10001093 | 3300025938 | Bacteria | 12036 |
| 509 | Ga0207704_10098645 | 3300025938 | Bacteria | 1941 |
| 510 | Ga0207665_10002156 | 3300025939 | Bacteria | 13326 |
| 511 | Ga0207665_10010333 | 3300025939 | Bacteria | 6128 |
| 512 | Ga0207665_10054983 | 3300025939 | Bacteria | 2685 |
| 513 | Ga0207665_10070823 | 3300025939 | Bacteria | 2380 |
| 514 | Ga0207665_10079926 | 3300025939 | Bacteria | 2248 |
| 515 | Ga0207665_10120205 | 3300025939 | Bacteria | 1855 |
| 516 | Ga0207691_10025953 | 3300025940 | Bacteria | 5499 |
| 517 | Ga0207711_10063349 | 3300025941 | Bacteria | 3191 |
| 518 | Ga0207661_10114948 | 3300025944 | Bacteria | 2282 |
| 519 | Ga0207661_10145048 | 3300025944 | Bacteria | 2047 |
| 520 | Ga0207661_10217226 | 3300025944 | Bacteria | 1688 |
| 521 | Ga0207661_10320529 | 3300025944 | Bacteria | 1393 |
| 522 | Ga0207661_10409811 | 3300025944 | Bacteria | 1230 |
| 523 | Ga0207679_10024106 | 3300025945 | Bacteria | 4169 |
| 524 | Ga0207679_10212206 | 3300025945 | Bacteria | 1624 |
| 525 | Ga0207679_10743176 | 3300025945 | Unclassified | 892 |
| 526 | Ga0207667_10112119 | 3300025949 | Bacteria | 2813 |
| 527 | Ga0207667_10157031 | 3300025949 | Bacteria | 2340 |
| 528 | Ga0207667_10238071 | 3300025949 | Unclassified | 1863 |
| 529 | Ga0207667_10319832 | 3300025949 | Bacteria | 1585 |
| 530 | Ga0207667_10689951 | 3300025949 | Bacteria | 1024 |
| 531 | Ga0207651_10321139 | 3300025960 | Bacteria | 1294 |
| 532 | Ga0207712_10117751 | 3300025961 | Bacteria | 2004 |
| 533 | Ga0207712_10150883 | 3300025961 | Bacteria | 1795 |
| 534 | Ga0207712_10170148 | 3300025961 | Bacteria | 1702 |
| 535 | Ga0207712_10194731 | 3300025961 | Bacteria | 1602 |
| 536 | Ga0207712_10212611 | 3300025961 | Bacteria | 1541 |
| 537 | Ga0207712_10592014 | 3300025961 | Unclassified | 958 |
| 538 | Ga0207712_10704374 | 3300025961 | Bacteria | 882 |
| 539 | Ga0207668_10026631 | 3300025972 | Bacteria | 3756 |
| 540 | Ga0207668_10031470 | 3300025972 | Bacteria | 3495 |
| 541 | Ga0207668_10155093 | 3300025972 | Bacteria | 1778 |
| 542 | Ga0207677_10181307 | 3300026023 | Bacteria | 1657 |
| 543 | Ga0207677_10428480 | 3300026023 | Bacteria | 1128 |
| 544 | Ga0207639_10075418 | 3300026041 | Bacteria | 2652 |
| 545 | Ga0207639_10499116 | 3300026041 | Bacteria | 1111 |
| 546 | Ga0207678_10055531 | 3300026067 | Bacteria | 3411 |
| 547 | Ga0207678_10069245 | 3300026067 | Bacteria | 3025 |
| 548 | Ga0207708_10000316 | 3300026075 | Bacteria | 38103 |
| 549 | Ga0207708_10473756 | 3300026075 | Unclassified | 1046 |
| 550 | Ga0207702_10009738 | 3300026078 | Bacteria | 8071 |
| 551 | Ga0207702_10455841 | 3300026078 | Bacteria | 1241 |
| 552 | Ga0207702_10486576 | 3300026078 | Bacteria | 1201 |
| 553 | Ga0207648_10006150 | 3300026089 | Bacteria | 11962 |
| 554 | Ga0207648_10111515 | 3300026089 | Bacteria | 2401 |
| 555 | Ga0207648_10474500 | 3300026089 | Bacteria | 1142 |
| 556 | Ga0207676_10000038 | 3300026095 | Bacteria | 171492 |
| 557 | Ga0207674_10027663 | 3300026116 | Bacteria | 5994 |
| 558 | Ga0207674_10028752 | 3300026116 | Bacteria | 5863 |
| 559 | Ga0207674_10058060 | 3300026116 | Unclassified | 3922 |
| 560 | Ga0207674_10307156 | 3300026116 | Bacteria | 1535 |
| 561 | Ga0207675_100002213 | 3300026118 | Bacteria | 19316 |
| 562 | Ga0207675_100005637 | 3300026118 | Bacteria | 11985 |
| 563 | Ga0207675_100007552 | 3300026118 | Bacteria | 10272 |
| 564 | Ga0207675_100018906 | 3300026118 | Bacteria | 6431 |
| 565 | Ga0207675_100064312 | 3300026118 | Bacteria | 3429 |
| 566 | Ga0207675_100068651 | 3300026118 | Bacteria | 3312 |
| 567 | Ga0207683_10001814 | 3300026121 | Bacteria | 18887 |
| 568 | Ga0207683_10008897 | 3300026121 | Bacteria | 8559 |
| 569 | Ga0207428_10003447 | 3300027907 | Bacteria | 15358 |
| 570 | Ga0207428_10038721 | 3300027907 | Bacteria | 3875 |
| 571 | Ga0207428_10080193 | 3300027907 | Bacteria | 2550 |
| 572 | Ga0207428_10100716 | 3300027907 | Bacteria | 2233 |
| 573 | Ga0268266_10050172 | 3300028379 | Bacteria | 3580 |
| 574 | Ga0268266_10226693 | 3300028379 | Bacteria | 1720 |
| 575 | Ga0268266_10393557 | 3300028379 | Bacteria | 1309 |
| 576 | Ga0268265_10657242 | 3300028380 | Bacteria | 1008 |
| 577 | Ga0268264_10257680 | 3300028381 | Bacteria | 1623 |
| 578 | Ga0307408_100164039 | 3300031548 | Unclassified | 1768 |
| 579 | Ga0307405_10027498 | 3300031731 | Unclassified | 3299 |
| 580 | Ga0307410_10011531 | 3300031852 | Bacteria | 5060 |
| 581 | Ga0307410_10065094 | 3300031852 | Bacteria | 2507 |
| 582 | Ga0307410_10070587 | 3300031852 | Bacteria | 2420 |
| 583 | Ga0307406_10016289 | 3300031901 | Bacteria | 4318 |
| 584 | Ga0307406_10120296 | 3300031901 | Unclassified | 1824 |
| 585 | Ga0307406_10179718 | 3300031901 | Bacteria | 1539 |
| 586 | Ga0307406_10182702 | 3300031901 | Bacteria | 1528 |
| 587 | Ga0307407_10006320 | 3300031903 | Bacteria | 5246 |
| 588 | Ga0307407_10017333 | 3300031903 | Bacteria | 3611 |
| 589 | Ga0307407_10113304 | 3300031903 | Unclassified | 1706 |
| 590 | Ga0307407_10398144 | 3300031903 | Bacteria | 987 |
| 591 | Ga0307412_10070216 | 3300031911 | Unclassified | 2387 |
| 592 | Ga0307412_10128520 | 3300031911 | Bacteria | 1837 |
| 593 | Ga0307409_100001197 | 3300031995 | Bacteria | 12440 |
| 594 | Ga0307409_100032250 | 3300031995 | Unclassified | 3795 |
| 595 | Ga0307409_100074431 | 3300031995 | Bacteria | 2714 |
| 596 | Ga0307409_100232346 | 3300031995 | Bacteria | 1673 |
| 597 | Ga0307416_100002210 | 3300032002 | Bacteria | 11066 |
| 598 | Ga0307416_100032735 | 3300032002 | Bacteria | 3933 |
| 599 | Ga0307416_100121943 | 3300032002 | Unclassified | 2325 |
| 600 | Ga0307414_10029673 | 3300032004 | Bacteria | 3563 |
| 601 | Ga0307414_10069184 | 3300032004 | Bacteria | 2537 |
| 602 | Ga0307414_10262419 | 3300032004 | Bacteria | 1442 |
| 603 | Ga0307411_10054496 | 3300032005 | Unclassified | 2626 |
| 604 | Ga0307411_10109922 | 3300032005 | Unclassified | 1970 |
| 605 | Ga0307415_100044324 | 3300032126 | Unclassified | 2973 |
| 606 | Ga0307415_100070787 | 3300032126 | Unclassified | 2450 |
| 607 | Ga0373928_0046268 | 3300035084 | Bacteria | 1015 |
| 608 | Ga0373932_0098627 | 3300035112 | Bacteria | 948 |
| 609 | Ga0373941_0153326 | 3300035115 | Bacteria | 847 |
| 610 | Ga0373945_0000408 | 3300035116 | Bacteria | 12344 |
| 611 | Ga0373945_0059601 | 3300035116 | Unclassified | 1422 |
| 612 | Ga0373943_0020423 | 3300035170 | Bacteria | 3054 |
| 613 | Ga0373943_0409611 | 3300035170 | Bacteria | 784 |
| 614 | Ga0373946_0002764 | 3300035171 | Bacteria | 6204 |
| 615 | Ga0373955_0249621 | 3300035172 | Bacteria | 1064 |
| 616 | Ga0373942_0056057 | 3300035207 | Bacteria | 1118 |
| 617 | Ga0373924_0055170 | 3300035410 | Bacteria | 1654 |
| 618 | Ga0373935_0005562 | 3300035692 | Bacteria | 7427 |
| 619 | Ga0373935_0093143 | 3300035692 | Bacteria | 1976 |
| 620 | Ga0373925_0001678 | 3300037068 | Bacteria | 18627 |
| 621 | Ga0373925_0559600 | 3300037068 | Bacteria | 941 |
| 622 | Ga0395899_0028499 | 3300037312 | Bacteria | 4205 |
| 623 | Ga0395899_0039222 | 3300037312 | Bacteria | 3546 |
| 624 | Ga0395899_0070679 | 3300037312 | Bacteria | 2555 |
| 625 | Ga0395899_0076290 | 3300037312 | Bacteria | 2447 |
| 626 | Ga0395899_0076300 | 3300037312 | Bacteria | 2447 |
| 627 | Ga0395899_0200369 | 3300037312 | Bacteria | 1392 |
| 628 | Ga0395899_0239011 | 3300037312 | Bacteria | 1251 |
| 629 | Ga0395900_0002072 | 3300037418 | Bacteria | 22505 |
| 630 | Ga0395900_0004735 | 3300037418 | Bacteria | 14352 |
| 631 | Ga0395900_0006797 | 3300037418 | Bacteria | 11870 |
| 632 | Ga0395900_0015456 | 3300037418 | Bacteria | 7781 |
| 633 | Ga0395900_0025244 | 3300037418 | Bacteria | 6083 |
| 634 | Ga0395900_0065136 | 3300037418 | Bacteria | 3743 |
| 635 | Ga0395900_0071833 | 3300037418 | Bacteria | 3558 |
| 636 | Ga0395900_0085405 | 3300037418 | Bacteria | 3243 |
| 637 | Ga0395900_0105266 | 3300037418 | Unclassified | 2898 |
| 638 | Ga0395900_0129706 | 3300037418 | Bacteria | 2584 |
| 639 | Ga0395900_0135342 | 3300037418 | Bacteria | 2524 |
| 640 | Ga0395900_0238090 | 3300037418 | Unclassified | 1827 |
| 641 | Ga0395900_0253259 | 3300037418 | Bacteria | 1761 |
| 642 | Ga0395900_0326493 | 3300037418 | Bacteria | 1513 |
| 643 | Ga0395900_0482701 | 3300037418 | Bacteria | 1192 |
| 644 | Ga0395900_0551746 | 3300037418 | Bacteria | 1097 |
| 645 | Ga0395898_0004022 | 3300037466 | Bacteria | 16162 |
| 646 | Ga0395898_0011628 | 3300037466 | Bacteria | 9135 |
| 647 | Ga0395898_0012231 | 3300037466 | Bacteria | 8872 |
| 648 | Ga0395898_0044784 | 3300037466 | Bacteria | 4352 |
| 649 | Ga0395898_0067337 | 3300037466 | Bacteria | 3467 |
| 650 | Ga0395898_0082178 | 3300037466 | Bacteria | 3105 |
| 651 | Ga0395898_0098373 | 3300037466 | Bacteria | 2809 |
| 652 | Ga0395898_0101276 | 3300037466 | Bacteria | 2766 |
| 653 | Ga0395898_0124772 | 3300037466 | Bacteria | 2466 |
| 654 | Ga0395898_0135652 | 3300037466 | Bacteria | 2356 |
| 655 | Ga0395898_0138213 | 3300037466 | Bacteria | 2333 |
| 656 | Ga0395898_0170231 | 3300037466 | Bacteria | 2082 |
| 657 | Ga0395898_0184784 | 3300037466 | Bacteria | 1992 |
| 658 | Ga0395898_0212905 | 3300037466 | Bacteria | 1843 |
| 659 | Ga0395898_0331755 | 3300037466 | Bacteria | 1450 |
| 660 | Ga0395898_0343919 | 3300037466 | Bacteria | 1422 |
| 661 | Ga0395898_0394046 | 3300037466 | Unclassified | 1320 |
| 662 | Ga0395898_0729982 | 3300037466 | Bacteria | 932 |
| 663 | Ga0395905_0006981 | 3300037471 | Bacteria | 11292 |
| 664 | Ga0395905_0010007 | 3300037471 | Bacteria | 9242 |
| 665 | Ga0395905_0017142 | 3300037471 | Bacteria | 6879 |
| 666 | Ga0395905_0027047 | 3300037471 | Bacteria | 5409 |
| 667 | Ga0395905_0035027 | 3300037471 | Bacteria | 4713 |
| 668 | Ga0395905_0037555 | 3300037471 | Bacteria | 4546 |
| 669 | Ga0395905_0039071 | 3300037471 | Bacteria | 4452 |
| 670 | Ga0395905_0107325 | 3300037471 | Bacteria | 2621 |
| 671 | Ga0395905_0120909 | 3300037471 | Unclassified | 2461 |
| 672 | Ga0395905_0175640 | 3300037471 | Bacteria | 2011 |
| 673 | Ga0395905_0226623 | 3300037471 | Bacteria | 1748 |
| 674 | Ga0395905_0389744 | 3300037471 | Unclassified | 1287 |
| 675 | Ga0395905_0542137 | 3300037471 | Bacteria | 1064 |
| 676 | Ga0395905_0553534 | 3300037471 | Bacteria | 1051 |
| 677 | Ga0436364_0434921 | 3300037853 | Bacteria | 10586 |
| 678 | Ga0436364_0706594 | 3300037853 | Bacteria | 1399 |
| 679 | Ga0395901_0001774 | 3300038443 | Bacteria | 22253 |
| 680 | Ga0395901_0003044 | 3300038443 | Bacteria | 16896 |
| 681 | Ga0395901_0004744 | 3300038443 | Bacteria | 13719 |
| 682 | Ga0395901_0006297 | 3300038443 | Bacteria | 12022 |
| 683 | Ga0395901_0007454 | 3300038443 | Bacteria | 11043 |
| 684 | Ga0395901_0009554 | 3300038443 | Bacteria | 9839 |
| 685 | Ga0395901_0019210 | 3300038443 | Bacteria | 6986 |
| 686 | Ga0395901_0027399 | 3300038443 | Bacteria | 5855 |
| 687 | Ga0395901_0030513 | 3300038443 | Bacteria | 5554 |
| 688 | Ga0395901_0036498 | 3300038443 | Bacteria | 5081 |
| 689 | Ga0395901_0043463 | 3300038443 | Bacteria | 4661 |
| 690 | Ga0395901_0045207 | 3300038443 | Bacteria | 4568 |
| 691 | Ga0395901_0059143 | 3300038443 | Bacteria | 3987 |
| 692 | Ga0395901_0072952 | 3300038443 | Bacteria | 3579 |
| 693 | Ga0395901_0084080 | 3300038443 | Bacteria | 3326 |
| 694 | Ga0395901_0103191 | 3300038443 | Bacteria | 2992 |
| 695 | Ga0395901_0112869 | 3300038443 | Bacteria | 2854 |
| 696 | Ga0395901_0116981 | 3300038443 | Bacteria | 2801 |
| 697 | Ga0395901_0201068 | 3300038443 | Bacteria | 2088 |
| 698 | Ga0395901_0205853 | 3300038443 | Unclassified | 2061 |
| 699 | Ga0395901_0249381 | 3300038443 | Bacteria | 1850 |
| 700 | Ga0395901_0294543 | 3300038443 | Bacteria | 1683 |
| 701 | Ga0436365_0032671 | 3300039437 | Bacteria | 13110 |
| 702 | Ga0436365_0623832 | 3300039437 | Bacteria | 4245 |
| 703 | Ga0436365_1576607 | 3300039437 | Bacteria | 861 |
| 704 | Ga0436365_1685261 | 3300039437 | Bacteria | 3556 |
| 705 | Ga0436360_0021796 | 3300039438 | Bacteria | 886 |
| 706 | Ga0436363_0474060 | 3300039450 | Bacteria | 2027 |
| 707 | Ga0436363_0515302 | 3300039450 | Bacteria | 1856 |
| 708 | Ga0436363_0746168 | 3300039450 | Unclassified | 1232 |
| 709 | Ga0436363_1306475 | 3300039450 | Bacteria | 1000 |
| 710 | Ga0436362_0291861 | 3300039453 | Bacteria | 2727 |
| 711 | Ga0436362_0514978 | 3300039453 | Bacteria | 1111 |
| 712 | Ga0439448_0006091 | 3300042005 | Bacteria | 3460 |
| 713 | Ga0439448_0146041 | 3300042005 | Unclassified | 820 |
| 714 | Ga0439455_0009092 | 3300042012 | Bacteria | 2148 |
| 715 | Ga0439460_0066193 | 3300042461 | Bacteria | 1111 |
| 716 | Ga0439460_0127503 | 3300042461 | Bacteria | 837 |
| 717 | Ga0466965_0020394 | 3300044683 | Bacteria | 3186 |
| 718 | Ga0466961_0005010 | 3300044693 | Bacteria | 8326 |
| 719 | Ga0466963_0012641 | 3300044694 | Bacteria | 5171 |
| 720 | Ga0466963_0019209 | 3300044694 | Bacteria | 4282 |
| 721 | Ga0466963_0038359 | 3300044694 | Bacteria | 3132 |
| 722 | Ga0466963_0051754 | 3300044694 | Bacteria | 2723 |
| 723 | Ga0466963_0190766 | 3300044694 | Unclassified | 1432 |
| 724 | Ga0466963_0215510 | 3300044694 | Bacteria | 1344 |
| 725 | Ga0466963_0235098 | 3300044694 | Bacteria | 1285 |
| 726 | Ga0466964_0014724 | 3300044706 | Bacteria | 2975 |
| 727 | Ga0466964_0034295 | 3300044706 | Bacteria | 2025 |
| 728 | Ga0466971_0139842 | 3300044719 | Bacteria | 1127 |
| 729 | Ga0466968_0026194 | 3300044735 | Bacteria | 2392 |
| 730 | Ga0466957_0033734 | 3300044842 | Bacteria | 3071 |
| 731 | Ga0466960_0139842 | 3300044901 | Bacteria | 1285 |
| 732 | Ga0466959_0001162 | 3300045049 | Bacteria | 15834 |
| 733 | Ga0466959_0033183 | 3300045049 | Bacteria | 3819 |
| 734 | Ga0466959_0062471 | 3300045049 | Bacteria | 2706 |
| 735 | Ga0466959_0068728 | 3300045049 | Bacteria | 2567 |
| 736 | Ga0466959_0089007 | 3300045049 | Bacteria | 2219 |
| 737 | Ga0466959_0093107 | 3300045049 | Bacteria | 2163 |
| 738 | Ga0466958_0000699 | 3300045836 | Bacteria | 14611 |
