F488811

General Info

Members Datasets Scaffolds Average Seq Length
1040 320 1040 246

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10000427|Ga0081538_1000042712
Length 249
Sequence MATVPEHKIGTREEWQAARDELAKLEAQQAERNEEIKRKRRGLPWVPVEKEYEFDTQEGKKRLAELFDGRSQLLAYNIMYGPDYTVGACPGCTNLADGFDATTLLHLNKRDVTMICFSRAPIDRLTAYRERMGWGFPYVSTYGTDFPWDFGLALTEEQARQIPAVSQMVDNPPEWLRFWASQVGAELKDGLRENPSYIAFAKDNGTVYHTYTVSAPDPFVAPYFSFLLDRTPKEQPEEPLNYRKDEYPD

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
84 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
100 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
188 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
189 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
190 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
191 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
192 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
193 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
194 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
195 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
197 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
206 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
207 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
208 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
209 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
210 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
211 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
212 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
213 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
214 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
215 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
216 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
217 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
218 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
219 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
220 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
221 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
222 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
223 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
224 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
225 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
226 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
227 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
228 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
229 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
230 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
231 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
232 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
233 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
234 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
235 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
236 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
237 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
238 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
239 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
240 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
241 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
242 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
243 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
244 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
245 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
246 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
247 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
248 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
249 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
250 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
251 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
252 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
253 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
254 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
255 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
256 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
257 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
258 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
259 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
260 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
261 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
262 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
263 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
264 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
265 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
266 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
267 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
268 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
269 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
270 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
271 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
272 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
273 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
274 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
275 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
276 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
279 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
280 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
281 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
282 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
283 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
284 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
285 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
286 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
287 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
288 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
289 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
290 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
291 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
294 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
295 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
296 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
297 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
298 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
299 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
300 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
301 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
302 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
303 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
304 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
305 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
306 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
307 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
308 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
309 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
310 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
311 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
312 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
313 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
314 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
315 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
316 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
317 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
318 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
320 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.75
Metatranscriptomes 1.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.92
Nodule 0
Rhizoplane 8.75
Rhizosphere 88.17
Stem 0
Stem Tuber 0
Unclassified 1.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10001507 3300003373 Bacteria 5288
2 JGI25407J50210_10008973 3300003373 Bacteria 2526
3 JGI25407J50210_10011522 3300003373 Bacteria 2260
4 JGI25407J50210_10047189 3300003373 Bacteria 1095
5 Ga0070658_10115835 3300005327 Bacteria 2223
6 Ga0070683_100013253 3300005329 Bacteria 7185
7 Ga0070683_100044886 3300005329 Bacteria 4078
8 Ga0070683_100047910 3300005329 Bacteria 3950
9 Ga0070683_100113734 3300005329 Bacteria 2554
10 Ga0070683_100513861 3300005329 Bacteria 1145
11 Ga0070683_100939499 3300005329 Bacteria 830
12 Ga0070690_100045622 3300005330 Bacteria 2785
13 Ga0068869_100104383 3300005334 Bacteria 2148
14 Ga0070680_100023564 3300005336 Bacteria 4910
15 Ga0070680_100057319 3300005336 Bacteria 3185
16 Ga0070680_100093720 3300005336 Unclassified 2488
17 Ga0070680_100287394 3300005336 Bacteria 1394
18 Ga0070682_100026173 3300005337 Bacteria 3489
19 Ga0070682_100062012 3300005337 Bacteria 2367
20 Ga0070682_100367311 3300005337 Bacteria 1078
21 Ga0068868_100284876 3300005338 Bacteria 1399
22 Ga0070660_100005554 3300005339 Bacteria 8736
23 Ga0070660_100008896 3300005339 Bacteria 7041
24 Ga0070661_100029503 3300005344 Bacteria 3960
25 Ga0070661_100163728 3300005344 Bacteria 1685
26 Ga0070692_10003017 3300005345 Bacteria 6709
27 Ga0070692_10046853 3300005345 Unclassified 2236
28 Ga0070668_100005321 3300005347 Bacteria 9556
29 Ga0070668_100090989 3300005347 Bacteria 2404
30 Ga0070668_100148982 3300005347 Bacteria 1891
31 Ga0070668_100203341 3300005347 Bacteria 1627
32 Ga0070669_100621992 3300005353 Unclassified 906
33 Ga0070675_100030266 3300005354 Bacteria 4369
34 Ga0070675_100299541 3300005354 Unclassified 1416
35 Ga0070671_100151973 3300005355 Unclassified 1955
36 Ga0070671_100462487 3300005355 Unclassified 1089
37 Ga0070674_100042039 3300005356 Bacteria 3102
38 Ga0070674_100194634 3300005356 Bacteria 1561
39 Ga0070674_100487106 3300005356 Unclassified 1025
40 Ga0070688_100010646 3300005365 Bacteria 5080
41 Ga0070659_100004504 3300005366 Bacteria 9952
42 Ga0070659_100054848 3300005366 Bacteria 3140
43 Ga0070659_100554391 3300005366 Bacteria 984
44 Ga0070667_100245436 3300005367 Bacteria 1600
45 Ga0070709_10048625 3300005434 Unclassified 2647
46 Ga0070709_10052381 3300005434 Bacteria 2565
47 Ga0070709_10054046 3300005434 Bacteria 2530
48 Ga0070714_100005053 3300005435 Bacteria 10033
49 Ga0070714_100010256 3300005435 Bacteria 7396
50 Ga0070714_100103275 3300005435 Bacteria 2514
51 Ga0070714_100113766 3300005435 Unclassified 2400
52 Ga0070714_100450171 3300005435 Archaea 1223
53 Ga0070714_100460668 3300005435 Bacteria 1209
54 Ga0070714_100857541 3300005435 Unclassified 881
55 Ga0070713_100043272 3300005436 Plasmid 3681
56 Ga0070713_100062584 3300005436 Bacteria 3117
57 Ga0070713_100087824 3300005436 Bacteria 2667
58 Ga0070713_100133794 3300005436 Unclassified 2189
59 Ga0070713_100280041 3300005436 Unclassified 1530
60 Ga0070713_100705421 3300005436 Bacteria 963
61 Ga0070710_10015128 3300005437 Bacteria 3898
62 Ga0070710_10091091 3300005437 Bacteria 1799
63 Ga0070710_10172943 3300005437 Bacteria 1347
64 Ga0070710_10276796 3300005437 Bacteria 1087
65 Ga0070701_10028242 3300005438 Unclassified 2757
66 Ga0070701_10205805 3300005438 Bacteria 1166
67 Ga0070711_100005462 3300005439 Bacteria 7603
68 Ga0070711_100037574 3300005439 Bacteria 3250
69 Ga0070711_100079539 3300005439 Bacteria 2332
70 Ga0070711_100188482 3300005439 Bacteria 1583
71 Ga0070711_100481169 3300005439 Unclassified 1020
72 Ga0070711_100565915 3300005439 Bacteria 944
73 Ga0070705_100021223 3300005440 Bacteria 3451
74 Ga0070705_100318368 3300005440 Bacteria 1122
75 Ga0070700_100019120 3300005441 Bacteria 3949
76 Ga0070700_100047266 3300005441 Bacteria 2663
77 Ga0070700_100137042 3300005441 Bacteria 1659
78 Ga0070700_100178438 3300005441 Bacteria 1476
79 Ga0070708_100037038 3300005445 Bacteria 4254
80 Ga0070708_100079609 3300005445 Bacteria 2965
81 Ga0070708_100154856 3300005445 Bacteria 2133
82 Ga0070708_100162787 3300005445 Bacteria 2080
83 Ga0070708_100241101 3300005445 Bacteria 1697
84 Ga0070708_100285405 3300005445 Bacteria 1554
85 Ga0070708_100321166 3300005445 Bacteria 1458
86 Ga0070708_100462749 3300005445 Unclassified 1196
87 Ga0070678_100004320 3300005456 Bacteria 8039
88 Ga0070662_100186375 3300005457 Bacteria 1638
89 Ga0070662_100210571 3300005457 Bacteria 1547
90 Ga0070681_10003999 3300005458 Bacteria 13908
91 Ga0070681_10007241 3300005458 Bacteria 10826
92 Ga0070681_10026548 3300005458 Bacteria 5821
93 Ga0070681_10235521 3300005458 Bacteria 1745
94 Ga0068867_100057511 3300005459 Bacteria 2880
95 Ga0068867_100090980 3300005459 Bacteria 2316
96 Ga0070685_10002573 3300005466 Bacteria 9288
97 Ga0070706_100000355 3300005467 Bacteria 55169
98 Ga0070706_100003262 3300005467 Bacteria 16043
99 Ga0070706_100003466 3300005467 Bacteria 15529
100 Ga0070706_100038316 3300005467 Bacteria 4425
101 Ga0070706_100110440 3300005467 Bacteria 2559
102 Ga0070706_100203845 3300005467 Bacteria 1848
103 Ga0070706_100210914 3300005467 Bacteria 1814
104 Ga0070706_100285776 3300005467 Bacteria 1539
105 Ga0070707_100015988 3300005468 Bacteria 7042
106 Ga0070707_100060696 3300005468 Bacteria 3626
107 Ga0070707_100085492 3300005468 Bacteria 3049
108 Ga0070707_100094045 3300005468 Bacteria 2902
109 Ga0070707_100127246 3300005468 Bacteria 2475
110 Ga0070707_100218182 3300005468 Bacteria 1858
111 Ga0070698_100000877 3300005471 Bacteria 33070
112 Ga0070698_100003968 3300005471 Bacteria 16281
113 Ga0070698_100008006 3300005471 Bacteria 11428
114 Ga0070698_100010517 3300005471 Bacteria 9864
115 Ga0070698_100010654 3300005471 Bacteria 9797
116 Ga0070698_100019558 3300005471 Bacteria 7106
117 Ga0070698_100039520 3300005471 Bacteria 4855
118 Ga0070698_100061762 3300005471 Bacteria 3781
119 Ga0070698_100067691 3300005471 Bacteria 3590
120 Ga0070698_100072849 3300005471 Bacteria 3442
121 Ga0070698_100148510 3300005471 Bacteria 2293
122 Ga0070698_100156240 3300005471 Bacteria 2226
123 Ga0070698_100535091 3300005471 Unclassified 1110
124 Ga0070698_100689082 3300005471 Bacteria 964
125 Ga0070698_100771940 3300005471 Bacteria 905
126 Ga0070699_100000462 3300005518 Bacteria 38841
127 Ga0070699_100000530 3300005518 Bacteria 36055
128 Ga0070699_100000709 3300005518 Bacteria 30905
129 Ga0070699_100000806 3300005518 Bacteria 28959
130 Ga0070699_100031673 3300005518 Bacteria 4566
131 Ga0070699_100131023 3300005518 Unclassified 2210
132 Ga0070699_100498837 3300005518 Bacteria 1106
133 Ga0070699_100540861 3300005518 Bacteria 1060
134 Ga0070679_100009018 3300005530 Bacteria 9410
135 Ga0070679_100017027 3300005530 Bacteria 7027
136 Ga0070679_100095839 3300005530 Bacteria 2955
137 Ga0070679_100129973 3300005530 Bacteria 2500
138 Ga0070679_100192735 3300005530 Bacteria 2006
139 Ga0070679_100376282 3300005530 Unclassified 1367
140 Ga0070684_100185372 3300005535 Bacteria 1892
141 Ga0070684_100185386 3300005535 Bacteria 1892
142 Ga0070684_100498416 3300005535 Bacteria 1128
143 Ga0070684_100560062 3300005535 Bacteria 1061
144 Ga0070684_100832321 3300005535 Bacteria 863
145 Ga0070697_100000066 3300005536 Bacteria 83881
146 Ga0070697_100002722 3300005536 Bacteria 13622
147 Ga0070697_100006497 3300005536 Bacteria 9052
148 Ga0070697_100050318 3300005536 Bacteria 3381
149 Ga0070697_100060774 3300005536 Bacteria 3080
150 Ga0068853_100207035 3300005539 Bacteria 1787
151 Ga0068853_100303761 3300005539 Bacteria 1476
152 Ga0070672_100057173 3300005543 Unclassified 3061
153 Ga0070686_100002093 3300005544 Bacteria 11008
154 Ga0070695_100063594 3300005545 Bacteria 2399
155 Ga0070695_100259151 3300005545 Bacteria 1269
156 Ga0070696_100003739 3300005546 Bacteria 10164
157 Ga0070696_100010458 3300005546 Bacteria 6219
158 Ga0070696_100031550 3300005546 Bacteria 3632
159 Ga0070693_100025536 3300005547 Bacteria 3181
160 Ga0070693_100026449 3300005547 Bacteria 3133