| 739 | Ga0466958_0006923 | 3300045836 | Bacteria | 6204 |
| 740 | Ga0466958_0013542 | 3300045836 | Bacteria | 4645 |
| 741 | Ga0466958_0025331 | 3300045836 | Bacteria | 3497 |
| 742 | Ga0466958_0265496 | 3300045836 | Bacteria | 1099 |
| 743 | Ga0466967_0019062 | 3300045976 | Bacteria | 5506 |
| 744 | Ga0466967_0027543 | 3300045976 | Bacteria | 4729 |
| 745 | Ga0466967_0033807 | 3300045976 | Bacteria | 4332 |
| 746 | Ga0466967_0042760 | 3300045976 | Bacteria | 3918 |
| 747 | Ga0466967_0308668 | 3300045976 | Bacteria | 1523 |
| 748 | Ga0495592_0000024 | 3300046454 | Bacteria | 136661 |
| 749 | Ga0495592_0067947 | 3300046454 | Bacteria | 2603 |
| 750 | Ga0495603_0080576 | 3300046455 | Bacteria | 1908 |
| 751 | Ga0495603_0092934 | 3300046455 | Bacteria | 1763 |
| 752 | Ga0495603_0098108 | 3300046455 | Unclassified | 1711 |
| 753 | Ga0495603_0119633 | 3300046455 | Bacteria | 1535 |
| 754 | Ga0495629_0003244 | 3300046459 | Bacteria | 12317 |
| 755 | Ga0495629_0171844 | 3300046459 | Bacteria | 1504 |
| 756 | Ga0495641_0005768 | 3300046461 | Bacteria | 8226 |
| 757 | Ga0495641_0013989 | 3300046461 | Bacteria | 4368 |
| 758 | Ga0495641_0057271 | 3300046461 | Bacteria | 1766 |
| 759 | Ga0495641_0087164 | 3300046461 | Bacteria | 1397 |
| 760 | Ga0495641_0104129 | 3300046461 | Bacteria | 1266 |
| 761 | Ga0495651_0040552 | 3300046462 | Bacteria | 3620 |
| 762 | Ga0495653_0003414 | 3300046463 | Bacteria | 12774 |
| 763 | Ga0495653_0049834 | 3300046463 | Bacteria | 3223 |
| 764 | Ga0495653_0097751 | 3300046463 | Bacteria | 2132 |
| 765 | Ga0495582_0000028 | 3300046473 | Bacteria | 79694 |
| 766 | Ga0495582_0020593 | 3300046473 | Bacteria | 3611 |
| 767 | Ga0495582_0104437 | 3300046473 | Bacteria | 1588 |
| 768 | Ga0495582_0105911 | 3300046473 | Bacteria | 1577 |
| 769 | Ga0495605_0149100 | 3300046474 | Unclassified | 1045 |
| 770 | Ga0495639_0066522 | 3300046475 | Bacteria | 1659 |
| 771 | Ga0495639_0249977 | 3300046475 | Bacteria | 876 |
| 772 | Ga0495662_0000448 | 3300046476 | Bacteria | 18533 |
| 773 | Ga0495594_0092156 | 3300046499 | Bacteria | 1699 |
| 774 | Ga0495594_0196564 | 3300046499 | Unclassified | 1149 |
| 775 | Ga0495596_0033823 | 3300046500 | Bacteria | 2034 |
| 776 | Ga0495596_0034066 | 3300046500 | Bacteria | 2024 |
| 777 | Ga0495596_0045905 | 3300046500 | Unclassified | 1717 |
| 778 | Ga0495607_0071166 | 3300046501 | Bacteria | 1940 |
| 779 | Ga0495608_0139004 | 3300046511 | Bacteria | 1551 |
| 780 | Ga0495616_0059385 | 3300046513 | Bacteria | 1881 |
| 781 | Ga0495616_0128083 | 3300046513 | Bacteria | 1166 |
| 782 | Ga0495618_0083468 | 3300046514 | Bacteria | 2041 |
| 783 | Ga0495628_0034794 | 3300046516 | Bacteria | 4051 |
| 784 | Ga0495630_0001414 | 3300046517 | Bacteria | 16594 |
| 785 | Ga0495630_0006834 | 3300046517 | Bacteria | 8134 |
| 786 | Ga0495631_0135961 | 3300046518 | Bacteria | 1056 |
| 787 | Ga0495632_0239850 | 3300046519 | Bacteria | 816 |
| 788 | Ga0495644_0115708 | 3300046523 | Bacteria | 1019 |
| 789 | Ga0495663_0020186 | 3300046525 | Bacteria | 1911 |
| 790 | Ga0495663_0068176 | 3300046525 | Bacteria | 1129 |
| 791 | Ga0495666_0017436 | 3300046526 | Unclassified | 3577 |
| 792 | Ga0495652_0058998 | 3300046529 | Bacteria | 3248 |
| 793 | Ga0495665_0000510 | 3300046531 | Bacteria | 19612 |
| 794 | Ga0495665_0051671 | 3300046531 | Bacteria | 2177 |
| 795 | Ga0495665_0192939 | 3300046531 | Bacteria | 1057 |
| 796 | Ga0495640_0009055 | 3300046533 | Bacteria | 7767 |
| 797 | Ga0495640_0070344 | 3300046533 | Bacteria | 2351 |
| 798 | Ga0495586_0000416 | 3300046535 | Bacteria | 25805 |
| 799 | Ga0495598_0041797 | 3300046537 | Bacteria | 1343 |
| 800 | Ga0495645_0000096 | 3300046543 | Bacteria | 60663 |
| 801 | Ga0495645_0029696 | 3300046543 | Bacteria | 3977 |
| 802 | Ga0495645_0222999 | 3300046543 | Bacteria | 1267 |
| 803 | Ga0495633_0153902 | 3300046558 | Bacteria | 1062 |
| 804 | Ga0495667_0002769 | 3300046559 | Bacteria | 11702 |
| 805 | Ga0495667_0015879 | 3300046559 | Bacteria | 5091 |
| 806 | Ga0495668_0080384 | 3300046616 | Bacteria | 1789 |
| 807 | Ga0495634_0010792 | 3300046642 | Bacteria | 6683 |
| 808 | Ga0495634_0022694 | 3300046642 | Bacteria | 4422 |
| 809 | Ga0495635_0003733 | 3300046663 | Bacteria | 10569 |
| 810 | Ga0495635_0017385 | 3300046663 | Bacteria | 5024 |
| 811 | Ga0495635_0027019 | 3300046663 | Bacteria | 3992 |
| 812 | Ga0495659_0056809 | 3300046664 | Bacteria | 1437 |
| 813 | Ga0495588_0319217 | 3300046674 | Bacteria | 817 |
| 814 | Ga0495657_0000027 | 3300046675 | Bacteria | 131421 |
| 815 | Ga0495657_0132396 | 3300046675 | Bacteria | 1561 |
| 816 | Ga0495647_0063423 | 3300046681 | Bacteria | 1463 |
| 817 | Ga0495658_0000356 | 3300046683 | Bacteria | 25845 |
| 818 | Ga0495613_0006132 | 3300046689 | Bacteria | 8997 |
| 819 | Ga0495624_0012550 | 3300046690 | Bacteria | 5786 |
| 820 | Ga0495589_0115699 | 3300046794 | Bacteria | 1293 |
| 821 | Ga0495600_0008124 | 3300046809 | Bacteria | 6438 |
| 822 | Ga0495600_0012918 | 3300046809 | Bacteria | 5234 |
| 823 | Ga0495581_0000589 | 3300047315 | Bacteria | 18974 |
| 824 | Ga0495581_0008442 | 3300047315 | Bacteria | 5974 |
| 825 | Ga0495581_0036720 | 3300047315 | Bacteria | 2835 |
| 826 | Ga0495581_0057184 | 3300047315 | Unclassified | 2251 |
| 827 | Ga0495604_0112987 | 3300047317 | Bacteria | 1978 |
| 828 | Ga0495674_0003615 | 3300047319 | Bacteria | 15050 |
| 829 | Ga0495674_0290143 | 3300047319 | Bacteria | 1338 |
| 830 | Ga0495676_0002194 | 3300047321 | Bacteria | 17296 |
| 831 | Ga0495676_0066469 | 3300047321 | Bacteria | 2794 |
| 832 | Ga0495676_0076321 | 3300047321 | Bacteria | 2559 |
| 833 | Ga0495676_0360213 | 3300047321 | Unclassified | 971 |
| 834 | Ga0495676_0384912 | 3300047321 | Bacteria | 933 |
| 835 | Ga0495680_0000298 | 3300047322 | Bacteria | 55499 |
| 836 | Ga0495680_0022784 | 3300047322 | Bacteria | 5215 |
| 837 | Ga0495680_0035743 | 3300047322 | Bacteria | 3998 |
| 838 | Ga0495683_0160497 | 3300047323 | Bacteria | 1040 |
| 839 | Ga0495677_0048713 | 3300047445 | Bacteria | 1557 |
| 840 | Ga0495677_0158893 | 3300047445 | Bacteria | 872 |
| 841 | Ga0495684_0005161 | 3300047471 | Bacteria | 10176 |
| 842 | Ga0495684_0020263 | 3300047471 | Bacteria | 5123 |
| 843 | Ga0495684_0038293 | 3300047471 | Bacteria | 3678 |
| 844 | Ga0495593_0015393 | 3300047673 | Bacteria | 4333 |
| 845 | Ga0495602_0272617 | 3300048088 | Bacteria | 1250 |
| 846 | Ga0496100_0001935 | 3300048903 | Bacteria | 10355 |
| 847 | Ga0496100_0003218 | 3300048903 | Bacteria | 8479 |
| 848 | Ga0496100_0011017 | 3300048903 | Bacteria | 5129 |
| 849 | Ga0496100_0106640 | 3300048903 | Bacteria | 1939 |
| 850 | Ga0496101_0001199 | 3300048904 | Bacteria | 15511 |
| 851 | Ga0496101_0017486 | 3300048904 | Bacteria | 4864 |
| 852 | Ga0496101_0032607 | 3300048904 | Bacteria | 3668 |
| 853 | Ga0496101_0044045 | 3300048904 | Bacteria | 3192 |
| 854 | Ga0496101_0206430 | 3300048904 | Bacteria | 1520 |
| 855 | Ga0496101_0296791 | 3300048904 | Bacteria | 1265 |
| 856 | Ga0496102_0001299 | 3300048905 | Bacteria | 22455 |
| 857 | Ga0496102_0016678 | 3300048905 | Bacteria | 6424 |
| 858 | Ga0496102_0024499 | 3300048905 | Bacteria | 5366 |
| 859 | Ga0496102_0075914 | 3300048905 | Bacteria | 3090 |
| 860 | Ga0496102_0095291 | 3300048905 | Bacteria | 2758 |
| 861 | Ga0496102_0331326 | 3300048905 | Bacteria | 1434 |
| 862 | Ga0496103_0003383 | 3300048906 | Bacteria | 9747 |
| 863 | Ga0496103_0009549 | 3300048906 | Bacteria | 5743 |
| 864 | Ga0496103_0086756 | 3300048906 | Bacteria | 1972 |
| 865 | Ga0496103_0129235 | 3300048906 | Bacteria | 1613 |
| 866 | Ga0496104_0004546 | 3300048907 | Bacteria | 12086 |
| 867 | Ga0496104_0023051 | 3300048907 | Bacteria | 5720 |
| 868 | Ga0496104_0061270 | 3300048907 | Bacteria | 3567 |
| 869 | Ga0496104_0096032 | 3300048907 | Bacteria | 2836 |
| 870 | Ga0496104_0657938 | 3300048907 | Bacteria | 956 |
| 871 | Ga0496105_0001487 | 3300048908 | Bacteria | 16545 |
| 872 | Ga0496105_0018157 | 3300048908 | Bacteria | 5647 |
| 873 | Ga0496105_0026821 | 3300048908 | Unclassified | 4702 |
| 874 | Ga0496105_0030322 | 3300048908 | Bacteria | 4432 |
| 875 | Ga0496105_0067203 | 3300048908 | Bacteria | 2959 |
| 876 | Ga0496106_0005675 | 3300048909 | Bacteria | 9233 |
| 877 | Ga0496106_0011163 | 3300048909 | Bacteria | 6646 |
| 878 | Ga0496106_0013211 | 3300048909 | Bacteria | 6093 |
| 879 | Ga0496106_0027485 | 3300048909 | Bacteria | 4237 |
| 880 | Ga0496106_0115149 | 3300048909 | Bacteria | 2096 |
| 881 | Ga0496107_0000485 | 3300048910 | Bacteria | 21863 |
| 882 | Ga0496107_0001899 | 3300048910 | Bacteria | 13247 |
| 883 | Ga0496107_0007973 | 3300048910 | Bacteria | 7310 |
| 884 | Ga0496107_0032609 | 3300048910 | Bacteria | 3723 |
| 885 | Ga0496107_0089594 | 3300048910 | Bacteria | 2246 |
| 886 | Ga0496107_0106544 | 3300048910 | Bacteria | 2059 |
| 887 | Ga0496107_0454833 | 3300048910 | Bacteria | 951 |
| 888 | Ga0496108_0011737 | 3300048911 | Bacteria | 7125 |
| 889 | Ga0496108_0016673 | 3300048911 | Bacteria | 6001 |
| 890 | Ga0496108_0022806 | 3300048911 | Bacteria | 5150 |
| 891 | Ga0496108_0041409 | 3300048911 | Bacteria | 3846 |
| 892 | Ga0496108_0139643 | 3300048911 | Bacteria | 2087 |
| 893 | Ga0496108_0313015 | 3300048911 | Bacteria | 1368 |
| 894 | Ga0496109_0010750 | 3300048912 | Bacteria | 7835 |
| 895 | Ga0496109_0122677 | 3300048912 | Unclassified | 2421 |
| 896 | Ga0496109_0126669 | 3300048912 | Bacteria | 2381 |
| 897 | Ga0496109_0280012 | 3300048912 | Bacteria | 1572 |
| 898 | Ga0496110_0002608 | 3300048913 | Bacteria | 13562 |
| 899 | Ga0496110_0025927 | 3300048913 | Bacteria | 5013 |
| 900 | Ga0496110_0110132 | 3300048913 | Bacteria | 2474 |
| 901 | Ga0496110_0114831 | 3300048913 | Bacteria | 2423 |
| 902 | Ga0496110_0381875 | 3300048913 | Bacteria | 1284 |
| 903 | Ga0496110_0384778 | 3300048913 | Bacteria | 1278 |
| 904 | Ga0496110_0392222 | 3300048913 | Bacteria | 1265 |
| 905 | Ga0496111_0033736 | 3300048914 | Bacteria | 3652 |
| 906 | Ga0496111_0040587 | 3300048914 | Unclassified | 3338 |
| 907 | Ga0496111_0043975 | 3300048914 | Unclassified | 3210 |
| 908 | Ga0496111_0063553 | 3300048914 | Bacteria | 2677 |
| 909 | Ga0496111_0147385 | 3300048914 | Unclassified | 1745 |
| 910 | Ga0496111_0248188 | 3300048914 | Bacteria | 1321 |
| 911 | Ga0496111_0562335 | 3300048914 | Bacteria | 837 |
| 912 | Ga0496112_0009522 | 3300048915 | Bacteria | 8761 |
| 913 | Ga0496112_0025748 | 3300048915 | Bacteria | 5651 |
| 914 | Ga0496112_0025813 | 3300048915 | Bacteria | 5645 |
| 915 | Ga0496112_0157698 | 3300048915 | Unclassified | 2236 |
| 916 | Ga0496112_0237441 | 3300048915 | Bacteria | 1776 |
| 917 | Ga0496112_0330562 | 3300048915 | Bacteria | 1468 |
| 918 | Ga0496112_0710478 | 3300048915 | Bacteria | 933 |
| 919 | Ga0496113_0001704 | 3300048916 | Bacteria | 12457 |
| 920 | Ga0496113_0119418 | 3300048916 | Bacteria | 2060 |
| 921 | Ga0496113_0207704 | 3300048916 | Bacteria | 1558 |
| 922 | Ga0496113_0238160 | 3300048916 | Bacteria | 1452 |
| 923 | Ga0496113_0334229 | 3300048916 | Bacteria | 1215 |
| 924 | Ga0496114_0005633 | 3300048917 | Bacteria | 9824 |
| 925 | Ga0496114_0014359 | 3300048917 | Bacteria | 6354 |
| 926 | Ga0496114_0027734 | 3300048917 | Bacteria | 4641 |
| 927 | Ga0496114_0133208 | 3300048917 | Bacteria | 2148 |
| 928 | Ga0496114_0358854 | 3300048917 | Bacteria | 1289 |
| 929 | Ga0496115_0008007 | 3300048918 | Bacteria | 7799 |
| 930 | Ga0496115_0008263 | 3300048918 | Bacteria | 7692 |
| 931 | Ga0496115_0018578 | 3300048918 | Bacteria | 5341 |
| 932 | Ga0496115_0019021 | 3300048918 | Bacteria | 5281 |
| 933 | Ga0496115_0030001 | 3300048918 | Bacteria | 4275 |
| 934 | Ga0496115_0048580 | 3300048918 | Bacteria | 3394 |
| 935 | Ga0496115_0269215 | 3300048918 | Bacteria | 1400 |
| 936 | Ga0496115_0604794 | 3300048918 | Bacteria | 871 |
| 937 | Ga0501038_0551879 | 3300049574 | Bacteria | 876 |
| 938 | Ga0501040_0483549 | 3300049576 | Bacteria | 892 |
| 939 | Ga0501067_0005277 | 3300049583 | Bacteria | 7178 |
| 940 | Ga0501067_0013055 | 3300049583 | Bacteria | 4597 |
| 941 | Ga0501067_0020211 | 3300049583 | Unclassified | 3684 |
| 942 | Ga0501067_0072306 | 3300049583 | Bacteria | 1910 |
| 943 | Ga0501067_0089170 | 3300049583 | Bacteria | 1712 |
| 944 | Ga0501068_0335852 | 3300049584 | Bacteria | 970 |
| 945 | Ga0501069_0039259 | 3300049585 | Bacteria | 2615 |
| 946 | Ga0501069_0045395 | 3300049585 | Bacteria | 2434 |
| 947 | Ga0501069_0121306 | 3300049585 | Bacteria | 1493 |
| 948 | Ga0501071_0162630 | 3300049587 | Unclassified | 1669 |
| 949 | Ga0501076_0063794 | 3300049592 | Bacteria | 2936 |
| 950 | Ga0501209_082374 | 3300049656 | Bacteria | 929 |
| 951 | Ga0501216_039765 | 3300049660 | Unclassified | 896 |
| 952 | nmdc:mga00v17_13500_c1 | 3300050491 | Bacteria | 4538 |
| 953 | nmdc:mga00v17_146630_c1 | 3300050491 | Bacteria | 1515 |
| 954 | nmdc:mga00v17_55987_c1 | 3300050491 | Bacteria | 2410 |
| 955 | nmdc:mga0yw44_116985_c1 | 3300050492 | Bacteria | 1714 |
| 956 | nmdc:mga0yw44_164311_c1 | 3300050492 | Bacteria | 1455 |
| 957 | nmdc:mga0yw44_181783_c1 | 3300050492 | Bacteria | 1384 |
| 958 | nmdc:mga0yw44_30517_c1 | 3300050492 | Unclassified | 3125 |
| 959 | nmdc:mga0yw44_51598_c1 | 3300050492 | Bacteria | 2491 |
| 960 | nmdc:mga06z11_131671_c1 | 3300050494 | Bacteria | 1405 |
| 961 | nmdc:mga06z11_248868_c1 | 3300050494 | Bacteria | 1046 |
| 962 | nmdc:mga06z11_46860_c1 | 3300050494 | Bacteria | 2192 |
| 963 | nmdc:mga04h51_15383_c1 | 3300050495 | Bacteria | 2203 |
| 964 | nmdc:mga05p37_154102_c1 | 3300050507 | Bacteria | 2809 |
| 965 | nmdc:mga05p37_176431_c1 | 3300050507 | Bacteria | 2603 |
| 966 | nmdc:mga05p37_209249_c1 | 3300050507 | Bacteria | 2358 |
| 967 | nmdc:mga05p37_210860_c1 | 3300050507 | Bacteria | 2348 |
| 968 | nmdc:mga05p37_289704_c1 | 3300050507 | Bacteria | 1949 |
| 969 | nmdc:mga05p37_292223_c1 | 3300050507 | Bacteria | 1939 |
| 970 | nmdc:mga05p37_300929_c1 | 3300050507 | Bacteria | 1906 |
| 971 | nmdc:mga05p37_43955_c1 | 3300050507 | Bacteria | 5496 |
| 972 | nmdc:mga05p37_4402_c1 | 3300050507 | Bacteria | 16459 |
| 973 | nmdc:mga05p37_54415_c1 | 3300050507 | Bacteria | 4924 |
| 974 | nmdc:mga05p37_58954_c1 | 3300050507 | Unclassified | 4728 |
| 975 | nmdc:mga05p37_66039_c1 | 3300050507 | Bacteria | 4451 |
| 976 | nmdc:mga05p37_84117_c1 | 3300050507 | Bacteria | 3920 |
| 977 | nmdc:mga05p37_886432_c1 | 3300050507 | Unclassified | 964 |
| 978 | nmdc:mga05p37_9555_c1 | 3300050507 | Bacteria | 11485 |
| 979 | nmdc:mga09592_145650_c1 | 3300050508 | Bacteria | 2042 |
| 980 | nmdc:mga09592_164877_c1 | 3300050508 | Bacteria | 1915 |
| 981 | nmdc:mga09592_478220_c1 | 3300050508 | Bacteria | 1073 |
| 982 | nmdc:mga0qj67_212160_c1 | 3300050509 | Bacteria | 1572 |
| 983 | nmdc:mga0qj67_257273_c1 | 3300050509 | Bacteria | 1416 |
| 984 | nmdc:mga0qj67_27476_c1 | 3300050509 | Bacteria | 4412 |
| 985 | nmdc:mga0qj67_73309_c1 | 3300050509 | Bacteria | 2734 |
| 986 | nmdc:mga06r32_12571_c1 | 3300050510 | Bacteria | 7644 |
| 987 | nmdc:mga06r32_19742_c1 | 3300050510 | Bacteria | 6193 |
| 988 | nmdc:mga06r32_358663_c1 | 3300050510 | Unclassified | 1442 |
| 989 | nmdc:mga06r32_60961_c1 | 3300050510 | Bacteria | 3631 |
| 990 | nmdc:mga06r32_64436_c2 | 3300050510 | Unclassified | 2347 |
| 991 | nmdc:mga06r32_78823_c1 | 3300050510 | Plasmid | 3203 |
| 992 | nmdc:mga08y16_137694_c1 | 3300050511 | Bacteria | 2538 |
| 993 | nmdc:mga08y16_221394_c1 | 3300050511 | Unclassified | 1959 |
| 994 | nmdc:mga08y16_46471_c1 | 3300050511 | Bacteria | 4545 |
| 995 | nmdc:mga08y16_587600_c1 | 3300050511 | Bacteria | 1123 |
| 996 | nmdc:mga08y16_64633_c1 | 3300050511 | Bacteria | 3820 |
| 997 | nmdc:mga08y16_783687_c1 | 3300050511 | Unclassified | 947 |
| 998 | nmdc:mga08y16_8878_c1 | 3300050511 | Bacteria | 10552 |
| 999 | nmdc:mga0n895_106274_c1 | 3300050512 | Bacteria | 2820 |
| 1000 | nmdc:mga0n895_134372_c1 | 3300050512 | Bacteria | 2500 |
| 1001 | nmdc:mga0n895_271288_c1 | 3300050512 | Bacteria | 1721 |
| 1002 | nmdc:mga0n895_316404_c1 | 3300050512 | Bacteria | 1582 |
| 1003 | nmdc:mga0n895_425375_c1 | 3300050512 | Bacteria | 1342 |
| 1004 | nmdc:mga0n895_432283_c1 | 3300050512 | Bacteria | 1330 |
| 1005 | nmdc:mga0n895_641836_c1 | 3300050512 | Bacteria | 1061 |
| 1006 | nmdc:mga0n895_6827_c1 | 3300050512 | Bacteria | 9745 |
| 1007 | nmdc:mga0n895_87870_c1 | 3300050512 | Bacteria | 3107 |
| 1008 | nmdc:mga0rr50_159551_c1 | 3300050513 | Bacteria | 1830 |
| 1009 | nmdc:mga0rr50_15994_c1 | 3300050513 | Bacteria | 4969 |
| 1010 | nmdc:mga0rr50_17058_c1 | 3300050513 | Bacteria | 4838 |
| 1011 | nmdc:mga0rr50_173052_c1 | 3300050513 | Bacteria | 1761 |
| 1012 | nmdc:mga0rr50_270156_c1 | 3300050513 | Bacteria | 1417 |
| 1013 | nmdc:mga0rr50_324426_c1 | 3300050513 | Bacteria | 1291 |
| 1014 | nmdc:mga0rr50_60199_c1 | 3300050513 | Bacteria | 2856 |
| 1015 | nmdc:mga08x19_104241_c1 | 3300050514 | Bacteria | 1885 |
| 1016 | nmdc:mga08x19_259661_c1 | 3300050514 | Bacteria | 1201 |
| 1017 | nmdc:mga08x19_59250_c1 | 3300050514 | Bacteria | 2478 |
| 1018 | nmdc:mga08x19_5982_c1 | 3300050514 | Bacteria | 7194 |
| 1019 | nmdc:mga0a205_152148_c1 | 3300050515 | Bacteria | 2213 |
| 1020 | nmdc:mga0a205_157349_c1 | 3300050515 | Bacteria | 2170 |
| 1021 | nmdc:mga0a205_212542_c1 | 3300050515 | Bacteria | 1822 |
| 1022 | nmdc:mga0a205_278056_c1 | 3300050515 | Bacteria | 1550 |
| 1023 | nmdc:mga0a205_33881_c1 | 3300050515 | Bacteria | 4898 |
| 1024 | nmdc:mga0a205_37515_c1 | 3300050515 | Bacteria | 4660 |
| 1025 | nmdc:mga0a205_3829_c1 | 3300050515 | Bacteria | 13479 |
| 1026 | nmdc:mga0a205_478416_c1 | 3300050515 | Unclassified | 1104 |
| 1027 | nmdc:mga0a205_730752_c1 | 3300050515 | Bacteria | 839 |
| 1028 | nmdc:mga0a205_77257_c1 | 3300050515 | Bacteria | 3217 |
| 1029 | Ga0495601_0000244 | 3300053077 | Bacteria | 29047 |
| 1030 | Ga0495601_0099836 | 3300053077 | Unclassified | 1874 |
| 1031 | Ga0495612_0000024 | 3300053078 | Bacteria | 115718 |
| 1032 | Ga0495655_0056459 | 3300053083 | Bacteria | 1057 |
| 1033 | Ga0495595_0112753 | 3300053084 | Bacteria | 1320 |
| 1034 | Ga0495619_0169104 | 3300053085 | Bacteria | 1511 |
| 1035 | Ga0587071_056674 | 3300060344 | Bacteria | 823 |
| 1036 | Ga0466962_0009567 | 3300061719 | Bacteria | 4647 |
| 1037 | Ga0466962_0013330 | 3300061719 | Bacteria | 3957 |
| 1038 | Ga0466962_0058285 | 3300061719 | Bacteria | 1844 |
| 1039 | Ga0466962_0116512 | 3300061719 | Bacteria | 1287 |
| 1040 | Ga0530510_0028109 | 3300061734 | Bacteria | 4033 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046455 | Ga0495603_0080576 | Ga0495603_0080576_1284_1889 | 201 |
| 2 | 3300039438 | Ga0436360_0021796 | Ga0436360_0021796_246_857 | 203 |
| 3 | 3300045836 | Ga0466958_0265496 | Ga0466958_0265496_466_1089 | 203 |
| 4 | 3300048916 | Ga0496113_0334229 | Ga0496113_0334229_593_1204 | 203 |
| 5 | 3300049574 | Ga0501038_0551879 | Ga0501038_0551879_24_635 | 203 |
| 6 | 3300050494 | nmdc:mga06z11_248868_c1 | nmdc:mga06z11_248868_c1_136_747 | 203 |
| 7 | 3300009177 | Ga0105248_11593278 | Ga0105248_115932781 | 206 |
| 8 | 3300048913 | Ga0496110_0114831 | Ga0496110_0114831_255_1154 | 220 |
| 9 | 3300048914 | Ga0496111_0147385 | Ga0496111_0147385_89_988 | 220 |
| 10 | 3300006846 | Ga0075430_100022119 | Ga0075430_1000221199 | 221 |
| 11 | 3300006847 | Ga0075431_100282525 | Ga0075431_1002825252 | 221 |
| 12 | 3300006880 | Ga0075429_100033200 | Ga0075429_1000332002 | 221 |
| 13 | 3300050508 | nmdc:mga09592_164877_c1 | nmdc:mga09592_164877_c1_974_1714 | 221 |
| 14 | 3300050510 | nmdc:mga06r32_60961_c1 | nmdc:mga06r32_60961_c1_1959_2699 | 221 |
| 15 | 3300039450 | Ga0436363_0474060 | Ga0436363_0474060_619_1359 | 229 |
| 16 | 3300006844 | Ga0075428_100011990 | Ga0075428_1000119906 | 232 |
| 17 | 3300009147 | Ga0114129_10008186 | Ga0114129_100081867 | 232 |
| 18 | 3300050507 | nmdc:mga05p37_4402_c1 | nmdc:mga05p37_4402_c1_12914_13651 | 232 |
| 19 | 3300005436 | Ga0070713_100705421 | Ga0070713_1007054211 | 235 |
| 20 | 3300049583 | Ga0501067_0005277 | Ga0501067_0005277_1991_2728 | 236 |
| 21 | 3300049585 | Ga0501069_0039259 | Ga0501069_0039259_1451_2188 | 236 |
| 22 | 3300003373 | JGI25407J50210_10008973 | JGI25407J50210_100089734 | 237 |
| 23 | 3300005981 | Ga0081538_10007198 | Ga0081538_1000719813 | 237 |
| 24 | 3300025906 | Ga0207699_10120033 | Ga0207699_101200334 | 238 |
| 25 | 3300025961 | Ga0207712_10212611 | Ga0207712_102126112 | 240 |
| 26 | 3300025928 | Ga0207700_10304288 | Ga0207700_103042882 | 243 |
| 27 | 3300025929 | Ga0207664_10401410 | Ga0207664_104014102 | 243 |
| 28 | 3300025945 | Ga0207679_10743176 | Ga0207679_107431761 | 243 |
| 29 | 3300005329 | Ga0070683_100939499 | Ga0070683_1009394991 | 244 |
| 30 | 3300005435 | Ga0070714_100010256 | Ga0070714_1000102568 | 244 |
| 31 | 3300005436 | Ga0070713_100133794 | Ga0070713_1001337942 | 244 |
| 32 | 3300005439 | Ga0070711_100481169 | Ga0070711_1004811691 | 244 |
| 33 | 3300005441 | Ga0070700_100178438 | Ga0070700_1001784382 | 244 |
| 34 | 3300005518 | Ga0070699_100000709 | Ga0070699_10000070916 | 244 |
| 35 | 3300005535 | Ga0070684_100832321 | Ga0070684_1008323211 | 244 |
| 36 | 3300005564 | Ga0070664_100110841 | Ga0070664_1001108411 | 244 |
| 37 | 3300005937 | Ga0081455_10047229 | Ga0081455_100472295 | 244 |
| 38 | 3300005985 | Ga0081539_10085440 | Ga0081539_100854403 | 244 |
| 39 | 3300009094 | Ga0111539_10212532 | Ga0111539_102125322 | 244 |
| 40 | 3300009147 | Ga0114129_10032163 | Ga0114129_100321635 | 244 |
| 41 | 3300009147 | Ga0114129_10252578 | Ga0114129_102525782 | 244 |
| 42 | 3300014497 | Ga0182008_10067232 | Ga0182008_100672322 | 244 |
| 43 | 3300020070 | Ga0206356_11431924 | Ga0206356_114319241 | 244 |
| 44 | 3300025927 | Ga0207687_10320327 | Ga0207687_103203272 | 244 |
| 45 | 3300025929 | Ga0207664_10005864 | Ga0207664_100058644 | 244 |
| 46 | 3300026078 | Ga0207702_10486576 | Ga0207702_104865762 | 244 |
| 47 | 3300026116 | Ga0207674_10058060 | Ga0207674_100580604 | 244 |
| 48 | 3300037312 | Ga0395899_0028499 | Ga0395899_0028499_2605_3339 | 244 |
| 49 | 3300037312 | Ga0395899_0076300 | Ga0395899_0076300_618_1361 | 244 |
| 50 | 3300037418 | Ga0395900_0025244 | Ga0395900_0025244_4596_5330 | 244 |
| 51 | 3300037418 | Ga0395900_0085405 | Ga0395900_0085405_942_1685 | 244 |
| 52 | 3300037466 | Ga0395898_0004022 | Ga0395898_0004022_7736_8470 | 244 |
| 53 | 3300037466 | Ga0395898_0098373 | Ga0395898_0098373_860_1594 | 244 |
| 54 | 3300037466 | Ga0395898_0135652 | Ga0395898_0135652_995_1738 | 244 |
| 55 | 3300037466 | Ga0395898_0729982 | Ga0395898_0729982_96_830 | 244 |
| 56 | 3300037471 | Ga0395905_0006981 | Ga0395905_0006981_4397_5131 | 244 |
| 57 | 3300037471 | Ga0395905_0226623 | Ga0395905_0226623_780_1523 | 244 |
| 58 | 3300037471 | Ga0395905_0542137 | Ga0395905_0542137_26_760 | 244 |
| 59 | 3300038443 | Ga0395901_0004744 | Ga0395901_0004744_6372_7106 | 244 |
| 60 | 3300038443 | Ga0395901_0084080 | Ga0395901_0084080_2067_2801 | 244 |
| 61 | 3300038443 | Ga0395901_0201068 | Ga0395901_0201068_619_1362 | 244 |
| 62 | 3300045049 | Ga0466959_0068728 | Ga0466959_0068728_1503_2246 | 244 |
| 63 | 3300045836 | Ga0466958_0013542 | Ga0466958_0013542_178_921 | 244 |
| 64 | 3300048914 | Ga0496111_0063553 | Ga0496111_0063553_1352_2086 | 244 |
| 65 | 3300048916 | Ga0496113_0238160 | Ga0496113_0238160_146_880 | 244 |
| 66 | 3300048917 | Ga0496114_0358854 | Ga0496114_0358854_442_1176 | 244 |
| 67 | 3300049583 | Ga0501067_0089170 | Ga0501067_0089170_766_1509 | 244 |
| 68 | 3300050507 | nmdc:mga05p37_210860_c1 | nmdc:mga05p37_210860_c1_955_1698 | 244 |
| 69 | 3300050509 | nmdc:mga0qj67_257273_c1 | nmdc:mga0qj67_257273_c1_403_1137 | 244 |
| 70 | 3300050511 | nmdc:mga08y16_137694_c1 | nmdc:mga08y16_137694_c1_1235_1978 | 244 |
| 71 | 3300050515 | nmdc:mga0a205_478416_c1 | nmdc:mga0a205_478416_c1_78_821 | 244 |
| 72 | 3300060344 | Ga0587071_056674 | Ga0587071_056674_61_804 | 244 |
| 73 | 3300061734 | Ga0530510_0028109 | Ga0530510_0028109_2023_2760 | 244 |
| 74 | 3300003373 | JGI25407J50210_10001507 | JGI25407J50210_100015071 | 245 |
| 75 | 3300003373 | JGI25407J50210_10011522 | JGI25407J50210_100115222 | 245 |
| 76 | 3300003373 | JGI25407J50210_10047189 | JGI25407J50210_100471892 | 245 |
| 77 | 3300005327 | Ga0070658_10115835 | Ga0070658_101158353 | 245 |
| 78 | 3300005329 | Ga0070683_100013253 | Ga0070683_1000132536 | 245 |
| 79 | 3300005329 | Ga0070683_100044886 | Ga0070683_1000448862 | 245 |
| 80 | 3300005329 | Ga0070683_100047910 | Ga0070683_1000479106 | 245 |
| 81 | 3300005329 | Ga0070683_100113734 | Ga0070683_1001137342 | 245 |
| 82 | 3300005329 | Ga0070683_100513861 | Ga0070683_1005138612 | 245 |
| 83 | 3300005330 | Ga0070690_100045622 | Ga0070690_1000456222 | 245 |
| 84 | 3300005334 | Ga0068869_100104383 | Ga0068869_1001043832 | 245 |
| 85 | 3300005336 | Ga0070680_100023564 | Ga0070680_1000235646 | 245 |
| 86 | 3300005336 | Ga0070680_100057319 | Ga0070680_1000573192 | 245 |
| 87 | 3300005336 | Ga0070680_100093720 | Ga0070680_1000937202 | 245 |
| 88 | 3300005336 | Ga0070680_100287394 | Ga0070680_1002873941 | 245 |
| 89 | 3300005337 | Ga0070682_100026173 | Ga0070682_1000261732 | 245 |
| 90 | 3300005337 | Ga0070682_100062012 | Ga0070682_1000620123 | 245 |
| 91 | 3300005337 | Ga0070682_100367311 | Ga0070682_1003673111 | 245 |
| 92 | 3300005338 | Ga0068868_100284876 | Ga0068868_1002848763 | 245 |
| 93 | 3300005339 | Ga0070660_100005554 | Ga0070660_1000055542 | 245 |
| 94 | 3300005339 | Ga0070660_100008896 | Ga0070660_1000088963 | 245 |
| 95 | 3300005344 | Ga0070661_100029503 | Ga0070661_1000295032 | 245 |
| 96 | 3300005344 | Ga0070661_100163728 | Ga0070661_1001637281 | 245 |
| 97 | 3300005345 | Ga0070692_10003017 | Ga0070692_100030174 | 245 |
| 98 | 3300005345 | Ga0070692_10046853 | Ga0070692_100468533 | 245 |
| 99 | 3300005347 | Ga0070668_100005321 | Ga0070668_1000053216 | 245 |
| 100 | 3300005347 | Ga0070668_100090989 | Ga0070668_1000909893 | 245 |
| 101 | 3300005347 | Ga0070668_100148982 | Ga0070668_1001489823 | 245 |
| 102 | 3300005347 | Ga0070668_100203341 | Ga0070668_1002033412 | 245 |
| 103 | 3300005353 | Ga0070669_100621992 | Ga0070669_1006219922 | 245 |
| 104 | 3300005354 | Ga0070675_100030266 | Ga0070675_1000302664 | 245 |
| 105 | 3300005354 | Ga0070675_100299541 | Ga0070675_1002995412 | 245 |
| 106 | 3300005355 | Ga0070671_100151973 | Ga0070671_1001519732 | 245 |
| 107 | 3300005355 | Ga0070671_100462487 | Ga0070671_1004624871 | 245 |
| 108 | 3300005356 | Ga0070674_100042039 | Ga0070674_1000420393 | 245 |
| 109 | 3300005356 | Ga0070674_100194634 | Ga0070674_1001946343 | 245 |
| 110 | 3300005356 | Ga0070674_100487106 | Ga0070674_1004871061 | 245 |
| 111 | 3300005365 | Ga0070688_100010646 | Ga0070688_1000106464 | 245 |
| 112 | 3300005366 | Ga0070659_100004504 | Ga0070659_1000045044 | 245 |
| 113 | 3300005366 | Ga0070659_100054848 | Ga0070659_1000548483 | 245 |
| 114 | 3300005366 | Ga0070659_100554391 | Ga0070659_1005543911 | 245 |
| 115 | 3300005367 | Ga0070667_100245436 | Ga0070667_1002454362 | 245 |
| 116 | 3300005434 | Ga0070709_10048625 | Ga0070709_100486252 | 245 |
| 117 | 3300005434 | Ga0070709_10052381 | Ga0070709_100523812 | 245 |
| 118 | 3300005434 | Ga0070709_10054046 | Ga0070709_100540462 | 245 |
| 119 | 3300005435 | Ga0070714_100005053 | Ga0070714_1000050532 | 245 |
| 120 | 3300005435 | Ga0070714_100103275 | Ga0070714_1001032752 | 245 |
| 121 | 3300005435 | Ga0070714_100113766 | Ga0070714_1001137662 | 245 |
| 122 | 3300005435 | Ga0070714_100450171 | Ga0070714_1004501712 | 245 |
| 123 | 3300005435 | Ga0070714_100460668 | Ga0070714_1004606682 | 245 |
| 124 | 3300005435 | Ga0070714_100857541 | Ga0070714_1008575411 | 245 |
| 125 | 3300005436 | Ga0070713_100043272 | Ga0070713_1000432722 | 245 |
| 126 | 3300005436 | Ga0070713_100062584 | Ga0070713_1000625844 | 245 |
| 127 | 3300005436 | Ga0070713_100087824 | Ga0070713_1000878242 | 245 |