161 Ga0070665_100034039 3300005548 Bacteria 5123
162 Ga0070665_100159951 3300005548 Bacteria 2254
163 Ga0070665_100664774 3300005548 Bacteria 1055
164 Ga0070704_100123440 3300005549 Bacteria 1994
165 Ga0070704_100257264 3300005549 Bacteria 1436
166 Ga0068855_100011061 3300005563 Bacteria 10887
167 Ga0068855_100076710 3300005563 Bacteria 3878
168 Ga0068855_100112342 3300005563 Bacteria 3126
169 Ga0068855_100204031 3300005563 Bacteria 2225
170 Ga0068855_100254819 3300005563 Bacteria 1956
171 Ga0068855_100476220 3300005563 Unclassified 1360
172 Ga0068855_100612133 3300005563 Bacteria 1173
173 Ga0070664_100063839 3300005564 Bacteria 3140
174 Ga0070664_100110841 3300005564 Bacteria 2395
175 Ga0070664_100513122 3300005564 Bacteria 1106
176 Ga0070664_100546534 3300005564 Bacteria 1071
177 Ga0068857_100020142 3300005577 Bacteria 5864
178 Ga0068857_100033886 3300005577 Bacteria 4518
179 Ga0068856_100048306 3300005614 Bacteria 4193
180 Ga0068856_100083216 3300005614 Bacteria 3177
181 Ga0068856_100155779 3300005614 Bacteria 2294
182 Ga0068856_100233260 3300005614 Bacteria 1855
183 Ga0068856_100544559 3300005614 Bacteria 1182
184 Ga0068856_100799862 3300005614 Bacteria 963
185 Ga0070702_100007158 3300005615 Bacteria 5330
186 Ga0070702_100052707 3300005615 Bacteria 2334
187 Ga0068852_100048901 3300005616 Bacteria 3615
188 Ga0068852_100061986 3300005616 Bacteria 3251
189 Ga0068864_100000066 3300005618 Bacteria 116383
190 Ga0068866_10001604 3300005718 Bacteria 9581
191 Ga0068861_100007679 3300005719 Bacteria 7403
192 Ga0068861_100024683 3300005719 Unclassified 4350
193 Ga0068861_100080645 3300005719 Bacteria 2546
194 Ga0068861_100189546 3300005719 Bacteria 1718
195 Ga0068858_100104722 3300005842 Bacteria 2640
196 Ga0068862_100139398 3300005844 Bacteria 2152
197 Ga0081455_10010429 3300005937 Bacteria 9433
198 Ga0081455_10024962 3300005937 Bacteria 5523
199 Ga0081455_10047229 3300005937 Bacteria 3730
200 Ga0081455_10073577 3300005937 Bacteria 2825
201 Ga0081455_10231564 3300005937 Bacteria 1363
202 Ga0081455_10245484 3300005937 Bacteria 1313
203 Ga0081538_10000404 3300005981 Bacteria 48911
204 Ga0081538_10000427 3300005981 Bacteria 47287
205 Ga0081538_10001017 3300005981 Bacteria 29941
206 Ga0081538_10001921 3300005981 Bacteria 20817
207 Ga0081538_10002722 3300005981 Bacteria 16990
208 Ga0081538_10003377 3300005981 Bacteria 15107
209 Ga0081538_10007198 3300005981 Bacteria 9657
210 Ga0081538_10013713 3300005981 Bacteria 6403
211 Ga0081538_10015810 3300005981 Bacteria 5821
212 Ga0081538_10023872 3300005981 Bacteria 4378
213 Ga0081538_10027775 3300005981 Bacteria 3911
214 Ga0081538_10040020 3300005981 Bacteria 2996
215 Ga0081538_10059173 3300005981 Bacteria 2215
216 Ga0081540_1001071 3300005983 Bacteria 24309
217 Ga0081540_1020136 3300005983 Bacteria 4024
218 Ga0081540_1094091 3300005983 Bacteria 1310
219 Ga0081539_10001078 3300005985 Bacteria 49685
220 Ga0081539_10003725 3300005985 Bacteria 18161
221 Ga0081539_10035593 3300005985 Bacteria 2989
222 Ga0081539_10050885 3300005985 Bacteria 2340
223 Ga0081539_10085440 3300005985 Bacteria 1646
224 Ga0070717_10000222 3300006028 Bacteria 39400
225 Ga0070717_10019069 3300006028 Bacteria 5371
226 Ga0070717_10020643 3300006028 Bacteria 5185
227 Ga0070717_10092904 3300006028 Bacteria 2550
228 Ga0070717_10166311 3300006028 Bacteria 1916
229 Ga0070717_10199875 3300006028 Bacteria 1750
230 Ga0075365_10005495 3300006038 Bacteria 6842
231 Ga0075365_10020554 3300006038 Bacteria 4095
232 Ga0075365_10026753 3300006038 Bacteria 3665
233 Ga0075365_10048811 3300006038 Unclassified 2787
234 Ga0075365_10084269 3300006038 Bacteria 2157
235 Ga0075363_100012817 3300006048 Bacteria 4047
236 Ga0075364_10040774 3300006051 Bacteria 3012
237 Ga0075364_10070702 3300006051 Unclassified 2298
238 Ga0075432_10100803 3300006058 Unclassified 1067
239 Ga0070715_10005321 3300006163 Bacteria 4285
240 Ga0070715_10059786 3300006163 Bacteria 1668
241 Ga0070715_10111478 3300006163 Unclassified 1291
242 Ga0070715_10242015 3300006163 Bacteria 939
243 Ga0070716_100009187 3300006173 Bacteria 4922
244 Ga0070716_100056525 3300006173 Bacteria 2251
245 Ga0070716_100161929 3300006173 Unclassified 1451
246 Ga0070712_100006792 3300006175 Bacteria 7120
247 Ga0070712_100040717 3300006175 Bacteria 3186
248 Ga0070712_100040830 3300006175 Bacteria 3182
249 Ga0070712_100052581 3300006175 Bacteria 2841
250 Ga0070712_100064706 3300006175 Bacteria 2594
251 Ga0070712_100259747 3300006175 Bacteria 1391
252 Ga0097621_100013985 3300006237 Bacteria 5994
253 Ga0097621_100333682 3300006237 Bacteria 1345
254 Ga0068871_100005996 3300006358 Bacteria 8554
255 Ga0068871_100062847 3300006358 Bacteria 3035
256 Ga0068871_100895731 3300006358 Unclassified 822
257 Ga0075428_100008845 3300006844 Bacteria 11172
258 Ga0075428_100011990 3300006844 Bacteria 9642
259 Ga0075428_100080455 3300006844 Bacteria 3556
260 Ga0075428_100241992 3300006844 Bacteria 1946
261 Ga0075428_100370617 3300006844 Bacteria 1535
262 Ga0075430_100022119 3300006846 Bacteria 5405
263 Ga0075430_100022646 3300006846 Bacteria 5346
264 Ga0075431_100022301 3300006847 Bacteria 6472
265 Ga0075431_100050949 3300006847 Bacteria 4269
266 Ga0075431_100063042 3300006847 Plasmid 3825
267 Ga0075431_100157001 3300006847 Bacteria 2340
268 Ga0075431_100282525 3300006847 Bacteria 1680
269 Ga0075431_100328964 3300006847 Bacteria 1540
270 Ga0075431_100716023 3300006847 Bacteria 978
271 Ga0075433_10005390 3300006852 Bacteria 10051
272 Ga0075433_10007855 3300006852 Bacteria 8482
273 Ga0075433_10172213 3300006852 Unclassified 1926
274 Ga0075433_10333777 3300006852 Bacteria 1340
275 Ga0075433_10439096 3300006852 Bacteria 1151
276 Ga0075434_100019182 3300006871 Bacteria 6615
277 Ga0075434_100112062 3300006871 Bacteria 2739
278 Ga0075434_100205984 3300006871 Bacteria 1987
279 Ga0075434_100239583 3300006871 Bacteria 1834
280 Ga0075434_100288626 3300006871 Bacteria 1660
281 Ga0075429_100033200 3300006880 Bacteria 4484
282 Ga0075429_100152578 3300006880 Bacteria 2023
283 Ga0075429_100236639 3300006880 Bacteria 1599
284 Ga0068865_100003911 3300006881 Bacteria 8936
285 Ga0068865_100071854 3300006881 Bacteria 2456
286 Ga0075436_100019126 3300006914 Unclassified 4692
287 Ga0075436_100019793 3300006914 Bacteria 4615
288 Ga0075436_100158914 3300006914 Bacteria 1593
289 Ga0075436_100181955 3300006914 Bacteria 1486
290 Ga0075435_100002620 3300007076 Bacteria 11988
291 Ga0075435_100004257 3300007076 Bacteria 9830
292 Ga0075435_100173399 3300007076 Bacteria 1820
293 Ga0075435_100212235 3300007076 Bacteria 1643
294 Ga0099794_10020916 3300007265 Bacteria 2967
295 Ga0099794_10141424 3300007265 Bacteria 1219
296 Ga0099794_10263762 3300007265 Unclassified 889
297 Ga0105244_10181059 3300009036 Bacteria 999
298 Ga0105240_10048754 3300009093 Bacteria 5351
299 Ga0105240_10165245 3300009093 Unclassified 2626
300 Ga0105240_10212995 3300009093 Bacteria 2256
301 Ga0111539_10004613 3300009094 Bacteria 17992
302 Ga0111539_10096335 3300009094 Bacteria 3475
303 Ga0111539_10212532 3300009094 Bacteria 2254
304 Ga0111539_10228140 3300009094 Bacteria 2169
305 Ga0111539_10615886 3300009094 Bacteria 1264
306 Ga0105245_10008994 3300009098 Bacteria 8711
307 Ga0105245_10033307 3300009098 Bacteria 4565
308 Ga0105245_10103796 3300009098 Unclassified 2634
309 Ga0105245_10140748 3300009098 Bacteria 2272
310 Ga0105245_10171360 3300009098 Bacteria 2067
311 Ga0105245_10306255 3300009098 Bacteria 1561
312 Ga0105247_10049508 3300009101 Bacteria 2584
313 Ga0114129_10008186 3300009147 Bacteria 14901
314 Ga0114129_10014902 3300009147 Bacteria 11076
315 Ga0114129_10019240 3300009147 Bacteria 9727
316 Ga0114129_10032040 3300009147 Bacteria 7430
317 Ga0114129_10032163 3300009147 Bacteria 7416
318 Ga0114129_10056990 3300009147 Bacteria 5470
319 Ga0114129_10188525 3300009147 Bacteria 2802
320 Ga0114129_10248910 3300009147 Bacteria 2387
321 Ga0114129_10252578 3300009147 Bacteria 2366
322 Ga0114129_10254074 3300009147 Bacteria 2358
323 Ga0114129_10300192 3300009147 Bacteria 2141
324 Ga0114129_10691269 3300009147 Bacteria 1312
325 Ga0114129_10789464 3300009147 Archaea 1212
326 Ga0114129_11165672 3300009147 Unclassified 961
327 Ga0105243_10002113 3300009148 Bacteria 16802
328 Ga0105241_10086572 3300009174 Bacteria 2465
329 Ga0105241_10236160 3300009174 Unclassified 1543
330 Ga0105242_10001082 3300009176 Bacteria 21400
331 Ga0105242_10299352 3300009176 Bacteria 1467
332 Ga0105242_10833080 3300009176 Unclassified 916
333 Ga0105248_10013215 3300009177 Bacteria 9089
334 Ga0105248_11593278 3300009177 Bacteria 740
335 Ga0105237_10000602 3300009545 Bacteria 50128
336 Ga0105237_10280461 3300009545 Bacteria 1669
337 Ga0105238_10048578 3300009551 Bacteria 4276
338 Ga0105238_10146274 3300009551 Bacteria 2340
339 Ga0105238_10320119 3300009551 Bacteria 1537
340 Ga0105249_10012750 3300009553 Bacteria 7410
341 Ga0105249_10099165 3300009553 Bacteria 2737
342 Ga0105249_10152752 3300009553 Bacteria 2224
343 Ga0105249_10190204 3300009553 Unclassified 2003
344 Ga0105249_10302900 3300009553 Bacteria 1604
345 Ga0105249_10706918 3300009553 Bacteria 1068
346 Ga0105239_10012439 3300010375 Bacteria 9479
347 Ga0105239_10023482 3300010375 Bacteria 6792
348 Ga0105239_10056542 3300010375 Bacteria 4303
349 Ga0105239_10083085 3300010375 Bacteria 3527
350 Ga0105239_10102031 3300010375 Bacteria 3175
351 Ga0105239_10148987 3300010375 Bacteria 2611
352 Ga0105246_10027163 3300011119 Bacteria 3747
353 Ga0105246_10403761 3300011119 Unclassified 1135
354 Ga0157320_1000926 3300012481 Bacteria 1350
355 Ga0157320_1004889 3300012481 Bacteria 873
356 Ga0157338_1002151 3300012515 Bacteria 1518
357 Ga0157373_10096136 3300013100 Bacteria 2085
358 Ga0157370_10077775 3300013104 Bacteria 3125
359 Ga0157370_10089679 3300013104 Bacteria 2888
360 Ga0157370_10288776 3300013104 Bacteria 1515
361 Ga0157370_10402652 3300013104 Bacteria 1259
362 Ga0157369_10001368 3300013105 Bacteria 30050
363 Ga0157369_10065657 3300013105 Bacteria 3905
364 Ga0157369_10135210 3300013105 Bacteria 2611
365 Ga0157369_10565498 3300013105 Bacteria 1175
366 Ga0157374_10025602 3300013296 Bacteria 5300
367 Ga0157374_10291155 3300013296 Unclassified 1614
368 Ga0157378_10002101 3300013297 Bacteria 17759
369 Ga0163162_10004455 3300013306 Bacteria 13495
370 Ga0163162_10023935 3300013306 Bacteria 6027
371 Ga0163162_10044727 3300013306 Bacteria 4435
372 Ga0157372_10015118 3300013307 Bacteria 8262
373 Ga0157372_10082053 3300013307 Bacteria 3650
374 Ga0157372_10282379 3300013307 Bacteria 1930
375 Ga0157375_10050642 3300013308 Bacteria 4074
376 Ga0157375_10115988 3300013308 Bacteria 2782
377 Ga0157375_10127111 3300013308 Unclassified 2665
378 Ga0157380_10004538 3300014326 Bacteria 9638
379 Ga0182008_10067232 3300014497 Unclassified 1763
380 Ga0182008_10138916 3300014497 Bacteria 1215
381 Ga0157377_10030221 3300014745 Bacteria 2933
382 Ga0157377_10098342 3300014745 Bacteria 1739
383 Ga0157376_10036102 3300014969 Bacteria 4001
384 Ga0197907_10720580 3300020069 Bacteria 1211
385 Ga0206356_10343528 3300020070 Bacteria 2235
386 Ga0206356_11354009 3300020070 Unclassified 2036
387 Ga0206356_11431924 3300020070 Bacteria 1062
388 Ga0206349_1954011 3300020075 Bacteria 1015
389 Ga0206350_10340442 3300020080 Bacteria 921
390 Ga0206350_11395722 3300020080 Bacteria 1140
391 Ga0206354_10696187 3300020081 Bacteria 1061
392 Ga0206354_11114285 3300020081 Unclassified 2503
393 Ga0206353_11645146 3300020082 Bacteria 6259
394 Ga0206353_11985042 3300020082 Bacteria 2256
395 Ga0213873_10048531 3300021358 Unclassified 1117
396 Ga0213876_10010928 3300021384 Bacteria 4862
397 Ga0213876_10014059 3300021384 Bacteria 4245
398 Ga0224712_10012585 3300022467 Bacteria 2668
399 Ga0207692_10006355 3300025898 Bacteria 4789
400 Ga0207692_10028495 3300025898 Bacteria 2642
401 Ga0207692_10104794 3300025898 Bacteria 1559
402 Ga0207692_10113633 3300025898 Bacteria 1505
403 Ga0207642_10000449 3300025899 Bacteria 12518
404 Ga0207710_10070883 3300025900 Unclassified 1598
405 Ga0207688_10092682 3300025901 Bacteria 1736
406 Ga0207688_10182197 3300025901 Unclassified 1253
407 Ga0207688_10309293 3300025901 Bacteria 967
408 Ga0207680_10184258 3300025903 Unclassified 1414
409 Ga0207685_10026495 3300025905 Bacteria 2017
410 Ga0207685_10043960 3300025905 Unclassified 1686
411 Ga0207685_10065683 3300025905 Bacteria 1453
412 Ga0207685_10273744 3300025905 Unclassified 826
413 Ga0207699_10005052 3300025906 Bacteria 6310
414 Ga0207699_10010075 3300025906 Bacteria 4728
415 Ga0207699_10036227 3300025906 Unclassified 2811
416 Ga0207699_10120033 3300025906 Bacteria 1699
417 Ga0207699_10121786 3300025906 Bacteria 1688
418 Ga0207705_10476007 3300025909 Unclassified 969
419 Ga0207684_10000006 3300025910 Bacteria 688605
420 Ga0207684_10000111 3300025910 Bacteria 153495
421 Ga0207684_10079026 3300025910 Bacteria 2798
422 Ga0207684_10198572 3300025910 Bacteria 1730
423 Ga0207684_10218558 3300025910 Bacteria 1645
424 Ga0207707_10009759 3300025912 Bacteria 8328
425 Ga0207707_10014965 3300025912 Bacteria 6755
426 Ga0207695_10046851 3300025913 Bacteria 4580
427 Ga0207695_10157193 3300025913 Unclassified 2208
428 Ga0207695_10608627 3300025913 Bacteria 974
429 Ga0207671_10355848 3300025914 Bacteria 1161
430 Ga0207693_10003431 3300025915 Bacteria 13522
431 Ga0207693_10003498 3300025915 Bacteria 13403
432 Ga0207693_10005467 3300025915 Bacteria 10593
433 Ga0207693_10027024 3300025915 Bacteria 4538
434 Ga0207693_10400015 3300025915 Bacteria 1074
435 Ga0207663_10005457 3300025916 Bacteria 6404
436 Ga0207663_10007121 3300025916 Bacteria 5779
437 Ga0207663_10012312 3300025916 Bacteria 4622
438 Ga0207663_10016317 3300025916 Bacteria 4115
439 Ga0207663_10023726 3300025916 Unclassified 3525
440 Ga0207663_10024453 3300025916 Bacteria 3479
441 Ga0207663_10064746 3300025916 Bacteria 2334
442 Ga0207663_10094323 3300025916 Unclassified 1994
443 Ga0207663_10182669 3300025916 Bacteria 1499
444 Ga0207663_10285765 3300025916 Bacteria 1227
445 Ga0207663_10730871 3300025916 Bacteria 785
446 Ga0207660_10004077 3300025917 Bacteria 9522
447 Ga0207660_10029108 3300025917 Bacteria 3785
448 Ga0207660_10242118 3300025917 Bacteria 1421
449 Ga0207660_10356751 3300025917 Bacteria 1172
450 Ga0207662_10026943 3300025918 Unclassified 3317
451 Ga0207657_10008674 3300025919 Bacteria 10293
452 Ga0207657_10009303 3300025919 Bacteria 9894
453 Ga0207657_10013621 3300025919 Bacteria 7974
454 Ga0207657_10014003 3300025919 Bacteria 7847
455 Ga0207657_10110399 3300025919 Bacteria 2272
456 Ga0207652_10017330 3300025921 Bacteria 5894
457 Ga0207652_10035210 3300025921 Bacteria 4224
458 Ga0207652_10183337 3300025921 Unclassified 1882
459 Ga0207646_10000746 3300025922 Bacteria 42261
460 Ga0207646_10009937 3300025922 Bacteria 9358
461 Ga0207646_10014914 3300025922 Bacteria 7356
462 Ga0207646_10017090 3300025922 Bacteria 6795
463 Ga0207646_10025038 3300025922 Bacteria 5462
464 Ga0207646_10035652 3300025922 Bacteria 4493
465 Ga0207646_10043965 3300025922 Bacteria 4010
466 Ga0207646_10113169 3300025922 Bacteria 2436
467 Ga0207646_10187402 3300025922 Bacteria 1869
468 Ga0207646_10559207 3300025922 Unclassified 1028
469 Ga0207659_10171696 3300025926 Unclassified 1711
470 Ga0207659_10319407 3300025926 Bacteria 1281
471 Ga0207687_10005452 3300025927 Bacteria 8416
472 Ga0207687_10007651 3300025927 Bacteria 7101
473 Ga0207687_10163194 3300025927 Unclassified 1712
474 Ga0207687_10320327 3300025927 Bacteria 1255
475 Ga0207687_10519551 3300025927 Unclassified 996
476 Ga0207700_10006621 3300025928 Bacteria 7020
477 Ga0207700_10023694 3300025928 Bacteria 4239
478 Ga0207700_10250028 3300025928 Bacteria 1514
479 Ga0207700_10304288 3300025928 Bacteria 1377