| 128 | 3300005436 | Ga0070713_100280041 | Ga0070713_1002800411 | 245 |
| 129 | 3300005437 | Ga0070710_10015128 | Ga0070710_100151285 | 245 |
| 130 | 3300005437 | Ga0070710_10091091 | Ga0070710_100910913 | 245 |
| 131 | 3300005437 | Ga0070710_10172943 | Ga0070710_101729432 | 245 |
| 132 | 3300005437 | Ga0070710_10276796 | Ga0070710_102767961 | 245 |
| 133 | 3300005438 | Ga0070701_10028242 | Ga0070701_100282422 | 245 |
| 134 | 3300005438 | Ga0070701_10205805 | Ga0070701_102058052 | 245 |
| 135 | 3300005439 | Ga0070711_100005462 | Ga0070711_1000054623 | 245 |
| 136 | 3300005439 | Ga0070711_100037574 | Ga0070711_1000375743 | 245 |
| 137 | 3300005439 | Ga0070711_100079539 | Ga0070711_1000795392 | 245 |
| 138 | 3300005439 | Ga0070711_100188482 | Ga0070711_1001884821 | 245 |
| 139 | 3300005439 | Ga0070711_100565915 | Ga0070711_1005659151 | 245 |
| 140 | 3300005440 | Ga0070705_100021223 | Ga0070705_1000212232 | 245 |
| 141 | 3300005440 | Ga0070705_100318368 | Ga0070705_1003183681 | 245 |
| 142 | 3300005441 | Ga0070700_100019120 | Ga0070700_1000191204 | 245 |
| 143 | 3300005441 | Ga0070700_100047266 | Ga0070700_1000472663 | 245 |
| 144 | 3300005441 | Ga0070700_100137042 | Ga0070700_1001370421 | 245 |
| 145 | 3300005445 | Ga0070708_100037038 | Ga0070708_1000370385 | 245 |
| 146 | 3300005445 | Ga0070708_100079609 | Ga0070708_1000796094 | 245 |
| 147 | 3300005445 | Ga0070708_100154856 | Ga0070708_1001548563 | 245 |
| 148 | 3300005445 | Ga0070708_100162787 | Ga0070708_1001627873 | 245 |
| 149 | 3300005445 | Ga0070708_100241101 | Ga0070708_1002411012 | 245 |
| 150 | 3300005445 | Ga0070708_100285405 | Ga0070708_1002854052 | 245 |
| 151 | 3300005445 | Ga0070708_100321166 | Ga0070708_1003211662 | 245 |
| 152 | 3300005445 | Ga0070708_100462749 | Ga0070708_1004627491 | 245 |
| 153 | 3300005456 | Ga0070678_100004320 | Ga0070678_1000043202 | 245 |
| 154 | 3300005457 | Ga0070662_100186375 | Ga0070662_1001863753 | 245 |
| 155 | 3300005457 | Ga0070662_100210571 | Ga0070662_1002105712 | 245 |
| 156 | 3300005458 | Ga0070681_10003999 | Ga0070681_1000399911 | 245 |
| 157 | 3300005458 | Ga0070681_10007241 | Ga0070681_100072416 | 245 |
| 158 | 3300005458 | Ga0070681_10026548 | Ga0070681_100265482 | 245 |
| 159 | 3300005458 | Ga0070681_10235521 | Ga0070681_102355212 | 245 |
| 160 | 3300005459 | Ga0068867_100057511 | Ga0068867_1000575113 | 245 |
| 161 | 3300005459 | Ga0068867_100090980 | Ga0068867_1000909803 | 245 |
| 162 | 3300005466 | Ga0070685_10002573 | Ga0070685_100025734 | 245 |
| 163 | 3300005467 | Ga0070706_100000355 | Ga0070706_10000035525 | 245 |
| 164 | 3300005467 | Ga0070706_100003262 | Ga0070706_10000326220 | 245 |
| 165 | 3300005467 | Ga0070706_100003466 | Ga0070706_10000346619 | 245 |
| 166 | 3300005467 | Ga0070706_100038316 | Ga0070706_1000383161 | 245 |
| 167 | 3300005467 | Ga0070706_100110440 | Ga0070706_1001104401 | 245 |
| 168 | 3300005467 | Ga0070706_100203845 | Ga0070706_1002038451 | 245 |
| 169 | 3300005467 | Ga0070706_100210914 | Ga0070706_1002109142 | 245 |
| 170 | 3300005467 | Ga0070706_100285776 | Ga0070706_1002857762 | 245 |
| 171 | 3300005468 | Ga0070707_100015988 | Ga0070707_1000159888 | 245 |
| 172 | 3300005468 | Ga0070707_100060696 | Ga0070707_1000606962 | 245 |
| 173 | 3300005468 | Ga0070707_100085492 | Ga0070707_1000854925 | 245 |
| 174 | 3300005468 | Ga0070707_100094045 | Ga0070707_1000940452 | 245 |
| 175 | 3300005468 | Ga0070707_100127246 | Ga0070707_1001272466 | 245 |
| 176 | 3300005468 | Ga0070707_100218182 | Ga0070707_1002181822 | 245 |
| 177 | 3300005471 | Ga0070698_100000877 | Ga0070698_1000008771 | 245 |
| 178 | 3300005471 | Ga0070698_100003968 | Ga0070698_1000039683 | 245 |
| 179 | 3300005471 | Ga0070698_100008006 | Ga0070698_1000080068 | 245 |
| 180 | 3300005471 | Ga0070698_100010517 | Ga0070698_1000105173 | 245 |
| 181 | 3300005471 | Ga0070698_100010654 | Ga0070698_1000106544 | 245 |
| 182 | 3300005471 | Ga0070698_100019558 | Ga0070698_1000195585 | 245 |
| 183 | 3300005471 | Ga0070698_100039520 | Ga0070698_1000395201 | 245 |
| 184 | 3300005471 | Ga0070698_100061762 | Ga0070698_1000617624 | 245 |
| 185 | 3300005471 | Ga0070698_100067691 | Ga0070698_1000676913 | 245 |
| 186 | 3300005471 | Ga0070698_100072849 | Ga0070698_1000728492 | 245 |
| 187 | 3300005471 | Ga0070698_100148510 | Ga0070698_1001485102 | 245 |
| 188 | 3300005471 | Ga0070698_100156240 | Ga0070698_1001562402 | 245 |
| 189 | 3300005471 | Ga0070698_100535091 | Ga0070698_1005350912 | 245 |
| 190 | 3300005471 | Ga0070698_100689082 | Ga0070698_1006890821 | 245 |
| 191 | 3300005471 | Ga0070698_100771940 | Ga0070698_1007719401 | 245 |
| 192 | 3300005518 | Ga0070699_100000462 | Ga0070699_10000046239 | 245 |
| 193 | 3300005518 | Ga0070699_100000530 | Ga0070699_10000053040 | 245 |
| 194 | 3300005518 | Ga0070699_100000806 | Ga0070699_1000008064 | 245 |
| 195 | 3300005518 | Ga0070699_100031673 | Ga0070699_1000316732 | 245 |
| 196 | 3300005518 | Ga0070699_100131023 | Ga0070699_1001310232 | 245 |
| 197 | 3300005518 | Ga0070699_100498837 | Ga0070699_1004988371 | 245 |
| 198 | 3300005518 | Ga0070699_100540861 | Ga0070699_1005408612 | 245 |
| 199 | 3300005530 | Ga0070679_100009018 | Ga0070679_1000090186 | 245 |
| 200 | 3300005530 | Ga0070679_100017027 | Ga0070679_1000170277 | 245 |
| 201 | 3300005530 | Ga0070679_100095839 | Ga0070679_1000958393 | 245 |
| 202 | 3300005530 | Ga0070679_100129973 | Ga0070679_1001299732 | 245 |
| 203 | 3300005530 | Ga0070679_100192735 | Ga0070679_1001927355 | 245 |
| 204 | 3300005530 | Ga0070679_100376282 | Ga0070679_1003762821 | 245 |
| 205 | 3300005535 | Ga0070684_100185372 | Ga0070684_1001853723 | 245 |
| 206 | 3300005535 | Ga0070684_100185386 | Ga0070684_1001853862 | 245 |
| 207 | 3300005535 | Ga0070684_100498416 | Ga0070684_1004984161 | 245 |
| 208 | 3300005535 | Ga0070684_100560062 | Ga0070684_1005600621 | 245 |
| 209 | 3300005536 | Ga0070697_100000066 | Ga0070697_10000006691 | 245 |
| 210 | 3300005536 | Ga0070697_100002722 | Ga0070697_10000272210 | 245 |
| 211 | 3300005536 | Ga0070697_100006497 | Ga0070697_1000064973 | 245 |
| 212 | 3300005536 | Ga0070697_100050318 | Ga0070697_1000503183 | 245 |
| 213 | 3300005536 | Ga0070697_100060774 | Ga0070697_1000607743 | 245 |
| 214 | 3300005539 | Ga0068853_100207035 | Ga0068853_1002070353 | 245 |
| 215 | 3300005539 | Ga0068853_100303761 | Ga0068853_1003037611 | 245 |
| 216 | 3300005543 | Ga0070672_100057173 | Ga0070672_1000571734 | 245 |
| 217 | 3300005544 | Ga0070686_100002093 | Ga0070686_1000020933 | 245 |
| 218 | 3300005545 | Ga0070695_100063594 | Ga0070695_1000635942 | 245 |
| 219 | 3300005545 | Ga0070695_100259151 | Ga0070695_1002591512 | 245 |
| 220 | 3300005546 | Ga0070696_100003739 | Ga0070696_1000037399 | 245 |
| 221 | 3300005546 | Ga0070696_100010458 | Ga0070696_1000104584 | 245 |
| 222 | 3300005546 | Ga0070696_100031550 | Ga0070696_1000315502 | 245 |
| 223 | 3300005547 | Ga0070693_100025536 | Ga0070693_1000255362 | 245 |
| 224 | 3300005547 | Ga0070693_100026449 | Ga0070693_1000264491 | 245 |
| 225 | 3300005548 | Ga0070665_100034039 | Ga0070665_1000340393 | 245 |
| 226 | 3300005548 | Ga0070665_100159951 | Ga0070665_1001599513 | 245 |
| 227 | 3300005548 | Ga0070665_100664774 | Ga0070665_1006647741 | 245 |
| 228 | 3300005549 | Ga0070704_100123440 | Ga0070704_1001234402 | 245 |
| 229 | 3300005549 | Ga0070704_100257264 | Ga0070704_1002572642 | 245 |
| 230 | 3300005563 | Ga0068855_100011061 | Ga0068855_10001106110 | 245 |
| 231 | 3300005563 | Ga0068855_100076710 | Ga0068855_1000767104 | 245 |
| 232 | 3300005563 | Ga0068855_100112342 | Ga0068855_1001123423 | 245 |
| 233 | 3300005563 | Ga0068855_100204031 | Ga0068855_1002040312 | 245 |
| 234 | 3300005563 | Ga0068855_100254819 | Ga0068855_1002548192 | 245 |
| 235 | 3300005563 | Ga0068855_100476220 | Ga0068855_1004762201 | 245 |
| 236 | 3300005563 | Ga0068855_100612133 | Ga0068855_1006121331 | 245 |
| 237 | 3300005564 | Ga0070664_100063839 | Ga0070664_1000638395 | 245 |
| 238 | 3300005564 | Ga0070664_100513122 | Ga0070664_1005131222 | 245 |
| 239 | 3300005564 | Ga0070664_100546534 | Ga0070664_1005465342 | 245 |
| 240 | 3300005577 | Ga0068857_100020142 | Ga0068857_1000201426 | 245 |
| 241 | 3300005577 | Ga0068857_100033886 | Ga0068857_1000338863 | 245 |
| 242 | 3300005614 | Ga0068856_100048306 | Ga0068856_1000483062 | 245 |
| 243 | 3300005614 | Ga0068856_100083216 | Ga0068856_1000832165 | 245 |
| 244 | 3300005614 | Ga0068856_100155779 | Ga0068856_1001557794 | 245 |
| 245 | 3300005614 | Ga0068856_100233260 | Ga0068856_1002332603 | 245 |
| 246 | 3300005614 | Ga0068856_100544559 | Ga0068856_1005445592 | 245 |
| 247 | 3300005614 | Ga0068856_100799862 | Ga0068856_1007998622 | 245 |
| 248 | 3300005615 | Ga0070702_100007158 | Ga0070702_1000071582 | 245 |
| 249 | 3300005615 | Ga0070702_100052707 | Ga0070702_1000527071 | 245 |
| 250 | 3300005616 | Ga0068852_100048901 | Ga0068852_1000489014 | 245 |
| 251 | 3300005616 | Ga0068852_100061986 | Ga0068852_1000619863 | 245 |
| 252 | 3300005618 | Ga0068864_100000066 | Ga0068864_10000006660 | 245 |
| 253 | 3300005718 | Ga0068866_10001604 | Ga0068866_100016048 | 245 |
| 254 | 3300005719 | Ga0068861_100007679 | Ga0068861_1000076795 | 245 |
| 255 | 3300005719 | Ga0068861_100024683 | Ga0068861_1000246831 | 245 |
| 256 | 3300005719 | Ga0068861_100080645 | Ga0068861_1000806453 | 245 |
| 257 | 3300005719 | Ga0068861_100189546 | Ga0068861_1001895462 | 245 |
| 258 | 3300005842 | Ga0068858_100104722 | Ga0068858_1001047223 | 245 |
| 259 | 3300005844 | Ga0068862_100139398 | Ga0068862_1001393983 | 245 |
| 260 | 3300005937 | Ga0081455_10010429 | Ga0081455_1001042911 | 245 |
| 261 | 3300005937 | Ga0081455_10024962 | Ga0081455_100249627 | 245 |
| 262 | 3300005937 | Ga0081455_10073577 | Ga0081455_100735772 | 245 |
| 263 | 3300005937 | Ga0081455_10231564 | Ga0081455_102315643 | 245 |
| 264 | 3300005937 | Ga0081455_10245484 | Ga0081455_102454842 | 245 |
| 265 | 3300005981 | Ga0081538_10000404 | Ga0081538_1000040416 | 245 |
| 266 | 3300005981 | Ga0081538_10000427 | Ga0081538_1000042712 | 245 |
| 267 | 3300005981 | Ga0081538_10001017 | Ga0081538_1000101713 | 245 |
| 268 | 3300005981 | Ga0081538_10001921 | Ga0081538_1000192114 | 245 |
| 269 | 3300005981 | Ga0081538_10002722 | Ga0081538_100027225 | 245 |
| 270 | 3300005981 | Ga0081538_10003377 | Ga0081538_100033774 | 245 |
| 271 | 3300005981 | Ga0081538_10013713 | Ga0081538_100137138 | 245 |
| 272 | 3300005981 | Ga0081538_10015810 | Ga0081538_100158105 | 245 |
| 273 | 3300005981 | Ga0081538_10023872 | Ga0081538_100238726 | 245 |
| 274 | 3300005981 | Ga0081538_10027775 | Ga0081538_100277753 | 245 |
| 275 | 3300005981 | Ga0081538_10040020 | Ga0081538_100400203 | 245 |
| 276 | 3300005981 | Ga0081538_10059173 | Ga0081538_100591732 | 245 |
| 277 | 3300005983 | Ga0081540_1001071 | Ga0081540_10010715 | 245 |
| 278 | 3300005983 | Ga0081540_1020136 | Ga0081540_10201366 | 245 |
| 279 | 3300005983 | Ga0081540_1094091 | Ga0081540_10940912 | 245 |
| 280 | 3300005985 | Ga0081539_10001078 | Ga0081539_1000107831 | 245 |
| 281 | 3300005985 | Ga0081539_10003725 | Ga0081539_100037259 | 245 |
| 282 | 3300005985 | Ga0081539_10035593 | Ga0081539_100355932 | 245 |
| 283 | 3300005985 | Ga0081539_10050885 | Ga0081539_100508853 | 245 |
| 284 | 3300006028 | Ga0070717_10000222 | Ga0070717_100002223 | 245 |
| 285 | 3300006028 | Ga0070717_10019069 | Ga0070717_100190694 | 245 |
| 286 | 3300006028 | Ga0070717_10020643 | Ga0070717_100206433 | 245 |
| 287 | 3300006028 | Ga0070717_10092904 | Ga0070717_100929045 | 245 |
| 288 | 3300006028 | Ga0070717_10166311 | Ga0070717_101663112 | 245 |
| 289 | 3300006028 | Ga0070717_10199875 | Ga0070717_101998751 | 245 |
| 290 | 3300006038 | Ga0075365_10005495 | Ga0075365_100054953 | 245 |
| 291 | 3300006038 | Ga0075365_10020554 | Ga0075365_100205541 | 245 |
| 292 | 3300006038 | Ga0075365_10026753 | Ga0075365_100267533 | 245 |
| 293 | 3300006038 | Ga0075365_10048811 | Ga0075365_100488114 | 245 |
| 294 | 3300006038 | Ga0075365_10084269 | Ga0075365_100842692 | 245 |
| 295 | 3300006048 | Ga0075363_100012817 | Ga0075363_1000128173 | 245 |
| 296 | 3300006051 | Ga0075364_10040774 | Ga0075364_100407743 | 245 |
| 297 | 3300006051 | Ga0075364_10070702 | Ga0075364_100707023 | 245 |
| 298 | 3300006058 | Ga0075432_10100803 | Ga0075432_101008031 | 245 |
| 299 | 3300006163 | Ga0070715_10005321 | Ga0070715_100053212 | 245 |
| 300 | 3300006163 | Ga0070715_10059786 | Ga0070715_100597862 | 245 |
| 301 | 3300006163 | Ga0070715_10111478 | Ga0070715_101114781 | 245 |
| 302 | 3300006163 | Ga0070715_10242015 | Ga0070715_102420151 | 245 |
| 303 | 3300006173 | Ga0070716_100009187 | Ga0070716_1000091875 | 245 |
| 304 | 3300006173 | Ga0070716_100056525 | Ga0070716_1000565253 | 245 |
| 305 | 3300006173 | Ga0070716_100161929 | Ga0070716_1001619292 | 245 |
| 306 | 3300006175 | Ga0070712_100006792 | Ga0070712_1000067922 | 245 |
| 307 | 3300006175 | Ga0070712_100040717 | Ga0070712_1000407173 | 245 |
| 308 | 3300006175 | Ga0070712_100040830 | Ga0070712_1000408303 | 245 |
| 309 | 3300006175 | Ga0070712_100052581 | Ga0070712_1000525814 | 245 |
| 310 | 3300006175 | Ga0070712_100064706 | Ga0070712_1000647064 | 245 |
| 311 | 3300006175 | Ga0070712_100259747 | Ga0070712_1002597471 | 245 |
| 312 | 3300006237 | Ga0097621_100013985 | Ga0097621_1000139857 | 245 |
| 313 | 3300006237 | Ga0097621_100333682 | Ga0097621_1003336822 | 245 |
| 314 | 3300006358 | Ga0068871_100005996 | Ga0068871_1000059969 | 245 |
| 315 | 3300006358 | Ga0068871_100062847 | Ga0068871_1000628472 | 245 |
| 316 | 3300006358 | Ga0068871_100895731 | Ga0068871_1008957311 | 245 |
| 317 | 3300006844 | Ga0075428_100008845 | Ga0075428_1000088456 | 245 |
| 318 | 3300006844 | Ga0075428_100080455 | Ga0075428_1000804552 | 245 |
| 319 | 3300006844 | Ga0075428_100241992 | Ga0075428_1002419922 | 245 |
| 320 | 3300006844 | Ga0075428_100370617 | Ga0075428_1003706172 | 245 |