480 Ga0207700_10832602 3300025928 Unclassified 826
481 Ga0207664_10003470 3300025929 Bacteria 10518
482 Ga0207664_10005864 3300025929 Bacteria 8400
483 Ga0207664_10010381 3300025929 Bacteria 6577
484 Ga0207664_10013689 3300025929 Bacteria 5832
485 Ga0207664_10052039 3300025929 Bacteria 3237
486 Ga0207664_10159446 3300025929 Bacteria 1923
487 Ga0207664_10401410 3300025929 Bacteria 1219
488 Ga0207664_10410661 3300025929 Bacteria 1205
489 Ga0207664_10671385 3300025929 Unclassified 932
490 Ga0207664_10701832 3300025929 Archaea 910
491 Ga0207644_10020755 3300025931 Bacteria 4469
492 Ga0207644_10633882 3300025931 Unclassified 889
493 Ga0207690_10371340 3300025932 Bacteria 1135
494 Ga0207690_10436351 3300025932 Bacteria 1050
495 Ga0207706_10003766 3300025933 Bacteria 14468
496 Ga0207706_10186011 3300025933 Bacteria 1824
497 Ga0207706_10333307 3300025933 Bacteria 1320
498 Ga0207686_10001941 3300025934 Bacteria 11414
499 Ga0207709_10001307 3300025935 Bacteria 17736
500 Ga0207709_10068350 3300025935 Bacteria 2245
501 Ga0207709_10097111 3300025935 Bacteria 1939
502 Ga0207709_10134650 3300025935 Bacteria 1689
503 Ga0207709_10688459 3300025935 Unclassified 817
504 Ga0207670_10221494 3300025936 Unclassified 1449
505 Ga0207669_10003552 3300025937 Bacteria 6754
506 Ga0207669_10008329 3300025937 Bacteria 4860
507 Ga0207669_10100834 3300025937 Bacteria 1908
508 Ga0207704_10001093 3300025938 Bacteria 12036
509 Ga0207704_10098645 3300025938 Bacteria 1941
510 Ga0207665_10002156 3300025939 Bacteria 13326
511 Ga0207665_10010333 3300025939 Bacteria 6128
512 Ga0207665_10054983 3300025939 Bacteria 2685
513 Ga0207665_10070823 3300025939 Bacteria 2380
514 Ga0207665_10079926 3300025939 Bacteria 2248
515 Ga0207665_10120205 3300025939 Bacteria 1855
516 Ga0207691_10025953 3300025940 Bacteria 5499
517 Ga0207711_10063349 3300025941 Bacteria 3191
518 Ga0207661_10114948 3300025944 Bacteria 2282
519 Ga0207661_10145048 3300025944 Bacteria 2047
520 Ga0207661_10217226 3300025944 Bacteria 1688
521 Ga0207661_10320529 3300025944 Bacteria 1393
522 Ga0207661_10409811 3300025944 Bacteria 1230
523 Ga0207679_10024106 3300025945 Bacteria 4169
524 Ga0207679_10212206 3300025945 Bacteria 1624
525 Ga0207679_10743176 3300025945 Unclassified 892
526 Ga0207667_10112119 3300025949 Bacteria 2813
527 Ga0207667_10157031 3300025949 Bacteria 2340
528 Ga0207667_10238071 3300025949 Unclassified 1863
529 Ga0207667_10319832 3300025949 Bacteria 1585
530 Ga0207667_10689951 3300025949 Bacteria 1024
531 Ga0207651_10321139 3300025960 Bacteria 1294
532 Ga0207712_10117751 3300025961 Bacteria 2004
533 Ga0207712_10150883 3300025961 Bacteria 1795
534 Ga0207712_10170148 3300025961 Bacteria 1702
535 Ga0207712_10194731 3300025961 Bacteria 1602
536 Ga0207712_10212611 3300025961 Bacteria 1541
537 Ga0207712_10592014 3300025961 Unclassified 958
538 Ga0207712_10704374 3300025961 Bacteria 882
539 Ga0207668_10026631 3300025972 Bacteria 3756
540 Ga0207668_10031470 3300025972 Bacteria 3495
541 Ga0207668_10155093 3300025972 Bacteria 1778
542 Ga0207677_10181307 3300026023 Bacteria 1657
543 Ga0207677_10428480 3300026023 Bacteria 1128
544 Ga0207639_10075418 3300026041 Bacteria 2652
545 Ga0207639_10499116 3300026041 Bacteria 1111
546 Ga0207678_10055531 3300026067 Bacteria 3411
547 Ga0207678_10069245 3300026067 Bacteria 3025
548 Ga0207708_10000316 3300026075 Bacteria 38103
549 Ga0207708_10473756 3300026075 Unclassified 1046
550 Ga0207702_10009738 3300026078 Bacteria 8071
551 Ga0207702_10455841 3300026078 Bacteria 1241
552 Ga0207702_10486576 3300026078 Bacteria 1201
553 Ga0207648_10006150 3300026089 Bacteria 11962
554 Ga0207648_10111515 3300026089 Bacteria 2401
555 Ga0207648_10474500 3300026089 Bacteria 1142
556 Ga0207676_10000038 3300026095 Bacteria 171492
557 Ga0207674_10027663 3300026116 Bacteria 5994
558 Ga0207674_10028752 3300026116 Bacteria 5863
559 Ga0207674_10058060 3300026116 Unclassified 3922
560 Ga0207674_10307156 3300026116 Bacteria 1535
561 Ga0207675_100002213 3300026118 Bacteria 19316
562 Ga0207675_100005637 3300026118 Bacteria 11985
563 Ga0207675_100007552 3300026118 Bacteria 10272
564 Ga0207675_100018906 3300026118 Bacteria 6431
565 Ga0207675_100064312 3300026118 Bacteria 3429
566 Ga0207675_100068651 3300026118 Bacteria 3312
567 Ga0207683_10001814 3300026121 Bacteria 18887
568 Ga0207683_10008897 3300026121 Bacteria 8559
569 Ga0207428_10003447 3300027907 Bacteria 15358
570 Ga0207428_10038721 3300027907 Bacteria 3875
571 Ga0207428_10080193 3300027907 Bacteria 2550
572 Ga0207428_10100716 3300027907 Bacteria 2233
573 Ga0268266_10050172 3300028379 Bacteria 3580
574 Ga0268266_10226693 3300028379 Bacteria 1720
575 Ga0268266_10393557 3300028379 Bacteria 1309
576 Ga0268265_10657242 3300028380 Bacteria 1008
577 Ga0268264_10257680 3300028381 Bacteria 1623
578 Ga0307408_100164039 3300031548 Unclassified 1768
579 Ga0307405_10027498 3300031731 Unclassified 3299
580 Ga0307410_10011531 3300031852 Bacteria 5060
581 Ga0307410_10065094 3300031852 Bacteria 2507
582 Ga0307410_10070587 3300031852 Bacteria 2420
583 Ga0307406_10016289 3300031901 Bacteria 4318
584 Ga0307406_10120296 3300031901 Unclassified 1824
585 Ga0307406_10179718 3300031901 Bacteria 1539
586 Ga0307406_10182702 3300031901 Bacteria 1528
587 Ga0307407_10006320 3300031903 Bacteria 5246
588 Ga0307407_10017333 3300031903 Bacteria 3611
589 Ga0307407_10113304 3300031903 Unclassified 1706
590 Ga0307407_10398144 3300031903 Bacteria 987
591 Ga0307412_10070216 3300031911 Unclassified 2387
592 Ga0307412_10128520 3300031911 Bacteria 1837
593 Ga0307409_100001197 3300031995 Bacteria 12440
594 Ga0307409_100032250 3300031995 Unclassified 3795
595 Ga0307409_100074431 3300031995 Bacteria 2714
596 Ga0307409_100232346 3300031995 Bacteria 1673
597 Ga0307416_100002210 3300032002 Bacteria 11066
598 Ga0307416_100032735 3300032002 Bacteria 3933
599 Ga0307416_100121943 3300032002 Unclassified 2325
600 Ga0307414_10029673 3300032004 Bacteria 3563
601 Ga0307414_10069184 3300032004 Bacteria 2537
602 Ga0307414_10262419 3300032004 Bacteria 1442
603 Ga0307411_10054496 3300032005 Unclassified 2626
604 Ga0307411_10109922 3300032005 Unclassified 1970
605 Ga0307415_100044324 3300032126 Unclassified 2973
606 Ga0307415_100070787 3300032126 Unclassified 2450
607 Ga0373928_0046268 3300035084 Bacteria 1015
608 Ga0373932_0098627 3300035112 Bacteria 948
609 Ga0373941_0153326 3300035115 Bacteria 847
610 Ga0373945_0000408 3300035116 Bacteria 12344
611 Ga0373945_0059601 3300035116 Unclassified 1422
612 Ga0373943_0020423 3300035170 Bacteria 3054
613 Ga0373943_0409611 3300035170 Bacteria 784
614 Ga0373946_0002764 3300035171 Bacteria 6204
615 Ga0373955_0249621 3300035172 Bacteria 1064
616 Ga0373942_0056057 3300035207 Bacteria 1118
617 Ga0373924_0055170 3300035410 Bacteria 1654
618 Ga0373935_0005562 3300035692 Bacteria 7427
619 Ga0373935_0093143 3300035692 Bacteria 1976
620 Ga0373925_0001678 3300037068 Bacteria 18627
621 Ga0373925_0559600 3300037068 Bacteria 941
622 Ga0395899_0028499 3300037312 Bacteria 4205
623 Ga0395899_0039222 3300037312 Bacteria 3546
624 Ga0395899_0070679 3300037312 Bacteria 2555
625 Ga0395899_0076290 3300037312 Bacteria 2447
626 Ga0395899_0076300 3300037312 Bacteria 2447
627 Ga0395899_0200369 3300037312 Bacteria 1392
628 Ga0395899_0239011 3300037312 Bacteria 1251
629 Ga0395900_0002072 3300037418 Bacteria 22505
630 Ga0395900_0004735 3300037418 Bacteria 14352
631 Ga0395900_0006797 3300037418 Bacteria 11870
632 Ga0395900_0015456 3300037418 Bacteria 7781
633 Ga0395900_0025244 3300037418 Bacteria 6083
634 Ga0395900_0065136 3300037418 Bacteria 3743
635 Ga0395900_0071833 3300037418 Bacteria 3558
636 Ga0395900_0085405 3300037418 Bacteria 3243
637 Ga0395900_0105266 3300037418 Unclassified 2898
638 Ga0395900_0129706 3300037418 Bacteria 2584
639 Ga0395900_0135342 3300037418 Bacteria 2524
640 Ga0395900_0238090 3300037418 Unclassified 1827
641 Ga0395900_0253259 3300037418 Bacteria 1761
642 Ga0395900_0326493 3300037418 Bacteria 1513
643 Ga0395900_0482701 3300037418 Bacteria 1192
644 Ga0395900_0551746 3300037418 Bacteria 1097
645 Ga0395898_0004022 3300037466 Bacteria 16162
646 Ga0395898_0011628 3300037466 Bacteria 9135
647 Ga0395898_0012231 3300037466 Bacteria 8872
648 Ga0395898_0044784 3300037466 Bacteria 4352
649 Ga0395898_0067337 3300037466 Bacteria 3467
650 Ga0395898_0082178 3300037466 Bacteria 3105
651 Ga0395898_0098373 3300037466 Bacteria 2809
652 Ga0395898_0101276 3300037466 Bacteria 2766
653 Ga0395898_0124772 3300037466 Bacteria 2466
654 Ga0395898_0135652 3300037466 Bacteria 2356
655 Ga0395898_0138213 3300037466 Bacteria 2333
656 Ga0395898_0170231 3300037466 Bacteria 2082
657 Ga0395898_0184784 3300037466 Bacteria 1992
658 Ga0395898_0212905 3300037466 Bacteria 1843
659 Ga0395898_0331755 3300037466 Bacteria 1450
660 Ga0395898_0343919 3300037466 Bacteria 1422
661 Ga0395898_0394046 3300037466 Unclassified 1320
662 Ga0395898_0729982 3300037466 Bacteria 932
663 Ga0395905_0006981 3300037471 Bacteria 11292
664 Ga0395905_0010007 3300037471 Bacteria 9242
665 Ga0395905_0017142 3300037471 Bacteria 6879
666 Ga0395905_0027047 3300037471 Bacteria 5409
667 Ga0395905_0035027 3300037471 Bacteria 4713
668 Ga0395905_0037555 3300037471 Bacteria 4546
669 Ga0395905_0039071 3300037471 Bacteria 4452
670 Ga0395905_0107325 3300037471 Bacteria 2621
671 Ga0395905_0120909 3300037471 Unclassified 2461
672 Ga0395905_0175640 3300037471 Bacteria 2011
673 Ga0395905_0226623 3300037471 Bacteria 1748
674 Ga0395905_0389744 3300037471 Unclassified 1287
675 Ga0395905_0542137 3300037471 Bacteria 1064
676 Ga0395905_0553534 3300037471 Bacteria 1051
677 Ga0436364_0434921 3300037853 Bacteria 10586
678 Ga0436364_0706594 3300037853 Bacteria 1399
679 Ga0395901_0001774 3300038443 Bacteria 22253
680 Ga0395901_0003044 3300038443 Bacteria 16896
681 Ga0395901_0004744 3300038443 Bacteria 13719
682 Ga0395901_0006297 3300038443 Bacteria 12022
683 Ga0395901_0007454 3300038443 Bacteria 11043
684 Ga0395901_0009554 3300038443 Bacteria 9839
685 Ga0395901_0019210 3300038443 Bacteria 6986
686 Ga0395901_0027399 3300038443 Bacteria 5855
687 Ga0395901_0030513 3300038443 Bacteria 5554
688 Ga0395901_0036498 3300038443 Bacteria 5081
689 Ga0395901_0043463 3300038443 Bacteria 4661
690 Ga0395901_0045207 3300038443 Bacteria 4568
691 Ga0395901_0059143 3300038443 Bacteria 3987
692 Ga0395901_0072952 3300038443 Bacteria 3579
693 Ga0395901_0084080 3300038443 Bacteria 3326
694 Ga0395901_0103191 3300038443 Bacteria 2992
695 Ga0395901_0112869 3300038443 Bacteria 2854
696 Ga0395901_0116981 3300038443 Bacteria 2801
697 Ga0395901_0201068 3300038443 Bacteria 2088
698 Ga0395901_0205853 3300038443 Unclassified 2061
699 Ga0395901_0249381 3300038443 Bacteria 1850
700 Ga0395901_0294543 3300038443 Bacteria 1683
701 Ga0436365_0032671 3300039437 Bacteria 13110
702 Ga0436365_0623832 3300039437 Bacteria 4245
703 Ga0436365_1576607 3300039437 Bacteria 861
704 Ga0436365_1685261 3300039437 Bacteria 3556
705 Ga0436360_0021796 3300039438 Bacteria 886
706 Ga0436363_0474060 3300039450 Bacteria 2027
707 Ga0436363_0515302 3300039450 Bacteria 1856
708 Ga0436363_0746168 3300039450 Unclassified 1232
709 Ga0436363_1306475 3300039450 Bacteria 1000
710 Ga0436362_0291861 3300039453 Bacteria 2727
711 Ga0436362_0514978 3300039453 Bacteria 1111
712 Ga0439448_0006091 3300042005 Bacteria 3460
713 Ga0439448_0146041 3300042005 Unclassified 820
714 Ga0439455_0009092 3300042012 Bacteria 2148
715 Ga0439460_0066193 3300042461 Bacteria 1111
716 Ga0439460_0127503 3300042461 Bacteria 837
717 Ga0466965_0020394 3300044683 Bacteria 3186
718 Ga0466961_0005010 3300044693 Bacteria 8326
719 Ga0466963_0012641 3300044694 Bacteria 5171
720 Ga0466963_0019209 3300044694 Bacteria 4282
721 Ga0466963_0038359 3300044694 Bacteria 3132
722 Ga0466963_0051754 3300044694 Bacteria 2723
723 Ga0466963_0190766 3300044694 Unclassified 1432
724 Ga0466963_0215510 3300044694 Bacteria 1344
725 Ga0466963_0235098 3300044694 Bacteria 1285
726 Ga0466964_0014724 3300044706 Bacteria 2975
727 Ga0466964_0034295 3300044706 Bacteria 2025
728 Ga0466971_0139842 3300044719 Bacteria 1127
729 Ga0466968_0026194 3300044735 Bacteria 2392
730 Ga0466957_0033734 3300044842 Bacteria 3071
731 Ga0466960_0139842 3300044901 Bacteria 1285
732 Ga0466959_0001162 3300045049 Bacteria 15834
733 Ga0466959_0033183 3300045049 Bacteria 3819
734 Ga0466959_0062471 3300045049 Bacteria 2706
735 Ga0466959_0068728 3300045049 Bacteria 2567
736 Ga0466959_0089007 3300045049 Bacteria 2219
737 Ga0466959_0093107 3300045049 Bacteria 2163
738 Ga0466958_0000699 3300045836 Bacteria 14611
739 Ga0466958_0006923 3300045836 Bacteria 6204
740 Ga0466958_0013542 3300045836 Bacteria 4645
741 Ga0466958_0025331 3300045836 Bacteria 3497
742 Ga0466958_0265496 3300045836 Bacteria 1099
743 Ga0466967_0019062 3300045976 Bacteria 5506
744 Ga0466967_0027543 3300045976 Bacteria 4729
745 Ga0466967_0033807 3300045976 Bacteria 4332
746 Ga0466967_0042760 3300045976 Bacteria 3918
747 Ga0466967_0308668 3300045976 Bacteria 1523
748 Ga0495592_0000024 3300046454 Bacteria 136661
749 Ga0495592_0067947 3300046454 Bacteria 2603
750 Ga0495603_0080576 3300046455 Bacteria 1908
751 Ga0495603_0092934 3300046455 Bacteria 1763
752 Ga0495603_0098108 3300046455 Unclassified 1711
753 Ga0495603_0119633 3300046455 Bacteria 1535
754 Ga0495629_0003244 3300046459 Bacteria 12317
755 Ga0495629_0171844 3300046459 Bacteria 1504
756 Ga0495641_0005768 3300046461 Bacteria 8226
757 Ga0495641_0013989 3300046461 Bacteria 4368
758 Ga0495641_0057271 3300046461 Bacteria 1766
759 Ga0495641_0087164 3300046461 Bacteria 1397
760 Ga0495641_0104129 3300046461 Bacteria 1266
761 Ga0495651_0040552 3300046462 Bacteria 3620
762 Ga0495653_0003414 3300046463 Bacteria 12774
763 Ga0495653_0049834 3300046463 Bacteria 3223
764 Ga0495653_0097751 3300046463 Bacteria 2132
765 Ga0495582_0000028 3300046473 Bacteria 79694
766 Ga0495582_0020593 3300046473 Bacteria 3611
767 Ga0495582_0104437 3300046473 Bacteria 1588
768 Ga0495582_0105911 3300046473 Bacteria 1577
769 Ga0495605_0149100 3300046474 Unclassified 1045
770 Ga0495639_0066522 3300046475 Bacteria 1659
771 Ga0495639_0249977 3300046475 Bacteria 876
772 Ga0495662_0000448 3300046476 Bacteria 18533
773 Ga0495594_0092156 3300046499 Bacteria 1699
774 Ga0495594_0196564 3300046499 Unclassified 1149
775 Ga0495596_0033823 3300046500 Bacteria 2034
776 Ga0495596_0034066 3300046500 Bacteria 2024
777 Ga0495596_0045905 3300046500 Unclassified 1717
778 Ga0495607_0071166 3300046501 Bacteria 1940
779 Ga0495608_0139004 3300046511 Bacteria 1551
780 Ga0495616_0059385 3300046513 Bacteria 1881
781 Ga0495616_0128083 3300046513 Bacteria 1166
782 Ga0495618_0083468 3300046514 Bacteria 2041
783 Ga0495628_0034794 3300046516 Bacteria 4051
784 Ga0495630_0001414 3300046517 Bacteria 16594
785 Ga0495630_0006834 3300046517 Bacteria 8134
786 Ga0495631_0135961 3300046518 Bacteria 1056
787 Ga0495632_0239850 3300046519 Bacteria 816
788 Ga0495644_0115708 3300046523 Bacteria 1019
789 Ga0495663_0020186 3300046525 Bacteria 1911
790 Ga0495663_0068176 3300046525 Bacteria 1129
791 Ga0495666_0017436 3300046526 Unclassified 3577
792 Ga0495652_0058998 3300046529 Bacteria 3248
793 Ga0495665_0000510 3300046531 Bacteria 19612
794 Ga0495665_0051671 3300046531 Bacteria 2177
795 Ga0495665_0192939 3300046531 Bacteria 1057
796 Ga0495640_0009055 3300046533 Bacteria 7767
797 Ga0495640_0070344 3300046533 Bacteria 2351
798 Ga0495586_0000416 3300046535 Bacteria 25805
799 Ga0495598_0041797 3300046537 Bacteria 1343
800 Ga0495645_0000096 3300046543 Bacteria 60663
801 Ga0495645_0029696 3300046543 Bacteria 3977
802 Ga0495645_0222999 3300046543 Bacteria 1267
803 Ga0495633_0153902 3300046558 Bacteria 1062
804 Ga0495667_0002769 3300046559 Bacteria 11702
805 Ga0495667_0015879 3300046559 Bacteria 5091
806 Ga0495668_0080384 3300046616 Bacteria 1789
807 Ga0495634_0010792 3300046642 Bacteria 6683
808 Ga0495634_0022694 3300046642 Bacteria 4422
809 Ga0495635_0003733 3300046663 Bacteria 10569
810 Ga0495635_0017385 3300046663 Bacteria 5024
811 Ga0495635_0027019 3300046663 Bacteria 3992
812 Ga0495659_0056809 3300046664 Bacteria 1437
813 Ga0495588_0319217 3300046674 Bacteria 817
814 Ga0495657_0000027 3300046675 Bacteria 131421
815 Ga0495657_0132396 3300046675 Bacteria 1561
816 Ga0495647_0063423 3300046681 Bacteria 1463
817 Ga0495658_0000356 3300046683 Bacteria 25845
818 Ga0495613_0006132 3300046689 Bacteria 8997
819 Ga0495624_0012550 3300046690 Bacteria 5786
820 Ga0495589_0115699 3300046794 Bacteria 1293
821 Ga0495600_0008124 3300046809 Bacteria 6438
822 Ga0495600_0012918 3300046809 Bacteria 5234
823 Ga0495581_0000589 3300047315 Bacteria 18974
824 Ga0495581_0008442 3300047315 Bacteria 5974
825 Ga0495581_0036720 3300047315 Bacteria 2835
826 Ga0495581_0057184 3300047315 Unclassified 2251
827 Ga0495604_0112987 3300047317 Bacteria 1978
828 Ga0495674_0003615 3300047319 Bacteria 15050
829 Ga0495674_0290143 3300047319 Bacteria 1338
830 Ga0495676_0002194 3300047321 Bacteria 17296
831 Ga0495676_0066469 3300047321 Bacteria 2794
832 Ga0495676_0076321 3300047321 Bacteria 2559
833 Ga0495676_0360213 3300047321 Unclassified 971
834 Ga0495676_0384912 3300047321 Bacteria 933
835 Ga0495680_0000298 3300047322 Bacteria 55499
836 Ga0495680_0022784 3300047322 Bacteria 5215
837 Ga0495680_0035743 3300047322 Bacteria 3998
838 Ga0495683_0160497 3300047323 Bacteria 1040
839 Ga0495677_0048713 3300047445 Bacteria 1557
840 Ga0495677_0158893 3300047445 Bacteria 872
841 Ga0495684_0005161 3300047471 Bacteria 10176
842 Ga0495684_0020263 3300047471 Bacteria 5123
843 Ga0495684_0038293 3300047471 Bacteria 3678
844 Ga0495593_0015393 3300047673 Bacteria 4333
845 Ga0495602_0272617 3300048088 Bacteria 1250
846 Ga0496100_0001935 3300048903 Bacteria 10355
847 Ga0496100_0003218 3300048903 Bacteria 8479
848 Ga0496100_0011017 3300048903 Bacteria 5129
849 Ga0496100_0106640 3300048903 Bacteria 1939
850 Ga0496101_0001199 3300048904 Bacteria 15511
851 Ga0496101_0017486 3300048904 Bacteria 4864
852 Ga0496101_0032607 3300048904 Bacteria 3668
853 Ga0496101_0044045 3300048904 Bacteria 3192
854 Ga0496101_0206430 3300048904 Bacteria 1520
855 Ga0496101_0296791 3300048904 Bacteria 1265
856 Ga0496102_0001299 3300048905 Bacteria 22455
857 Ga0496102_0016678 3300048905 Bacteria 6424
858 Ga0496102_0024499 3300048905 Bacteria 5366
859 Ga0496102_0075914 3300048905 Bacteria 3090
860 Ga0496102_0095291 3300048905 Bacteria 2758
861 Ga0496102_0331326 3300048905 Bacteria 1434
862 Ga0496103_0003383 3300048906 Bacteria 9747
863 Ga0496103_0009549 3300048906 Bacteria 5743
864 Ga0496103_0086756 3300048906 Bacteria 1972
865 Ga0496103_0129235 3300048906 Bacteria 1613
866 Ga0496104_0004546 3300048907 Bacteria 12086
867 Ga0496104_0023051 3300048907 Bacteria 5720
868 Ga0496104_0061270 3300048907 Bacteria 3567
869 Ga0496104_0096032 3300048907 Bacteria 2836
870 Ga0496104_0657938 3300048907 Bacteria 956
871 Ga0496105_0001487 3300048908 Bacteria 16545
872 Ga0496105_0018157 3300048908 Bacteria 5647
873 Ga0496105_0026821 3300048908 Unclassified 4702
874 Ga0496105_0030322 3300048908 Bacteria 4432
875 Ga0496105_0067203 3300048908 Bacteria 2959
876 Ga0496106_0005675 3300048909 Bacteria 9233
877 Ga0496106_0011163 3300048909 Bacteria 6646
878 Ga0496106_0013211 3300048909 Bacteria 6093
879 Ga0496106_0027485 3300048909 Bacteria 4237
880 Ga0496106_0115149 3300048909 Bacteria 2096
881 Ga0496107_0000485 3300048910 Bacteria 21863
882 Ga0496107_0001899 3300048910 Bacteria 13247
883 Ga0496107_0007973 3300048910 Bacteria 7310
884 Ga0496107_0032609 3300048910 Bacteria 3723
885 Ga0496107_0089594 3300048910 Bacteria 2246
886 Ga0496107_0106544 3300048910 Bacteria 2059
887 Ga0496107_0454833 3300048910 Bacteria 951
888 Ga0496108_0011737 3300048911 Bacteria 7125
889 Ga0496108_0016673 3300048911 Bacteria 6001
890 Ga0496108_0022806 3300048911 Bacteria 5150
891 Ga0496108_0041409 3300048911 Bacteria 3846
892 Ga0496108_0139643 3300048911 Bacteria 2087
893 Ga0496108_0313015 3300048911 Bacteria 1368
894 Ga0496109_0010750 3300048912 Bacteria 7835
895 Ga0496109_0122677 3300048912 Unclassified 2421
896 Ga0496109_0126669 3300048912 Bacteria 2381
897 Ga0496109_0280012 3300048912 Bacteria 1572
898 Ga0496110_0002608 3300048913 Bacteria 13562
899 Ga0496110_0025927 3300048913 Bacteria 5013
900 Ga0496110_0110132 3300048913 Bacteria 2474
901 Ga0496110_0114831 3300048913 Bacteria 2423
902 Ga0496110_0381875 3300048913 Bacteria 1284
903 Ga0496110_0384778 3300048913 Bacteria 1278
904 Ga0496110_0392222 3300048913 Bacteria 1265
905 Ga0496111_0033736 3300048914 Bacteria 3652
906 Ga0496111_0040587 3300048914 Unclassified 3338
907 Ga0496111_0043975 3300048914 Unclassified 3210
908 Ga0496111_0063553 3300048914 Bacteria 2677
909 Ga0496111_0147385 3300048914 Unclassified 1745
910 Ga0496111_0248188 3300048914 Bacteria 1321
911 Ga0496111_0562335 3300048914 Bacteria 837
912 Ga0496112_0009522 3300048915 Bacteria 8761
913 Ga0496112_0025748 3300048915 Bacteria 5651
914 Ga0496112_0025813 3300048915 Bacteria 5645
915 Ga0496112_0157698 3300048915 Unclassified 2236
916 Ga0496112_0237441 3300048915 Bacteria 1776
917 Ga0496112_0330562 3300048915 Bacteria 1468
918 Ga0496112_0710478 3300048915 Bacteria 933
919 Ga0496113_0001704 3300048916 Bacteria 12457
920 Ga0496113_0119418 3300048916 Bacteria 2060
921 Ga0496113_0207704 3300048916 Bacteria 1558
922 Ga0496113_0238160 3300048916 Bacteria 1452
923 Ga0496113_0334229 3300048916 Bacteria 1215
924 Ga0496114_0005633 3300048917 Bacteria 9824
925 Ga0496114_0014359 3300048917 Bacteria 6354
926 Ga0496114_0027734 3300048917 Bacteria 4641
927 Ga0496114_0133208 3300048917 Bacteria 2148
928 Ga0496114_0358854 3300048917 Bacteria 1289
929 Ga0496115_0008007 3300048918 Bacteria 7799
930 Ga0496115_0008263 3300048918 Bacteria 7692
931 Ga0496115_0018578 3300048918 Bacteria 5341
932 Ga0496115_0019021 3300048918 Bacteria 5281
933 Ga0496115_0030001 3300048918 Bacteria 4275
934 Ga0496115_0048580 3300048918 Bacteria 3394
935 Ga0496115_0269215 3300048918 Bacteria 1400
936 Ga0496115_0604794 3300048918 Bacteria 871
937 Ga0501038_0551879 3300049574 Bacteria 876
938 Ga0501040_0483549 3300049576 Bacteria 892
939 Ga0501067_0005277 3300049583 Bacteria 7178
940 Ga0501067_0013055 3300049583 Bacteria 4597
941 Ga0501067_0020211 3300049583 Unclassified 3684
942 Ga0501067_0072306 3300049583 Bacteria 1910
943 Ga0501067_0089170 3300049583 Bacteria 1712
944 Ga0501068_0335852 3300049584 Bacteria 970
945 Ga0501069_0039259 3300049585 Bacteria 2615
946 Ga0501069_0045395 3300049585 Bacteria 2434
947 Ga0501069_0121306 3300049585 Bacteria 1493
948 Ga0501071_0162630 3300049587 Unclassified 1669
949 Ga0501076_0063794 3300049592 Bacteria 2936
950 Ga0501209_082374 3300049656 Bacteria 929
951 Ga0501216_039765 3300049660 Unclassified 896
952 nmdc:mga00v17_13500_c1 3300050491 Bacteria 4538
953 nmdc:mga00v17_146630_c1 3300050491 Bacteria 1515
954 nmdc:mga00v17_55987_c1 3300050491 Bacteria 2410
955 nmdc:mga0yw44_116985_c1 3300050492 Bacteria 1714
956 nmdc:mga0yw44_164311_c1 3300050492 Bacteria 1455
957 nmdc:mga0yw44_181783_c1 3300050492 Bacteria 1384
958 nmdc:mga0yw44_30517_c1 3300050492 Unclassified 3125
959 nmdc:mga0yw44_51598_c1 3300050492 Bacteria 2491
960 nmdc:mga06z11_131671_c1 3300050494 Bacteria 1405
961 nmdc:mga06z11_248868_c1 3300050494 Bacteria 1046
962 nmdc:mga06z11_46860_c1 3300050494 Bacteria 2192
963 nmdc:mga04h51_15383_c1 3300050495 Bacteria 2203
964 nmdc:mga05p37_154102_c1 3300050507 Bacteria 2809
965 nmdc:mga05p37_176431_c1 3300050507 Bacteria 2603
966 nmdc:mga05p37_209249_c1 3300050507 Bacteria 2358
967 nmdc:mga05p37_210860_c1 3300050507 Bacteria 2348
968 nmdc:mga05p37_289704_c1 3300050507 Bacteria 1949
969 nmdc:mga05p37_292223_c1 3300050507 Bacteria 1939
970 nmdc:mga05p37_300929_c1 3300050507 Bacteria 1906
971 nmdc:mga05p37_43955_c1 3300050507 Bacteria 5496
972 nmdc:mga05p37_4402_c1 3300050507 Bacteria 16459
973 nmdc:mga05p37_54415_c1 3300050507 Bacteria 4924
974 nmdc:mga05p37_58954_c1 3300050507 Unclassified 4728
975 nmdc:mga05p37_66039_c1 3300050507 Bacteria 4451
976 nmdc:mga05p37_84117_c1 3300050507 Bacteria 3920
977 nmdc:mga05p37_886432_c1 3300050507 Unclassified 964
978 nmdc:mga05p37_9555_c1 3300050507 Bacteria 11485
979 nmdc:mga09592_145650_c1 3300050508 Bacteria 2042
980 nmdc:mga09592_164877_c1 3300050508 Bacteria 1915
981 nmdc:mga09592_478220_c1 3300050508 Bacteria 1073
982 nmdc:mga0qj67_212160_c1 3300050509 Bacteria 1572
983 nmdc:mga0qj67_257273_c1 3300050509 Bacteria 1416
984 nmdc:mga0qj67_27476_c1 3300050509 Bacteria 4412
985 nmdc:mga0qj67_73309_c1 3300050509 Bacteria 2734
986 nmdc:mga06r32_12571_c1 3300050510 Bacteria 7644
987 nmdc:mga06r32_19742_c1 3300050510 Bacteria 6193
988 nmdc:mga06r32_358663_c1 3300050510 Unclassified 1442
989 nmdc:mga06r32_60961_c1 3300050510 Bacteria 3631
990 nmdc:mga06r32_64436_c2 3300050510 Unclassified 2347
991 nmdc:mga06r32_78823_c1 3300050510 Plasmid 3203
992 nmdc:mga08y16_137694_c1 3300050511 Bacteria 2538
993 nmdc:mga08y16_221394_c1 3300050511 Unclassified 1959
994 nmdc:mga08y16_46471_c1 3300050511 Bacteria 4545
995 nmdc:mga08y16_587600_c1 3300050511 Bacteria 1123
996 nmdc:mga08y16_64633_c1 3300050511 Bacteria 3820
997 nmdc:mga08y16_783687_c1 3300050511 Unclassified 947
998 nmdc:mga08y16_8878_c1 3300050511 Bacteria 10552
999 nmdc:mga0n895_106274_c1 3300050512 Bacteria 2820
1000 nmdc:mga0n895_134372_c1 3300050512 Bacteria 2500
1001 nmdc:mga0n895_271288_c1 3300050512 Bacteria 1721
1002 nmdc:mga0n895_316404_c1 3300050512 Bacteria 1582
1003 nmdc:mga0n895_425375_c1 3300050512 Bacteria 1342
1004 nmdc:mga0n895_432283_c1 3300050512 Bacteria 1330
1005 nmdc:mga0n895_641836_c1 3300050512 Bacteria 1061
1006 nmdc:mga0n895_6827_c1 3300050512 Bacteria 9745
1007 nmdc:mga0n895_87870_c1 3300050512 Bacteria 3107
1008 nmdc:mga0rr50_159551_c1 3300050513 Bacteria 1830
1009 nmdc:mga0rr50_15994_c1 3300050513 Bacteria 4969
1010 nmdc:mga0rr50_17058_c1 3300050513 Bacteria 4838
1011 nmdc:mga0rr50_173052_c1 3300050513 Bacteria 1761
1012 nmdc:mga0rr50_270156_c1 3300050513 Bacteria 1417
1013 nmdc:mga0rr50_324426_c1 3300050513 Bacteria 1291
1014 nmdc:mga0rr50_60199_c1 3300050513 Bacteria 2856
1015 nmdc:mga08x19_104241_c1 3300050514 Bacteria 1885
1016 nmdc:mga08x19_259661_c1 3300050514 Bacteria 1201
1017 nmdc:mga08x19_59250_c1 3300050514 Bacteria 2478
1018 nmdc:mga08x19_5982_c1 3300050514 Bacteria 7194
1019 nmdc:mga0a205_152148_c1 3300050515 Bacteria 2213
1020 nmdc:mga0a205_157349_c1 3300050515 Bacteria 2170
1021 nmdc:mga0a205_212542_c1 3300050515 Bacteria 1822
1022 nmdc:mga0a205_278056_c1 3300050515 Bacteria 1550
1023 nmdc:mga0a205_33881_c1 3300050515 Bacteria 4898
1024 nmdc:mga0a205_37515_c1 3300050515 Bacteria 4660
1025 nmdc:mga0a205_3829_c1 3300050515 Bacteria 13479
1026 nmdc:mga0a205_478416_c1 3300050515 Unclassified 1104
1027 nmdc:mga0a205_730752_c1 3300050515 Bacteria 839
1028 nmdc:mga0a205_77257_c1 3300050515 Bacteria 3217
1029 Ga0495601_0000244 3300053077 Bacteria 29047
1030 Ga0495601_0099836 3300053077 Unclassified 1874
1031 Ga0495612_0000024 3300053078 Bacteria 115718
1032 Ga0495655_0056459 3300053083 Bacteria 1057
1033 Ga0495595_0112753 3300053084 Bacteria 1320
1034 Ga0495619_0169104 3300053085 Bacteria 1511
1035 Ga0587071_056674 3300060344 Bacteria 823
1036 Ga0466962_0009567 3300061719 Bacteria 4647
1037 Ga0466962_0013330 3300061719 Bacteria 3957
1038 Ga0466962_0058285 3300061719 Bacteria 1844
1039 Ga0466962_0116512 3300061719 Bacteria 1287
1040 Ga0530510_0028109 3300061734 Bacteria 4033

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046455 Ga0495603_0080576 Ga0495603_0080576_1284_1889 201
2 3300039438 Ga0436360_0021796 Ga0436360_0021796_246_857 203
3 3300045836 Ga0466958_0265496 Ga0466958_0265496_466_1089 203
4 3300048916 Ga0496113_0334229 Ga0496113_0334229_593_1204 203
5 3300049574 Ga0501038_0551879 Ga0501038_0551879_24_635 203
6 3300050494 nmdc:mga06z11_248868_c1 nmdc:mga06z11_248868_c1_136_747 203
7 3300009177 Ga0105248_11593278 Ga0105248_115932781 206
8 3300048913 Ga0496110_0114831 Ga0496110_0114831_255_1154 220
9 3300048914 Ga0496111_0147385 Ga0496111_0147385_89_988 220
10 3300006846 Ga0075430_100022119 Ga0075430_1000221199 221
11 3300006847 Ga0075431_100282525 Ga0075431_1002825252 221
12 3300006880 Ga0075429_100033200 Ga0075429_1000332002 221
13 3300050508 nmdc:mga09592_164877_c1 nmdc:mga09592_164877_c1_974_1714 221
14 3300050510 nmdc:mga06r32_60961_c1 nmdc:mga06r32_60961_c1_1959_2699 221
15 3300039450 Ga0436363_0474060 Ga0436363_0474060_619_1359 229
16 3300006844 Ga0075428_100011990 Ga0075428_1000119906 232
17 3300009147 Ga0114129_10008186 Ga0114129_100081867 232
18 3300050507 nmdc:mga05p37_4402_c1 nmdc:mga05p37_4402_c1_12914_13651 232
19 3300005436 Ga0070713_100705421 Ga0070713_1007054211 235
20 3300049583 Ga0501067_0005277 Ga0501067_0005277_1991_2728 236
21 3300049585 Ga0501069_0039259 Ga0501069_0039259_1451_2188 236
22 3300003373 JGI25407J50210_10008973 JGI25407J50210_100089734 237
23 3300005981 Ga0081538_10007198 Ga0081538_1000719813 237
24 3300025906 Ga0207699_10120033 Ga0207699_101200334 238
25 3300025961 Ga0207712_10212611 Ga0207712_102126112 240
26 3300025928 Ga0207700_10304288 Ga0207700_103042882 243
27 3300025929 Ga0207664_10401410 Ga0207664_104014102 243
28 3300025945 Ga0207679_10743176 Ga0207679_107431761 243
29 3300005329 Ga0070683_100939499 Ga0070683_1009394991 244
30 3300005435 Ga0070714_100010256 Ga0070714_1000102568 244
31 3300005436 Ga0070713_100133794 Ga0070713_1001337942 244
32 3300005439 Ga0070711_100481169 Ga0070711_1004811691 244
33 3300005441 Ga0070700_100178438 Ga0070700_1001784382 244
34 3300005518 Ga0070699_100000709 Ga0070699_10000070916 244
35 3300005535 Ga0070684_100832321 Ga0070684_1008323211 244
36 3300005564 Ga0070664_100110841 Ga0070664_1001108411 244
37 3300005937 Ga0081455_10047229 Ga0081455_100472295 244
38 3300005985 Ga0081539_10085440 Ga0081539_100854403 244
39 3300009094 Ga0111539_10212532 Ga0111539_102125322 244
40 3300009147 Ga0114129_10032163 Ga0114129_100321635 244
41 3300009147 Ga0114129_10252578 Ga0114129_102525782 244
42 3300014497 Ga0182008_10067232 Ga0182008_100672322 244
43 3300020070 Ga0206356_11431924 Ga0206356_114319241 244
44 3300025927 Ga0207687_10320327 Ga0207687_103203272 244
45 3300025929 Ga0207664_10005864 Ga0207664_100058644 244
46 3300026078 Ga0207702_10486576 Ga0207702_104865762 244
47 3300026116 Ga0207674_10058060 Ga0207674_100580604 244
48 3300037312 Ga0395899_0028499 Ga0395899_0028499_2605_3339 244
49 3300037312 Ga0395899_0076300 Ga0395899_0076300_618_1361 244
50 3300037418 Ga0395900_0025244 Ga0395900_0025244_4596_5330 244
51 3300037418 Ga0395900_0085405 Ga0395900_0085405_942_1685 244
52 3300037466 Ga0395898_0004022 Ga0395898_0004022_7736_8470 244
53 3300037466 Ga0395898_0098373 Ga0395898_0098373_860_1594 244
54 3300037466 Ga0395898_0135652 Ga0395898_0135652_995_1738 244
55 3300037466 Ga0395898_0729982 Ga0395898_0729982_96_830 244
56 3300037471 Ga0395905_0006981 Ga0395905_0006981_4397_5131 244
57 3300037471 Ga0395905_0226623 Ga0395905_0226623_780_1523 244
58 3300037471 Ga0395905_0542137 Ga0395905_0542137_26_760 244
59 3300038443 Ga0395901_0004744 Ga0395901_0004744_6372_7106 244
60 3300038443 Ga0395901_0084080 Ga0395901_0084080_2067_2801 244
61 3300038443 Ga0395901_0201068 Ga0395901_0201068_619_1362 244
62 3300045049 Ga0466959_0068728 Ga0466959_0068728_1503_2246 244