| 321 | 3300006846 | Ga0075430_100022646 | Ga0075430_1000226464 | 245 |
| 322 | 3300006847 | Ga0075431_100022301 | Ga0075431_1000223019 | 245 |
| 323 | 3300006847 | Ga0075431_100050949 | Ga0075431_1000509497 | 245 |
| 324 | 3300006847 | Ga0075431_100063042 | Ga0075431_1000630423 | 245 |
| 325 | 3300006847 | Ga0075431_100157001 | Ga0075431_1001570013 | 245 |
| 326 | 3300006847 | Ga0075431_100328964 | Ga0075431_1003289642 | 245 |
| 327 | 3300006847 | Ga0075431_100716023 | Ga0075431_1007160232 | 245 |
| 328 | 3300006852 | Ga0075433_10005390 | Ga0075433_100053905 | 245 |
| 329 | 3300006852 | Ga0075433_10007855 | Ga0075433_1000785513 | 245 |
| 330 | 3300006852 | Ga0075433_10172213 | Ga0075433_101722132 | 245 |
| 331 | 3300006852 | Ga0075433_10333777 | Ga0075433_103337772 | 245 |
| 332 | 3300006852 | Ga0075433_10439096 | Ga0075433_104390962 | 245 |
| 333 | 3300006871 | Ga0075434_100019182 | Ga0075434_1000191822 | 245 |
| 334 | 3300006871 | Ga0075434_100112062 | Ga0075434_1001120622 | 245 |
| 335 | 3300006871 | Ga0075434_100205984 | Ga0075434_1002059842 | 245 |
| 336 | 3300006871 | Ga0075434_100239583 | Ga0075434_1002395831 | 245 |
| 337 | 3300006871 | Ga0075434_100288626 | Ga0075434_1002886264 | 245 |
| 338 | 3300006880 | Ga0075429_100152578 | Ga0075429_1001525782 | 245 |
| 339 | 3300006880 | Ga0075429_100236639 | Ga0075429_1002366392 | 245 |
| 340 | 3300006881 | Ga0068865_100003911 | Ga0068865_10000391110 | 245 |
| 341 | 3300006881 | Ga0068865_100071854 | Ga0068865_1000718544 | 245 |
| 342 | 3300006914 | Ga0075436_100019126 | Ga0075436_1000191265 | 245 |
| 343 | 3300006914 | Ga0075436_100019793 | Ga0075436_1000197932 | 245 |
| 344 | 3300006914 | Ga0075436_100158914 | Ga0075436_1001589141 | 245 |
| 345 | 3300006914 | Ga0075436_100181955 | Ga0075436_1001819553 | 245 |
| 346 | 3300007076 | Ga0075435_100002620 | Ga0075435_1000026204 | 245 |
| 347 | 3300007076 | Ga0075435_100004257 | Ga0075435_1000042575 | 245 |
| 348 | 3300007076 | Ga0075435_100173399 | Ga0075435_1001733991 | 245 |
| 349 | 3300007076 | Ga0075435_100212235 | Ga0075435_1002122351 | 245 |
| 350 | 3300007265 | Ga0099794_10020916 | Ga0099794_100209161 | 245 |
| 351 | 3300007265 | Ga0099794_10141424 | Ga0099794_101414242 | 245 |
| 352 | 3300007265 | Ga0099794_10263762 | Ga0099794_102637621 | 245 |
| 353 | 3300009036 | Ga0105244_10181059 | Ga0105244_101810592 | 245 |
| 354 | 3300009093 | Ga0105240_10048754 | Ga0105240_100487546 | 245 |
| 355 | 3300009093 | Ga0105240_10165245 | Ga0105240_101652453 | 245 |
| 356 | 3300009093 | Ga0105240_10212995 | Ga0105240_102129953 | 245 |
| 357 | 3300009094 | Ga0111539_10004613 | Ga0111539_1000461314 | 245 |
| 358 | 3300009094 | Ga0111539_10096335 | Ga0111539_100963353 | 245 |
| 359 | 3300009094 | Ga0111539_10228140 | Ga0111539_102281402 | 245 |
| 360 | 3300009094 | Ga0111539_10615886 | Ga0111539_106158862 | 245 |
| 361 | 3300009098 | Ga0105245_10008994 | Ga0105245_100089944 | 245 |
| 362 | 3300009098 | Ga0105245_10033307 | Ga0105245_100333074 | 245 |
| 363 | 3300009098 | Ga0105245_10103796 | Ga0105245_101037961 | 245 |
| 364 | 3300009098 | Ga0105245_10140748 | Ga0105245_101407482 | 245 |
| 365 | 3300009098 | Ga0105245_10171360 | Ga0105245_101713602 | 245 |
| 366 | 3300009098 | Ga0105245_10306255 | Ga0105245_103062552 | 245 |
| 367 | 3300009101 | Ga0105247_10049508 | Ga0105247_100495082 | 245 |
| 368 | 3300009147 | Ga0114129_10014902 | Ga0114129_100149025 | 245 |
| 369 | 3300009147 | Ga0114129_10019240 | Ga0114129_1001924015 | 245 |
| 370 | 3300009147 | Ga0114129_10032040 | Ga0114129_100320402 | 245 |
| 371 | 3300009147 | Ga0114129_10056990 | Ga0114129_100569903 | 245 |
| 372 | 3300009147 | Ga0114129_10188525 | Ga0114129_101885255 | 245 |
| 373 | 3300009147 | Ga0114129_10248910 | Ga0114129_102489102 | 245 |
| 374 | 3300009147 | Ga0114129_10254074 | Ga0114129_102540743 | 245 |
| 375 | 3300009147 | Ga0114129_10300192 | Ga0114129_103001922 | 245 |
| 376 | 3300009147 | Ga0114129_10691269 | Ga0114129_106912692 | 245 |
| 377 | 3300009147 | Ga0114129_10789464 | Ga0114129_107894642 | 245 |
| 378 | 3300009147 | Ga0114129_11165672 | Ga0114129_111656721 | 245 |
| 379 | 3300009148 | Ga0105243_10002113 | Ga0105243_100021134 | 245 |
| 380 | 3300009174 | Ga0105241_10086572 | Ga0105241_100865722 | 245 |
| 381 | 3300009174 | Ga0105241_10236160 | Ga0105241_102361602 | 245 |
| 382 | 3300009176 | Ga0105242_10001082 | Ga0105242_100010828 | 245 |
| 383 | 3300009176 | Ga0105242_10299352 | Ga0105242_102993522 | 245 |
| 384 | 3300009176 | Ga0105242_10833080 | Ga0105242_108330802 | 245 |
| 385 | 3300009177 | Ga0105248_10013215 | Ga0105248_1001321510 | 245 |
| 386 | 3300009545 | Ga0105237_10000602 | Ga0105237_1000060234 | 245 |
| 387 | 3300009545 | Ga0105237_10280461 | Ga0105237_102804612 | 245 |
| 388 | 3300009551 | Ga0105238_10048578 | Ga0105238_100485785 | 245 |
| 389 | 3300009551 | Ga0105238_10146274 | Ga0105238_101462744 | 245 |
| 390 | 3300009551 | Ga0105238_10320119 | Ga0105238_103201192 | 245 |
| 391 | 3300009553 | Ga0105249_10012750 | Ga0105249_100127504 | 245 |
| 392 | 3300009553 | Ga0105249_10099165 | Ga0105249_100991652 | 245 |
| 393 | 3300009553 | Ga0105249_10152752 | Ga0105249_101527524 | 245 |
| 394 | 3300009553 | Ga0105249_10190204 | Ga0105249_101902044 | 245 |
| 395 | 3300009553 | Ga0105249_10302900 | Ga0105249_103029003 | 245 |
| 396 | 3300009553 | Ga0105249_10706918 | Ga0105249_107069182 | 245 |
| 397 | 3300010375 | Ga0105239_10012439 | Ga0105239_100124392 | 245 |
| 398 | 3300010375 | Ga0105239_10023482 | Ga0105239_100234826 | 245 |
| 399 | 3300010375 | Ga0105239_10056542 | Ga0105239_100565422 | 245 |
| 400 | 3300010375 | Ga0105239_10083085 | Ga0105239_100830853 | 245 |
| 401 | 3300010375 | Ga0105239_10102031 | Ga0105239_101020313 | 245 |
| 402 | 3300010375 | Ga0105239_10148987 | Ga0105239_101489872 | 245 |
| 403 | 3300011119 | Ga0105246_10027163 | Ga0105246_100271634 | 245 |
| 404 | 3300011119 | Ga0105246_10403761 | Ga0105246_104037612 | 245 |
| 405 | 3300012481 | Ga0157320_1000926 | Ga0157320_10009262 | 245 |
| 406 | 3300012481 | Ga0157320_1004889 | Ga0157320_10048891 | 245 |
| 407 | 3300012515 | Ga0157338_1002151 | Ga0157338_10021511 | 245 |
| 408 | 3300013100 | Ga0157373_10096136 | Ga0157373_100961363 | 245 |
| 409 | 3300013104 | Ga0157370_10077775 | Ga0157370_100777753 | 245 |
| 410 | 3300013104 | Ga0157370_10089679 | Ga0157370_100896794 | 245 |
| 411 | 3300013104 | Ga0157370_10288776 | Ga0157370_102887762 | 245 |
| 412 | 3300013104 | Ga0157370_10402652 | Ga0157370_104026522 | 245 |
| 413 | 3300013105 | Ga0157369_10001368 | Ga0157369_100013682 | 245 |
| 414 | 3300013105 | Ga0157369_10065657 | Ga0157369_100656573 | 245 |
| 415 | 3300013105 | Ga0157369_10135210 | Ga0157369_101352102 | 245 |
| 416 | 3300013105 | Ga0157369_10565498 | Ga0157369_105654982 | 245 |
| 417 | 3300013296 | Ga0157374_10025602 | Ga0157374_100256025 | 245 |
| 418 | 3300013296 | Ga0157374_10291155 | Ga0157374_102911552 | 245 |
| 419 | 3300013297 | Ga0157378_10002101 | Ga0157378_1000210113 | 245 |
| 420 | 3300013306 | Ga0163162_10004455 | Ga0163162_1000445512 | 245 |
| 421 | 3300013306 | Ga0163162_10023935 | Ga0163162_100239356 | 245 |
| 422 | 3300013306 | Ga0163162_10044727 | Ga0163162_100447274 | 245 |
| 423 | 3300013307 | Ga0157372_10015118 | Ga0157372_100151186 | 245 |
| 424 | 3300013307 | Ga0157372_10082053 | Ga0157372_100820533 | 245 |
| 425 | 3300013307 | Ga0157372_10282379 | Ga0157372_102823792 | 245 |
| 426 | 3300013308 | Ga0157375_10050642 | Ga0157375_100506423 | 245 |
| 427 | 3300013308 | Ga0157375_10115988 | Ga0157375_101159882 | 245 |
| 428 | 3300013308 | Ga0157375_10127111 | Ga0157375_101271111 | 245 |
| 429 | 3300014326 | Ga0157380_10004538 | Ga0157380_1000453810 | 245 |
| 430 | 3300014497 | Ga0182008_10138916 | Ga0182008_101389161 | 245 |
| 431 | 3300014745 | Ga0157377_10030221 | Ga0157377_100302214 | 245 |
| 432 | 3300014745 | Ga0157377_10098342 | Ga0157377_100983423 | 245 |
| 433 | 3300014969 | Ga0157376_10036102 | Ga0157376_100361024 | 245 |
| 434 | 3300020069 | Ga0197907_10720580 | Ga0197907_107205802 | 245 |
| 435 | 3300020070 | Ga0206356_10343528 | Ga0206356_103435282 | 245 |
| 436 | 3300020070 | Ga0206356_11354009 | Ga0206356_113540091 | 245 |
| 437 | 3300020075 | Ga0206349_1954011 | Ga0206349_19540111 | 245 |
| 438 | 3300020080 | Ga0206350_10340442 | Ga0206350_103404422 | 245 |
| 439 | 3300020080 | Ga0206350_11395722 | Ga0206350_113957222 | 245 |
| 440 | 3300020081 | Ga0206354_10696187 | Ga0206354_106961871 | 245 |
| 441 | 3300020081 | Ga0206354_11114285 | Ga0206354_111142851 | 245 |
| 442 | 3300020082 | Ga0206353_11645146 | Ga0206353_116451464 | 245 |
| 443 | 3300020082 | Ga0206353_11985042 | Ga0206353_119850422 | 245 |
| 444 | 3300021358 | Ga0213873_10048531 | Ga0213873_100485311 | 245 |
| 445 | 3300021384 | Ga0213876_10010928 | Ga0213876_100109283 | 245 |
| 446 | 3300021384 | Ga0213876_10014059 | Ga0213876_100140594 | 245 |
| 447 | 3300022467 | Ga0224712_10012585 | Ga0224712_100125851 | 245 |
| 448 | 3300025898 | Ga0207692_10006355 | Ga0207692_100063556 | 245 |
| 449 | 3300025898 | Ga0207692_10028495 | Ga0207692_100284951 | 245 |
| 450 | 3300025898 | Ga0207692_10104794 | Ga0207692_101047941 | 245 |
| 451 | 3300025898 | Ga0207692_10113633 | Ga0207692_101136332 | 245 |
| 452 | 3300025899 | Ga0207642_10000449 | Ga0207642_100004498 | 245 |
| 453 | 3300025900 | Ga0207710_10070883 | Ga0207710_100708832 | 245 |
| 454 | 3300025901 | Ga0207688_10092682 | Ga0207688_100926821 | 245 |
| 455 | 3300025901 | Ga0207688_10182197 | Ga0207688_101821971 | 245 |
| 456 | 3300025901 | Ga0207688_10309293 | Ga0207688_103092932 | 245 |
| 457 | 3300025903 | Ga0207680_10184258 | Ga0207680_101842581 | 245 |
| 458 | 3300025905 | Ga0207685_10026495 | Ga0207685_100264952 | 245 |
| 459 | 3300025905 | Ga0207685_10043960 | Ga0207685_100439601 | 245 |
| 460 | 3300025905 | Ga0207685_10065683 | Ga0207685_100656831 | 245 |
| 461 | 3300025905 | Ga0207685_10273744 | Ga0207685_102737441 | 245 |
| 462 | 3300025906 | Ga0207699_10005052 | Ga0207699_100050524 | 245 |
| 463 | 3300025906 | Ga0207699_10010075 | Ga0207699_100100754 | 245 |
| 464 | 3300025906 | Ga0207699_10036227 | Ga0207699_100362272 | 245 |
| 465 | 3300025906 | Ga0207699_10121786 | Ga0207699_101217861 | 245 |
| 466 | 3300025909 | Ga0207705_10476007 | Ga0207705_104760071 | 245 |
| 467 | 3300025910 | Ga0207684_10000006 | Ga0207684_10000006640 | 245 |
| 468 | 3300025910 | Ga0207684_10000111 | Ga0207684_10000111119 | 245 |
| 469 | 3300025910 | Ga0207684_10079026 | Ga0207684_100790262 | 245 |
| 470 | 3300025910 | Ga0207684_10198572 | Ga0207684_101985722 | 245 |
| 471 | 3300025910 | Ga0207684_10218558 | Ga0207684_102185582 | 245 |
| 472 | 3300025912 | Ga0207707_10009759 | Ga0207707_100097593 | 245 |
| 473 | 3300025912 | Ga0207707_10014965 | Ga0207707_100149659 | 245 |
| 474 | 3300025913 | Ga0207695_10046851 | Ga0207695_100468515 | 245 |
| 475 | 3300025913 | Ga0207695_10157193 | Ga0207695_101571932 | 245 |
| 476 | 3300025913 | Ga0207695_10608627 | Ga0207695_106086271 | 245 |
| 477 | 3300025914 | Ga0207671_10355848 | Ga0207671_103558481 | 245 |
| 478 | 3300025915 | Ga0207693_10003431 | Ga0207693_100034318 | 245 |
| 479 | 3300025915 | Ga0207693_10003498 | Ga0207693_100034985 | 245 |
| 480 | 3300025915 | Ga0207693_10005467 | Ga0207693_100054672 | 245 |
| 481 | 3300025915 | Ga0207693_10027024 | Ga0207693_100270244 | 245 |
| 482 | 3300025915 | Ga0207693_10400015 | Ga0207693_104000152 | 245 |
| 483 | 3300025916 | Ga0207663_10005457 | Ga0207663_100054573 | 245 |
| 484 | 3300025916 | Ga0207663_10007121 | Ga0207663_100071213 | 245 |
| 485 | 3300025916 | Ga0207663_10012312 | Ga0207663_100123124 | 245 |
| 486 | 3300025916 | Ga0207663_10016317 | Ga0207663_100163172 | 245 |
| 487 | 3300025916 | Ga0207663_10023726 | Ga0207663_100237264 | 245 |
| 488 | 3300025916 | Ga0207663_10024453 | Ga0207663_100244533 | 245 |
| 489 | 3300025916 | Ga0207663_10064746 | Ga0207663_100647462 | 245 |
| 490 | 3300025916 | Ga0207663_10094323 | Ga0207663_100943231 | 245 |
| 491 | 3300025916 | Ga0207663_10182669 | Ga0207663_101826692 | 245 |
| 492 | 3300025916 | Ga0207663_10285765 | Ga0207663_102857652 | 245 |
| 493 | 3300025916 | Ga0207663_10730871 | Ga0207663_107308711 | 245 |
| 494 | 3300025917 | Ga0207660_10004077 | Ga0207660_100040778 | 245 |
| 495 | 3300025917 | Ga0207660_10029108 | Ga0207660_100291082 | 245 |
| 496 | 3300025917 | Ga0207660_10242118 | Ga0207660_102421181 | 245 |
| 497 | 3300025917 | Ga0207660_10356751 | Ga0207660_103567512 | 245 |
| 498 | 3300025918 | Ga0207662_10026943 | Ga0207662_100269431 | 245 |
| 499 | 3300025919 | Ga0207657_10008674 | Ga0207657_100086748 | 245 |
| 500 | 3300025919 | Ga0207657_10009303 | Ga0207657_100093039 | 245 |
| 501 | 3300025919 | Ga0207657_10013621 | Ga0207657_100136213 | 245 |
| 502 | 3300025919 | Ga0207657_10014003 | Ga0207657_100140032 | 245 |
| 503 | 3300025919 | Ga0207657_10110399 | Ga0207657_101103992 | 245 |
| 504 | 3300025921 | Ga0207652_10017330 | Ga0207652_100173302 | 245 |
| 505 | 3300025921 | Ga0207652_10035210 | Ga0207652_100352104 | 245 |
| 506 | 3300025921 | Ga0207652_10183337 | Ga0207652_101833371 | 245 |
| 507 | 3300025922 | Ga0207646_10000746 | Ga0207646_1000074620 | 245 |
| 508 | 3300025922 | Ga0207646_10009937 | Ga0207646_100099373 | 245 |
| 509 | 3300025922 | Ga0207646_10014914 | Ga0207646_100149142 | 245 |
| 510 | 3300025922 | Ga0207646_10017090 | Ga0207646_100170907 | 245 |
| 511 | 3300025922 | Ga0207646_10025038 | Ga0207646_100250384 | 245 |
| 512 | 3300025922 | Ga0207646_10035652 | Ga0207646_100356521 | 245 |
| 513 | 3300025922 | Ga0207646_10043965 | Ga0207646_100439652 | 245 |
| 514 | 3300025922 | Ga0207646_10113169 | Ga0207646_101131692 | 245 |
| 515 | 3300025922 | Ga0207646_10187402 | Ga0207646_101874022 | 245 |
| 516 | 3300025922 | Ga0207646_10559207 | Ga0207646_105592071 | 245 |
| 517 | 3300025926 | Ga0207659_10171696 | Ga0207659_101716962 | 245 |
| 518 | 3300025926 | Ga0207659_10319407 | Ga0207659_103194072 | 245 |
| 519 | 3300025927 | Ga0207687_10005452 | Ga0207687_100054528 | 245 |
| 520 | 3300025927 | Ga0207687_10007651 | Ga0207687_100076513 | 245 |
| 521 | 3300025927 | Ga0207687_10163194 | Ga0207687_101631942 | 245 |
| 522 | 3300025927 | Ga0207687_10519551 | Ga0207687_105195512 | 245 |
| 523 | 3300025928 | Ga0207700_10006621 | Ga0207700_1000662110 | 245 |
| 524 | 3300025928 | Ga0207700_10023694 | Ga0207700_100236942 | 245 |
| 525 | 3300025928 | Ga0207700_10250028 | Ga0207700_102500282 | 245 |
| 526 | 3300025928 | Ga0207700_10832602 | Ga0207700_108326021 | 245 |
| 527 | 3300025929 | Ga0207664_10003470 | Ga0207664_100034708 | 245 |
| 528 | 3300025929 | Ga0207664_10010381 | Ga0207664_100103814 | 245 |
| 529 | 3300025929 | Ga0207664_10013689 | Ga0207664_100136895 | 245 |
| 530 | 3300025929 | Ga0207664_10052039 | Ga0207664_100520393 | 245 |
| 531 | 3300025929 | Ga0207664_10159446 | Ga0207664_101594462 | 245 |
| 532 | 3300025929 | Ga0207664_10410661 | Ga0207664_104106611 | 245 |
| 533 | 3300025929 | Ga0207664_10671385 | Ga0207664_106713851 | 245 |
| 534 | 3300025929 | Ga0207664_10701832 | Ga0207664_107018321 | 245 |
| 535 | 3300025931 | Ga0207644_10020755 | Ga0207644_100207556 | 245 |
| 536 | 3300025931 | Ga0207644_10633882 | Ga0207644_106338821 | 245 |
| 537 | 3300025932 | Ga0207690_10371340 | Ga0207690_103713402 | 245 |
| 538 | 3300025932 | Ga0207690_10436351 | Ga0207690_104363511 | 245 |
| 539 | 3300025933 | Ga0207706_10003766 | Ga0207706_1000376614 | 245 |
| 540 | 3300025933 | Ga0207706_10186011 | Ga0207706_101860112 | 245 |
| 541 | 3300025933 | Ga0207706_10333307 | Ga0207706_103333071 | 245 |
| 542 | 3300025934 | Ga0207686_10001941 | Ga0207686_100019414 | 245 |
| 543 | 3300025935 | Ga0207709_10001307 | Ga0207709_1000130717 | 245 |
| 544 | 3300025935 | Ga0207709_10068350 | Ga0207709_100683502 | 245 |
| 545 | 3300025935 | Ga0207709_10097111 | Ga0207709_100971111 | 245 |
| 546 | 3300025935 | Ga0207709_10134650 | Ga0207709_101346502 | 245 |
| 547 | 3300025935 | Ga0207709_10688459 | Ga0207709_106884591 | 245 |
| 548 | 3300025936 | Ga0207670_10221494 | Ga0207670_102214942 | 245 |
| 549 | 3300025937 | Ga0207669_10003552 | Ga0207669_100035524 | 245 |
| 550 | 3300025937 | Ga0207669_10008329 | Ga0207669_100083293 | 245 |
| 551 | 3300025937 | Ga0207669_10100834 | Ga0207669_101008341 | 245 |
| 552 | 3300025938 | Ga0207704_10001093 | Ga0207704_100010932 | 245 |
| 553 | 3300025938 | Ga0207704_10098645 | Ga0207704_100986453 | 245 |
| 554 | 3300025939 | Ga0207665_10002156 | Ga0207665_1000215615 | 245 |
| 555 | 3300025939 | Ga0207665_10010333 | Ga0207665_100103334 | 245 |
| 556 | 3300025939 | Ga0207665_10054983 | Ga0207665_100549832 | 245 |
| 557 | 3300025939 | Ga0207665_10070823 | Ga0207665_100708232 | 245 |
| 558 | 3300025939 | Ga0207665_10079926 | Ga0207665_100799262 | 245 |
| 559 | 3300025939 | Ga0207665_10120205 | Ga0207665_101202051 | 245 |
| 560 | 3300025940 | Ga0207691_10025953 | Ga0207691_100259537 | 245 |
| 561 | 3300025941 | Ga0207711_10063349 | Ga0207711_100633492 | 245 |
| 562 | 3300025944 | Ga0207661_10114948 | Ga0207661_101149482 | 245 |
| 563 | 3300025944 | Ga0207661_10145048 | Ga0207661_101450482 | 245 |
| 564 | 3300025944 | Ga0207661_10217226 | Ga0207661_102172262 | 245 |
| 565 | 3300025944 | Ga0207661_10320529 | Ga0207661_103205292 | 245 |
| 566 | 3300025944 | Ga0207661_10409811 | Ga0207661_104098112 | 245 |
| 567 | 3300025945 | Ga0207679_10024106 | Ga0207679_100241062 | 245 |
| 568 | 3300025945 | Ga0207679_10212206 | Ga0207679_102122063 | 245 |
| 569 | 3300025949 | Ga0207667_10112119 | Ga0207667_101121192 | 245 |
| 570 | 3300025949 | Ga0207667_10157031 | Ga0207667_101570312 | 245 |
| 571 | 3300025949 | Ga0207667_10238071 | Ga0207667_102380712 | 245 |
| 572 | 3300025949 | Ga0207667_10319832 | Ga0207667_103198322 | 245 |
| 573 | 3300025949 | Ga0207667_10689951 | Ga0207667_106899511 | 245 |
| 574 | 3300025960 | Ga0207651_10321139 | Ga0207651_103211391 | 245 |
| 575 | 3300025961 | Ga0207712_10117751 | Ga0207712_101177512 | 245 |
| 576 | 3300025961 | Ga0207712_10150883 | Ga0207712_101508832 | 245 |
| 577 | 3300025961 | Ga0207712_10170148 | Ga0207712_101701483 | 245 |
| 578 | 3300025961 | Ga0207712_10194731 | Ga0207712_101947313 | 245 |
| 579 | 3300025961 | Ga0207712_10592014 | Ga0207712_105920141 | 245 |
| 580 | 3300025961 | Ga0207712_10704374 | Ga0207712_107043741 | 245 |
| 581 | 3300025972 | Ga0207668_10026631 | Ga0207668_100266316 | 245 |
| 582 | 3300025972 | Ga0207668_10031470 | Ga0207668_100314703 | 245 |
| 583 | 3300025972 | Ga0207668_10155093 | Ga0207668_101550932 | 245 |
| 584 | 3300026023 | Ga0207677_10181307 | Ga0207677_101813071 | 245 |
| 585 | 3300026023 | Ga0207677_10428480 | Ga0207677_104284802 | 245 |
| 586 | 3300026041 | Ga0207639_10075418 | Ga0207639_100754184 | 245 |
| 587 | 3300026041 | Ga0207639_10499116 | Ga0207639_104991161 | 245 |
| 588 | 3300026067 | Ga0207678_10055531 | Ga0207678_100555314 | 245 |
| 589 | 3300026067 | Ga0207678_10069245 | Ga0207678_100692453 | 245 |
| 590 | 3300026075 | Ga0207708_10000316 | Ga0207708_1000031638 | 245 |
| 591 | 3300026075 | Ga0207708_10473756 | Ga0207708_104737561 | 245 |
| 592 | 3300026078 | Ga0207702_10009738 | Ga0207702_100097389 | 245 |
| 593 | 3300026078 | Ga0207702_10455841 | Ga0207702_104558411 | 245 |
| 594 | 3300026089 | Ga0207648_10006150 | Ga0207648_100061504 | 245 |
| 595 | 3300026089 | Ga0207648_10111515 | Ga0207648_101115152 | 245 |
| 596 | 3300026089 | Ga0207648_10474500 | Ga0207648_104745002 | 245 |
| 597 | 3300026095 | Ga0207676_10000038 | Ga0207676_10000038110 | 245 |
| 598 | 3300026116 | Ga0207674_10027663 | Ga0207674_100276636 | 245 |
| 599 | 3300026116 | Ga0207674_10028752 | Ga0207674_100287525 | 245 |
| 600 | 3300026116 | Ga0207674_10307156 | Ga0207674_103071563 | 245 |
| 601 | 3300026118 | Ga0207675_100002213 | Ga0207675_1000022134 | 245 |
| 602 | 3300026118 | Ga0207675_100005637 | Ga0207675_1000056377 | 245 |
| 603 | 3300026118 | Ga0207675_100007552 | Ga0207675_10000755210 | 245 |
| 604 | 3300026118 | Ga0207675_100018906 | Ga0207675_1000189065 | 245 |
| 605 | 3300026118 | Ga0207675_100064312 | Ga0207675_1000643123 | 245 |
| 606 | 3300026118 | Ga0207675_100068651 | Ga0207675_1000686514 | 245 |
| 607 | 3300026121 | Ga0207683_10001814 | Ga0207683_1000181411 | 245 |
| 608 | 3300026121 | Ga0207683_10008897 | Ga0207683_100088973 | 245 |
| 609 | 3300027907 | Ga0207428_10003447 | Ga0207428_1000344720 | 245 |
| 610 | 3300027907 | Ga0207428_10038721 | Ga0207428_100387212 | 245 |
| 611 | 3300027907 | Ga0207428_10080193 | Ga0207428_100801932 | 245 |
| 612 | 3300027907 | Ga0207428_10100716 | Ga0207428_101007163 | 245 |
| 613 | 3300028379 | Ga0268266_10050172 | Ga0268266_100501725 | 245 |
| 614 | 3300028379 | Ga0268266_10226693 | Ga0268266_102266932 | 245 |
| 615 | 3300028379 | Ga0268266_10393557 | Ga0268266_103935571 | 245 |
| 616 | 3300028380 | Ga0268265_10657242 | Ga0268265_106572422 | 245 |
| 617 | 3300028381 | Ga0268264_10257680 | Ga0268264_102576802 | 245 |
| 618 | 3300031548 | Ga0307408_100164039 | Ga0307408_1001640392 | 245 |
| 619 | 3300031731 | Ga0307405_10027498 | Ga0307405_100274983 | 245 |
| 620 | 3300031852 | Ga0307410_10011531 | Ga0307410_100115317 | 245 |
| 621 | 3300031852 | Ga0307410_10065094 | Ga0307410_100650941 | 245 |
| 622 | 3300031852 | Ga0307410_10070587 | Ga0307410_100705873 | 245 |
| 623 | 3300031901 | Ga0307406_10016289 | Ga0307406_100162892 | 245 |
| 624 | 3300031901 | Ga0307406_10120296 | Ga0307406_101202962 | 245 |
| 625 | 3300031901 | Ga0307406_10179718 | Ga0307406_101797182 | 245 |
| 626 | 3300031901 | Ga0307406_10182702 | Ga0307406_101827021 | 245 |
| 627 | 3300031903 | Ga0307407_10006320 | Ga0307407_100063207 | 245 |
| 628 | 3300031903 | Ga0307407_10017333 | Ga0307407_100173331 | 245 |
| 629 | 3300031903 | Ga0307407_10113304 | Ga0307407_101133043 | 245 |
| 630 | 3300031903 | Ga0307407_10398144 | Ga0307407_103981442 | 245 |
| 631 | 3300031911 | Ga0307412_10070216 | Ga0307412_100702163 | 245 |
| 632 | 3300031911 | Ga0307412_10128520 | Ga0307412_101285201 | 245 |
| 633 | 3300031995 | Ga0307409_100001197 | Ga0307409_1000011973 | 245 |
| 634 | 3300031995 | Ga0307409_100032250 | Ga0307409_1000322504 | 245 |
| 635 | 3300031995 | Ga0307409_100074431 | Ga0307409_1000744313 | 245 |
| 636 | 3300031995 | Ga0307409_100232346 | Ga0307409_1002323462 | 245 |
| 637 | 3300032002 | Ga0307416_100002210 | Ga0307416_1000022108 | 245 |
| 638 | 3300032002 | Ga0307416_100032735 | Ga0307416_1000327353 | 245 |
| 639 | 3300032002 | Ga0307416_100121943 | Ga0307416_1001219432 | 245 |
| 640 | 3300032004 | Ga0307414_10029673 | Ga0307414_100296735 | 245 |
| 641 | 3300032004 | Ga0307414_10069184 | Ga0307414_100691843 | 245 |
| 642 | 3300032004 | Ga0307414_10262419 | Ga0307414_102624192 | 245 |
| 643 | 3300032005 | Ga0307411_10054496 | Ga0307411_100544961 | 245 |
| 644 | 3300032005 | Ga0307411_10109922 | Ga0307411_101099221 | 245 |
| 645 | 3300032126 | Ga0307415_100044324 | Ga0307415_1000443243 | 245 |
| 646 | 3300032126 | Ga0307415_100070787 | Ga0307415_1000707873 | 245 |
| 647 | 3300035084 | Ga0373928_0046268 | Ga0373928_0046268_206_943 | 245 |
| 648 | 3300035112 | Ga0373932_0098627 | Ga0373932_0098627_132_869 | 245 |
| 649 | 3300035115 | Ga0373941_0153326 | Ga0373941_0153326_66_803 | 245 |
| 650 | 3300035116 | Ga0373945_0000408 | Ga0373945_0000408_3790_4527 | 245 |
| 651 | 3300035116 | Ga0373945_0059601 | Ga0373945_0059601_143_880 | 245 |
| 652 | 3300035170 | Ga0373943_0020423 | Ga0373943_0020423_502_1242 | 245 |
| 653 | 3300035170 | Ga0373943_0409611 | Ga0373943_0409611_29_766 | 245 |
| 654 | 3300035171 | Ga0373946_0002764 | Ga0373946_0002764_5180_5917 | 245 |
| 655 | 3300035172 | Ga0373955_0249621 | Ga0373955_0249621_126_869 | 245 |
| 656 | 3300035207 | Ga0373942_0056057 | Ga0373942_0056057_296_1033 | 245 |
| 657 | 3300035410 | Ga0373924_0055170 | Ga0373924_0055170_251_988 | 245 |
| 658 | 3300035692 | Ga0373935_0005562 | Ga0373935_0005562_2425_3162 | 245 |
| 659 | 3300035692 | Ga0373935_0093143 | Ga0373935_0093143_871_1608 | 245 |
| 660 | 3300037068 | Ga0373925_0001678 | Ga0373925_0001678_3599_4336 | 245 |
| 661 | 3300037068 | Ga0373925_0559600 | Ga0373925_0559600_149_889 | 245 |
| 662 | 3300037312 | Ga0395899_0039222 | Ga0395899_0039222_1302_2039 | 245 |
| 663 | 3300037312 | Ga0395899_0070679 | Ga0395899_0070679_475_1212 | 245 |
| 664 | 3300037312 | Ga0395899_0076290 | Ga0395899_0076290_1229_1966 | 245 |
| 665 | 3300037312 | Ga0395899_0200369 | Ga0395899_0200369_265_1002 | 245 |
| 666 | 3300037312 | Ga0395899_0239011 | Ga0395899_0239011_57_794 | 245 |
| 667 | 3300037418 | Ga0395900_0002072 | Ga0395900_0002072_16286_17029 | 245 |
| 668 | 3300037418 | Ga0395900_0004735 | Ga0395900_0004735_12449_13273 | 245 |
| 669 | 3300037418 | Ga0395900_0006797 | Ga0395900_0006797_10673_11410 | 245 |
| 670 | 3300037418 | Ga0395900_0015456 | Ga0395900_0015456_5522_6259 | 245 |
| 671 | 3300037418 | Ga0395900_0065136 | Ga0395900_0065136_255_992 | 245 |
| 672 | 3300037418 | Ga0395900_0071833 | Ga0395900_0071833_1086_1823 | 245 |
| 673 | 3300037418 | Ga0395900_0105266 | Ga0395900_0105266_673_1410 | 245 |
| 674 | 3300037418 | Ga0395900_0129706 | Ga0395900_0129706_1217_1954 | 245 |
| 675 | 3300037418 | Ga0395900_0135342 | Ga0395900_0135342_630_1367 | 245 |
| 676 | 3300037418 | Ga0395900_0238090 | Ga0395900_0238090_915_1652 | 245 |
| 677 | 3300037418 | Ga0395900_0253259 | Ga0395900_0253259_99_836 | 245 |
| 678 | 3300037418 | Ga0395900_0326493 | Ga0395900_0326493_468_1226 | 245 |
| 679 | 3300037418 | Ga0395900_0482701 | Ga0395900_0482701_201_938 | 245 |
| 680 | 3300037418 | Ga0395900_0551746 | Ga0395900_0551746_176_913 | 245 |
| 681 | 3300037466 | Ga0395898_0011628 | Ga0395898_0011628_6505_7242 | 245 |
| 682 | 3300037466 | Ga0395898_0012231 | Ga0395898_0012231_5100_5837 | 245 |
| 683 | 3300037466 | Ga0395898_0044784 | Ga0395898_0044784_1515_2252 | 245 |
| 684 | 3300037466 | Ga0395898_0067337 | Ga0395898_0067337_1463_2200 | 245 |
| 685 | 3300037466 | Ga0395898_0082178 | Ga0395898_0082178_2155_2892 | 245 |
| 686 | 3300037466 | Ga0395898_0101276 | Ga0395898_0101276_1240_1998 | 245 |
| 687 | 3300037466 | Ga0395898_0124772 | Ga0395898_0124772_513_1250 | 245 |
| 688 | 3300037466 | Ga0395898_0138213 | Ga0395898_0138213_1316_2056 | 245 |
| 689 | 3300037466 | Ga0395898_0170231 | Ga0395898_0170231_317_1063 | 245 |
| 690 | 3300037466 | Ga0395898_0184784 | Ga0395898_0184784_406_1143 | 245 |
| 691 | 3300037466 | Ga0395898_0212905 | Ga0395898_0212905_1084_1824 | 245 |
| 692 | 3300037466 | Ga0395898_0331755 | Ga0395898_0331755_542_1279 | 245 |
| 693 | 3300037466 | Ga0395898_0343919 | Ga0395898_0343919_405_1196 | 245 |
| 694 | 3300037466 | Ga0395898_0394046 | Ga0395898_0394046_350_1087 | 245 |
| 695 | 3300037471 | Ga0395905_0010007 | Ga0395905_0010007_3390_4133 | 245 |
| 696 | 3300037471 | Ga0395905_0017142 | Ga0395905_0017142_114_851 | 245 |
| 697 | 3300037471 | Ga0395905_0027047 | Ga0395905_0027047_4274_5011 | 245 |
| 698 | 3300037471 | Ga0395905_0035027 | Ga0395905_0035027_3603_4340 | 245 |
| 699 | 3300037471 | Ga0395905_0037555 | Ga0395905_0037555_2566_3303 | 245 |
| 700 | 3300037471 | Ga0395905_0039071 | Ga0395905_0039071_2754_3545 | 245 |
| 701 | 3300037471 | Ga0395905_0107325 | Ga0395905_0107325_1674_2411 | 245 |
| 702 | 3300037471 | Ga0395905_0120909 | Ga0395905_0120909_415_1152 | 245 |
| 703 | 3300037471 | Ga0395905_0175640 | Ga0395905_0175640_356_1093 | 245 |
| 704 | 3300037471 | Ga0395905_0389744 | Ga0395905_0389744_144_935 | 245 |
| 705 | 3300037471 | Ga0395905_0553534 | Ga0395905_0553534_204_944 | 245 |
| 706 | 3300037853 | Ga0436364_0434921 | Ga0436364_0434921_332_1075 | 245 |
| 707 | 3300037853 | Ga0436364_0706594 | Ga0436364_0706594_607_1344 | 245 |
| 708 | 3300038443 | Ga0395901_0001774 | Ga0395901_0001774_16430_17173 | 245 |
| 709 | 3300038443 | Ga0395901_0003044 | Ga0395901_0003044_1076_1837 | 245 |