63 3300045836 Ga0466958_0013542 Ga0466958_0013542_178_921 244
64 3300048914 Ga0496111_0063553 Ga0496111_0063553_1352_2086 244
65 3300048916 Ga0496113_0238160 Ga0496113_0238160_146_880 244
66 3300048917 Ga0496114_0358854 Ga0496114_0358854_442_1176 244
67 3300049583 Ga0501067_0089170 Ga0501067_0089170_766_1509 244
68 3300050507 nmdc:mga05p37_210860_c1 nmdc:mga05p37_210860_c1_955_1698 244
69 3300050509 nmdc:mga0qj67_257273_c1 nmdc:mga0qj67_257273_c1_403_1137 244
70 3300050511 nmdc:mga08y16_137694_c1 nmdc:mga08y16_137694_c1_1235_1978 244
71 3300050515 nmdc:mga0a205_478416_c1 nmdc:mga0a205_478416_c1_78_821 244
72 3300060344 Ga0587071_056674 Ga0587071_056674_61_804 244
73 3300061734 Ga0530510_0028109 Ga0530510_0028109_2023_2760 244
74 3300003373 JGI25407J50210_10001507 JGI25407J50210_100015071 245
75 3300003373 JGI25407J50210_10011522 JGI25407J50210_100115222 245
76 3300003373 JGI25407J50210_10047189 JGI25407J50210_100471892 245
77 3300005327 Ga0070658_10115835 Ga0070658_101158353 245
78 3300005329 Ga0070683_100013253 Ga0070683_1000132536 245
79 3300005329 Ga0070683_100044886 Ga0070683_1000448862 245
80 3300005329 Ga0070683_100047910 Ga0070683_1000479106 245
81 3300005329 Ga0070683_100113734 Ga0070683_1001137342 245
82 3300005329 Ga0070683_100513861 Ga0070683_1005138612 245
83 3300005330 Ga0070690_100045622 Ga0070690_1000456222 245
84 3300005334 Ga0068869_100104383 Ga0068869_1001043832 245
85 3300005336 Ga0070680_100023564 Ga0070680_1000235646 245
86 3300005336 Ga0070680_100057319 Ga0070680_1000573192 245
87 3300005336 Ga0070680_100093720 Ga0070680_1000937202 245
88 3300005336 Ga0070680_100287394 Ga0070680_1002873941 245
89 3300005337 Ga0070682_100026173 Ga0070682_1000261732 245
90 3300005337 Ga0070682_100062012 Ga0070682_1000620123 245
91 3300005337 Ga0070682_100367311 Ga0070682_1003673111 245
92 3300005338 Ga0068868_100284876 Ga0068868_1002848763 245
93 3300005339 Ga0070660_100005554 Ga0070660_1000055542 245
94 3300005339 Ga0070660_100008896 Ga0070660_1000088963 245
95 3300005344 Ga0070661_100029503 Ga0070661_1000295032 245
96 3300005344 Ga0070661_100163728 Ga0070661_1001637281 245
97 3300005345 Ga0070692_10003017 Ga0070692_100030174 245
98 3300005345 Ga0070692_10046853 Ga0070692_100468533 245
99 3300005347 Ga0070668_100005321 Ga0070668_1000053216 245
100 3300005347 Ga0070668_100090989 Ga0070668_1000909893 245
101 3300005347 Ga0070668_100148982 Ga0070668_1001489823 245
102 3300005347 Ga0070668_100203341 Ga0070668_1002033412 245
103 3300005353 Ga0070669_100621992 Ga0070669_1006219922 245
104 3300005354 Ga0070675_100030266 Ga0070675_1000302664 245
105 3300005354 Ga0070675_100299541 Ga0070675_1002995412 245
106 3300005355 Ga0070671_100151973 Ga0070671_1001519732 245
107 3300005355 Ga0070671_100462487 Ga0070671_1004624871 245
108 3300005356 Ga0070674_100042039 Ga0070674_1000420393 245
109 3300005356 Ga0070674_100194634 Ga0070674_1001946343 245
110 3300005356 Ga0070674_100487106 Ga0070674_1004871061 245
111 3300005365 Ga0070688_100010646 Ga0070688_1000106464 245
112 3300005366 Ga0070659_100004504 Ga0070659_1000045044 245
113 3300005366 Ga0070659_100054848 Ga0070659_1000548483 245
114 3300005366 Ga0070659_100554391 Ga0070659_1005543911 245
115 3300005367 Ga0070667_100245436 Ga0070667_1002454362 245
116 3300005434 Ga0070709_10048625 Ga0070709_100486252 245
117 3300005434 Ga0070709_10052381 Ga0070709_100523812 245
118 3300005434 Ga0070709_10054046 Ga0070709_100540462 245
119 3300005435 Ga0070714_100005053 Ga0070714_1000050532 245
120 3300005435 Ga0070714_100103275 Ga0070714_1001032752 245
121 3300005435 Ga0070714_100113766 Ga0070714_1001137662 245
122 3300005435 Ga0070714_100450171 Ga0070714_1004501712 245
123 3300005435 Ga0070714_100460668 Ga0070714_1004606682 245
124 3300005435 Ga0070714_100857541 Ga0070714_1008575411 245
125 3300005436 Ga0070713_100043272 Ga0070713_1000432722 245
126 3300005436 Ga0070713_100062584 Ga0070713_1000625844 245
127 3300005436 Ga0070713_100087824 Ga0070713_1000878242 245
128 3300005436 Ga0070713_100280041 Ga0070713_1002800411 245
129 3300005437 Ga0070710_10015128 Ga0070710_100151285 245
130 3300005437 Ga0070710_10091091 Ga0070710_100910913 245
131 3300005437 Ga0070710_10172943 Ga0070710_101729432 245
132 3300005437 Ga0070710_10276796 Ga0070710_102767961 245
133 3300005438 Ga0070701_10028242 Ga0070701_100282422 245
134 3300005438 Ga0070701_10205805 Ga0070701_102058052 245
135 3300005439 Ga0070711_100005462 Ga0070711_1000054623 245
136 3300005439 Ga0070711_100037574 Ga0070711_1000375743 245
137 3300005439 Ga0070711_100079539 Ga0070711_1000795392 245
138 3300005439 Ga0070711_100188482 Ga0070711_1001884821 245
139 3300005439 Ga0070711_100565915 Ga0070711_1005659151 245
140 3300005440 Ga0070705_100021223 Ga0070705_1000212232 245
141 3300005440 Ga0070705_100318368 Ga0070705_1003183681 245
142 3300005441 Ga0070700_100019120 Ga0070700_1000191204 245
143 3300005441 Ga0070700_100047266 Ga0070700_1000472663 245
144 3300005441 Ga0070700_100137042 Ga0070700_1001370421 245
145 3300005445 Ga0070708_100037038 Ga0070708_1000370385 245
146 3300005445 Ga0070708_100079609 Ga0070708_1000796094 245
147 3300005445 Ga0070708_100154856 Ga0070708_1001548563 245
148 3300005445 Ga0070708_100162787 Ga0070708_1001627873 245
149 3300005445 Ga0070708_100241101 Ga0070708_1002411012 245
150 3300005445 Ga0070708_100285405 Ga0070708_1002854052 245
151 3300005445 Ga0070708_100321166 Ga0070708_1003211662 245
152 3300005445 Ga0070708_100462749 Ga0070708_1004627491 245
153 3300005456 Ga0070678_100004320 Ga0070678_1000043202 245
154 3300005457 Ga0070662_100186375 Ga0070662_1001863753 245
155 3300005457 Ga0070662_100210571 Ga0070662_1002105712 245
156 3300005458 Ga0070681_10003999 Ga0070681_1000399911 245
157 3300005458 Ga0070681_10007241 Ga0070681_100072416 245
158 3300005458 Ga0070681_10026548 Ga0070681_100265482 245
159 3300005458 Ga0070681_10235521 Ga0070681_102355212 245
160 3300005459 Ga0068867_100057511 Ga0068867_1000575113 245
161 3300005459 Ga0068867_100090980 Ga0068867_1000909803 245
162 3300005466 Ga0070685_10002573 Ga0070685_100025734 245
163 3300005467 Ga0070706_100000355 Ga0070706_10000035525 245
164 3300005467 Ga0070706_100003262 Ga0070706_10000326220 245
165 3300005467 Ga0070706_100003466 Ga0070706_10000346619 245
166 3300005467 Ga0070706_100038316 Ga0070706_1000383161 245
167 3300005467 Ga0070706_100110440 Ga0070706_1001104401 245
168 3300005467 Ga0070706_100203845 Ga0070706_1002038451 245
169 3300005467 Ga0070706_100210914 Ga0070706_1002109142 245
170 3300005467 Ga0070706_100285776 Ga0070706_1002857762 245
171 3300005468 Ga0070707_100015988 Ga0070707_1000159888 245
172 3300005468 Ga0070707_100060696 Ga0070707_1000606962 245
173 3300005468 Ga0070707_100085492 Ga0070707_1000854925 245
174 3300005468 Ga0070707_100094045 Ga0070707_1000940452 245
175 3300005468 Ga0070707_100127246 Ga0070707_1001272466 245
176 3300005468 Ga0070707_100218182 Ga0070707_1002181822 245
177 3300005471 Ga0070698_100000877 Ga0070698_1000008771 245
178 3300005471 Ga0070698_100003968 Ga0070698_1000039683 245
179 3300005471 Ga0070698_100008006 Ga0070698_1000080068 245
180 3300005471 Ga0070698_100010517 Ga0070698_1000105173 245
181 3300005471 Ga0070698_100010654 Ga0070698_1000106544 245
182 3300005471 Ga0070698_100019558 Ga0070698_1000195585 245
183 3300005471 Ga0070698_100039520 Ga0070698_1000395201 245
184 3300005471 Ga0070698_100061762 Ga0070698_1000617624 245
185 3300005471 Ga0070698_100067691 Ga0070698_1000676913 245
186 3300005471 Ga0070698_100072849 Ga0070698_1000728492 245
187 3300005471 Ga0070698_100148510 Ga0070698_1001485102 245
188 3300005471 Ga0070698_100156240 Ga0070698_1001562402 245
189 3300005471 Ga0070698_100535091 Ga0070698_1005350912 245
190 3300005471 Ga0070698_100689082 Ga0070698_1006890821 245
191 3300005471 Ga0070698_100771940 Ga0070698_1007719401 245
192 3300005518 Ga0070699_100000462 Ga0070699_10000046239 245
193 3300005518 Ga0070699_100000530 Ga0070699_10000053040 245
194 3300005518 Ga0070699_100000806 Ga0070699_1000008064 245
195 3300005518 Ga0070699_100031673 Ga0070699_1000316732 245
196 3300005518 Ga0070699_100131023 Ga0070699_1001310232 245
197 3300005518 Ga0070699_100498837 Ga0070699_1004988371 245
198 3300005518 Ga0070699_100540861 Ga0070699_1005408612 245
199 3300005530 Ga0070679_100009018 Ga0070679_1000090186 245
200 3300005530 Ga0070679_100017027 Ga0070679_1000170277 245
201 3300005530 Ga0070679_100095839 Ga0070679_1000958393 245
202 3300005530 Ga0070679_100129973 Ga0070679_1001299732 245
203 3300005530 Ga0070679_100192735 Ga0070679_1001927355 245
204 3300005530 Ga0070679_100376282 Ga0070679_1003762821 245
205 3300005535 Ga0070684_100185372 Ga0070684_1001853723 245
206 3300005535 Ga0070684_100185386 Ga0070684_1001853862 245
207 3300005535 Ga0070684_100498416 Ga0070684_1004984161 245
208 3300005535 Ga0070684_100560062 Ga0070684_1005600621 245
209 3300005536 Ga0070697_100000066 Ga0070697_10000006691 245
210 3300005536 Ga0070697_100002722 Ga0070697_10000272210 245
211 3300005536 Ga0070697_100006497 Ga0070697_1000064973 245
212 3300005536 Ga0070697_100050318 Ga0070697_1000503183 245
213 3300005536 Ga0070697_100060774 Ga0070697_1000607743 245
214 3300005539 Ga0068853_100207035 Ga0068853_1002070353 245
215 3300005539 Ga0068853_100303761 Ga0068853_1003037611 245
216 3300005543 Ga0070672_100057173 Ga0070672_1000571734 245
217 3300005544 Ga0070686_100002093 Ga0070686_1000020933 245
218 3300005545 Ga0070695_100063594 Ga0070695_1000635942 245
219 3300005545 Ga0070695_100259151 Ga0070695_1002591512 245
220 3300005546 Ga0070696_100003739 Ga0070696_1000037399 245
221 3300005546 Ga0070696_100010458 Ga0070696_1000104584 245
222 3300005546 Ga0070696_100031550 Ga0070696_1000315502 245
223 3300005547 Ga0070693_100025536 Ga0070693_1000255362 245
224 3300005547 Ga0070693_100026449 Ga0070693_1000264491 245
225 3300005548 Ga0070665_100034039 Ga0070665_1000340393 245
226 3300005548 Ga0070665_100159951 Ga0070665_1001599513 245
227 3300005548 Ga0070665_100664774 Ga0070665_1006647741 245
228 3300005549 Ga0070704_100123440 Ga0070704_1001234402 245
229 3300005549 Ga0070704_100257264 Ga0070704_1002572642 245
230 3300005563 Ga0068855_100011061 Ga0068855_10001106110 245
231 3300005563 Ga0068855_100076710 Ga0068855_1000767104 245
232 3300005563 Ga0068855_100112342 Ga0068855_1001123423 245
233 3300005563 Ga0068855_100204031 Ga0068855_1002040312 245
234 3300005563 Ga0068855_100254819 Ga0068855_1002548192 245
235 3300005563 Ga0068855_100476220 Ga0068855_1004762201 245
236 3300005563 Ga0068855_100612133 Ga0068855_1006121331 245
237 3300005564 Ga0070664_100063839 Ga0070664_1000638395 245
238 3300005564 Ga0070664_100513122 Ga0070664_1005131222 245
239 3300005564 Ga0070664_100546534 Ga0070664_1005465342 245
240 3300005577 Ga0068857_100020142 Ga0068857_1000201426 245
241 3300005577 Ga0068857_100033886 Ga0068857_1000338863 245
242 3300005614 Ga0068856_100048306 Ga0068856_1000483062 245
243 3300005614 Ga0068856_100083216 Ga0068856_1000832165 245
244 3300005614 Ga0068856_100155779 Ga0068856_1001557794 245
245 3300005614 Ga0068856_100233260 Ga0068856_1002332603 245
246 3300005614 Ga0068856_100544559 Ga0068856_1005445592 245
247 3300005614 Ga0068856_100799862 Ga0068856_1007998622 245
248 3300005615 Ga0070702_100007158 Ga0070702_1000071582 245
249 3300005615 Ga0070702_100052707 Ga0070702_1000527071 245
250 3300005616 Ga0068852_100048901 Ga0068852_1000489014 245
251 3300005616 Ga0068852_100061986 Ga0068852_1000619863 245
252 3300005618 Ga0068864_100000066 Ga0068864_10000006660 245
253 3300005718 Ga0068866_10001604 Ga0068866_100016048 245
254 3300005719 Ga0068861_100007679 Ga0068861_1000076795 245
255 3300005719 Ga0068861_100024683 Ga0068861_1000246831 245
256 3300005719 Ga0068861_100080645 Ga0068861_1000806453 245
257 3300005719 Ga0068861_100189546 Ga0068861_1001895462 245
258 3300005842 Ga0068858_100104722 Ga0068858_1001047223 245
259 3300005844 Ga0068862_100139398 Ga0068862_1001393983 245
260 3300005937 Ga0081455_10010429 Ga0081455_1001042911 245
261 3300005937 Ga0081455_10024962 Ga0081455_100249627 245
262 3300005937 Ga0081455_10073577 Ga0081455_100735772 245
263 3300005937 Ga0081455_10231564 Ga0081455_102315643 245
264 3300005937 Ga0081455_10245484 Ga0081455_102454842 245
265 3300005981 Ga0081538_10000404 Ga0081538_1000040416 245
266 3300005981 Ga0081538_10000427 Ga0081538_1000042712 245
267 3300005981 Ga0081538_10001017 Ga0081538_1000101713 245
268 3300005981 Ga0081538_10001921 Ga0081538_1000192114 245
269 3300005981 Ga0081538_10002722 Ga0081538_100027225 245
270 3300005981 Ga0081538_10003377 Ga0081538_100033774 245
271 3300005981 Ga0081538_10013713 Ga0081538_100137138 245
272 3300005981 Ga0081538_10015810 Ga0081538_100158105 245
273 3300005981 Ga0081538_10023872 Ga0081538_100238726 245
274 3300005981 Ga0081538_10027775 Ga0081538_100277753 245
275 3300005981 Ga0081538_10040020 Ga0081538_100400203 245
276 3300005981 Ga0081538_10059173 Ga0081538_100591732 245
277 3300005983 Ga0081540_1001071 Ga0081540_10010715 245
278 3300005983 Ga0081540_1020136 Ga0081540_10201366 245
279 3300005983 Ga0081540_1094091 Ga0081540_10940912 245
280 3300005985 Ga0081539_10001078 Ga0081539_1000107831 245
281 3300005985 Ga0081539_10003725 Ga0081539_100037259 245
282 3300005985 Ga0081539_10035593 Ga0081539_100355932 245
283 3300005985 Ga0081539_10050885 Ga0081539_100508853 245
284 3300006028 Ga0070717_10000222 Ga0070717_100002223 245
285 3300006028 Ga0070717_10019069 Ga0070717_100190694 245
286 3300006028 Ga0070717_10020643 Ga0070717_100206433 245
287 3300006028 Ga0070717_10092904 Ga0070717_100929045 245
288 3300006028 Ga0070717_10166311 Ga0070717_101663112 245
289 3300006028 Ga0070717_10199875 Ga0070717_101998751 245
290 3300006038 Ga0075365_10005495 Ga0075365_100054953 245
291 3300006038 Ga0075365_10020554 Ga0075365_100205541 245
292 3300006038 Ga0075365_10026753 Ga0075365_100267533 245
293 3300006038 Ga0075365_10048811 Ga0075365_100488114 245
294 3300006038 Ga0075365_10084269 Ga0075365_100842692 245
295 3300006048 Ga0075363_100012817 Ga0075363_1000128173 245
296 3300006051 Ga0075364_10040774 Ga0075364_100407743 245
297 3300006051 Ga0075364_10070702 Ga0075364_100707023 245
298 3300006058 Ga0075432_10100803 Ga0075432_101008031 245
299 3300006163 Ga0070715_10005321 Ga0070715_100053212 245
300 3300006163 Ga0070715_10059786 Ga0070715_100597862 245
301 3300006163 Ga0070715_10111478 Ga0070715_101114781 245
302 3300006163 Ga0070715_10242015 Ga0070715_102420151 245
303 3300006173 Ga0070716_100009187 Ga0070716_1000091875 245
304 3300006173 Ga0070716_100056525 Ga0070716_1000565253 245
305 3300006173 Ga0070716_100161929 Ga0070716_1001619292 245
306 3300006175 Ga0070712_100006792 Ga0070712_1000067922 245
307 3300006175 Ga0070712_100040717 Ga0070712_1000407173 245
308 3300006175 Ga0070712_100040830 Ga0070712_1000408303 245
309 3300006175 Ga0070712_100052581 Ga0070712_1000525814 245
310 3300006175 Ga0070712_100064706 Ga0070712_1000647064 245
311 3300006175 Ga0070712_100259747 Ga0070712_1002597471 245
312 3300006237 Ga0097621_100013985 Ga0097621_1000139857 245
313 3300006237 Ga0097621_100333682 Ga0097621_1003336822 245
314 3300006358 Ga0068871_100005996 Ga0068871_1000059969 245
315 3300006358 Ga0068871_100062847 Ga0068871_1000628472 245
316 3300006358 Ga0068871_100895731 Ga0068871_1008957311 245
317 3300006844 Ga0075428_100008845 Ga0075428_1000088456 245
318 3300006844 Ga0075428_100080455 Ga0075428_1000804552 245
319 3300006844 Ga0075428_100241992 Ga0075428_1002419922 245
320 3300006844 Ga0075428_100370617 Ga0075428_1003706172 245
321 3300006846 Ga0075430_100022646 Ga0075430_1000226464 245
322 3300006847 Ga0075431_100022301 Ga0075431_1000223019 245
323 3300006847 Ga0075431_100050949 Ga0075431_1000509497 245
324 3300006847 Ga0075431_100063042 Ga0075431_1000630423 245
325 3300006847 Ga0075431_100157001 Ga0075431_1001570013 245
326 3300006847 Ga0075431_100328964 Ga0075431_1003289642 245
327 3300006847 Ga0075431_100716023 Ga0075431_1007160232 245
328 3300006852 Ga0075433_10005390 Ga0075433_100053905 245
329 3300006852 Ga0075433_10007855 Ga0075433_1000785513 245
330 3300006852 Ga0075433_10172213 Ga0075433_101722132 245
331 3300006852 Ga0075433_10333777 Ga0075433_103337772 245
332 3300006852 Ga0075433_10439096 Ga0075433_104390962 245
333 3300006871 Ga0075434_100019182 Ga0075434_1000191822 245
334 3300006871 Ga0075434_100112062 Ga0075434_1001120622 245
335 3300006871 Ga0075434_100205984 Ga0075434_1002059842 245
336 3300006871 Ga0075434_100239583 Ga0075434_1002395831 245
337 3300006871 Ga0075434_100288626 Ga0075434_1002886264 245
338 3300006880 Ga0075429_100152578 Ga0075429_1001525782 245
339 3300006880 Ga0075429_100236639 Ga0075429_1002366392 245
340 3300006881 Ga0068865_100003911 Ga0068865_10000391110 245
341 3300006881 Ga0068865_100071854 Ga0068865_1000718544 245
342 3300006914 Ga0075436_100019126 Ga0075436_1000191265 245
343 3300006914 Ga0075436_100019793 Ga0075436_1000197932 245
344 3300006914 Ga0075436_100158914 Ga0075436_1001589141 245
345 3300006914 Ga0075436_100181955 Ga0075436_1001819553 245
346 3300007076 Ga0075435_100002620 Ga0075435_1000026204 245
347 3300007076 Ga0075435_100004257 Ga0075435_1000042575 245
348 3300007076 Ga0075435_100173399 Ga0075435_1001733991 245
349 3300007076 Ga0075435_100212235 Ga0075435_1002122351 245
350 3300007265 Ga0099794_10020916 Ga0099794_100209161 245
351 3300007265 Ga0099794_10141424 Ga0099794_101414242 245
352 3300007265 Ga0099794_10263762 Ga0099794_102637621 245
353 3300009036 Ga0105244_10181059 Ga0105244_101810592 245
354 3300009093 Ga0105240_10048754 Ga0105240_100487546 245
355 3300009093 Ga0105240_10165245 Ga0105240_101652453 245
356 3300009093 Ga0105240_10212995 Ga0105240_102129953 245
357 3300009094 Ga0111539_10004613 Ga0111539_1000461314 245
358 3300009094 Ga0111539_10096335 Ga0111539_100963353 245
359 3300009094 Ga0111539_10228140 Ga0111539_102281402 245
360 3300009094 Ga0111539_10615886 Ga0111539_106158862 245
361 3300009098 Ga0105245_10008994 Ga0105245_100089944 245
362 3300009098 Ga0105245_10033307 Ga0105245_100333074 245
363 3300009098 Ga0105245_10103796 Ga0105245_101037961 245
364 3300009098 Ga0105245_10140748 Ga0105245_101407482 245
365 3300009098 Ga0105245_10171360 Ga0105245_101713602 245
366 3300009098 Ga0105245_10306255 Ga0105245_103062552 245
367 3300009101 Ga0105247_10049508 Ga0105247_100495082 245
368 3300009147 Ga0114129_10014902 Ga0114129_100149025 245
369 3300009147 Ga0114129_10019240 Ga0114129_1001924015 245
370 3300009147 Ga0114129_10032040 Ga0114129_100320402 245
371 3300009147 Ga0114129_10056990 Ga0114129_100569903 245
372 3300009147 Ga0114129_10188525 Ga0114129_101885255 245
373 3300009147 Ga0114129_10248910 Ga0114129_102489102 245
374 3300009147 Ga0114129_10254074 Ga0114129_102540743 245
375 3300009147 Ga0114129_10300192 Ga0114129_103001922 245
376 3300009147 Ga0114129_10691269 Ga0114129_106912692 245
377 3300009147 Ga0114129_10789464 Ga0114129_107894642 245
378 3300009147 Ga0114129_11165672 Ga0114129_111656721 245
379 3300009148 Ga0105243_10002113 Ga0105243_100021134 245
380 3300009174 Ga0105241_10086572 Ga0105241_100865722 245
381 3300009174 Ga0105241_10236160 Ga0105241_102361602 245
382 3300009176 Ga0105242_10001082 Ga0105242_100010828 245
383 3300009176 Ga0105242_10299352 Ga0105242_102993522 245
384 3300009176 Ga0105242_10833080 Ga0105242_108330802 245
385 3300009177 Ga0105248_10013215 Ga0105248_1001321510 245
386 3300009545 Ga0105237_10000602 Ga0105237_1000060234 245
387 3300009545 Ga0105237_10280461 Ga0105237_102804612 245
388 3300009551 Ga0105238_10048578 Ga0105238_100485785 245
389 3300009551 Ga0105238_10146274 Ga0105238_101462744 245
390 3300009551 Ga0105238_10320119 Ga0105238_103201192 245
391 3300009553 Ga0105249_10012750 Ga0105249_100127504 245
392 3300009553 Ga0105249_10099165 Ga0105249_100991652 245
393 3300009553 Ga0105249_10152752 Ga0105249_101527524 245
394 3300009553 Ga0105249_10190204 Ga0105249_101902044 245
395 3300009553 Ga0105249_10302900 Ga0105249_103029003 245
396 3300009553 Ga0105249_10706918 Ga0105249_107069182 245
397 3300010375 Ga0105239_10012439 Ga0105239_100124392 245
398 3300010375 Ga0105239_10023482 Ga0105239_100234826 245
399 3300010375 Ga0105239_10056542 Ga0105239_100565422 245
400 3300010375 Ga0105239_10083085 Ga0105239_100830853 245
401 3300010375 Ga0105239_10102031 Ga0105239_101020313 245
402 3300010375 Ga0105239_10148987 Ga0105239_101489872 245
403 3300011119 Ga0105246_10027163 Ga0105246_100271634 245
404 3300011119 Ga0105246_10403761 Ga0105246_104037612 245
405 3300012481 Ga0157320_1000926 Ga0157320_10009262 245
406 3300012481 Ga0157320_1004889 Ga0157320_10048891 245
407 3300012515 Ga0157338_1002151 Ga0157338_10021511 245
408 3300013100 Ga0157373_10096136 Ga0157373_100961363 245
409 3300013104 Ga0157370_10077775 Ga0157370_100777753 245
410 3300013104 Ga0157370_10089679 Ga0157370_100896794 245
411 3300013104 Ga0157370_10288776 Ga0157370_102887762 245
412 3300013104 Ga0157370_10402652 Ga0157370_104026522 245
413 3300013105 Ga0157369_10001368 Ga0157369_100013682 245
414 3300013105 Ga0157369_10065657 Ga0157369_100656573 245
415 3300013105 Ga0157369_10135210 Ga0157369_101352102 245
416 3300013105 Ga0157369_10565498 Ga0157369_105654982 245
417 3300013296 Ga0157374_10025602 Ga0157374_100256025 245
418 3300013296 Ga0157374_10291155 Ga0157374_102911552 245
419 3300013297 Ga0157378_10002101 Ga0157378_1000210113 245
420 3300013306 Ga0163162_10004455 Ga0163162_1000445512 245
421 3300013306 Ga0163162_10023935 Ga0163162_100239356 245
422 3300013306 Ga0163162_10044727 Ga0163162_100447274 245
423 3300013307 Ga0157372_10015118 Ga0157372_100151186 245
424 3300013307 Ga0157372_10082053 Ga0157372_100820533 245
425 3300013307 Ga0157372_10282379 Ga0157372_102823792 245
426 3300013308 Ga0157375_10050642 Ga0157375_100506423 245
427 3300013308 Ga0157375_10115988 Ga0157375_101159882 245
428 3300013308 Ga0157375_10127111 Ga0157375_101271111 245
429 3300014326 Ga0157380_10004538 Ga0157380_1000453810 245
430 3300014497 Ga0182008_10138916 Ga0182008_101389161 245
431 3300014745 Ga0157377_10030221 Ga0157377_100302214 245
432 3300014745 Ga0157377_10098342 Ga0157377_100983423 245
433 3300014969 Ga0157376_10036102 Ga0157376_100361024 245
434 3300020069 Ga0197907_10720580 Ga0197907_107205802 245
435 3300020070 Ga0206356_10343528 Ga0206356_103435282 245
436 3300020070 Ga0206356_11354009 Ga0206356_113540091 245
437 3300020075 Ga0206349_1954011 Ga0206349_19540111 245
438 3300020080 Ga0206350_10340442 Ga0206350_103404422 245
439 3300020080 Ga0206350_11395722 Ga0206350_113957222 245
440 3300020081 Ga0206354_10696187 Ga0206354_106961871 245
441 3300020081 Ga0206354_11114285 Ga0206354_111142851 245
442 3300020082 Ga0206353_11645146 Ga0206353_116451464 245
443 3300020082 Ga0206353_11985042 Ga0206353_119850422 245
444 3300021358 Ga0213873_10048531 Ga0213873_100485311 245
445 3300021384 Ga0213876_10010928 Ga0213876_100109283 245
446 3300021384 Ga0213876_10014059 Ga0213876_100140594 245
447 3300022467 Ga0224712_10012585 Ga0224712_100125851 245
448 3300025898 Ga0207692_10006355 Ga0207692_100063556 245
449 3300025898 Ga0207692_10028495 Ga0207692_100284951 245
450 3300025898 Ga0207692_10104794 Ga0207692_101047941 245
451 3300025898 Ga0207692_10113633 Ga0207692_101136332 245
452 3300025899 Ga0207642_10000449 Ga0207642_100004498 245
453 3300025900 Ga0207710_10070883 Ga0207710_100708832 245
454 3300025901 Ga0207688_10092682 Ga0207688_100926821 245
455 3300025901 Ga0207688_10182197 Ga0207688_101821971 245
456 3300025901 Ga0207688_10309293 Ga0207688_103092932 245
457 3300025903 Ga0207680_10184258 Ga0207680_101842581 245
458 3300025905 Ga0207685_10026495 Ga0207685_100264952 245
459 3300025905 Ga0207685_10043960 Ga0207685_100439601 245
460 3300025905 Ga0207685_10065683 Ga0207685_100656831 245
461 3300025905 Ga0207685_10273744 Ga0207685_102737441 245
462 3300025906 Ga0207699_10005052 Ga0207699_100050524 245
463 3300025906 Ga0207699_10010075 Ga0207699_100100754 245
464 3300025906 Ga0207699_10036227 Ga0207699_100362272 245
465 3300025906 Ga0207699_10121786 Ga0207699_101217861 245
466 3300025909 Ga0207705_10476007 Ga0207705_104760071 245
467 3300025910 Ga0207684_10000006 Ga0207684_10000006640 245
468 3300025910 Ga0207684_10000111 Ga0207684_10000111119 245
469 3300025910 Ga0207684_10079026 Ga0207684_100790262 245
470 3300025910 Ga0207684_10198572 Ga0207684_101985722 245
471 3300025910 Ga0207684_10218558 Ga0207684_102185582 245
472 3300025912 Ga0207707_10009759 Ga0207707_100097593 245
473 3300025912 Ga0207707_10014965 Ga0207707_100149659 245
474 3300025913 Ga0207695_10046851 Ga0207695_100468515 245
475 3300025913 Ga0207695_10157193 Ga0207695_101571932 245
476 3300025913 Ga0207695_10608627 Ga0207695_106086271 245
477 3300025914 Ga0207671_10355848 Ga0207671_103558481 245
478 3300025915 Ga0207693_10003431 Ga0207693_100034318 245
479 3300025915 Ga0207693_10003498 Ga0207693_100034985 245
480 3300025915 Ga0207693_10005467 Ga0207693_100054672 245
481 3300025915 Ga0207693_10027024 Ga0207693_100270244 245
482 3300025915 Ga0207693_10400015 Ga0207693_104000152 245
483 3300025916 Ga0207663_10005457 Ga0207663_100054573 245
484 3300025916 Ga0207663_10007121 Ga0207663_100071213 245
485 3300025916 Ga0207663_10012312 Ga0207663_100123124 245
486 3300025916 Ga0207663_10016317 Ga0207663_100163172 245
487 3300025916 Ga0207663_10023726 Ga0207663_100237264 245
488 3300025916 Ga0207663_10024453 Ga0207663_100244533 245
489 3300025916 Ga0207663_10064746 Ga0207663_100647462 245
490 3300025916 Ga0207663_10094323 Ga0207663_100943231 245
491 3300025916 Ga0207663_10182669 Ga0207663_101826692 245
492 3300025916 Ga0207663_10285765 Ga0207663_102857652 245
493 3300025916 Ga0207663_10730871 Ga0207663_107308711 245
494 3300025917 Ga0207660_10004077 Ga0207660_100040778 245
495 3300025917 Ga0207660_10029108 Ga0207660_100291082 245
496 3300025917 Ga0207660_10242118 Ga0207660_102421181 245
497 3300025917 Ga0207660_10356751 Ga0207660_103567512 245
498 3300025918 Ga0207662_10026943 Ga0207662_100269431 245
499 3300025919 Ga0207657_10008674 Ga0207657_100086748 245
500 3300025919 Ga0207657_10009303 Ga0207657_100093039 245
501 3300025919 Ga0207657_10013621 Ga0207657_100136213 245
502 3300025919 Ga0207657_10014003 Ga0207657_100140032 245
503 3300025919 Ga0207657_10110399 Ga0207657_101103992 245
504 3300025921 Ga0207652_10017330 Ga0207652_100173302 245
505 3300025921 Ga0207652_10035210 Ga0207652_100352104 245
506 3300025921 Ga0207652_10183337 Ga0207652_101833371 245
507 3300025922 Ga0207646_10000746 Ga0207646_1000074620 245
508 3300025922 Ga0207646_10009937 Ga0207646_100099373 245
509 3300025922 Ga0207646_10014914 Ga0207646_100149142 245
510 3300025922 Ga0207646_10017090 Ga0207646_100170907 245
511 3300025922 Ga0207646_10025038 Ga0207646_100250384 245
512 3300025922 Ga0207646_10035652 Ga0207646_100356521 245
513 3300025922 Ga0207646_10043965 Ga0207646_100439652 245
514 3300025922 Ga0207646_10113169 Ga0207646_101131692 245
515 3300025922 Ga0207646_10187402 Ga0207646_101874022 245
516 3300025922 Ga0207646_10559207 Ga0207646_105592071 245
517 3300025926 Ga0207659_10171696 Ga0207659_101716962 245
518 3300025926 Ga0207659_10319407 Ga0207659_103194072 245
519 3300025927 Ga0207687_10005452 Ga0207687_100054528 245
520 3300025927 Ga0207687_10007651 Ga0207687_100076513 245
521 3300025927 Ga0207687_10163194 Ga0207687_101631942 245
522 3300025927 Ga0207687_10519551 Ga0207687_105195512 245
523 3300025928 Ga0207700_10006621 Ga0207700_1000662110 245
524 3300025928 Ga0207700_10023694 Ga0207700_100236942 245
525 3300025928 Ga0207700_10250028 Ga0207700_102500282 245
526 3300025928 Ga0207700_10832602 Ga0207700_108326021 245
527 3300025929 Ga0207664_10003470 Ga0207664_100034708 245
528 3300025929 Ga0207664_10010381 Ga0207664_100103814 245
529 3300025929 Ga0207664_10013689 Ga0207664_100136895 245
530 3300025929 Ga0207664_10052039 Ga0207664_100520393 245
531 3300025929 Ga0207664_10159446 Ga0207664_101594462 245
532 3300025929 Ga0207664_10410661 Ga0207664_104106611 245
533 3300025929 Ga0207664_10671385 Ga0207664_106713851 245
534 3300025929 Ga0207664_10701832 Ga0207664_107018321 245
535 3300025931 Ga0207644_10020755 Ga0207644_100207556 245
536 3300025931 Ga0207644_10633882 Ga0207644_106338821 245
537 3300025932 Ga0207690_10371340 Ga0207690_103713402 245
538 3300025932 Ga0207690_10436351 Ga0207690_104363511 245
539 3300025933 Ga0207706_10003766 Ga0207706_1000376614 245
540 3300025933 Ga0207706_10186011 Ga0207706_101860112 245
541 3300025933 Ga0207706_10333307 Ga0207706_103333071 245
542 3300025934 Ga0207686_10001941 Ga0207686_100019414 245
543 3300025935 Ga0207709_10001307 Ga0207709_1000130717 245
544 3300025935 Ga0207709_10068350 Ga0207709_100683502 245
545 3300025935 Ga0207709_10097111 Ga0207709_100971111 245
546 3300025935 Ga0207709_10134650 Ga0207709_101346502 245
547 3300025935 Ga0207709_10688459 Ga0207709_106884591 245
548 3300025936 Ga0207670_10221494 Ga0207670_102214942 245
549 3300025937 Ga0207669_10003552 Ga0207669_100035524 245
550 3300025937 Ga0207669_10008329 Ga0207669_100083293 245
551 3300025937 Ga0207669_10100834 Ga0207669_101008341 245
552 3300025938 Ga0207704_10001093 Ga0207704_100010932 245
553 3300025938 Ga0207704_10098645 Ga0207704_100986453 245
554 3300025939 Ga0207665_10002156 Ga0207665_1000215615 245
555 3300025939 Ga0207665_10010333 Ga0207665_100103334 245
556 3300025939 Ga0207665_10054983 Ga0207665_100549832 245
557 3300025939 Ga0207665_10070823 Ga0207665_100708232 245
558 3300025939 Ga0207665_10079926 Ga0207665_100799262 245
559 3300025939 Ga0207665_10120205 Ga0207665_101202051 245
560 3300025940 Ga0207691_10025953 Ga0207691_100259537 245
561 3300025941 Ga0207711_10063349 Ga0207711_100633492 245
562 3300025944 Ga0207661_10114948 Ga0207661_101149482 245
563 3300025944 Ga0207661_10145048 Ga0207661_101450482 245
564 3300025944 Ga0207661_10217226 Ga0207661_102172262 245
565 3300025944 Ga0207661_10320529 Ga0207661_103205292 245
566 3300025944 Ga0207661_10409811 Ga0207661_104098112 245
567 3300025945 Ga0207679_10024106 Ga0207679_100241062 245
568 3300025945 Ga0207679_10212206 Ga0207679_102122063 245
569 3300025949 Ga0207667_10112119 Ga0207667_101121192 245
570 3300025949 Ga0207667_10157031 Ga0207667_101570312 245
571 3300025949 Ga0207667_10238071 Ga0207667_102380712 245
572 3300025949 Ga0207667_10319832 Ga0207667_103198322 245
573 3300025949 Ga0207667_10689951 Ga0207667_106899511 245
574 3300025960 Ga0207651_10321139 Ga0207651_103211391 245
575 3300025961 Ga0207712_10117751 Ga0207712_101177512 245
576 3300025961 Ga0207712_10150883 Ga0207712_101508832 245
577 3300025961 Ga0207712_10170148 Ga0207712_101701483 245
578 3300025961 Ga0207712_10194731 Ga0207712_101947313 245
579 3300025961 Ga0207712_10592014 Ga0207712_105920141 245
580 3300025961 Ga0207712_10704374 Ga0207712_107043741 245
581 3300025972 Ga0207668_10026631 Ga0207668_100266316 245
582 3300025972 Ga0207668_10031470 Ga0207668_100314703 245
583 3300025972 Ga0207668_10155093 Ga0207668_101550932 245
584 3300026023 Ga0207677_10181307 Ga0207677_101813071 245
585 3300026023 Ga0207677_10428480 Ga0207677_104284802 245
586 3300026041 Ga0207639_10075418 Ga0207639_100754184 245
587 3300026041 Ga0207639_10499116 Ga0207639_104991161 245
588 3300026067 Ga0207678_10055531 Ga0207678_100555314 245
589 3300026067 Ga0207678_10069245 Ga0207678_100692453 245