| 710 | 3300038443 | Ga0395901_0006297 | Ga0395901_0006297_4493_5230 | 245 |
| 711 | 3300038443 | Ga0395901_0007454 | Ga0395901_0007454_3694_4431 | 245 |
| 712 | 3300038443 | Ga0395901_0009554 | Ga0395901_0009554_4541_5278 | 245 |
| 713 | 3300038443 | Ga0395901_0019210 | Ga0395901_0019210_5998_6735 | 245 |
| 714 | 3300038443 | Ga0395901_0027399 | Ga0395901_0027399_1259_1996 | 245 |
| 715 | 3300038443 | Ga0395901_0030513 | Ga0395901_0030513_330_1076 | 245 |
| 716 | 3300038443 | Ga0395901_0036498 | Ga0395901_0036498_719_1456 | 245 |
| 717 | 3300038443 | Ga0395901_0043463 | Ga0395901_0043463_1676_2422 | 245 |
| 718 | 3300038443 | Ga0395901_0045207 | Ga0395901_0045207_3202_3939 | 245 |
| 719 | 3300038443 | Ga0395901_0059143 | Ga0395901_0059143_2703_3440 | 245 |
| 720 | 3300038443 | Ga0395901_0072952 | Ga0395901_0072952_148_906 | 245 |
| 721 | 3300038443 | Ga0395901_0103191 | Ga0395901_0103191_1307_2044 | 245 |
| 722 | 3300038443 | Ga0395901_0112869 | Ga0395901_0112869_1224_1961 | 245 |
| 723 | 3300038443 | Ga0395901_0116981 | Ga0395901_0116981_110_847 | 245 |
| 724 | 3300038443 | Ga0395901_0205853 | Ga0395901_0205853_285_1022 | 245 |
| 725 | 3300038443 | Ga0395901_0249381 | Ga0395901_0249381_318_1055 | 245 |
| 726 | 3300038443 | Ga0395901_0294543 | Ga0395901_0294543_568_1305 | 245 |
| 727 | 3300039437 | Ga0436365_0032671 | Ga0436365_0032671_2586_3326 | 245 |
| 728 | 3300039437 | Ga0436365_0623832 | Ga0436365_0623832_1808_2545 | 245 |
| 729 | 3300039437 | Ga0436365_1576607 | Ga0436365_1576607_82_819 | 245 |
| 730 | 3300039437 | Ga0436365_1685261 | Ga0436365_1685261_1079_1849 | 245 |
| 731 | 3300039450 | Ga0436363_0515302 | Ga0436363_0515302_965_1702 | 245 |
| 732 | 3300039450 | Ga0436363_0746168 | Ga0436363_0746168_87_830 | 245 |
| 733 | 3300039450 | Ga0436363_1306475 | Ga0436363_1306475_111_848 | 245 |
| 734 | 3300039453 | Ga0436362_0291861 | Ga0436362_0291861_1808_2548 | 245 |
| 735 | 3300039453 | Ga0436362_0514978 | Ga0436362_0514978_127_882 | 245 |
| 736 | 3300042005 | Ga0439448_0006091 | Ga0439448_0006091_1615_2352 | 245 |
| 737 | 3300042005 | Ga0439448_0146041 | Ga0439448_0146041_11_748 | 245 |
| 738 | 3300042012 | Ga0439455_0009092 | Ga0439455_0009092_904_1641 | 245 |
| 739 | 3300042461 | Ga0439460_0066193 | Ga0439460_0066193_176_913 | 245 |
| 740 | 3300042461 | Ga0439460_0127503 | Ga0439460_0127503_42_779 | 245 |
| 741 | 3300044683 | Ga0466965_0020394 | Ga0466965_0020394_1729_2475 | 245 |
| 742 | 3300044693 | Ga0466961_0005010 | Ga0466961_0005010_4062_4799 | 245 |
| 743 | 3300044694 | Ga0466963_0012641 | Ga0466963_0012641_1348_2094 | 245 |
| 744 | 3300044694 | Ga0466963_0019209 | Ga0466963_0019209_2287_3024 | 245 |
| 745 | 3300044694 | Ga0466963_0038359 | Ga0466963_0038359_978_1724 | 245 |
| 746 | 3300044694 | Ga0466963_0051754 | Ga0466963_0051754_1427_2164 | 245 |
| 747 | 3300044694 | Ga0466963_0190766 | Ga0466963_0190766_24_764 | 245 |
| 748 | 3300044694 | Ga0466963_0215510 | Ga0466963_0215510_477_1214 | 245 |
| 749 | 3300044694 | Ga0466963_0235098 | Ga0466963_0235098_413_1150 | 245 |
| 750 | 3300044706 | Ga0466964_0014724 | Ga0466964_0014724_317_1054 | 245 |
| 751 | 3300044706 | Ga0466964_0034295 | Ga0466964_0034295_146_883 | 245 |
| 752 | 3300044719 | Ga0466971_0139842 | Ga0466971_0139842_322_1068 | 245 |
| 753 | 3300044735 | Ga0466968_0026194 | Ga0466968_0026194_1402_2139 | 245 |
| 754 | 3300044842 | Ga0466957_0033734 | Ga0466957_0033734_2302_3048 | 245 |
| 755 | 3300044901 | Ga0466960_0139842 | Ga0466960_0139842_264_1004 | 245 |
| 756 | 3300045049 | Ga0466959_0001162 | Ga0466959_0001162_1781_2518 | 245 |
| 757 | 3300045049 | Ga0466959_0033183 | Ga0466959_0033183_121_867 | 245 |
| 758 | 3300045049 | Ga0466959_0062471 | Ga0466959_0062471_1020_1757 | 245 |
| 759 | 3300045049 | Ga0466959_0089007 | Ga0466959_0089007_363_1103 | 245 |
| 760 | 3300045049 | Ga0466959_0093107 | Ga0466959_0093107_1092_1838 | 245 |
| 761 | 3300045836 | Ga0466958_0000699 | Ga0466958_0000699_2367_3104 | 245 |
| 762 | 3300045836 | Ga0466958_0006923 | Ga0466958_0006923_2450_3187 | 245 |
| 763 | 3300045836 | Ga0466958_0025331 | Ga0466958_0025331_242_988 | 245 |
| 764 | 3300045976 | Ga0466967_0019062 | Ga0466967_0019062_816_1553 | 245 |
| 765 | 3300045976 | Ga0466967_0027543 | Ga0466967_0027543_2056_2802 | 245 |
| 766 | 3300045976 | Ga0466967_0033807 | Ga0466967_0033807_2843_3589 | 245 |
| 767 | 3300045976 | Ga0466967_0042760 | Ga0466967_0042760_1310_2056 | 245 |
| 768 | 3300045976 | Ga0466967_0308668 | Ga0466967_0308668_257_994 | 245 |
| 769 | 3300046454 | Ga0495592_0000024 | Ga0495592_0000024_83782_84519 | 245 |
| 770 | 3300046454 | Ga0495592_0067947 | Ga0495592_0067947_1477_2214 | 245 |
| 771 | 3300046455 | Ga0495603_0092934 | Ga0495603_0092934_804_1592 | 245 |
| 772 | 3300046455 | Ga0495603_0098108 | Ga0495603_0098108_472_1209 | 245 |
| 773 | 3300046455 | Ga0495603_0119633 | Ga0495603_0119633_125_862 | 245 |
| 774 | 3300046459 | Ga0495629_0003244 | Ga0495629_0003244_9830_10567 | 245 |
| 775 | 3300046459 | Ga0495629_0171844 | Ga0495629_0171844_85_822 | 245 |
| 776 | 3300046461 | Ga0495641_0005768 | Ga0495641_0005768_404_1141 | 245 |
| 777 | 3300046461 | Ga0495641_0013989 | Ga0495641_0013989_1668_2405 | 245 |
| 778 | 3300046461 | Ga0495641_0057271 | Ga0495641_0057271_360_1097 | 245 |
| 779 | 3300046461 | Ga0495641_0087164 | Ga0495641_0087164_335_1072 | 245 |
| 780 | 3300046461 | Ga0495641_0104129 | Ga0495641_0104129_77_814 | 245 |
| 781 | 3300046462 | Ga0495651_0040552 | Ga0495651_0040552_2114_2851 | 245 |
| 782 | 3300046463 | Ga0495653_0003414 | Ga0495653_0003414_6561_7472 | 245 |
| 783 | 3300046463 | Ga0495653_0049834 | Ga0495653_0049834_294_1031 | 245 |
| 784 | 3300046463 | Ga0495653_0097751 | Ga0495653_0097751_864_1601 | 245 |
| 785 | 3300046473 | Ga0495582_0000028 | Ga0495582_0000028_23233_23970 | 245 |
| 786 | 3300046473 | Ga0495582_0020593 | Ga0495582_0020593_138_875 | 245 |
| 787 | 3300046473 | Ga0495582_0104437 | Ga0495582_0104437_514_1251 | 245 |
| 788 | 3300046473 | Ga0495582_0105911 | Ga0495582_0105911_26_763 | 245 |
| 789 | 3300046474 | Ga0495605_0149100 | Ga0495605_0149100_52_804 | 245 |
| 790 | 3300046475 | Ga0495639_0066522 | Ga0495639_0066522_724_1461 | 245 |
| 791 | 3300046475 | Ga0495639_0249977 | Ga0495639_0249977_58_795 | 245 |
| 792 | 3300046476 | Ga0495662_0000448 | Ga0495662_0000448_13531_14268 | 245 |
| 793 | 3300046499 | Ga0495594_0092156 | Ga0495594_0092156_136_873 | 245 |
| 794 | 3300046499 | Ga0495594_0196564 | Ga0495594_0196564_302_1039 | 245 |
| 795 | 3300046500 | Ga0495596_0033823 | Ga0495596_0033823_1049_1792 | 245 |
| 796 | 3300046500 | Ga0495596_0034066 | Ga0495596_0034066_1116_1853 | 245 |
| 797 | 3300046500 | Ga0495596_0045905 | Ga0495596_0045905_85_837 | 245 |
| 798 | 3300046501 | Ga0495607_0071166 | Ga0495607_0071166_758_1501 | 245 |
| 799 | 3300046511 | Ga0495608_0139004 | Ga0495608_0139004_95_832 | 245 |
| 800 | 3300046513 | Ga0495616_0059385 | Ga0495616_0059385_938_1684 | 245 |
| 801 | 3300046513 | Ga0495616_0128083 | Ga0495616_0128083_287_1024 | 245 |
| 802 | 3300046514 | Ga0495618_0083468 | Ga0495618_0083468_627_1364 | 245 |
| 803 | 3300046516 | Ga0495628_0034794 | Ga0495628_0034794_2726_3469 | 245 |
| 804 | 3300046517 | Ga0495630_0001414 | Ga0495630_0001414_732_1469 | 245 |
| 805 | 3300046517 | Ga0495630_0006834 | Ga0495630_0006834_4588_5325 | 245 |
| 806 | 3300046518 | Ga0495631_0135961 | Ga0495631_0135961_237_974 | 245 |
| 807 | 3300046519 | Ga0495632_0239850 | Ga0495632_0239850_41_778 | 245 |
| 808 | 3300046523 | Ga0495644_0115708 | Ga0495644_0115708_35_772 | 245 |
| 809 | 3300046525 | Ga0495663_0020186 | Ga0495663_0020186_506_1243 | 245 |
| 810 | 3300046525 | Ga0495663_0068176 | Ga0495663_0068176_187_924 | 245 |
| 811 | 3300046526 | Ga0495666_0017436 | Ga0495666_0017436_13_750 | 245 |
| 812 | 3300046529 | Ga0495652_0058998 | Ga0495652_0058998_1040_1828 | 245 |
| 813 | 3300046531 | Ga0495665_0000510 | Ga0495665_0000510_4582_5319 | 245 |
| 814 | 3300046531 | Ga0495665_0051671 | Ga0495665_0051671_375_1112 | 245 |
| 815 | 3300046531 | Ga0495665_0192939 | Ga0495665_0192939_227_964 | 245 |
| 816 | 3300046533 | Ga0495640_0009055 | Ga0495640_0009055_4573_5310 | 245 |
| 817 | 3300046533 | Ga0495640_0070344 | Ga0495640_0070344_221_958 | 245 |
| 818 | 3300046535 | Ga0495586_0000416 | Ga0495586_0000416_14287_15024 | 245 |
| 819 | 3300046537 | Ga0495598_0041797 | Ga0495598_0041797_20_757 | 245 |
| 820 | 3300046543 | Ga0495645_0000096 | Ga0495645_0000096_52489_53226 | 245 |
| 821 | 3300046543 | Ga0495645_0029696 | Ga0495645_0029696_2973_3710 | 245 |
| 822 | 3300046543 | Ga0495645_0222999 | Ga0495645_0222999_293_1081 | 245 |
| 823 | 3300046558 | Ga0495633_0153902 | Ga0495633_0153902_216_959 | 245 |
| 824 | 3300046559 | Ga0495667_0002769 | Ga0495667_0002769_6434_7171 | 245 |
| 825 | 3300046559 | Ga0495667_0015879 | Ga0495667_0015879_84_821 | 245 |
| 826 | 3300046616 | Ga0495668_0080384 | Ga0495668_0080384_191_928 | 245 |
| 827 | 3300046642 | Ga0495634_0010792 | Ga0495634_0010792_3271_4008 | 245 |
| 828 | 3300046642 | Ga0495634_0022694 | Ga0495634_0022694_1812_2549 | 245 |
| 829 | 3300046663 | Ga0495635_0003733 | Ga0495635_0003733_5017_5754 | 245 |
| 830 | 3300046663 | Ga0495635_0017385 | Ga0495635_0017385_3013_3924 | 245 |
| 831 | 3300046663 | Ga0495635_0027019 | Ga0495635_0027019_1562_2350 | 245 |
| 832 | 3300046664 | Ga0495659_0056809 | Ga0495659_0056809_28_765 | 245 |
| 833 | 3300046674 | Ga0495588_0319217 | Ga0495588_0319217_32_769 | 245 |
| 834 | 3300046675 | Ga0495657_0000027 | Ga0495657_0000027_69179_69916 | 245 |
| 835 | 3300046675 | Ga0495657_0132396 | Ga0495657_0132396_667_1404 | 245 |
| 836 | 3300046681 | Ga0495647_0063423 | Ga0495647_0063423_462_1199 | 245 |
| 837 | 3300046683 | Ga0495658_0000356 | Ga0495658_0000356_18336_19073 | 245 |
| 838 | 3300046689 | Ga0495613_0006132 | Ga0495613_0006132_3382_4119 | 245 |
| 839 | 3300046690 | Ga0495624_0012550 | Ga0495624_0012550_468_1205 | 245 |
| 840 | 3300046794 | Ga0495589_0115699 | Ga0495589_0115699_30_767 | 245 |
| 841 | 3300046809 | Ga0495600_0008124 | Ga0495600_0008124_5122_5859 | 245 |
| 842 | 3300046809 | Ga0495600_0012918 | Ga0495600_0012918_569_1306 | 245 |
| 843 | 3300047315 | Ga0495581_0000589 | Ga0495581_0000589_4636_5373 | 245 |
| 844 | 3300047315 | Ga0495581_0008442 | Ga0495581_0008442_3548_4285 | 245 |
| 845 | 3300047315 | Ga0495581_0036720 | Ga0495581_0036720_260_997 | 245 |
| 846 | 3300047315 | Ga0495581_0057184 | Ga0495581_0057184_1265_2002 | 245 |
| 847 | 3300047317 | Ga0495604_0112987 | Ga0495604_0112987_94_831 | 245 |
| 848 | 3300047319 | Ga0495674_0003615 | Ga0495674_0003615_6579_7316 | 245 |
| 849 | 3300047319 | Ga0495674_0290143 | Ga0495674_0290143_363_1100 | 245 |
| 850 | 3300047321 | Ga0495676_0002194 | Ga0495676_0002194_11379_12116 | 245 |
| 851 | 3300047321 | Ga0495676_0066469 | Ga0495676_0066469_449_1186 | 245 |
| 852 | 3300047321 | Ga0495676_0076321 | Ga0495676_0076321_128_865 | 245 |
| 853 | 3300047321 | Ga0495676_0360213 | Ga0495676_0360213_29_766 | 245 |
| 854 | 3300047321 | Ga0495676_0384912 | Ga0495676_0384912_67_879 | 245 |
| 855 | 3300047322 | Ga0495680_0000298 | Ga0495680_0000298_320_1057 | 245 |
| 856 | 3300047322 | Ga0495680_0022784 | Ga0495680_0022784_1099_1836 | 245 |
| 857 | 3300047322 | Ga0495680_0035743 | Ga0495680_0035743_1125_2036 | 245 |
| 858 | 3300047323 | Ga0495683_0160497 | Ga0495683_0160497_241_978 | 245 |
| 859 | 3300047445 | Ga0495677_0048713 | Ga0495677_0048713_626_1363 | 245 |
| 860 | 3300047445 | Ga0495677_0158893 | Ga0495677_0158893_124_861 | 245 |
| 861 | 3300047471 | Ga0495684_0005161 | Ga0495684_0005161_1612_2349 | 245 |
| 862 | 3300047471 | Ga0495684_0020263 | Ga0495684_0020263_1129_1917 | 245 |
| 863 | 3300047471 | Ga0495684_0038293 | Ga0495684_0038293_2287_3024 | 245 |
| 864 | 3300047673 | Ga0495593_0015393 | Ga0495593_0015393_1669_2457 | 245 |
| 865 | 3300048088 | Ga0495602_0272617 | Ga0495602_0272617_291_1028 | 245 |
| 866 | 3300048903 | Ga0496100_0001935 | Ga0496100_0001935_1541_2278 | 245 |
| 867 | 3300048903 | Ga0496100_0003218 | Ga0496100_0003218_1802_2539 | 245 |
| 868 | 3300048903 | Ga0496100_0011017 | Ga0496100_0011017_422_1159 | 245 |
| 869 | 3300048903 | Ga0496100_0106640 | Ga0496100_0106640_595_1332 | 245 |
| 870 | 3300048904 | Ga0496101_0001199 | Ga0496101_0001199_3569_4306 | 245 |
| 871 | 3300048904 | Ga0496101_0017486 | Ga0496101_0017486_2009_2746 | 245 |
| 872 | 3300048904 | Ga0496101_0032607 | Ga0496101_0032607_1634_2371 | 245 |
| 873 | 3300048904 | Ga0496101_0044045 | Ga0496101_0044045_706_1443 | 245 |
| 874 | 3300048904 | Ga0496101_0206430 | Ga0496101_0206430_76_813 | 245 |
| 875 | 3300048904 | Ga0496101_0296791 | Ga0496101_0296791_437_1174 | 245 |
| 876 | 3300048905 | Ga0496102_0001299 | Ga0496102_0001299_17649_18386 | 245 |
| 877 | 3300048905 | Ga0496102_0016678 | Ga0496102_0016678_2587_3324 | 245 |
| 878 | 3300048905 | Ga0496102_0024499 | Ga0496102_0024499_1456_2193 | 245 |
| 879 | 3300048905 | Ga0496102_0075914 | Ga0496102_0075914_306_1043 | 245 |
| 880 | 3300048905 | Ga0496102_0095291 | Ga0496102_0095291_613_1350 | 245 |
| 881 | 3300048905 | Ga0496102_0331326 | Ga0496102_0331326_672_1409 | 245 |
| 882 | 3300048906 | Ga0496103_0003383 | Ga0496103_0003383_7868_8605 | 245 |
| 883 | 3300048906 | Ga0496103_0009549 | Ga0496103_0009549_4879_5616 | 245 |
| 884 | 3300048906 | Ga0496103_0086756 | Ga0496103_0086756_490_1227 | 245 |
| 885 | 3300048906 | Ga0496103_0129235 | Ga0496103_0129235_834_1571 | 245 |
| 886 | 3300048907 | Ga0496104_0004546 | Ga0496104_0004546_465_1202 | 245 |
| 887 | 3300048907 | Ga0496104_0023051 | Ga0496104_0023051_3687_4424 | 245 |
| 888 | 3300048907 | Ga0496104_0061270 | Ga0496104_0061270_1765_2502 | 245 |
| 889 | 3300048907 | Ga0496104_0096032 | Ga0496104_0096032_1667_2404 | 245 |
| 890 | 3300048907 | Ga0496104_0657938 | Ga0496104_0657938_158_895 | 245 |
| 891 | 3300048908 | Ga0496105_0001487 | Ga0496105_0001487_8288_9025 | 245 |