590 3300026075 Ga0207708_10000316 Ga0207708_1000031638 245
591 3300026075 Ga0207708_10473756 Ga0207708_104737561 245
592 3300026078 Ga0207702_10009738 Ga0207702_100097389 245
593 3300026078 Ga0207702_10455841 Ga0207702_104558411 245
594 3300026089 Ga0207648_10006150 Ga0207648_100061504 245
595 3300026089 Ga0207648_10111515 Ga0207648_101115152 245
596 3300026089 Ga0207648_10474500 Ga0207648_104745002 245
597 3300026095 Ga0207676_10000038 Ga0207676_10000038110 245
598 3300026116 Ga0207674_10027663 Ga0207674_100276636 245
599 3300026116 Ga0207674_10028752 Ga0207674_100287525 245
600 3300026116 Ga0207674_10307156 Ga0207674_103071563 245
601 3300026118 Ga0207675_100002213 Ga0207675_1000022134 245
602 3300026118 Ga0207675_100005637 Ga0207675_1000056377 245
603 3300026118 Ga0207675_100007552 Ga0207675_10000755210 245
604 3300026118 Ga0207675_100018906 Ga0207675_1000189065 245
605 3300026118 Ga0207675_100064312 Ga0207675_1000643123 245
606 3300026118 Ga0207675_100068651 Ga0207675_1000686514 245
607 3300026121 Ga0207683_10001814 Ga0207683_1000181411 245
608 3300026121 Ga0207683_10008897 Ga0207683_100088973 245
609 3300027907 Ga0207428_10003447 Ga0207428_1000344720 245
610 3300027907 Ga0207428_10038721 Ga0207428_100387212 245
611 3300027907 Ga0207428_10080193 Ga0207428_100801932 245
612 3300027907 Ga0207428_10100716 Ga0207428_101007163 245
613 3300028379 Ga0268266_10050172 Ga0268266_100501725 245
614 3300028379 Ga0268266_10226693 Ga0268266_102266932 245
615 3300028379 Ga0268266_10393557 Ga0268266_103935571 245
616 3300028380 Ga0268265_10657242 Ga0268265_106572422 245
617 3300028381 Ga0268264_10257680 Ga0268264_102576802 245
618 3300031548 Ga0307408_100164039 Ga0307408_1001640392 245
619 3300031731 Ga0307405_10027498 Ga0307405_100274983 245
620 3300031852 Ga0307410_10011531 Ga0307410_100115317 245
621 3300031852 Ga0307410_10065094 Ga0307410_100650941 245
622 3300031852 Ga0307410_10070587 Ga0307410_100705873 245
623 3300031901 Ga0307406_10016289 Ga0307406_100162892 245
624 3300031901 Ga0307406_10120296 Ga0307406_101202962 245
625 3300031901 Ga0307406_10179718 Ga0307406_101797182 245
626 3300031901 Ga0307406_10182702 Ga0307406_101827021 245
627 3300031903 Ga0307407_10006320 Ga0307407_100063207 245
628 3300031903 Ga0307407_10017333 Ga0307407_100173331 245
629 3300031903 Ga0307407_10113304 Ga0307407_101133043 245
630 3300031903 Ga0307407_10398144 Ga0307407_103981442 245
631 3300031911 Ga0307412_10070216 Ga0307412_100702163 245
632 3300031911 Ga0307412_10128520 Ga0307412_101285201 245
633 3300031995 Ga0307409_100001197 Ga0307409_1000011973 245
634 3300031995 Ga0307409_100032250 Ga0307409_1000322504 245
635 3300031995 Ga0307409_100074431 Ga0307409_1000744313 245
636 3300031995 Ga0307409_100232346 Ga0307409_1002323462 245
637 3300032002 Ga0307416_100002210 Ga0307416_1000022108 245
638 3300032002 Ga0307416_100032735 Ga0307416_1000327353 245
639 3300032002 Ga0307416_100121943 Ga0307416_1001219432 245
640 3300032004 Ga0307414_10029673 Ga0307414_100296735 245
641 3300032004 Ga0307414_10069184 Ga0307414_100691843 245
642 3300032004 Ga0307414_10262419 Ga0307414_102624192 245
643 3300032005 Ga0307411_10054496 Ga0307411_100544961 245
644 3300032005 Ga0307411_10109922 Ga0307411_101099221 245
645 3300032126 Ga0307415_100044324 Ga0307415_1000443243 245
646 3300032126 Ga0307415_100070787 Ga0307415_1000707873 245
647 3300035084 Ga0373928_0046268 Ga0373928_0046268_206_943 245
648 3300035112 Ga0373932_0098627 Ga0373932_0098627_132_869 245
649 3300035115 Ga0373941_0153326 Ga0373941_0153326_66_803 245
650 3300035116 Ga0373945_0000408 Ga0373945_0000408_3790_4527 245
651 3300035116 Ga0373945_0059601 Ga0373945_0059601_143_880 245
652 3300035170 Ga0373943_0020423 Ga0373943_0020423_502_1242 245
653 3300035170 Ga0373943_0409611 Ga0373943_0409611_29_766 245
654 3300035171 Ga0373946_0002764 Ga0373946_0002764_5180_5917 245
655 3300035172 Ga0373955_0249621 Ga0373955_0249621_126_869 245
656 3300035207 Ga0373942_0056057 Ga0373942_0056057_296_1033 245
657 3300035410 Ga0373924_0055170 Ga0373924_0055170_251_988 245
658 3300035692 Ga0373935_0005562 Ga0373935_0005562_2425_3162 245
659 3300035692 Ga0373935_0093143 Ga0373935_0093143_871_1608 245
660 3300037068 Ga0373925_0001678 Ga0373925_0001678_3599_4336 245
661 3300037068 Ga0373925_0559600 Ga0373925_0559600_149_889 245
662 3300037312 Ga0395899_0039222 Ga0395899_0039222_1302_2039 245
663 3300037312 Ga0395899_0070679 Ga0395899_0070679_475_1212 245
664 3300037312 Ga0395899_0076290 Ga0395899_0076290_1229_1966 245
665 3300037312 Ga0395899_0200369 Ga0395899_0200369_265_1002 245
666 3300037312 Ga0395899_0239011 Ga0395899_0239011_57_794 245
667 3300037418 Ga0395900_0002072 Ga0395900_0002072_16286_17029 245
668 3300037418 Ga0395900_0004735 Ga0395900_0004735_12449_13273 245
669 3300037418 Ga0395900_0006797 Ga0395900_0006797_10673_11410 245
670 3300037418 Ga0395900_0015456 Ga0395900_0015456_5522_6259 245
671 3300037418 Ga0395900_0065136 Ga0395900_0065136_255_992 245
672 3300037418 Ga0395900_0071833 Ga0395900_0071833_1086_1823 245
673 3300037418 Ga0395900_0105266 Ga0395900_0105266_673_1410 245
674 3300037418 Ga0395900_0129706 Ga0395900_0129706_1217_1954 245
675 3300037418 Ga0395900_0135342 Ga0395900_0135342_630_1367 245
676 3300037418 Ga0395900_0238090 Ga0395900_0238090_915_1652 245
677 3300037418 Ga0395900_0253259 Ga0395900_0253259_99_836 245
678 3300037418 Ga0395900_0326493 Ga0395900_0326493_468_1226 245
679 3300037418 Ga0395900_0482701 Ga0395900_0482701_201_938 245
680 3300037418 Ga0395900_0551746 Ga0395900_0551746_176_913 245
681 3300037466 Ga0395898_0011628 Ga0395898_0011628_6505_7242 245
682 3300037466 Ga0395898_0012231 Ga0395898_0012231_5100_5837 245
683 3300037466 Ga0395898_0044784 Ga0395898_0044784_1515_2252 245
684 3300037466 Ga0395898_0067337 Ga0395898_0067337_1463_2200 245
685 3300037466 Ga0395898_0082178 Ga0395898_0082178_2155_2892 245
686 3300037466 Ga0395898_0101276 Ga0395898_0101276_1240_1998 245
687 3300037466 Ga0395898_0124772 Ga0395898_0124772_513_1250 245
688 3300037466 Ga0395898_0138213 Ga0395898_0138213_1316_2056 245
689 3300037466 Ga0395898_0170231 Ga0395898_0170231_317_1063 245
690 3300037466 Ga0395898_0184784 Ga0395898_0184784_406_1143 245
691 3300037466 Ga0395898_0212905 Ga0395898_0212905_1084_1824 245
692 3300037466 Ga0395898_0331755 Ga0395898_0331755_542_1279 245
693 3300037466 Ga0395898_0343919 Ga0395898_0343919_405_1196 245
694 3300037466 Ga0395898_0394046 Ga0395898_0394046_350_1087 245
695 3300037471 Ga0395905_0010007 Ga0395905_0010007_3390_4133 245
696 3300037471 Ga0395905_0017142 Ga0395905_0017142_114_851 245
697 3300037471 Ga0395905_0027047 Ga0395905_0027047_4274_5011 245
698 3300037471 Ga0395905_0035027 Ga0395905_0035027_3603_4340 245
699 3300037471 Ga0395905_0037555 Ga0395905_0037555_2566_3303 245
700 3300037471 Ga0395905_0039071 Ga0395905_0039071_2754_3545 245
701 3300037471 Ga0395905_0107325 Ga0395905_0107325_1674_2411 245
702 3300037471 Ga0395905_0120909 Ga0395905_0120909_415_1152 245
703 3300037471 Ga0395905_0175640 Ga0395905_0175640_356_1093 245
704 3300037471 Ga0395905_0389744 Ga0395905_0389744_144_935 245
705 3300037471 Ga0395905_0553534 Ga0395905_0553534_204_944 245
706 3300037853 Ga0436364_0434921 Ga0436364_0434921_332_1075 245
707 3300037853 Ga0436364_0706594 Ga0436364_0706594_607_1344 245
708 3300038443 Ga0395901_0001774 Ga0395901_0001774_16430_17173 245
709 3300038443 Ga0395901_0003044 Ga0395901_0003044_1076_1837 245
710 3300038443 Ga0395901_0006297 Ga0395901_0006297_4493_5230 245
711 3300038443 Ga0395901_0007454 Ga0395901_0007454_3694_4431 245
712 3300038443 Ga0395901_0009554 Ga0395901_0009554_4541_5278 245
713 3300038443 Ga0395901_0019210 Ga0395901_0019210_5998_6735 245
714 3300038443 Ga0395901_0027399 Ga0395901_0027399_1259_1996 245
715 3300038443 Ga0395901_0030513 Ga0395901_0030513_330_1076 245
716 3300038443 Ga0395901_0036498 Ga0395901_0036498_719_1456 245
717 3300038443 Ga0395901_0043463 Ga0395901_0043463_1676_2422 245
718 3300038443 Ga0395901_0045207 Ga0395901_0045207_3202_3939 245
719 3300038443 Ga0395901_0059143 Ga0395901_0059143_2703_3440 245
720 3300038443 Ga0395901_0072952 Ga0395901_0072952_148_906 245
721 3300038443 Ga0395901_0103191 Ga0395901_0103191_1307_2044 245
722 3300038443 Ga0395901_0112869 Ga0395901_0112869_1224_1961 245
723 3300038443 Ga0395901_0116981 Ga0395901_0116981_110_847 245
724 3300038443 Ga0395901_0205853 Ga0395901_0205853_285_1022 245
725 3300038443 Ga0395901_0249381 Ga0395901_0249381_318_1055 245
726 3300038443 Ga0395901_0294543 Ga0395901_0294543_568_1305 245
727 3300039437 Ga0436365_0032671 Ga0436365_0032671_2586_3326 245
728 3300039437 Ga0436365_0623832 Ga0436365_0623832_1808_2545 245
729 3300039437 Ga0436365_1576607 Ga0436365_1576607_82_819 245
730 3300039437 Ga0436365_1685261 Ga0436365_1685261_1079_1849 245
731 3300039450 Ga0436363_0515302 Ga0436363_0515302_965_1702 245
732 3300039450 Ga0436363_0746168 Ga0436363_0746168_87_830 245
733 3300039450 Ga0436363_1306475 Ga0436363_1306475_111_848 245
734 3300039453 Ga0436362_0291861 Ga0436362_0291861_1808_2548 245
735 3300039453 Ga0436362_0514978 Ga0436362_0514978_127_882 245
736 3300042005 Ga0439448_0006091 Ga0439448_0006091_1615_2352 245
737 3300042005 Ga0439448_0146041 Ga0439448_0146041_11_748 245
738 3300042012 Ga0439455_0009092 Ga0439455_0009092_904_1641 245
739 3300042461 Ga0439460_0066193 Ga0439460_0066193_176_913 245
740 3300042461 Ga0439460_0127503 Ga0439460_0127503_42_779 245
741 3300044683 Ga0466965_0020394 Ga0466965_0020394_1729_2475 245
742 3300044693 Ga0466961_0005010 Ga0466961_0005010_4062_4799 245
743 3300044694 Ga0466963_0012641 Ga0466963_0012641_1348_2094 245
744 3300044694 Ga0466963_0019209 Ga0466963_0019209_2287_3024 245
745 3300044694 Ga0466963_0038359 Ga0466963_0038359_978_1724 245
746 3300044694 Ga0466963_0051754 Ga0466963_0051754_1427_2164 245
747 3300044694 Ga0466963_0190766 Ga0466963_0190766_24_764 245
748 3300044694 Ga0466963_0215510 Ga0466963_0215510_477_1214 245
749 3300044694 Ga0466963_0235098 Ga0466963_0235098_413_1150 245
750 3300044706 Ga0466964_0014724 Ga0466964_0014724_317_1054 245
751 3300044706 Ga0466964_0034295 Ga0466964_0034295_146_883 245
752 3300044719 Ga0466971_0139842 Ga0466971_0139842_322_1068 245
753 3300044735 Ga0466968_0026194 Ga0466968_0026194_1402_2139 245
754 3300044842 Ga0466957_0033734 Ga0466957_0033734_2302_3048 245
755 3300044901 Ga0466960_0139842 Ga0466960_0139842_264_1004 245
756 3300045049 Ga0466959_0001162 Ga0466959_0001162_1781_2518 245
757 3300045049 Ga0466959_0033183 Ga0466959_0033183_121_867 245
758 3300045049 Ga0466959_0062471 Ga0466959_0062471_1020_1757 245
759 3300045049 Ga0466959_0089007 Ga0466959_0089007_363_1103 245
760 3300045049 Ga0466959_0093107 Ga0466959_0093107_1092_1838 245
761 3300045836 Ga0466958_0000699 Ga0466958_0000699_2367_3104 245
762 3300045836 Ga0466958_0006923 Ga0466958_0006923_2450_3187 245
763 3300045836 Ga0466958_0025331 Ga0466958_0025331_242_988 245
764 3300045976 Ga0466967_0019062 Ga0466967_0019062_816_1553 245
765 3300045976 Ga0466967_0027543 Ga0466967_0027543_2056_2802 245
766 3300045976 Ga0466967_0033807 Ga0466967_0033807_2843_3589 245
767 3300045976 Ga0466967_0042760 Ga0466967_0042760_1310_2056 245
768 3300045976 Ga0466967_0308668 Ga0466967_0308668_257_994 245
769 3300046454 Ga0495592_0000024 Ga0495592_0000024_83782_84519 245
770 3300046454 Ga0495592_0067947 Ga0495592_0067947_1477_2214 245
771 3300046455 Ga0495603_0092934 Ga0495603_0092934_804_1592 245
772 3300046455 Ga0495603_0098108 Ga0495603_0098108_472_1209 245
773 3300046455 Ga0495603_0119633 Ga0495603_0119633_125_862 245
774 3300046459 Ga0495629_0003244 Ga0495629_0003244_9830_10567 245
775 3300046459 Ga0495629_0171844 Ga0495629_0171844_85_822 245
776 3300046461 Ga0495641_0005768 Ga0495641_0005768_404_1141 245
777 3300046461 Ga0495641_0013989 Ga0495641_0013989_1668_2405 245
778 3300046461 Ga0495641_0057271 Ga0495641_0057271_360_1097 245
779 3300046461 Ga0495641_0087164 Ga0495641_0087164_335_1072 245
780 3300046461 Ga0495641_0104129 Ga0495641_0104129_77_814 245
781 3300046462 Ga0495651_0040552 Ga0495651_0040552_2114_2851 245
782 3300046463 Ga0495653_0003414 Ga0495653_0003414_6561_7472 245
783 3300046463 Ga0495653_0049834 Ga0495653_0049834_294_1031 245
784 3300046463 Ga0495653_0097751 Ga0495653_0097751_864_1601 245
785 3300046473 Ga0495582_0000028 Ga0495582_0000028_23233_23970 245
786 3300046473 Ga0495582_0020593 Ga0495582_0020593_138_875 245
787 3300046473 Ga0495582_0104437 Ga0495582_0104437_514_1251 245
788 3300046473 Ga0495582_0105911 Ga0495582_0105911_26_763 245
789 3300046474 Ga0495605_0149100 Ga0495605_0149100_52_804 245
790 3300046475 Ga0495639_0066522 Ga0495639_0066522_724_1461 245
791 3300046475 Ga0495639_0249977 Ga0495639_0249977_58_795 245
792 3300046476 Ga0495662_0000448 Ga0495662_0000448_13531_14268 245
793 3300046499 Ga0495594_0092156 Ga0495594_0092156_136_873 245
794 3300046499 Ga0495594_0196564 Ga0495594_0196564_302_1039 245
795 3300046500 Ga0495596_0033823 Ga0495596_0033823_1049_1792 245
796 3300046500 Ga0495596_0034066 Ga0495596_0034066_1116_1853 245
797 3300046500 Ga0495596_0045905 Ga0495596_0045905_85_837 245
798 3300046501 Ga0495607_0071166 Ga0495607_0071166_758_1501 245
799 3300046511 Ga0495608_0139004 Ga0495608_0139004_95_832 245
800 3300046513 Ga0495616_0059385 Ga0495616_0059385_938_1684 245
801 3300046513 Ga0495616_0128083 Ga0495616_0128083_287_1024 245
802 3300046514 Ga0495618_0083468 Ga0495618_0083468_627_1364 245
803 3300046516 Ga0495628_0034794 Ga0495628_0034794_2726_3469 245
804 3300046517 Ga0495630_0001414 Ga0495630_0001414_732_1469 245
805 3300046517 Ga0495630_0006834 Ga0495630_0006834_4588_5325 245
806 3300046518 Ga0495631_0135961 Ga0495631_0135961_237_974 245
807 3300046519 Ga0495632_0239850 Ga0495632_0239850_41_778 245
808 3300046523 Ga0495644_0115708 Ga0495644_0115708_35_772 245
809 3300046525 Ga0495663_0020186 Ga0495663_0020186_506_1243 245
810 3300046525 Ga0495663_0068176 Ga0495663_0068176_187_924 245
811 3300046526 Ga0495666_0017436 Ga0495666_0017436_13_750 245
812 3300046529 Ga0495652_0058998 Ga0495652_0058998_1040_1828 245
813 3300046531 Ga0495665_0000510 Ga0495665_0000510_4582_5319 245
814 3300046531 Ga0495665_0051671 Ga0495665_0051671_375_1112 245
815 3300046531 Ga0495665_0192939 Ga0495665_0192939_227_964 245
816 3300046533 Ga0495640_0009055 Ga0495640_0009055_4573_5310 245
817 3300046533 Ga0495640_0070344 Ga0495640_0070344_221_958 245
818 3300046535 Ga0495586_0000416 Ga0495586_0000416_14287_15024 245
819 3300046537 Ga0495598_0041797 Ga0495598_0041797_20_757 245
820 3300046543 Ga0495645_0000096 Ga0495645_0000096_52489_53226 245
821 3300046543 Ga0495645_0029696 Ga0495645_0029696_2973_3710 245
822 3300046543 Ga0495645_0222999 Ga0495645_0222999_293_1081 245
823 3300046558 Ga0495633_0153902 Ga0495633_0153902_216_959 245
824 3300046559 Ga0495667_0002769 Ga0495667_0002769_6434_7171 245
825 3300046559 Ga0495667_0015879 Ga0495667_0015879_84_821 245
826 3300046616 Ga0495668_0080384 Ga0495668_0080384_191_928 245
827 3300046642 Ga0495634_0010792 Ga0495634_0010792_3271_4008 245
828 3300046642 Ga0495634_0022694 Ga0495634_0022694_1812_2549 245
829 3300046663 Ga0495635_0003733 Ga0495635_0003733_5017_5754 245
830 3300046663 Ga0495635_0017385 Ga0495635_0017385_3013_3924 245
831 3300046663 Ga0495635_0027019 Ga0495635_0027019_1562_2350 245
832 3300046664 Ga0495659_0056809 Ga0495659_0056809_28_765 245
833 3300046674 Ga0495588_0319217 Ga0495588_0319217_32_769 245
834 3300046675 Ga0495657_0000027 Ga0495657_0000027_69179_69916 245
835 3300046675 Ga0495657_0132396 Ga0495657_0132396_667_1404 245
836 3300046681 Ga0495647_0063423 Ga0495647_0063423_462_1199 245
837 3300046683 Ga0495658_0000356 Ga0495658_0000356_18336_19073 245
838 3300046689 Ga0495613_0006132 Ga0495613_0006132_3382_4119 245
839 3300046690 Ga0495624_0012550 Ga0495624_0012550_468_1205 245
840 3300046794 Ga0495589_0115699 Ga0495589_0115699_30_767 245
841 3300046809 Ga0495600_0008124 Ga0495600_0008124_5122_5859 245
842 3300046809 Ga0495600_0012918 Ga0495600_0012918_569_1306 245
843 3300047315 Ga0495581_0000589 Ga0495581_0000589_4636_5373 245
844 3300047315 Ga0495581_0008442 Ga0495581_0008442_3548_4285 245
845 3300047315 Ga0495581_0036720 Ga0495581_0036720_260_997 245
846 3300047315 Ga0495581_0057184 Ga0495581_0057184_1265_2002 245
847 3300047317 Ga0495604_0112987 Ga0495604_0112987_94_831 245
848 3300047319 Ga0495674_0003615 Ga0495674_0003615_6579_7316 245
849 3300047319 Ga0495674_0290143 Ga0495674_0290143_363_1100 245
850 3300047321 Ga0495676_0002194 Ga0495676_0002194_11379_12116 245
851 3300047321 Ga0495676_0066469 Ga0495676_0066469_449_1186 245
852 3300047321 Ga0495676_0076321 Ga0495676_0076321_128_865 245
853 3300047321 Ga0495676_0360213 Ga0495676_0360213_29_766 245
854 3300047321 Ga0495676_0384912 Ga0495676_0384912_67_879 245
855 3300047322 Ga0495680_0000298 Ga0495680_0000298_320_1057 245
856 3300047322 Ga0495680_0022784 Ga0495680_0022784_1099_1836 245
857 3300047322 Ga0495680_0035743 Ga0495680_0035743_1125_2036 245
858 3300047323 Ga0495683_0160497 Ga0495683_0160497_241_978 245
859 3300047445 Ga0495677_0048713 Ga0495677_0048713_626_1363 245
860 3300047445 Ga0495677_0158893 Ga0495677_0158893_124_861 245
861 3300047471 Ga0495684_0005161 Ga0495684_0005161_1612_2349 245
862 3300047471 Ga0495684_0020263 Ga0495684_0020263_1129_1917 245
863 3300047471 Ga0495684_0038293 Ga0495684_0038293_2287_3024 245
864 3300047673 Ga0495593_0015393 Ga0495593_0015393_1669_2457 245
865 3300048088 Ga0495602_0272617 Ga0495602_0272617_291_1028 245
866 3300048903 Ga0496100_0001935 Ga0496100_0001935_1541_2278 245
867 3300048903 Ga0496100_0003218 Ga0496100_0003218_1802_2539 245
868 3300048903 Ga0496100_0011017 Ga0496100_0011017_422_1159 245
869 3300048903 Ga0496100_0106640 Ga0496100_0106640_595_1332 245
870 3300048904 Ga0496101_0001199 Ga0496101_0001199_3569_4306 245
871 3300048904 Ga0496101_0017486 Ga0496101_0017486_2009_2746 245
872 3300048904 Ga0496101_0032607 Ga0496101_0032607_1634_2371 245
873 3300048904 Ga0496101_0044045 Ga0496101_0044045_706_1443 245
874 3300048904 Ga0496101_0206430 Ga0496101_0206430_76_813 245
875 3300048904 Ga0496101_0296791 Ga0496101_0296791_437_1174 245
876 3300048905 Ga0496102_0001299 Ga0496102_0001299_17649_18386 245
877 3300048905 Ga0496102_0016678 Ga0496102_0016678_2587_3324 245
878 3300048905 Ga0496102_0024499 Ga0496102_0024499_1456_2193 245
879 3300048905 Ga0496102_0075914 Ga0496102_0075914_306_1043 245
880 3300048905 Ga0496102_0095291 Ga0496102_0095291_613_1350 245
881 3300048905 Ga0496102_0331326 Ga0496102_0331326_672_1409 245
882 3300048906 Ga0496103_0003383 Ga0496103_0003383_7868_8605 245
883 3300048906 Ga0496103_0009549 Ga0496103_0009549_4879_5616 245
884 3300048906 Ga0496103_0086756 Ga0496103_0086756_490_1227 245
885 3300048906 Ga0496103_0129235 Ga0496103_0129235_834_1571 245
886 3300048907 Ga0496104_0004546 Ga0496104_0004546_465_1202 245
887 3300048907 Ga0496104_0023051 Ga0496104_0023051_3687_4424 245
888 3300048907 Ga0496104_0061270 Ga0496104_0061270_1765_2502 245
889 3300048907 Ga0496104_0096032 Ga0496104_0096032_1667_2404 245
890 3300048907 Ga0496104_0657938 Ga0496104_0657938_158_895 245
891 3300048908 Ga0496105_0001487 Ga0496105_0001487_8288_9025 245
892 3300048908 Ga0496105_0018157 Ga0496105_0018157_4572_5309 245
893 3300048908 Ga0496105_0026821 Ga0496105_0026821_3133_3870 245
894 3300048908 Ga0496105_0030322 Ga0496105_0030322_2308_3045 245
895 3300048908 Ga0496105_0067203 Ga0496105_0067203_1830_2567 245
896 3300048909 Ga0496106_0005675 Ga0496106_0005675_1538_2275 245
897 3300048909 Ga0496106_0011163 Ga0496106_0011163_2182_2919 245
898 3300048909 Ga0496106_0013211 Ga0496106_0013211_3854_4591 245
899 3300048909 Ga0496106_0027485 Ga0496106_0027485_1331_2068 245
900 3300048909 Ga0496106_0115149 Ga0496106_0115149_1058_1795 245
901 3300048910 Ga0496107_0000485 Ga0496107_0000485_7008_7745 245
902 3300048910 Ga0496107_0001899 Ga0496107_0001899_5923_6660 245
903 3300048910 Ga0496107_0007973 Ga0496107_0007973_4387_5124 245
904 3300048910 Ga0496107_0032609 Ga0496107_0032609_1286_2023 245
905 3300048910 Ga0496107_0089594 Ga0496107_0089594_896_1633 245
906 3300048910 Ga0496107_0106544 Ga0496107_0106544_747_1484 245
907 3300048910 Ga0496107_0454833 Ga0496107_0454833_57_827 245
908 3300048911 Ga0496108_0011737 Ga0496108_0011737_5580_6317 245
909 3300048911 Ga0496108_0016673 Ga0496108_0016673_4088_4825 245
910 3300048911 Ga0496108_0022806 Ga0496108_0022806_476_1246 245
911 3300048911 Ga0496108_0041409 Ga0496108_0041409_1672_2409 245
912 3300048911 Ga0496108_0139643 Ga0496108_0139643_1295_2032 245
913 3300048911 Ga0496108_0313015 Ga0496108_0313015_265_1002 245
914 3300048912 Ga0496109_0010750 Ga0496109_0010750_3102_3839 245
915 3300048912 Ga0496109_0122677 Ga0496109_0122677_1621_2358 245
916 3300048912 Ga0496109_0126669 Ga0496109_0126669_1214_1951 245
917 3300048912 Ga0496109_0280012 Ga0496109_0280012_619_1356 245
918 3300048913 Ga0496110_0002608 Ga0496110_0002608_9739_10476 245
919 3300048913 Ga0496110_0025927 Ga0496110_0025927_3952_4689 245
920 3300048913 Ga0496110_0110132 Ga0496110_0110132_45_782 245
921 3300048913 Ga0496110_0381875 Ga0496110_0381875_423_1193 245
922 3300048913 Ga0496110_0384778 Ga0496110_0384778_335_1072 245
923 3300048913 Ga0496110_0392222 Ga0496110_0392222_18_755 245
924 3300048914 Ga0496111_0033736 Ga0496111_0033736_1184_1921 245
925 3300048914 Ga0496111_0040587 Ga0496111_0040587_639_1376 245
926 3300048914 Ga0496111_0043975 Ga0496111_0043975_2230_2967 245
927 3300048914 Ga0496111_0248188 Ga0496111_0248188_268_1005 245
928 3300048914 Ga0496111_0562335 Ga0496111_0562335_16_753 245
929 3300048915 Ga0496112_0009522 Ga0496112_0009522_6194_6931 245
930 3300048915 Ga0496112_0025748 Ga0496112_0025748_1846_2583 245
931 3300048915 Ga0496112_0025813 Ga0496112_0025813_1067_1804 245
932 3300048915 Ga0496112_0157698 Ga0496112_0157698_559_1296 245
933 3300048915 Ga0496112_0237441 Ga0496112_0237441_352_1089 245
934 3300048915 Ga0496112_0330562 Ga0496112_0330562_570_1307 245
935 3300048915 Ga0496112_0710478 Ga0496112_0710478_132_869 245
936 3300048916 Ga0496113_0001704 Ga0496113_0001704_1229_1966 245
937 3300048916 Ga0496113_0119418 Ga0496113_0119418_743_1513 245
938 3300048916 Ga0496113_0207704 Ga0496113_0207704_570_1307 245
939 3300048917 Ga0496114_0005633 Ga0496114_0005633_8052_8789 245
940 3300048917 Ga0496114_0014359 Ga0496114_0014359_1716_2453 245
941 3300048917 Ga0496114_0027734 Ga0496114_0027734_649_1386 245
942 3300048917 Ga0496114_0133208 Ga0496114_0133208_696_1433 245
943 3300048918 Ga0496115_0008007 Ga0496115_0008007_3020_3757 245
944 3300048918 Ga0496115_0008263 Ga0496115_0008263_5754_6491 245
945 3300048918 Ga0496115_0018578 Ga0496115_0018578_2517_3254 245
946 3300048918 Ga0496115_0019021 Ga0496115_0019021_1534_2271 245
947 3300048918 Ga0496115_0030001 Ga0496115_0030001_299_1036 245
948 3300048918 Ga0496115_0048580 Ga0496115_0048580_1537_2274 245
949 3300048918 Ga0496115_0269215 Ga0496115_0269215_159_896 245
950 3300048918 Ga0496115_0604794 Ga0496115_0604794_27_839 245
951 3300049576 Ga0501040_0483549 Ga0501040_0483549_133_870 245
952 3300049583 Ga0501067_0013055 Ga0501067_0013055_1360_2097 245
953 3300049583 Ga0501067_0020211 Ga0501067_0020211_2646_3383 245
954 3300049583 Ga0501067_0072306 Ga0501067_0072306_400_1137 245
955 3300049584 Ga0501068_0335852 Ga0501068_0335852_161_898 245
956 3300049585 Ga0501069_0045395 Ga0501069_0045395_737_1474 245
957 3300049585 Ga0501069_0121306 Ga0501069_0121306_625_1362 245
958 3300049587 Ga0501071_0162630 Ga0501071_0162630_157_897 245
959 3300049592 Ga0501076_0063794 Ga0501076_0063794_838_1575 245
960 3300049656 Ga0501209_082374 Ga0501209_082374_112_855 245
961 3300049660 Ga0501216_039765 Ga0501216_039765_66_806 245
962 3300050491 nmdc:mga00v17_13500_c1 nmdc:mga00v17_13500_c1_728_1498 245
963 3300050491 nmdc:mga00v17_146630_c1 nmdc:mga00v17_146630_c1_534_1274 245
964 3300050491 nmdc:mga00v17_55987_c1 nmdc:mga00v17_55987_c1_278_1015 245
965 3300050492 nmdc:mga0yw44_116985_c1 nmdc:mga0yw44_116985_c1_921_1658 245
966 3300050492 nmdc:mga0yw44_164311_c1 nmdc:mga0yw44_164311_c1_256_996 245
967 3300050492 nmdc:mga0yw44_181783_c1 nmdc:mga0yw44_181783_c1_620_1357 245
968 3300050492 nmdc:mga0yw44_30517_c1 nmdc:mga0yw44_30517_c1_1521_2258 245
969 3300050492 nmdc:mga0yw44_51598_c1 nmdc:mga0yw44_51598_c1_756_1526 245
970 3300050494 nmdc:mga06z11_131671_c1 nmdc:mga06z11_131671_c1_656_1393 245
971 3300050494 nmdc:mga06z11_46860_c1 nmdc:mga06z11_46860_c1_240_1010 245
972 3300050495 nmdc:mga04h51_15383_c1 nmdc:mga04h51_15383_c1_1112_1849 245
973 3300050507 nmdc:mga05p37_154102_c1 nmdc:mga05p37_154102_c1_1962_2699 245
974 3300050507 nmdc:mga05p37_176431_c1 nmdc:mga05p37_176431_c1_1094_1831 245
975 3300050507 nmdc:mga05p37_209249_c1 nmdc:mga05p37_209249_c1_64_801 245
976 3300050507 nmdc:mga05p37_289704_c1 nmdc:mga05p37_289704_c1_723_1460 245
977 3300050507 nmdc:mga05p37_292223_c1 nmdc:mga05p37_292223_c1_47_784 245
978 3300050507 nmdc:mga05p37_300929_c1 nmdc:mga05p37_300929_c1_566_1303 245
979 3300050507 nmdc:mga05p37_43955_c1 nmdc:mga05p37_43955_c1_4345_5082 245
980 3300050507 nmdc:mga05p37_54415_c1 nmdc:mga05p37_54415_c1_1440_2177 245
981 3300050507 nmdc:mga05p37_58954_c1 nmdc:mga05p37_58954_c1_156_965 245
982 3300050507 nmdc:mga05p37_66039_c1 nmdc:mga05p37_66039_c1_740_1477 245
983 3300050507 nmdc:mga05p37_84117_c1 nmdc:mga05p37_84117_c1_1138_1875 245
984 3300050507 nmdc:mga05p37_886432_c1 nmdc:mga05p37_886432_c1_65_805 245
985 3300050507 nmdc:mga05p37_9555_c1 nmdc:mga05p37_9555_c1_7212_7949 245
986 3300050508 nmdc:mga09592_145650_c1 nmdc:mga09592_145650_c1_547_1284 245
987 3300050508 nmdc:mga09592_478220_c1 nmdc:mga09592_478220_c1_38_778 245
988 3300050509 nmdc:mga0qj67_212160_c1 nmdc:mga0qj67_212160_c1_376_1113 245
989 3300050509 nmdc:mga0qj67_27476_c1 nmdc:mga0qj67_27476_c1_2554_3294 245
990 3300050509 nmdc:mga0qj67_73309_c1 nmdc:mga0qj67_73309_c1_1179_1916 245
991 3300050510 nmdc:mga06r32_12571_c1 nmdc:mga06r32_12571_c1_5022_5759 245
992 3300050510 nmdc:mga06r32_19742_c1 nmdc:mga06r32_19742_c1_4466_5206 245
993 3300050510 nmdc:mga06r32_358663_c1 nmdc:mga06r32_358663_c1_313_1050 245
994 3300050510 nmdc:mga06r32_64436_c2 nmdc:mga06r32_64436_c2_1522_2259 245
995 3300050510 nmdc:mga06r32_78823_c1 nmdc:mga06r32_78823_c1_1792_2574 245
996 3300050511 nmdc:mga08y16_221394_c1 nmdc:mga08y16_221394_c1_74_844 245
997 3300050511 nmdc:mga08y16_46471_c1 nmdc:mga08y16_46471_c1_3501_4241 245
998 3300050511 nmdc:mga08y16_587600_c1 nmdc:mga08y16_587600_c1_312_1049 245
999 3300050511 nmdc:mga08y16_64633_c1 nmdc:mga08y16_64633_c1_33_770 245
1000 3300050511 nmdc:mga08y16_783687_c1 nmdc:mga08y16_783687_c1_135_872 245
1001 3300050511 nmdc:mga08y16_8878_c1 nmdc:mga08y16_8878_c1_9105_9914 245
1002 3300050512 nmdc:mga0n895_106274_c1 nmdc:mga0n895_106274_c1_748_1485 245
1003 3300050512 nmdc:mga0n895_134372_c1 nmdc:mga0n895_134372_c1_336_1073 245
1004 3300050512 nmdc:mga0n895_271288_c1 nmdc:mga0n895_271288_c1_263_1000 245
1005 3300050512 nmdc:mga0n895_316404_c1 nmdc:mga0n895_316404_c1_72_809 245
1006 3300050512 nmdc:mga0n895_425375_c1 nmdc:mga0n895_425375_c1_286_1023 245
1007 3300050512 nmdc:mga0n895_432283_c1 nmdc:mga0n895_432283_c1_179_916 245
1008 3300050512 nmdc:mga0n895_641836_c1 nmdc:mga0n895_641836_c1_229_966 245
1009 3300050512 nmdc:mga0n895_6827_c1 nmdc:mga0n895_6827_c1_3734_4471 245
1010 3300050512 nmdc:mga0n895_87870_c1 nmdc:mga0n895_87870_c1_1611_2348 245
1011 3300050513 nmdc:mga0rr50_159551_c1 nmdc:mga0rr50_159551_c1_886_1623 245
1012 3300050513 nmdc:mga0rr50_15994_c1 nmdc:mga0rr50_15994_c1_1579_2316 245
1013 3300050513 nmdc:mga0rr50_17058_c1 nmdc:mga0rr50_17058_c1_1495_2232 245
1014 3300050513 nmdc:mga0rr50_173052_c1 nmdc:mga0rr50_173052_c1_883_1620 245
1015 3300050513 nmdc:mga0rr50_270156_c1 nmdc:mga0rr50_270156_c1_27_764 245
1016 3300050513 nmdc:mga0rr50_324426_c1 nmdc:mga0rr50_324426_c1_37_774 245
1017 3300050513 nmdc:mga0rr50_60199_c1 nmdc:mga0rr50_60199_c1_810_1547 245
1018 3300050514 nmdc:mga08x19_104241_c1 nmdc:mga08x19_104241_c1_624_1361 245
1019 3300050514 nmdc:mga08x19_259661_c1 nmdc:mga08x19_259661_c1_48_785 245
1020 3300050514 nmdc:mga08x19_59250_c1 nmdc:mga08x19_59250_c1_691_1428 245
1021 3300050514 nmdc:mga08x19_5982_c1 nmdc:mga08x19_5982_c1_2171_2908 245
1022 3300050515 nmdc:mga0a205_152148_c1 nmdc:mga0a205_152148_c1_873_1610 245
1023 3300050515 nmdc:mga0a205_157349_c1 nmdc:mga0a205_157349_c1_878_1615 245
1024 3300050515 nmdc:mga0a205_212542_c1 nmdc:mga0a205_212542_c1_394_1131 245
1025 3300050515 nmdc:mga0a205_278056_c1 nmdc:mga0a205_278056_c1_523_1272 245
1026 3300050515 nmdc:mga0a205_33881_c1 nmdc:mga0a205_33881_c1_3353_4090 245
1027 3300050515 nmdc:mga0a205_37515_c1 nmdc:mga0a205_37515_c1_3371_4111 245
1028 3300050515 nmdc:mga0a205_3829_c1 nmdc:mga0a205_3829_c1_11010_11747 245
1029 3300050515 nmdc:mga0a205_730752_c1 nmdc:mga0a205_730752_c1_67_804 245
1030 3300050515 nmdc:mga0a205_77257_c1 nmdc:mga0a205_77257_c1_318_1058 245
1031 3300053077 Ga0495601_0000244 Ga0495601_0000244_3474_4211 245
1032 3300053077 Ga0495601_0099836 Ga0495601_0099836_941_1678 245
1033 3300053078 Ga0495612_0000024 Ga0495612_0000024_32631_33374 245
1034 3300053083 Ga0495655_0056459 Ga0495655_0056459_217_969 245
1035 3300053084 Ga0495595_0112753 Ga0495595_0112753_178_915 245
1036 3300053085 Ga0495619_0169104 Ga0495619_0169104_708_1496 245
1037 3300061719 Ga0466962_0009567 Ga0466962_0009567_2453_3190 245
1038 3300061719 Ga0466962_0013330 Ga0466962_0013330_2547_3293 245
1039 3300061719 Ga0466962_0058285 Ga0466962_0058285_42_779 245
1040 3300061719 Ga0466962_0116512 Ga0466962_0116512_382_1128 245

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05988

DUF899

Bacterial protein of unknown function (DUF899)

4

247

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ixr-assembly1.cif.gz_A crystal structure of xylella fastidiosa prxq c47s mutant 0.7664 49 226
1xqs-assembly2.cif.gz_D crystal structure of the hspbp1 core domain complexed with the fragment of hsp70 atpase domain 0.7501 190 210
4eo3-assembly1.cif.gz_B peroxiredoxin nitroreductase fusion enzyme 0.7437 43 226
5io2-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c48s mutant 0.7322 50 210
5iph-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c84s mutant 0.7321 50 210
ID Description Score Start End Superfamily
af_P0AE52_4_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.81 40 150 3.40.30.10
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7936 47 211 3.40.30.10
af_Q0D5G1_11_348_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7682 190 213 2.130.10.10
af_Q24JW8_19_118_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7507 189 210 2.60.40.10
af_Q54W30_4_152_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7453 40 226 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A536JEW5-F1-model_v4 DUF899 domain-containing protein 0.9838 40 245
AF-A0A536CKR3-F1-model_v4 DUF899 domain-containing protein 0.9833 1 245
AF-A0A538LY14-F1-model_v4 DUF899 domain-containing protein 0.9828 1 245
AF-A0A538JEK0-F1-model_v4 DUF899 domain-containing protein 0.9817 1 245
AF-A0A536JEW5-F1-model_v4 DUF899 domain-containing protein 0.9791 40 245

Feature Viewer

pLDDT pTM Quality
95.16 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map