| 892 | 3300048908 | Ga0496105_0018157 | Ga0496105_0018157_4572_5309 | 245 |
| 893 | 3300048908 | Ga0496105_0026821 | Ga0496105_0026821_3133_3870 | 245 |
| 894 | 3300048908 | Ga0496105_0030322 | Ga0496105_0030322_2308_3045 | 245 |
| 895 | 3300048908 | Ga0496105_0067203 | Ga0496105_0067203_1830_2567 | 245 |
| 896 | 3300048909 | Ga0496106_0005675 | Ga0496106_0005675_1538_2275 | 245 |
| 897 | 3300048909 | Ga0496106_0011163 | Ga0496106_0011163_2182_2919 | 245 |
| 898 | 3300048909 | Ga0496106_0013211 | Ga0496106_0013211_3854_4591 | 245 |
| 899 | 3300048909 | Ga0496106_0027485 | Ga0496106_0027485_1331_2068 | 245 |
| 900 | 3300048909 | Ga0496106_0115149 | Ga0496106_0115149_1058_1795 | 245 |
| 901 | 3300048910 | Ga0496107_0000485 | Ga0496107_0000485_7008_7745 | 245 |
| 902 | 3300048910 | Ga0496107_0001899 | Ga0496107_0001899_5923_6660 | 245 |
| 903 | 3300048910 | Ga0496107_0007973 | Ga0496107_0007973_4387_5124 | 245 |
| 904 | 3300048910 | Ga0496107_0032609 | Ga0496107_0032609_1286_2023 | 245 |
| 905 | 3300048910 | Ga0496107_0089594 | Ga0496107_0089594_896_1633 | 245 |
| 906 | 3300048910 | Ga0496107_0106544 | Ga0496107_0106544_747_1484 | 245 |
| 907 | 3300048910 | Ga0496107_0454833 | Ga0496107_0454833_57_827 | 245 |
| 908 | 3300048911 | Ga0496108_0011737 | Ga0496108_0011737_5580_6317 | 245 |
| 909 | 3300048911 | Ga0496108_0016673 | Ga0496108_0016673_4088_4825 | 245 |
| 910 | 3300048911 | Ga0496108_0022806 | Ga0496108_0022806_476_1246 | 245 |
| 911 | 3300048911 | Ga0496108_0041409 | Ga0496108_0041409_1672_2409 | 245 |
| 912 | 3300048911 | Ga0496108_0139643 | Ga0496108_0139643_1295_2032 | 245 |
| 913 | 3300048911 | Ga0496108_0313015 | Ga0496108_0313015_265_1002 | 245 |
| 914 | 3300048912 | Ga0496109_0010750 | Ga0496109_0010750_3102_3839 | 245 |
| 915 | 3300048912 | Ga0496109_0122677 | Ga0496109_0122677_1621_2358 | 245 |
| 916 | 3300048912 | Ga0496109_0126669 | Ga0496109_0126669_1214_1951 | 245 |
| 917 | 3300048912 | Ga0496109_0280012 | Ga0496109_0280012_619_1356 | 245 |
| 918 | 3300048913 | Ga0496110_0002608 | Ga0496110_0002608_9739_10476 | 245 |
| 919 | 3300048913 | Ga0496110_0025927 | Ga0496110_0025927_3952_4689 | 245 |
| 920 | 3300048913 | Ga0496110_0110132 | Ga0496110_0110132_45_782 | 245 |
| 921 | 3300048913 | Ga0496110_0381875 | Ga0496110_0381875_423_1193 | 245 |
| 922 | 3300048913 | Ga0496110_0384778 | Ga0496110_0384778_335_1072 | 245 |
| 923 | 3300048913 | Ga0496110_0392222 | Ga0496110_0392222_18_755 | 245 |
| 924 | 3300048914 | Ga0496111_0033736 | Ga0496111_0033736_1184_1921 | 245 |
| 925 | 3300048914 | Ga0496111_0040587 | Ga0496111_0040587_639_1376 | 245 |
| 926 | 3300048914 | Ga0496111_0043975 | Ga0496111_0043975_2230_2967 | 245 |
| 927 | 3300048914 | Ga0496111_0248188 | Ga0496111_0248188_268_1005 | 245 |
| 928 | 3300048914 | Ga0496111_0562335 | Ga0496111_0562335_16_753 | 245 |
| 929 | 3300048915 | Ga0496112_0009522 | Ga0496112_0009522_6194_6931 | 245 |
| 930 | 3300048915 | Ga0496112_0025748 | Ga0496112_0025748_1846_2583 | 245 |
| 931 | 3300048915 | Ga0496112_0025813 | Ga0496112_0025813_1067_1804 | 245 |
| 932 | 3300048915 | Ga0496112_0157698 | Ga0496112_0157698_559_1296 | 245 |
| 933 | 3300048915 | Ga0496112_0237441 | Ga0496112_0237441_352_1089 | 245 |
| 934 | 3300048915 | Ga0496112_0330562 | Ga0496112_0330562_570_1307 | 245 |
| 935 | 3300048915 | Ga0496112_0710478 | Ga0496112_0710478_132_869 | 245 |
| 936 | 3300048916 | Ga0496113_0001704 | Ga0496113_0001704_1229_1966 | 245 |
| 937 | 3300048916 | Ga0496113_0119418 | Ga0496113_0119418_743_1513 | 245 |
| 938 | 3300048916 | Ga0496113_0207704 | Ga0496113_0207704_570_1307 | 245 |
| 939 | 3300048917 | Ga0496114_0005633 | Ga0496114_0005633_8052_8789 | 245 |
| 940 | 3300048917 | Ga0496114_0014359 | Ga0496114_0014359_1716_2453 | 245 |
| 941 | 3300048917 | Ga0496114_0027734 | Ga0496114_0027734_649_1386 | 245 |
| 942 | 3300048917 | Ga0496114_0133208 | Ga0496114_0133208_696_1433 | 245 |
| 943 | 3300048918 | Ga0496115_0008007 | Ga0496115_0008007_3020_3757 | 245 |
| 944 | 3300048918 | Ga0496115_0008263 | Ga0496115_0008263_5754_6491 | 245 |
| 945 | 3300048918 | Ga0496115_0018578 | Ga0496115_0018578_2517_3254 | 245 |
| 946 | 3300048918 | Ga0496115_0019021 | Ga0496115_0019021_1534_2271 | 245 |
| 947 | 3300048918 | Ga0496115_0030001 | Ga0496115_0030001_299_1036 | 245 |
| 948 | 3300048918 | Ga0496115_0048580 | Ga0496115_0048580_1537_2274 | 245 |
| 949 | 3300048918 | Ga0496115_0269215 | Ga0496115_0269215_159_896 | 245 |
| 950 | 3300048918 | Ga0496115_0604794 | Ga0496115_0604794_27_839 | 245 |
| 951 | 3300049576 | Ga0501040_0483549 | Ga0501040_0483549_133_870 | 245 |
| 952 | 3300049583 | Ga0501067_0013055 | Ga0501067_0013055_1360_2097 | 245 |
| 953 | 3300049583 | Ga0501067_0020211 | Ga0501067_0020211_2646_3383 | 245 |
| 954 | 3300049583 | Ga0501067_0072306 | Ga0501067_0072306_400_1137 | 245 |
| 955 | 3300049584 | Ga0501068_0335852 | Ga0501068_0335852_161_898 | 245 |
| 956 | 3300049585 | Ga0501069_0045395 | Ga0501069_0045395_737_1474 | 245 |
| 957 | 3300049585 | Ga0501069_0121306 | Ga0501069_0121306_625_1362 | 245 |
| 958 | 3300049587 | Ga0501071_0162630 | Ga0501071_0162630_157_897 | 245 |
| 959 | 3300049592 | Ga0501076_0063794 | Ga0501076_0063794_838_1575 | 245 |
| 960 | 3300049656 | Ga0501209_082374 | Ga0501209_082374_112_855 | 245 |
| 961 | 3300049660 | Ga0501216_039765 | Ga0501216_039765_66_806 | 245 |
| 962 | 3300050491 | nmdc:mga00v17_13500_c1 | nmdc:mga00v17_13500_c1_728_1498 | 245 |
| 963 | 3300050491 | nmdc:mga00v17_146630_c1 | nmdc:mga00v17_146630_c1_534_1274 | 245 |
| 964 | 3300050491 | nmdc:mga00v17_55987_c1 | nmdc:mga00v17_55987_c1_278_1015 | 245 |
| 965 | 3300050492 | nmdc:mga0yw44_116985_c1 | nmdc:mga0yw44_116985_c1_921_1658 | 245 |
| 966 | 3300050492 | nmdc:mga0yw44_164311_c1 | nmdc:mga0yw44_164311_c1_256_996 | 245 |
| 967 | 3300050492 | nmdc:mga0yw44_181783_c1 | nmdc:mga0yw44_181783_c1_620_1357 | 245 |
| 968 | 3300050492 | nmdc:mga0yw44_30517_c1 | nmdc:mga0yw44_30517_c1_1521_2258 | 245 |
| 969 | 3300050492 | nmdc:mga0yw44_51598_c1 | nmdc:mga0yw44_51598_c1_756_1526 | 245 |
| 970 | 3300050494 | nmdc:mga06z11_131671_c1 | nmdc:mga06z11_131671_c1_656_1393 | 245 |
| 971 | 3300050494 | nmdc:mga06z11_46860_c1 | nmdc:mga06z11_46860_c1_240_1010 | 245 |
| 972 | 3300050495 | nmdc:mga04h51_15383_c1 | nmdc:mga04h51_15383_c1_1112_1849 | 245 |
| 973 | 3300050507 | nmdc:mga05p37_154102_c1 | nmdc:mga05p37_154102_c1_1962_2699 | 245 |
| 974 | 3300050507 | nmdc:mga05p37_176431_c1 | nmdc:mga05p37_176431_c1_1094_1831 | 245 |
| 975 | 3300050507 | nmdc:mga05p37_209249_c1 | nmdc:mga05p37_209249_c1_64_801 | 245 |
| 976 | 3300050507 | nmdc:mga05p37_289704_c1 | nmdc:mga05p37_289704_c1_723_1460 | 245 |
| 977 | 3300050507 | nmdc:mga05p37_292223_c1 | nmdc:mga05p37_292223_c1_47_784 | 245 |
| 978 | 3300050507 | nmdc:mga05p37_300929_c1 | nmdc:mga05p37_300929_c1_566_1303 | 245 |
| 979 | 3300050507 | nmdc:mga05p37_43955_c1 | nmdc:mga05p37_43955_c1_4345_5082 | 245 |
| 980 | 3300050507 | nmdc:mga05p37_54415_c1 | nmdc:mga05p37_54415_c1_1440_2177 | 245 |
| 981 | 3300050507 | nmdc:mga05p37_58954_c1 | nmdc:mga05p37_58954_c1_156_965 | 245 |
| 982 | 3300050507 | nmdc:mga05p37_66039_c1 | nmdc:mga05p37_66039_c1_740_1477 | 245 |
| 983 | 3300050507 | nmdc:mga05p37_84117_c1 | nmdc:mga05p37_84117_c1_1138_1875 | 245 |
| 984 | 3300050507 | nmdc:mga05p37_886432_c1 | nmdc:mga05p37_886432_c1_65_805 | 245 |
| 985 | 3300050507 | nmdc:mga05p37_9555_c1 | nmdc:mga05p37_9555_c1_7212_7949 | 245 |
| 986 | 3300050508 | nmdc:mga09592_145650_c1 | nmdc:mga09592_145650_c1_547_1284 | 245 |
| 987 | 3300050508 | nmdc:mga09592_478220_c1 | nmdc:mga09592_478220_c1_38_778 | 245 |
| 988 | 3300050509 | nmdc:mga0qj67_212160_c1 | nmdc:mga0qj67_212160_c1_376_1113 | 245 |
| 989 | 3300050509 | nmdc:mga0qj67_27476_c1 | nmdc:mga0qj67_27476_c1_2554_3294 | 245 |
| 990 | 3300050509 | nmdc:mga0qj67_73309_c1 | nmdc:mga0qj67_73309_c1_1179_1916 | 245 |
| 991 | 3300050510 | nmdc:mga06r32_12571_c1 | nmdc:mga06r32_12571_c1_5022_5759 | 245 |
| 992 | 3300050510 | nmdc:mga06r32_19742_c1 | nmdc:mga06r32_19742_c1_4466_5206 | 245 |
| 993 | 3300050510 | nmdc:mga06r32_358663_c1 | nmdc:mga06r32_358663_c1_313_1050 | 245 |
| 994 | 3300050510 | nmdc:mga06r32_64436_c2 | nmdc:mga06r32_64436_c2_1522_2259 | 245 |
| 995 | 3300050510 | nmdc:mga06r32_78823_c1 | nmdc:mga06r32_78823_c1_1792_2574 | 245 |
| 996 | 3300050511 | nmdc:mga08y16_221394_c1 | nmdc:mga08y16_221394_c1_74_844 | 245 |
| 997 | 3300050511 | nmdc:mga08y16_46471_c1 | nmdc:mga08y16_46471_c1_3501_4241 | 245 |
| 998 | 3300050511 | nmdc:mga08y16_587600_c1 | nmdc:mga08y16_587600_c1_312_1049 | 245 |
| 999 | 3300050511 | nmdc:mga08y16_64633_c1 | nmdc:mga08y16_64633_c1_33_770 | 245 |
| 1000 | 3300050511 | nmdc:mga08y16_783687_c1 | nmdc:mga08y16_783687_c1_135_872 | 245 |
| 1001 | 3300050511 | nmdc:mga08y16_8878_c1 | nmdc:mga08y16_8878_c1_9105_9914 | 245 |
| 1002 | 3300050512 | nmdc:mga0n895_106274_c1 | nmdc:mga0n895_106274_c1_748_1485 | 245 |
| 1003 | 3300050512 | nmdc:mga0n895_134372_c1 | nmdc:mga0n895_134372_c1_336_1073 | 245 |
| 1004 | 3300050512 | nmdc:mga0n895_271288_c1 | nmdc:mga0n895_271288_c1_263_1000 | 245 |
| 1005 | 3300050512 | nmdc:mga0n895_316404_c1 | nmdc:mga0n895_316404_c1_72_809 | 245 |
| 1006 | 3300050512 | nmdc:mga0n895_425375_c1 | nmdc:mga0n895_425375_c1_286_1023 | 245 |
| 1007 | 3300050512 | nmdc:mga0n895_432283_c1 | nmdc:mga0n895_432283_c1_179_916 | 245 |
| 1008 | 3300050512 | nmdc:mga0n895_641836_c1 | nmdc:mga0n895_641836_c1_229_966 | 245 |
| 1009 | 3300050512 | nmdc:mga0n895_6827_c1 | nmdc:mga0n895_6827_c1_3734_4471 | 245 |
| 1010 | 3300050512 | nmdc:mga0n895_87870_c1 | nmdc:mga0n895_87870_c1_1611_2348 | 245 |
| 1011 | 3300050513 | nmdc:mga0rr50_159551_c1 | nmdc:mga0rr50_159551_c1_886_1623 | 245 |
| 1012 | 3300050513 | nmdc:mga0rr50_15994_c1 | nmdc:mga0rr50_15994_c1_1579_2316 | 245 |
| 1013 | 3300050513 | nmdc:mga0rr50_17058_c1 | nmdc:mga0rr50_17058_c1_1495_2232 | 245 |
| 1014 | 3300050513 | nmdc:mga0rr50_173052_c1 | nmdc:mga0rr50_173052_c1_883_1620 | 245 |
| 1015 | 3300050513 | nmdc:mga0rr50_270156_c1 | nmdc:mga0rr50_270156_c1_27_764 | 245 |
| 1016 | 3300050513 | nmdc:mga0rr50_324426_c1 | nmdc:mga0rr50_324426_c1_37_774 | 245 |
| 1017 | 3300050513 | nmdc:mga0rr50_60199_c1 | nmdc:mga0rr50_60199_c1_810_1547 | 245 |
| 1018 | 3300050514 | nmdc:mga08x19_104241_c1 | nmdc:mga08x19_104241_c1_624_1361 | 245 |
| 1019 | 3300050514 | nmdc:mga08x19_259661_c1 | nmdc:mga08x19_259661_c1_48_785 | 245 |
| 1020 | 3300050514 | nmdc:mga08x19_59250_c1 | nmdc:mga08x19_59250_c1_691_1428 | 245 |
| 1021 | 3300050514 | nmdc:mga08x19_5982_c1 | nmdc:mga08x19_5982_c1_2171_2908 | 245 |
| 1022 | 3300050515 | nmdc:mga0a205_152148_c1 | nmdc:mga0a205_152148_c1_873_1610 | 245 |
| 1023 | 3300050515 | nmdc:mga0a205_157349_c1 | nmdc:mga0a205_157349_c1_878_1615 | 245 |
| 1024 | 3300050515 | nmdc:mga0a205_212542_c1 | nmdc:mga0a205_212542_c1_394_1131 | 245 |
| 1025 | 3300050515 | nmdc:mga0a205_278056_c1 | nmdc:mga0a205_278056_c1_523_1272 | 245 |
| 1026 | 3300050515 | nmdc:mga0a205_33881_c1 | nmdc:mga0a205_33881_c1_3353_4090 | 245 |
| 1027 | 3300050515 | nmdc:mga0a205_37515_c1 | nmdc:mga0a205_37515_c1_3371_4111 | 245 |
| 1028 | 3300050515 | nmdc:mga0a205_3829_c1 | nmdc:mga0a205_3829_c1_11010_11747 | 245 |
| 1029 | 3300050515 | nmdc:mga0a205_730752_c1 | nmdc:mga0a205_730752_c1_67_804 | 245 |
| 1030 | 3300050515 | nmdc:mga0a205_77257_c1 | nmdc:mga0a205_77257_c1_318_1058 | 245 |
| 1031 | 3300053077 | Ga0495601_0000244 | Ga0495601_0000244_3474_4211 | 245 |
| 1032 | 3300053077 | Ga0495601_0099836 | Ga0495601_0099836_941_1678 | 245 |
| 1033 | 3300053078 | Ga0495612_0000024 | Ga0495612_0000024_32631_33374 | 245 |
| 1034 | 3300053083 | Ga0495655_0056459 | Ga0495655_0056459_217_969 | 245 |
| 1035 | 3300053084 | Ga0495595_0112753 | Ga0495595_0112753_178_915 | 245 |
| 1036 | 3300053085 | Ga0495619_0169104 | Ga0495619_0169104_708_1496 | 245 |
| 1037 | 3300061719 | Ga0466962_0009567 | Ga0466962_0009567_2453_3190 | 245 |
| 1038 | 3300061719 | Ga0466962_0013330 | Ga0466962_0013330_2547_3293 | 245 |
| 1039 | 3300061719 | Ga0466962_0058285 | Ga0466962_0058285_42_779 | 245 |
| 1040 | 3300061719 | Ga0466962_0116512 | Ga0466962_0116512_382_1128 | 245 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ixr-assembly1.cif.gz_A | crystal structure of xylella fastidiosa prxq c47s mutant | 0.7664 | 49 | 226 |
| 1xqs-assembly2.cif.gz_D | crystal structure of the hspbp1 core domain complexed with the fragment of hsp70 atpase domain | 0.7501 | 190 | 210 |
| 4eo3-assembly1.cif.gz_B | peroxiredoxin nitroreductase fusion enzyme | 0.7437 | 43 | 226 |
| 5io2-assembly1.cif.gz_A | xanthomonas campestris peroxiredoxin q - c48s mutant | 0.7322 | 50 | 210 |
| 5iph-assembly1.cif.gz_A | xanthomonas campestris peroxiredoxin q - c84s mutant | 0.7321 | 50 | 210 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AE52_4_156_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.81 | 40 | 150 | 3.40.30.10 |
| af_Q2G280_3_151_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.7936 | 47 | 211 | 3.40.30.10 |
| af_Q0D5G1_11_348_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.7682 | 190 | 213 | 2.130.10.10 |
| af_Q24JW8_19_118_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.7507 | 189 | 210 | 2.60.40.10 |
| af_Q54W30_4_152_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.7453 | 40 | 226 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536JEW5-F1-model_v4 | DUF899 domain-containing protein | 0.9838 | 40 | 245 |
|
| AF-A0A536CKR3-F1-model_v4 | DUF899 domain-containing protein | 0.9833 | 1 | 245 |
|
| AF-A0A538LY14-F1-model_v4 | DUF899 domain-containing protein | 0.9828 | 1 | 245 |
|
| AF-A0A538JEK0-F1-model_v4 | DUF899 domain-containing protein | 0.9817 | 1 | 245 |
|
| AF-A0A536JEW5-F1-model_v4 | DUF899 domain-containing protein | 0.9791 | 40 | 245 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar