F488725

General Info

Members Datasets Scaffolds Average Seq Length
1036 446 988 164

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0171810|Ga0466969_0171810_378_950
Length 190
Sequence MLRHVIALPLANCTERSILQPMFEIKASNNASKREQYADLVEQARGMLAGEPSLIANAANFAALVFHSLPDFNWAGFYLYDGKELVVGPFQGKPACIRIAIGRGVCGTAAQTRQTQVVRDVNAFDGHIACDAASQSEIVVPLVKADGTLLGVWDVDSPLVGRFDEEDRAGMEALCAVFMEAVGVGWVSAA

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
5 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
6 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
7 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
8 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
9 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
10 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
11 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
12 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
13 2519103095 Burkholderia sp. KJ006 Isolate Nodule
14 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
15 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
16 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
17 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
18 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
19 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
20 2734482264 Dyella sp. AD052 Isolate Unclassified
21 2738543009 Luteibacter sp. OK325 Isolate Unclassified
22 2739367700 Dyella sp. YR388 Isolate Unclassified
23 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
24 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
25 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
26 2818991450 Burkholderia sp. 604 Isolate Unclassified
27 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
28 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
29 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
30 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
31 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
32 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
33 2884411467 Dyella sp. AD56 Isolate Rhizosphere
34 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
35 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
36 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
37 2919404418 Luteibacter sp. 3190 Isolate Unclassified
38 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
39 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
40 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
41 2928963466 Dyella japonica 1073 Isolate Unclassified
42 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
43 2941471342 Luteibacter sp. 621 Isolate Unclassified
44 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
45 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
46 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
47 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
48 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
49 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
50 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
51 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
52 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
53 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
54 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
55 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
56 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
57 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
58 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
59 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
60 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
61 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
62 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
63 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
64 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
65 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
66 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
67 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
68 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
69 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
70 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
71 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
72 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
73 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
74 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
75 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
76 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
77 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
78 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
79 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
80 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
81 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
82 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
83 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
84 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
85 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
86 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
87 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
88 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
89 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
90 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
91 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
92 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
93 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
94 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
95 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
96 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
97 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
98 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
99 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
100 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
101 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
102 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
103 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
104 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
105 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
106 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
107 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
108 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
109 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
110 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
111 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
112 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
113 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
114 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
115 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
116 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
117 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
118 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
119 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
120 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
121 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
122 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
123 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
124 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
125 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
126 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
127 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
128 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
129 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
130 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
131 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
132 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
133 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
134 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
135 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
136 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
137 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
138 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
139 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
140 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
141 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
142 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
143 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
144 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
145 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
146 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
147 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
148 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
149 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
150 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
151 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
152 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
153 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
154 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
155 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
156 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
157 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
158 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
159 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
160 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
161 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
162 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
163 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
164 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
165 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
166 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
167 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
168 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
169 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
170 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
171 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
172 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
173 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
174 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
175 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
176 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
177 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
178 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
179 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
180 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
181 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
182 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
183 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
184 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
190 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
191 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
193 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
194 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
197 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
198 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
199 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
200 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
202 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
203 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
204 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
205 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
206 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
207 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
256 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
260 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
261 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
262 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
263 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
264 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
265 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
266 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
267 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
268 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
269 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
270 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
271 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
272 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
273 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
274 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
275 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
276 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
277 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
278 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
279 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
280 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
281 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
282 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
283 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
284 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
285 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
286 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
287 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
288 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
289 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
290 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
291 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
292 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
293 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
294 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
295 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
296 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
297 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
298 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
299 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
300 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
301 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
302 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
303 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
304 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
305 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
306 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
307 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
308 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
309 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
310 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
311 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
312 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
313 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
314 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
315 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
316 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
317 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
318 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
319 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
320 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
321 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
322 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
323 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
324 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
325 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
326 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
327 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
328 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
329 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
330 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
331 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
332 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
333 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
334 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
335 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
336 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
337 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
338 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
339 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
340 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
341 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
342 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
343 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
344 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
345 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
346 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
347 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
348 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
349 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
350 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
351 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
352 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
353 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
354 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
355 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
356 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
357 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
358 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
359 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
360 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
361 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
362 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
363 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
364 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
365 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
366 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
367 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
368 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
369 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
370 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
371 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
372 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
373 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
374 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
375 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
376 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
377 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
378 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
379 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
380 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
381 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
382 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
383 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
384 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
385 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
386 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
387 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
388 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
389 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
390 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
391 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
392 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
393 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
394 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
395 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
400 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
405 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
406 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
408 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
410 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
411 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
412 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
413 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
414 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
415 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
416 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
417 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
418 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
419 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
420 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
421 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
422 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
423 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
424 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
427 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
428 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
429 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
430 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
431 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
432 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
433 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
434 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
435 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
436 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
437 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
438 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
439 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
440 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
441 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
442 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
443 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
444 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
445 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
446 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.79
Metatranscriptomes 0.58
Isolates 4.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.85
Nodule 0.87
Rhizoplane 2.99
Rhizosphere 75.97
Stem 0
Stem Tuber 0
Unclassified 10.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1008608 3300001904 Bacteria 1694
2 JGI24739J22299_10001810 3300001989 Bacteria 8145
3 JGI24737J22298_10001918 3300001990 Bacteria 7434
4 JGI24737J22298_10179732 3300001990 Bacteria 624
5 JGI24735J21928_10002849 3300002067 Bacteria 5964
6 JGI24735J21928_10007156 3300002067 Bacteria 3642
7 JGI24735J21928_10045229 3300002067 Bacteria 1279
8 JGI24738J21930_10045317 3300002075 Bacteria 894
9 JGI25156J39149_1001007 3300002705 Bacteria 13267
10 JGI25156J39149_1006545 3300002705 Bacteria 3168
11 JGI25162J39368_1000538 3300002737 Bacteria 28189
12 JGI25162J39368_1001470 3300002737 Bacteria 12379
13 JGI25154J39366_1006550 3300002738 Bacteria 1689
14 JGI25157J39369_1000731 3300002741 Bacteria 17502
15 JGI25157J39369_1001489 3300002741 Bacteria 8621
16 JGI25164J39214_1000064 3300002772 Bacteria 107073
17 JGI25165J46597_1000278 3300003214 Bacteria 65807
18 rootH1_10022311 3300003316 Bacteria 6739
19 rootH2_10000507 3300003320 Bacteria 26810
20 rootH2_10053565 3300003320 Bacteria 3133
21 rootH1_10116952 3300003323 Bacteria 1231
22 rootH1_10139123 3300003323 Bacteria 4538
23 Ga0006562J51391_1027929 3300003578 Bacteria 3800
24 Ga0006562J51391_1027930 3300003578 Bacteria 3120
25 Ga0006562J51391_1033987 3300003578 Bacteria 5860
26 Ga0006562J51391_1033988 3300003578 Bacteria 11310
27 Ga0055539_1001315 3300003752 Bacteria 4829
28 Ga0055533_1000716 3300003756 Bacteria 10802
29 Ga0055533_1001494 3300003756 Bacteria 6137
30 Ga0055525_1000043 3300003759 Bacteria 268656
31 Ga0055527_1000028 3300003760 Bacteria 172877
32 Ga0055527_1000068 3300003760 Bacteria 87357
33 Ga0055527_1002157 3300003760 Bacteria 3494
34 Ga0055535_1000081 3300003761 Bacteria 107148
35 Ga0055535_1000090 3300003761 Bacteria 102120
36 Ga0055535_1000351 3300003761 Bacteria 45382
37 Ga0055535_1000368 3300003761 Bacteria 43481
38 Ga0055535_1008265 3300003761 Bacteria 1896
39 Ga0055542_1000053 3300003762 Bacteria 172877
40 Ga0055542_1000093 3300003762 Bacteria 120262
41 Ga0055542_1000113 3300003762 Bacteria 107148
42 Ga0055542_1000417 3300003762 Bacteria 41501
43 Ga0055542_1000450 3300003762 Bacteria 39041
44 Ga0055529_1000104 3300003763 Bacteria 126692
45 Ga0055529_1000281 3300003763 Bacteria 60403
46 Ga0055529_1000312 3300003763 Bacteria 55812
47 Ga0055526_1017184 3300003771 Bacteria 2781
48 Ga0055524_1000715 3300003775 Bacteria 22817
49 Ga0055534_1001790 3300003784 Bacteria 8087
50 Ga0065704_10126300 3300005289 Bacteria 1691
51 Ga0065712_10073660 3300005290 Bacteria 4317
52 Ga0065715_10046227 3300005293 Bacteria 1216
53 Ga0065707_10082887 3300005295 Bacteria 11574
54 Ga0070658_10004443 3300005327 Bacteria 11421
55 Ga0070658_10009305 3300005327 Bacteria 7902
56 Ga0070658_10056502 3300005327 Bacteria 3190
57 Ga0070658_10573874 3300005327 Bacteria 977
58 Ga0070683_100182540 3300005329 Bacteria 1992
59 Ga0070670_100097839 3300005331 Bacteria 2525
60 Ga0070670_101469491 3300005331 Bacteria 625
61 Ga0070666_10000001 3300005335 Bacteria 543080
62 Ga0070666_10028903 3300005335 Bacteria 3641
63 Ga0070680_100044803 3300005336 Bacteria 3595
64 Ga0070682_100015838 3300005337 Bacteria 4375
65 Ga0068868_100157861 3300005338 Bacteria 1871
66 Ga0068868_100290290 3300005338 Bacteria 1386
67 Ga0070660_100000996 3300005339 Bacteria 19003
68 Ga0070660_100017448 3300005339 Bacteria 5232
69 Ga0070660_100036930 3300005339 Bacteria 3702
70 Ga0070660_100924514 3300005339 Bacteria 736
71 Ga0070689_100007728 3300005340 Bacteria 7533
72 Ga0070689_100012897 3300005340 Bacteria 6034
73 Ga0070691_10000185 3300005341 Bacteria 20700
74 Ga0070691_10000527 3300005341 Bacteria 14442
75 Ga0070687_100220036 3300005343 Bacteria 1162
76 Ga0070687_100504210 3300005343 Bacteria 815
77 Ga0070661_100079076 3300005344 Bacteria 2426
78 Ga0070661_100103377 3300005344 Bacteria 2121
79 Ga0070661_100663045 3300005344 Bacteria 848
80 Ga0070661_101081743 3300005344 Bacteria 668
81 Ga0070661_101243723 3300005344 Bacteria 623
82 Ga0070692_10108345 3300005345 Bacteria 1533
83 Ga0070668_100022772 3300005347 Bacteria 4736
84 Ga0070668_100160832 3300005347 Bacteria 1822
85 Ga0070668_100288542 3300005347 Bacteria 1373
86 Ga0070668_101662633 3300005347 Bacteria 586
87 Ga0070675_100006757 3300005354 Bacteria 8815
88 Ga0070675_100167512 3300005354 Bacteria 1893
89 Ga0070671_100002542 3300005355 Bacteria 14135
90 Ga0070671_100153698 3300005355 Bacteria 1943
91 Ga0070671_100184508 3300005355 Bacteria 1767
92 Ga0070673_100340416 3300005364 Bacteria 1329
93 Ga0070673_100562856 3300005364 Bacteria 1037
94 Ga0070688_100013718 3300005365 Bacteria 4578
95 Ga0070688_100433004 3300005365 Bacteria 980
96 Ga0070659_100005242 3300005366 Bacteria 9297
97 Ga0070659_100010709 3300005366 Bacteria 6757
98 Ga0070659_100029016 3300005366 Bacteria 4275
99 Ga0070667_100021861 3300005367 Bacteria 5309
100 Ga0070667_100031347 3300005367 Bacteria 4433
101 Ga0070667_100148699 3300005367 Bacteria 2056
102 Ga0070667_100382788 3300005367 Bacteria 1278
103 Ga0070709_10002174 3300005434 Bacteria 10614
104 Ga0070709_10143710 3300005434 Bacteria 1642
105 Ga0070714_100172444 3300005435 Bacteria 1964
106 Ga0070714_100389172 3300005435 Bacteria 1316
107 Ga0070713_100000141 3300005436 Bacteria 47574
108 Ga0070713_100613007 3300005436 Bacteria 1035
109 Ga0070711_100040650 3300005439 Bacteria 3137
110 Ga0070705_100455529 3300005440 Bacteria 961
111 Ga0070694_100183911 3300005444 Bacteria 1547
112 Ga0070694_100840581 3300005444 Bacteria 755
113 Ga0070694_101020317 3300005444 Bacteria 687
114 Ga0070663_100021903 3300005455 Bacteria 4260
115 Ga0070663_100068878 3300005455 Bacteria 2569
116 Ga0070663_100153281 3300005455 Bacteria 1769
117 Ga0070663_100193484 3300005455 Bacteria 1584
118 Ga0070663_100227861 3300005455 Bacteria 1466
119 Ga0070663_100273696 3300005455 Bacteria 1343
120 Ga0070662_100152837 3300005457 Bacteria 1799
121 Ga0070681_10000073 3300005458 Bacteria 74242
122 Ga0070681_10012053 3300005458 Bacteria 8575
123 Ga0070681_10048156 3300005458 Bacteria 4260
124 Ga0070681_10055196 3300005458 Bacteria 3956
125 Ga0068867_100055314 3300005459 Bacteria 2934
126 Ga0070685_10799127 3300005466 Bacteria 695
127 Ga0070707_100756693 3300005468 Bacteria 935
128 Ga0070679_100082982 3300005530 Bacteria 3194
129 Ga0070679_100224206 3300005530 Bacteria 1840
130 Ga0070679_100672414 3300005530 Bacteria 978
131 Ga0070684_100099768 3300005535 Bacteria 2592
132 Ga0070684_100513698 3300005535 Bacteria 1110
133 Ga0068853_100006034 3300005539 Bacteria 9584
134 Ga0068853_100047768 3300005539 Bacteria 3674
135 Ga0068853_100119917 3300005539 Bacteria 2345
136 Ga0068853_100201062 3300005539 Bacteria 1813
137 Ga0068853_100558899 3300005539 Bacteria 1085
138 Ga0068853_100733854 3300005539 Bacteria 943
139 Ga0070695_100005528 3300005545 Bacteria 7442
140 Ga0070695_100518582 3300005545 Bacteria 924
141 Ga0070696_100095010 3300005546 Bacteria 2128
142 Ga0070696_100379146 3300005546 Bacteria 1102
143 Ga0070693_100002643 3300005547 Bacteria 8249
144 Ga0070693_100030504 3300005547 Bacteria 2947
145 Ga0070693_100075066 3300005547 Bacteria 2001
146 Ga0070665_100077205 3300005548 Bacteria 3337
147 Ga0070665_100081831 3300005548 Bacteria 3234
148 Ga0070665_100141214 3300005548 Bacteria 2411
149 Ga0070704_100145588 3300005549 Bacteria 1856
150 Ga0068855_100007063 3300005563 Bacteria 13618
151 Ga0068855_100021852 3300005563 Bacteria 7672
152 Ga0068855_100041946 3300005563 Bacteria 5422
153 Ga0068855_100060941 3300005563 Bacteria 4409
154 Ga0068855_100089822 3300005563 Bacteria 3546
155 Ga0068855_100117653 3300005563 Bacteria 3044
156 Ga0068855_100184728 3300005563 Bacteria 2355
157 Ga0068855_100201748 3300005563 Bacteria 2239
158 Ga0068855_100954548 3300005563 Bacteria 903
159 Ga0068855_100982820 3300005563 Bacteria 888
160 Ga0070664_100160545 3300005564 Bacteria 1989
161 Ga0068857_100002119 3300005577 Bacteria 16141
162 Ga0068857_100025014 3300005577 Bacteria 5259
163 Ga0068857_100033922 3300005577 Bacteria 4515
164 Ga0068857_100107679 3300005577 Bacteria 2504
165 Ga0068857_100158849 3300005577 Bacteria 2051
166 Ga0068854_100000943 3300005578 Bacteria 17491
167 Ga0068854_100015417 3300005578 Bacteria 5062
168 Ga0068854_100027117 3300005578 Bacteria 3946
169 Ga0068854_100055930 3300005578 Bacteria 2843
170 Ga0068854_100097432 3300005578 Bacteria 2199
171 Ga0068854_102061983 3300005578 Bacteria 526
172 Ga0068856_100000207 3300005614 Bacteria 63158
173 Ga0068856_100000601 3300005614 Bacteria 39402
174 Ga0068856_100001988 3300005614 Bacteria 21316
175 Ga0068856_100002737 3300005614 Bacteria 18051
176 Ga0068856_100068183 3300005614 Bacteria 3516
177 Ga0068856_100393266 3300005614 Bacteria 1406
178 Ga0068856_100721415 3300005614 Bacteria 1017
179 Ga0068852_100007350 3300005616 Bacteria 8036
180 Ga0068852_100015672 3300005616 Bacteria 5888
181 Ga0068852_100143084 3300005616 Bacteria 2215
182 Ga0068859_100457976 3300005617 Bacteria 1371
183 Ga0068864_100184874 3300005618 Bacteria 1907
184 Ga0068864_100650261 3300005618 Bacteria 1027
185 Ga0068866_10402514 3300005718 Bacteria 883
186 Ga0068861_100004302 3300005719 Bacteria 9551
187 Ga0068851_10172710 3300005834 Bacteria 1193
188 Ga0068851_10184633 3300005834 Bacteria 1156
189 Ga0068863_100638734 3300005841 Bacteria 1055
190 Ga0068863_102264099 3300005841 Bacteria 553
191 Ga0068858_100057882 3300005842 Bacteria 3582
192 Ga0068858_100108013 3300005842 Bacteria 2598
193 Ga0068858_100141583 3300005842 Bacteria 2258
194 Ga0068858_100171745 3300005842 Bacteria 2044
195 Ga0068858_100402966 3300005842 Bacteria 1314
196 Ga0068860_100017690 3300005843 Bacteria 6943
197 Ga0068860_100652674 3300005843 Bacteria 1060
198 Ga0070717_10307105 3300006028 Bacteria 1411
199 Ga0075365_10275431 3300006038 Bacteria 1184
200 Ga0075368_10139733 3300006042 Bacteria 1009
201 Ga0075363_100278658 3300006048 Bacteria 967
202 Ga0075364_10081975 3300006051 Bacteria 2134
203 Ga0075364_10086286 3300006051 Bacteria 2079
204 Ga0070716_100118647 3300006173 Bacteria 1652
205 Ga0070716_100126527 3300006173 Bacteria 1608
206 Ga0070712_100000023 3300006175 Bacteria 80972
207 Ga0070712_100000260 3300006175 Bacteria 29575
208 Ga0075362_10229580 3300006177 Bacteria 909
209 Ga0075367_10112841 3300006178 Bacteria 1670
210 Ga0075367_10324976 3300006178 Bacteria 970
211 Ga0075369_10012978 3300006186 Bacteria 3297
212 Ga0075366_10010093 3300006195 Bacteria 5292
213 Ga0097621_100029484 3300006237 Bacteria 4334
214 Ga0097621_100769244 3300006237 Unclassified 890
215 Ga0097621_100989596 3300006237 Bacteria 786
216 Ga0068871_100106078 3300006358 Bacteria 2358
217 Ga0068871_100136919 3300006358 Bacteria 2080
218 Ga0068871_100346626 3300006358 Bacteria 1313
219 Ga0068871_100742322 3300006358 Bacteria 902
220 Ga0075430_100034074 3300006846 Bacteria 4321
221 Ga0075434_100181992 3300006871 Bacteria 2122
222 Ga0075434_101450578 3300006871 Bacteria 696
223 Ga0068865_100031222 3300006881 Bacteria 3551
224 Ga0068865_100450875 3300006881 Unclassified 1063
225 Ga0075436_100000211 3300006914 Bacteria 36106
226 Ga0075436_100001356 3300006914 Bacteria 16647
227 Ga0097620_100457962 3300006931 Bacteria 1371
228 Ga0075435_100027464 3300007076 Bacteria 4453
229 Ga0075435_100890519 3300007076 Bacteria 776
230 Ga0075435_101485324 3300007076 Bacteria 594
231 Ga0105251_10000166 3300009011 Bacteria 67845
232 Ga0105240_10003992 3300009093 Bacteria 22736
233 Ga0105240_10007148 3300009093 Bacteria 16262
234 Ga0105240_10007501 3300009093 Bacteria 15829
235 Ga0105240_10013903 3300009093 Bacteria 11019
236 Ga0105240_10018515 3300009093 Bacteria 9349
237 Ga0105245_10808944 3300009098 Bacteria 975
238 Ga0105245_11174931 3300009098 Bacteria 815
239 Ga0105245_11814928 3300009098 Bacteria 663
240 Ga0105245_12143627 3300009098 Bacteria 613
241 Ga0105247_10012698 3300009101 Bacteria 5054
242 Ga0105243_10952536 3300009148 Bacteria 858
243 Ga0105241_10013790 3300009174 Bacteria 5920
244 Ga0105241_10128958 3300009174 Bacteria 2045
245 Ga0105241_10155939 3300009174 Bacteria 1872
246 Ga0105241_10237112 3300009174 Bacteria 1540
247 Ga0105241_10429916 3300009174 Bacteria 1164
248 Ga0105241_11177058 3300009174 Bacteria 725
249 Ga0105242_10009594 3300009176 Bacteria 7418
250 Ga0105248_10012144 3300009177 Bacteria 9501
251 Ga0105248_10044017 3300009177 Bacteria 5007
252 Ga0105237_10000022 3300009545 Bacteria 228427
253 Ga0105237_10008165 3300009545 Bacteria 11370
254 Ga0105237_11249219 3300009545 Bacteria 749
255 Ga0105238_10001476 3300009551 Bacteria 23610
256 Ga0105238_10004707 3300009551 Bacteria 13487
257 Ga0105238_10056363 3300009551 Bacteria 3943
258 Ga0105238_10061673 3300009551 Bacteria 3751
259 Ga0105238_10067278 3300009551 Bacteria 3584
260 Ga0105238_10073952 3300009551 Unclassified 3402
261 Ga0105238_10080064 3300009551 Bacteria 3256
262 Ga0105238_10182997 3300009551 Bacteria 2072
263 Ga0105238_10806858 3300009551 Bacteria 954
264 Ga0105238_11226149 3300009551 Bacteria 775
265 Ga0105249_10205327 3300009553 Bacteria 1930
266 Ga0105249_11107020 3300009553 Bacteria 862
267 Ga0105147_101012 3300009982 Bacteria 2244
268 Ga0105239_10000480 3300010375 Bacteria 58268
269 Ga0105239_10010740 3300010375 Bacteria 10229
270 Ga0105239_10044538 3300010375 Bacteria 4864
271 Ga0105239_10347138 3300010375 Bacteria 1675
272 Ga0105239_10902952 3300010375 Bacteria 1014
273 Ga0105246_10410841 3300011119 Bacteria 1127
274 Ga0157314_1000016 3300012500 Bacteria 16679
275 Ga0157347_1001364 3300012502 Bacteria 1897
276 Ga0157373_10001427 3300013100 Bacteria 18228
277 Ga0157373_10009142 3300013100 Bacteria 7328
278 Ga0157373_10025784 3300013100 Bacteria 4249
279 Ga0157373_10451038 3300013100 Bacteria 925
280 Ga0157373_10724601 3300013100 Bacteria 730
281 Ga0157371_10000949 3300013102 Bacteria 32394
282 Ga0157371_10021378 3300013102 Bacteria 4751
283 Ga0157371_10131813 3300013102 Bacteria 1779
284 Ga0157370_10002571 3300013104 Bacteria 21783
285 Ga0157370_10003277 3300013104 Bacteria 19077
286 Ga0157370_10004924 3300013104 Bacteria 15119
287 Ga0157370_10032119 3300013104 Bacteria 5129
288 Ga0157370_10040527 3300013104 Bacteria 4497
289 Ga0157370_10247442 3300013104 Bacteria 1649
290 Ga0157370_11651885 3300013104 Bacteria 575
291 Ga0157369_10062027 3300013105 Bacteria 4029
292 Ga0157369_10063520 3300013105 Bacteria 3977
293 Ga0157369_10128798 3300013105 Bacteria 2682
294 Ga0157369_10130919 3300013105 Bacteria 2658
295 Ga0157369_10281078 3300013105 Bacteria 1733
296 Ga0157374_10086846 3300013296 Bacteria 2977
297 Ga0157374_10327811 3300013296 Bacteria 1518
298 Ga0157374_10665818 3300013296 Bacteria 1053
299 Ga0157374_11080610 3300013296 Bacteria 822
300 Ga0157378_10053485 3300013297 Bacteria 3594
301 Ga0157378_10351037 3300013297 Bacteria 1441
302 Ga0157378_11074736 3300013297 Bacteria 841
303 Ga0163162_10000810 3300013306 Bacteria 29022
304 Ga0163162_10130877 3300013306 Bacteria 2618
305 Ga0163162_10197536 3300013306 Bacteria 2140
306 Ga0163162_11741408 3300013306 Unclassified 712
307 Ga0157372_10047613 3300013307 Bacteria 4764
308 Ga0157372_10145276 3300013307 Bacteria 2735
309 Ga0157372_10190530 3300013307 Bacteria 2375
310 Ga0157372_10379465 3300013307 Bacteria 1647
311 Ga0157372_11426743 3300013307 Bacteria 798
312 Ga0163163_10501482 3300014325 Bacteria 1276
313 Ga0163163_10704965 3300014325 Bacteria 1073
314 Ga0163163_10793968 3300014325 Bacteria 1010
315 Ga0157380_10005575 3300014326 Bacteria 8793
316 Ga0157380_10007540 3300014326 Bacteria 7731
317 Ga0182008_10039688 3300014497 Bacteria 2352
318 Ga0182008_10084244 3300014497 Bacteria 1566
319 Ga0157379_10003729 3300014968 Bacteria 12965
320 Ga0157379_10800502 3300014968 Bacteria 890
321 Ga0157379_11401652 3300014968 Unclassified 677
322 Ga0157376_10065585 3300014969 Bacteria 3067
323 Ga0157376_10351679 3300014969 Bacteria 1410
324 Ga0182006_1000058 3300015261 Bacteria 167164
325 Ga0182007_10000640 3300015262 Bacteria 20231
326 Ga0182007_10017026 3300015262 Bacteria 2666
327 Ga0182007_10145714 3300015262 Bacteria 803
328 Ga0182005_1002232 3300015265 Bacteria 7120
329 Ga0183368_1002 3300015687 Bacteria 1865598
330 Ga0163161_10004052 3300017792 Bacteria 10245
331 Ga0163161_10025432 3300017792 Bacteria 4190
332 Ga0163161_10812087 3300017792 Bacteria 787
333 Ga0206356_11117712 3300020070 Bacteria 680
334 Ga0206353_10911170 3300020082 Bacteria 1033
335 Ga0209435_113671 3300025206 Bacteria 862
336 Ga0209566_104006 3300025225 Bacteria 2097
337 Ga0209674_100014 3300025226 Bacteria 704989
338 Ga0209674_100059 3300025226 Bacteria 282517
339 Ga0209672_100004 3300025228 Bacteria 1467504
340 Ga0209672_100008 3300025228 Bacteria 946876
341 Ga0209672_100019 3300025228 Bacteria 432215
342 Ga0209672_100148 3300025228 Bacteria 62818
343 Ga0209672_100250 3300025228 Bacteria 40232
344 Ga0209672_101111 3300025228 Bacteria 11363
345 Ga0209147_100026 3300025229 Bacteria 421622
346 Ga0209563_100036 3300025230 Bacteria 448275
347 Ga0207427_100037 3300025231 Bacteria 303108
348 Ga0209437_100213 3300025233 Bacteria 107087
349 Ga0209437_100257 3300025233 Bacteria 82683
350 Ga0209437_106796 3300025233 Bacteria 1890
351 Ga0209258_100003 3300025242 Bacteria 1467504
352 Ga0209258_100004 3300025242 Bacteria 1376422
353 Ga0209258_100008 3300025242 Bacteria 1009355
354 Ga0209258_100057 3300025242 Bacteria 334259
355 Ga0209258_100106 3300025242 Bacteria 206622
356 Ga0209258_100253 3300025242 Bacteria 96309
357 Ga0209258_101587 3300025242 Bacteria 7532
358 Ga0209258_102649 3300025242 Bacteria 4437
359 Ga0209646_1000836 3300025246 Bacteria 10370
360 Ga0209646_1000920 3300025246 Bacteria 9436
361 Ga0209026_1000045 3300025250 Bacteria 263431
362 Ga0209026_1000203 3300025250 Bacteria 82196
363 Ga0209026_1000368 3300025250 Bacteria 41597
364 Ga0209026_1001886 3300025250 Bacteria 8527
365 Ga0209026_1005722 3300025250 Bacteria 3254
366 Ga0209677_105222 3300025253 Bacteria 3456
367 Ga0209148_1000002 3300025254 Bacteria 2399500
368 Ga0209148_1000016 3300025254 Bacteria 804369
369 Ga0209148_1000042 3300025254 Bacteria 464111
370 Ga0209148_1000068 3300025254 Bacteria 335510
371 Ga0209148_1000200 3300025254 Bacteria 107200
372 Ga0209148_1001546 3300025254 Bacteria 11159
373 Ga0209759_1000117 3300025256 Bacteria 141785
374 Ga0209759_1000185 3300025256 Bacteria 100505
375 Ga0209759_1002855 3300025256 Bacteria 7285
376 Ga0209759_1003448 3300025256 Bacteria 6297
377 Ga0209129_1002704 3300025258 Bacteria 8321
378 Ga0209129_1012943 3300025258 Bacteria 1872
379 Ga0209233_1000096 3300025261 Bacteria 303482
380 Ga0209233_1011598 3300025261 Bacteria 2592
381 Ga0209233_1019797 3300025261 Bacteria 1780
382 Ga0209233_1058431 3300025261 Bacteria 754
383 Ga0209565_1000094 3300025263 Bacteria 134853
384 Ga0209455_1000004 3300025272 Bacteria 1467504
385 Ga0209455_1000007 3300025272 Bacteria 1157983
386 Ga0209455_1000016 3300025272 Bacteria 753097
387 Ga0209455_1000103 3300025272 Bacteria 201664
388 Ga0209455_1000142 3300025272 Bacteria 138027
389 Ga0209455_1003324 3300025272 Bacteria 5757
390 Ga0209455_1005694 3300025272 Bacteria 3800
391 Ga0209455_1007165 3300025272 Bacteria 3183
392 Ga0209673_1058028 3300025273 Bacteria 982
393 Ga0209675_1002994 3300025291 Bacteria 8317
394 Ga0209025_1002073 3300025294 Bacteria 22764
395 Ga0209564_1000942 3300025295 Bacteria 37527
396 Ga0209758_1000491 3300025297 Bacteria 64678
397 Ga0209758_1024734 3300025297 Bacteria 2665
398 Ga0209758_1025701 3300025297 Bacteria 2573
399 Ga0209256_1001544 3300025299 Bacteria 22970
400 Ga0209256_1012538 3300025299 Bacteria 3229
401 Ga0209051_1018386 3300025303 Bacteria 3093
402 Ga0207656_10048892 3300025321 Bacteria 1822
403 Ga0207713_1000221 3300025735 Bacteria 76659
404 Ga0207642_10676486 3300025899 Bacteria 649
405 Ga0207710_10005665 3300025900 Bacteria 5375
406 Ga0207680_10000003 3300025903 Bacteria 925264
407 Ga0207680_10233838 3300025903 Bacteria 1264
408 Ga0207647_10000005 3300025904 Bacteria 223490
409 Ga0207647_10012567 3300025904 Bacteria 5888
410 Ga0207647_10023640 3300025904 Bacteria 4062
411 Ga0207699_10212014 3300025906 Bacteria 1318
412 Ga0207645_10128939 3300025907 Bacteria 1646
413 Ga0207705_10000105 3300025909 Bacteria 95742
414 Ga0207705_10006165 3300025909 Bacteria 8917
415 Ga0207654_10000066 3300025911 Bacteria 68652
416 Ga0207707_10000105 3300025912 Bacteria 83206
417 Ga0207707_10001585 3300025912 Bacteria 20960
418 Ga0207707_10037229 3300025912 Bacteria 4251
419 Ga0207695_10001444 3300025913 Bacteria 39750
420 Ga0207695_10003927 3300025913 Bacteria 20570
421 Ga0207695_10004251 3300025913 Bacteria 19672
422 Ga0207695_10004499 3300025913 Bacteria 18977
423 Ga0207695_10010604 3300025913 Bacteria 11263
424 Ga0207695_10011161 3300025913 Bacteria 10903
425 Ga0207671_10000009 3300025914 Bacteria 724862
426 Ga0207671_10000205 3300025914 Bacteria 89701
427 Ga0207671_10059601 3300025914 Bacteria 2831
428 Ga0207671_10664502 3300025914 Bacteria 829
429 Ga0207663_10317953 3300025916 Bacteria 1169
430 Ga0207663_10980416 3300025916 Bacteria 677
431 Ga0207660_10007467 3300025917 Bacteria 7071
432 Ga0207662_10203049 3300025918 Bacteria 1284
433 Ga0207657_10004336 3300025919 Bacteria 15025
434 Ga0207657_10162213 3300025919 Bacteria 1815
435 Ga0207657_10260605 3300025919 Bacteria 1380
436 Ga0207649_10018912 3300025920 Bacteria 3929
437 Ga0207649_10923662 3300025920 Bacteria 685
438 Ga0207649_10950477 3300025920 Bacteria 675
439 Ga0207652_10002799 3300025921 Bacteria 14635
440 Ga0207652_10315168 3300025921 Bacteria 1412
441 Ga0207652_10534002 3300025921 Bacteria 1055
442 Ga0207694_10001033 3300025924 Bacteria 24240
443 Ga0207694_10055667 3300025924 Bacteria 3070
444 Ga0207694_10085965 3300025924 Bacteria 2476
445 Ga0207694_10179922 3300025924 Bacteria 1714
446 Ga0207694_10190707 3300025924 Unclassified 1665
447 Ga0207694_10249918 3300025924 Bacteria 1451
448 Ga0207694_10438426 3300025924 Bacteria 1090
449 Ga0207694_10532769 3300025924 Bacteria 985
450 Ga0207694_10621120 3300025924 Bacteria 909
451 Ga0207650_10107709 3300025925 Bacteria 2153
452 Ga0207650_10349698 3300025925 Bacteria 1216
453 Ga0207687_10068943 3300025927 Bacteria 2521
454 Ga0207664_10455141 3300025929 Bacteria 1143
455 Ga0207690_10004742 3300025932 Bacteria 8029
456 Ga0207690_10021343 3300025932 Bacteria 4015
457 Ga0207690_10546571 3300025932 Bacteria 941
458 Ga0207686_10009412 3300025934 Bacteria 5300
459 Ga0207686_10068642 3300025934 Bacteria 2271
460 Ga0207709_11411085 3300025935 Bacteria 577
461 Ga0207670_10028380 3300025936 Bacteria 3552
462 Ga0207670_10272851 3300025936 Bacteria 1315
463 Ga0207704_10190400 3300025938 Unclassified 1492
464 Ga0207711_10050655 3300025941 Bacteria 3555
465 Ga0207711_10064907 3300025941 Bacteria 3155
466 Ga0207711_10354843 3300025941 Bacteria 1358
467 Ga0207689_10068293 3300025942 Bacteria 2921
468 Ga0207679_10029011 3300025945 Bacteria 3848
469 Ga0207667_10000193 3300025949 Bacteria 88949
470 Ga0207667_10000244 3300025949 Bacteria 76441
471 Ga0207667_10002143 3300025949 Bacteria 24745
472 Ga0207667_10003976 3300025949 Bacteria 18166
473 Ga0207667_10008736 3300025949 Bacteria 12009
474 Ga0207667_10075772 3300025949 Bacteria 3492
475 Ga0207667_10195614 3300025949 Bacteria 2074
476 Ga0207667_10617780 3300025949 Bacteria 1092
477 Ga0207651_10119037 3300025960 Bacteria 1999
478 Ga0207651_10439986 3300025960 Bacteria 1117
479 Ga0207712_10247187 3300025961 Bacteria 1440
480 Ga0207668_10124865 3300025972 Bacteria 1955
481 Ga0207668_10266626 3300025972 Bacteria 1398
482 Ga0207640_10000169 3300025981 Bacteria 47286
483 Ga0207640_10000961 3300025981 Bacteria 15990
484 Ga0207640_10015686 3300025981 Bacteria 4390
485 Ga0207640_10043770 3300025981 Bacteria 2864
486 Ga0207640_10074513 3300025981 Bacteria 2297
487 Ga0207640_10293452 3300025981 Bacteria 1283
488 Ga0207658_10183357 3300025986 Bacteria 1734
489 Ga0207658_10355862 3300025986 Bacteria 1276
490 Ga0207658_10477769 3300025986 Bacteria 1107
491 Ga0207658_11140685 3300025986 Bacteria 712
492 Ga0207703_10083650 3300026035 Bacteria 2667
493 Ga0207703_10117135 3300026035 Bacteria 2282
494 Ga0207703_10134009 3300026035 Bacteria 2143
495 Ga0207639_10034959 3300026041 Bacteria 3717
496 Ga0207639_10141799 3300026041 Bacteria 2003
497 Ga0207639_10244031 3300026041 Bacteria 1563
498 Ga0207639_10477191 3300026041 Bacteria 1136
499 Ga0207678_10012183 3300026067 Bacteria 7555
500 Ga0207678_10021852 3300026067 Bacteria 5611
501 Ga0207678_10087171 3300026067 Bacteria 2668
502 Ga0207678_10183666 3300026067 Bacteria 1786
503 Ga0207678_10196563 3300026067 Bacteria 1724
504 Ga0207678_10223933 3300026067 Bacteria 1610
505 Ga0207678_10297027 3300026067 Bacteria 1388
506 Ga0207678_11235862 3300026067 Bacteria 661
507 Ga0207702_10000279 3300026078 Bacteria 58912
508 Ga0207702_10005755 3300026078 Bacteria 10786
509 Ga0207702_10008212 3300026078 Bacteria 8825
510 Ga0207702_11043160 3300026078 Bacteria 811
511 Ga0207702_11486691 3300026078 Bacteria 671
512 Ga0207641_10005694 3300026088 Bacteria 10602
513 Ga0207641_10383426 3300026088 Bacteria 1346
514 Ga0207648_10149152 3300026089 Bacteria 2063
515 Ga0207676_10640214 3300026095 Bacteria 1025
516 Ga0207674_10000134 3300026116 Bacteria 86377
517 Ga0207674_10000401 3300026116 Bacteria 56126
518 Ga0207674_10076088 3300026116 Bacteria 3366
519 Ga0207674_10106286 3300026116 Bacteria 2784
520 Ga0207674_10128797 3300026116 Bacteria 2495
521 Ga0207674_10200995 3300026116 Bacteria 1942
522 Ga0207674_10810171 3300026116 Bacteria 904
523 Ga0207675_100004588 3300026118 Bacteria 13316
524 Ga0207675_100406003 3300026118 Bacteria 1343
525 Ga0207698_11022169 3300026142 Bacteria 838
526 Ga0209282_1000056 3300027666 Bacteria 100584
527 Ga0268266_10000011 3300028379 Bacteria 757403
528 Ga0268266_10092294 3300028379 Bacteria 2656
529 Ga0268266_10875245 3300028379 Bacteria 868
530 Ga0268265_10757154 3300028380 Bacteria 943
531 Ga0268264_10232993 3300028381 Bacteria 1701
532 Ga0268264_10250318 3300028381 Bacteria 1646
533 Ga0307517_10092418 3300028786 Bacteria 2462
534 Ga0265327_10104843 3300031251 Bacteria 1359
535 Ga0307513_10201771 3300031456 Bacteria 1829
536 Ga0307513_10699977 3300031456 Bacteria 719
537 Ga0307408_100448470 3300031548 Bacteria 1119
538 Ga0307405_10714677 3300031731 Bacteria 831
539 Ga0307413_10088260 3300031824 Bacteria 2011
540 Ga0307413_10726263 3300031824 Bacteria 828
541 Ga0307407_10737876 3300031903 Bacteria 745
542 Ga0307409_101123161 3300031995 Bacteria 808
543 Ga0307411_10360250 3300032005 Bacteria 1189
544 Ga0307510_10040224 3300033180 Bacteria 5136
545 Ga0373926_0083976 3300035083 Bacteria 1180
546 Ga0373957_0248328 3300035120 Bacteria 748
547 Ga0373955_0104792 3300035172 Bacteria 1628
548 Ga0373931_0006882 3300035691 Bacteria 5346
549 Ga0373935_0376423 3300035692 Bacteria 1016
550 Ga0373927_0034762 3300035695 Bacteria 3278
551 Ga0373937_0006062 3300036401 Bacteria 10406
552 Ga0373925_0045596 3300037068 Bacteria 3257
553 Ga0373925_0335765 3300037068 Bacteria 1225
554 Ga0373925_0646457 3300037068 Bacteria 871
555 Ga0395899_0000226 3300037312 Bacteria 76657
556 Ga0395899_0003288 3300037312 Bacteria 12813
557 Ga0395899_0003519 3300037312 Bacteria 12408
558 Ga0395899_0292473 3300037312 Bacteria 1105
559 Ga0395900_0000011 3300037418 Bacteria 421926
560 Ga0395900_0000078 3300037418 Bacteria 179292
561 Ga0395900_0008850 3300037418 Bacteria 10335
562 Ga0395900_0778801 3300037418 Bacteria 885
563 Ga0395898_0000029 3300037466 Bacteria 370667
564 Ga0395898_0000336 3300037466 Bacteria 106457
565 Ga0395898_0040001 3300037466 Bacteria 4639
566 Ga0395898_0469500 3300037466 Bacteria 1197
567 Ga0395905_0172296 3300037471 Bacteria 2033
568 Ga0395901_0106861 3300038443 Bacteria 2937
569 Ga0395901_0116900 3300038443 Bacteria 2802
570 Ga0395901_0869160 3300038443 Bacteria 885
571 Ga0451791_0401505 3300041451 Bacteria 4911
572 Ga0451791_1329675 3300041451 Bacteria 765
573 Ga0451802_1042238 3300041460 Bacteria 1692
574 Ga0451804_0307298 3300041463 Bacteria 731
575 Ga0451807_0155889 3300041486 Bacteria 2169
576 Ga0451833_0261258 3300041491 Bacteria 1095
577 Ga0451837_0107029 3300041494 Bacteria 4061
578 Ga0451837_0381109 3300041494 Bacteria 2022
579 Ga0439431_0084438 3300041997 Bacteria 859
580 Ga0451577_0318117 3300042876 Bacteria 1411
581 Ga0451577_0375764 3300042876 Bacteria 1289
582 Ga0466969_0031836 3300044656 Bacteria 2683
583 Ga0466969_0033388 3300044656 Bacteria 2612
584 Ga0466969_0042658 3300044656 Bacteria 2263
585 Ga0466969_0171810 3300044656 Bacteria 993
586 Ga0466972_0033943 3300044658 Bacteria 2502
587 Ga0466989_0019721 3300044663 Bacteria 3869
588 Ga0466982_0000001 3300044672 Bacteria 514662
589 Ga0466965_0113435 3300044683 Bacteria 1394
590 Ga0466965_0152070 3300044683 Bacteria 1210
591 Ga0466966_0004620 3300044684 Bacteria 9072
592 Ga0466966_0007031 3300044684 Bacteria 7451
593 Ga0466966_0011542 3300044684 Bacteria 5860
594 Ga0466961_0001169 3300044693 Bacteria 16139
595 Ga0466961_0001667 3300044693 Bacteria 13816
596 Ga0466961_0023321 3300044693 Bacteria 3981
597 Ga0466961_0025976 3300044693 Bacteria 3764
598 Ga0466963_0011721 3300044694 Bacteria 5345
599 Ga0466963_0096443 3300044694 Bacteria 2020
600 Ga0466964_0004985 3300044706 Bacteria 4906
601 Ga0466964_0275861 3300044706 Bacteria 838
602 Ga0466964_0378005 3300044706 Bacteria 735
603 Ga0466971_0007278 3300044719 Bacteria 4818
604 Ga0466968_0015619 3300044735 Bacteria 3012
605 Ga0466970_0001207 3300044765 Bacteria 12553
606 Ga0466970_0042862 3300044765 Bacteria 2407
607 Ga0466970_0050528 3300044765 Bacteria 2217
608 Ga0466957_0123453 3300044842 Bacteria 1653
609 Ga0466957_0127426 3300044842 Bacteria 1627
610 Ga0466957_0139004 3300044842 Bacteria 1563
611 Ga0466957_0478905 3300044842 Bacteria 861
612 Ga0466960_0035701 3300044901 Bacteria 2324
613 Ga0466959_0000006 3300045049 Bacteria 192678
614 Ga0466959_0011279 3300045049 Bacteria 6414
615 Ga0466959_0021454 3300045049 Bacteria 4763
616 Ga0466959_0169706 3300045049 Bacteria 1530
617 Ga0466959_0461067 3300045049 Bacteria 861
618 Ga0466958_0023770 3300045836 Bacteria 3601
619 Ga0466958_0042117 3300045836 Bacteria 2749
620 Ga0466958_0121422 3300045836 Bacteria 1636
621 Ga0466958_0162720 3300045836 Bacteria 1410
622 Ga0495617_000040 3300046452 Bacteria 126637
623 Ga0495617_001397 3300046452 Bacteria 10640
624 Ga0495592_0120393 3300046454 Bacteria 1847
625 Ga0495590_0071212 3300046457 Bacteria 1220
626 Ga0495591_026505 3300046458 Bacteria 1800
627 Ga0495629_0056246 3300046459 Bacteria 2751
628 Ga0495638_0000339 3300046460 Bacteria 59031
629 Ga0495638_0000670 3300046460 Bacteria 37267
630 Ga0495638_0008078 3300046460 Bacteria 7488
631 Ga0495638_0065452 3300046460 Bacteria 2237
632 Ga0495638_0125300 3300046460 Bacteria 1514
633 Ga0495651_0104976 3300046462 Bacteria 2097
634 Ga0495650_0000112 3300046471 Bacteria 197339
635 Ga0495650_0000852 3300046471 Bacteria 36650
636 Ga0495650_0006997 3300046471 Bacteria 6887
637 Ga0495650_0013554 3300046471 Bacteria 4303
638 Ga0495605_0000834 3300046474 Bacteria 21724
639 Ga0495605_0103498 3300046474 Bacteria 1306
640 Ga0495664_0310201 3300046477 Bacteria 952
641 Ga0495584_0002683 3300046491 Bacteria 10010
642 Ga0495585_0000024 3300046492 Bacteria 148384
643 Ga0495585_0012695 3300046492 Bacteria 4958
644 Ga0495585_0281625 3300046492 Bacteria 822
645 Ga0495596_0000060 3300046500 Bacteria 79429
646 Ga0495607_0001134 3300046501 Bacteria 24157
647 Ga0495607_0003270 3300046501 Bacteria 12466
648 Ga0495607_0070767 3300046501 Bacteria 1948
649 Ga0495583_0029981 3300046506 Bacteria 2655
650 Ga0495606_0000902 3300046507 Bacteria 44174
651 Ga0495606_0001920 3300046507 Bacteria 25804
652 Ga0495606_0005113 3300046507 Bacteria 12741
653 Ga0495606_0017472 3300046507 Bacteria 5421
654 Ga0495606_0029881 3300046507 Bacteria 3818
655 Ga0495606_0095395 3300046507 Bacteria 1822
656 Ga0495608_0189403 3300046511 Bacteria 1299
657 Ga0495610_0000235 3300046512 Bacteria 58396
658 Ga0495610_0026982 3300046512 Bacteria 3059
659 Ga0495616_0000496 3300046513 Bacteria 29907
660 Ga0495616_0000948 3300046513 Bacteria 20871
661 Ga0495616_0006065 3300046513 Bacteria 7364
662 Ga0495620_0000348 3300046515 Bacteria 32030
663 Ga0495620_0061047 3300046515 Bacteria 1569
664 Ga0495628_0120775 3300046516 Bacteria 2011
665 Ga0495628_0148849 3300046516 Bacteria 1784
666 Ga0495631_0000331 3300046518 Bacteria 32429
667 Ga0495631_0005220 3300046518 Bacteria 6837
668 Ga0495631_0369941 3300046518 Bacteria 610
669 Ga0495632_0000005 3300046519 Bacteria 362872
670 Ga0495632_0002695 3300046519 Bacteria 13262
671 Ga0495632_0015748 3300046519 Bacteria 4226
672 Ga0495643_0037484 3300046522 Bacteria 2659
673 Ga0495648_0004979 3300046524 Bacteria 11163
674 Ga0495648_0006512 3300046524 Bacteria 9519
675 Ga0495648_0020135 3300046524 Bacteria 4667
676 Ga0495663_0003305 3300046525 Bacteria 4670
677 Ga0495652_0174652 3300046529 Bacteria 1655
678 Ga0495654_0265487 3300046530 Bacteria 710
679 Ga0495587_0080671 3300046536 Bacteria 1885
680 Ga0495598_0013526 3300046537 Bacteria 2025
681 Ga0495609_0000573 3300046538 Bacteria 28911
682 Ga0495609_0008691 3300046538 Bacteria 4953
683 Ga0495621_0007430 3300046539 Bacteria 3245
684 Ga0495645_0085218 3300046543 Bacteria 2262
685 Ga0495645_0136859 3300046543 Bacteria 1712
686 Ga0495622_0000954 3300046557 Bacteria 15501
687 Ga0495667_0116573 3300046559 Bacteria 1725
688 Ga0495667_0147015 3300046559 Bacteria 1518
689 Ga0495656_0479924 3300046615 Bacteria 657
690 Ga0495668_0007118 3300046616 Bacteria 7206
691 Ga0495668_0135978 3300046616 Bacteria 1345
692 Ga0495611_0000005 3300046648 Bacteria 284271
693 Ga0495611_0000039 3300046648 Bacteria 100068
694 Ga0495611_0239590 3300046648 Bacteria 842
695 Ga0495625_0000066 3300046660 Bacteria 172144
696 Ga0495625_0049565 3300046660 Bacteria 3018
697 Ga0495625_0052521 3300046660 Bacteria 2918
698 Ga0495625_0064695 3300046660 Bacteria 2579
699 Ga0495625_0066875 3300046660 Bacteria 2531
700 Ga0495625_0270106 3300046660 Bacteria 1097
701 Ga0495635_0033451 3300046663 Bacteria 3566
702 Ga0495661_0004104 3300046665 Bacteria 10608
703 Ga0495661_0015165 3300046665 Bacteria 5145
704 Ga0495661_0050806 3300046665 Bacteria 2507
705 Ga0495657_0028273 3300046675 Bacteria 3947
706 Ga0495657_0068025 3300046675 Bacteria 2336
707 Ga0495623_0119945 3300046679 Bacteria 1584
708 Ga0495647_0318148 3300046681 Bacteria 704
709 Ga0495658_0129605 3300046683 Bacteria 1534
710 Ga0495669_0019406 3300046684 Bacteria 2935
711 Ga0495613_0624211 3300046689 Bacteria 715
712 Ga0495670_0003480 3300046691 Bacteria 7736
713 Ga0495670_0008096 3300046691 Bacteria 5165
714 Ga0495670_0369262 3300046691 Bacteria 773
715 Ga0495671_0002622 3300046692 Bacteria 11308
716 Ga0495671_0009862 3300046692 Bacteria 5314
717 Ga0495649_0009841 3300046694 Bacteria 5659
718 Ga0495589_0000026 3300046794 Bacteria 184723
719 Ga0495660_0000544 3300046810 Bacteria 30876
720 Ga0495660_0012768 3300046810 Bacteria 4873
721 Ga0495604_0058823 3300047317 Bacteria 2950
722 Ga0495604_0124017 3300047317 Bacteria 1866
723 Ga0495636_0117221 3300047318 Bacteria 1176
724 Ga0495672_0028976 3300047320 Bacteria 3494
725 Ga0495672_0149341 3300047320 Bacteria 1213
726 Ga0495683_0001769 3300047323 Bacteria 13615
727 Ga0495675_0257236 3300047444 Bacteria 1047
728 Ga0495677_0067846 3300047445 Bacteria 1327
729 Ga0495679_000010 3300047446 Bacteria 337760
730 Ga0495679_034113 3300047446 Bacteria 1622
731 Ga0495685_062513 3300047447 Bacteria 1253
732 Ga0495673_0000038 3300047469 Bacteria 303785
733 Ga0495673_0000045 3300047469 Bacteria 280765
734 Ga0495673_0001306 3300047469 Bacteria 20288
735 Ga0495684_0011976 3300047471 Bacteria 6689
736 Ga0495684_0346330 3300047471 Bacteria 1056
737 Ga0495686_0000050 3300047472 Bacteria 269010
738 Ga0495686_0000297 3300047472 Bacteria 85762
739 Ga0495686_0002453 3300047472 Bacteria 17478
740 Ga0495686_0012390 3300047472 Bacteria 5965
741 Ga0495686_0069393 3300047472 Bacteria 2172
742 Ga0495602_0373648 3300048088 Bacteria 1023
743 Ga0495602_0467633 3300048088 Bacteria 887
744 Ga0496100_0106172 3300048903 Bacteria 1943
745 Ga0496101_0135366 3300048904 Bacteria 1874
746 Ga0496101_0263846 3300048904 Bacteria 1344
747 Ga0496101_0871253 3300048904 Bacteria 709
748 Ga0496102_0222324 3300048905 Bacteria 1780
749 Ga0496102_0734201 3300048905 Bacteria 910
750 Ga0496104_0071611 3300048907 Bacteria 3296
751 Ga0496104_0145631 3300048907 Bacteria 2275
752 Ga0496104_1062658 3300048907 Bacteria 713
753 Ga0496105_0007857 3300048908 Bacteria 8282
754 Ga0496105_0737563 3300048908 Bacteria 753
755 Ga0496106_0000097 3300048909 Bacteria 66262
756 Ga0496106_0917761 3300048909 Bacteria 691
757 Ga0496106_1008555 3300048909 Bacteria 654
758 Ga0496108_0047944 3300048911 Bacteria 3572
759 Ga0496109_0113065 3300048912 Bacteria 2525
760 Ga0496109_0440352 3300048912 Bacteria 1231
761 Ga0496111_0268892 3300048914 Bacteria 1265
762 Ga0496112_0271738 3300048915 Bacteria 1643
763 Ga0496113_0012014 3300048916 Bacteria 5807
764 Ga0496113_0222473 3300048916 Bacteria 1504
765 Ga0496114_1335055 3300048917 Bacteria 604
766 Ga0496115_0000283 3300048918 Bacteria 43828
767 Ga0496115_0002834 3300048918 Bacteria 12471
768 Ga0496115_0012403 3300048918 Bacteria 6413
769 Ga0496115_1054726 3300048918 Bacteria 618
770 Ga0496116_0002634 3300048919 Bacteria 18622
771 Ga0496116_0056171 3300048919 Bacteria 2582
772 Ga0496117_0076902 3300048920 Bacteria 2210
773 Ga0496117_0077580 3300048920 Bacteria 2198
774 Ga0496117_0082170 3300048920 Bacteria 2111
775 Ga0496117_0163237 3300048920 Bacteria 1302
776 Ga0496117_0507393 3300048920 Bacteria 583
777 Ga0496118_0002818 3300048921 Bacteria 22746
778 Ga0496118_0003470 3300048921 Bacteria 19795
779 Ga0496118_0004496 3300048921 Bacteria 16495
780 Ga0496118_0006149 3300048921 Bacteria 13319
781 Ga0496118_0006461 3300048921 Bacteria 12872
782 Ga0496119_0000291 3300048922 Bacteria 70213
783 Ga0496119_0016378 3300048922 Bacteria 5644
784 Ga0496120_0000397 3300048923 Bacteria 70206
785 Ga0496120_0001574 3300048923 Bacteria 26674
786 Ga0496121_0000531 3300048924 Bacteria 72444
787 Ga0496121_0001099 3300048924 Bacteria 47710
788 Ga0496121_0002812 3300048924 Bacteria 25735
789 Ga0496121_0003485 3300048924 Bacteria 22401
790 Ga0496121_0007940 3300048924 Bacteria 12682
791 Ga0496121_0015521 3300048924 Bacteria 7970
792 Ga0496121_0015815 3300048924 Bacteria 7854
793 Ga0496121_0020023 3300048924 Bacteria 6652
794 Ga0496121_0084225 3300048924 Bacteria 2508
795 Ga0496121_0103775 3300048924 Bacteria 2186
796 Ga0496121_0121910 3300048924 Bacteria 1967
797 Ga0496121_0141953 3300048924 Bacteria 1780
798 Ga0496121_0252139 3300048924 Bacteria 1223
799 Ga0496122_0002324 3300048925 Bacteria 27434
800 Ga0496122_0007927 3300048925 Bacteria 11626
801 Ga0496122_0061502 3300048925 Bacteria 2756
802 Ga0496122_0192599 3300048925 Bacteria 1201
803 Ga0496122_0592492 3300048925 Bacteria 520
804 Ga0496123_0002089 3300048926 Bacteria 25702
805 Ga0496123_0026147 3300048926 Bacteria 4381
806 Ga0496123_0027129 3300048926 Bacteria 4273
807 Ga0496125_0000647 3300048928 Bacteria 58140
808 Ga0496125_0012655 3300048928 Bacteria 8352
809 Ga0496125_0024927 3300048928 Bacteria 5489
810 Ga0496125_0216524 3300048928 Bacteria 1238
811 Ga0496125_0412248 3300048928 Bacteria 786
812 Ga0496126_0001015 3300048929 Bacteria 47751
813 Ga0496126_0068693 3300048929 Bacteria 3163
814 Ga0496126_0098442 3300048929 Bacteria 2562
815 Ga0496126_0192114 3300048929 Bacteria 1729
816 Ga0496126_0197252 3300048929 Bacteria 1702
817 Ga0496126_0686034 3300048929 Bacteria 798
818 Ga0495678_000672 3300049459 Bacteria 31401
819 Ga0495682_0010314 3300049460 Bacteria 3621
820 Ga0495682_0018766 3300049460 Bacteria 2604
821 Ga0501031_0005471 3300049568 Bacteria 8265
822 Ga0501031_0011536 3300049568 Bacteria 5761
823 Ga0501031_0039301 3300049568 Bacteria 3087
824 Ga0501032_0032581 3300049569 Bacteria 3571
825 Ga0501032_0200553 3300049569 Bacteria 1302
826 Ga0501032_0240022 3300049569 Bacteria 1177
827 Ga0501033_0000289 3300049570 Bacteria 48277
828 Ga0501033_0000339 3300049570 Bacteria 44797
829 Ga0501033_0036019 3300049570 Bacteria 3709
830 Ga0501033_0074403 3300049570 Bacteria 2494
831 Ga0501033_0155948 3300049570 Bacteria 1645
832 Ga0501033_0471617 3300049570 Bacteria 870
833 Ga0501034_0001724 3300049571 Bacteria 28139
834 Ga0501034_0012646 3300049571 Bacteria 8708
835 Ga0501034_0023149 3300049571 Bacteria 6332
836 Ga0501034_0126272 3300049571 Bacteria 2543
837 Ga0501034_0146951 3300049571 Bacteria 2334
838 Ga0501034_0169310 3300049571 Bacteria 2152
839 Ga0501034_0181126 3300049571 Bacteria 2072
840 Ga0501034_0195113 3300049571 Bacteria 1985
841 Ga0501034_0692355 3300049571 Bacteria 918
842 Ga0501036_0000051 3300049572 Bacteria 75057
843 Ga0501036_0048851 3300049572 Bacteria 3582
844 Ga0501036_0551496 3300049572 Bacteria 958
845 Ga0501036_0653395 3300049572 Bacteria 870
846 Ga0501036_0901850 3300049572 Bacteria 725
847 Ga0501036_1127952 3300049572 Bacteria 640
848 Ga0501037_0002569 3300049573 Bacteria 13111
849 Ga0501037_0026579 3300049573 Bacteria 4278
850 Ga0501037_0150259 3300049573 Bacteria 1665
851 Ga0501037_0238428 3300049573 Bacteria 1275
852 Ga0501037_0368517 3300049573 Bacteria 989
853 Ga0501037_0401334 3300049573 Bacteria 940
854 Ga0501037_0478779 3300049573 Bacteria 846
855 Ga0501037_0738756 3300049573 Bacteria 653
856 Ga0501038_0005817 3300049574 Bacteria 11412
857 Ga0501038_0019453 3300049574 Bacteria 6120
858 Ga0501038_0044246 3300049574 Bacteria 3870
859 Ga0501038_0140701 3300049574 Bacteria 1974
860 Ga0501038_0359075 3300049574 Bacteria 1133
861 Ga0501038_0514752 3300049574 Bacteria 914
862 Ga0501039_0027791 3300049575 Bacteria 4350
863 Ga0501039_0030698 3300049575 Bacteria 4144
864 Ga0501039_0221944 3300049575 Bacteria 1486
865 Ga0501040_0202723 3300049576 Bacteria 1409
866 Ga0501041_0007930 3300049577 Bacteria 6243
867 Ga0501042_0079853 3300049578 Bacteria 2344
868 Ga0501042_0305891 3300049578 Bacteria 1148
869 Ga0501043_0003654 3300049579 Bacteria 12629
870 Ga0501043_0015316 3300049579 Bacteria 6006
871 Ga0501043_0051289 3300049579 Bacteria 3241
872 Ga0501043_0127804 3300049579 Bacteria 1992
873 Ga0501043_0128392 3300049579 Bacteria 1987
874 Ga0501043_0132366 3300049579 Bacteria 1954
875 Ga0501043_0164621 3300049579 Bacteria 1732
876 Ga0501043_0320570 3300049579 Bacteria 1182
877 Ga0501043_1105114 3300049579 Bacteria 560
878 Ga0501046_0006257 3300049580 Bacteria 10560
879 Ga0501046_0011629 3300049580 Bacteria 7523
880 Ga0501046_0015448 3300049580 Bacteria 6413
881 Ga0501046_0054043 3300049580 Bacteria 3161
882 Ga0501046_0070261 3300049580 Bacteria 2722
883 Ga0501046_0162254 3300049580 Bacteria 1680
884 Ga0501046_0202997 3300049580 Bacteria 1474
885 Ga0501046_0303782 3300049580 Bacteria 1165
886 Ga0501047_0001196 3300049581 Bacteria 25704
887 Ga0501047_0001416 3300049581 Bacteria 23526
888 Ga0501047_0014773 3300049581 Bacteria 7431
889 Ga0501047_0015511 3300049581 Bacteria 7259
890 Ga0501047_0025910 3300049581 Bacteria 5638
891 Ga0501047_0099896 3300049581 Bacteria 2781
892 Ga0501047_0317447 3300049581 Bacteria 1398
893 Ga0501047_0324912 3300049581 Bacteria 1378
894 Ga0501047_0459337 3300049581 Bacteria 1102
895 Ga0501047_0510192 3300049581 Bacteria 1029
896 Ga0501047_1070930 3300049581 Bacteria 619
897 Ga0501048_0023832 3300049582 Bacteria 4470
898 Ga0501048_0081172 3300049582 Bacteria 2288
899 Ga0501048_0086692 3300049582 Bacteria 2208
900 Ga0501048_0226859 3300049582 Bacteria 1325
901 Ga0501048_0413846 3300049582 Bacteria 964
902 Ga0501048_0502865 3300049582 Bacteria 869
903 Ga0501068_0077570 3300049584 Bacteria 2035
904 Ga0501068_0266891 3300049584 Bacteria 1092
905 Ga0501069_0017848 3300049585 Bacteria 3827
906 Ga0501070_0001751 3300049586 Bacteria 19191
907 Ga0501070_0002827 3300049586 Bacteria 15146
908 Ga0501070_0050328 3300049586 Bacteria 3459
909 Ga0501070_0090232 3300049586 Bacteria 2536
910 Ga0501070_0221901 3300049586 Bacteria 1550
911 Ga0501070_0748232 3300049586 Bacteria 770
912 Ga0501071_0349800 3300049587 Bacteria 1124
913 Ga0501072_0256236 3300049588 Bacteria 1393
914 Ga0501072_0315842 3300049588 Bacteria 1242
915 Ga0501073_0024817 3300049589 Bacteria 4303
916 Ga0501073_0039910 3300049589 Bacteria 3324
917 Ga0501073_0082245 3300049589 Bacteria 2240
918 Ga0501073_0295662 3300049589 Bacteria 1117
919 Ga0501074_0003781 3300049590 Bacteria 10754
920 Ga0501074_0005065 3300049590 Bacteria 9459
921 Ga0501074_0194285 3300049590 Bacteria 1447
922 Ga0501074_0211829 3300049590 Bacteria 1380
923 Ga0501074_0584540 3300049590 Bacteria 790
924 Ga0501075_0118012 3300049591 Bacteria 2017
925 Ga0501076_0031032 3300049592 Bacteria 4165
926 Ga0501076_0036539 3300049592 Bacteria 3849
927 Ga0501077_0297788 3300049593 Bacteria 1027
928 Ga0501077_0470240 3300049593 Bacteria 805
929 Ga0501079_0008655 3300049741 Bacteria 7719
930 Ga0501079_0012401 3300049741 Bacteria 6504
931 Ga0501079_0113180 3300049741 Bacteria 2109
932 Ga0501079_0196934 3300049741 Bacteria 1573
933 Ga0501079_0896104 3300049741 Bacteria 698
934 Ga0501080_0009065 3300049742 Bacteria 9056
935 Ga0501080_0021486 3300049742 Bacteria 5972
936 Ga0501080_0070795 3300049742 Bacteria 3244
937 Ga0501080_0072753 3300049742 Bacteria 3198
938 Ga0501080_0097049 3300049742 Bacteria 2736
939 Ga0501080_0125100 3300049742 Bacteria 2381
940 Ga0501080_0236388 3300049742 Bacteria 1669
941 Ga0501081_0110592 3300049743 Bacteria 1949
942 Ga0501083_0032266 3300049744 Bacteria 3593
943 Ga0501083_0723980 3300049744 Bacteria 647
944 Ga0501035_0001784 3300049822 Bacteria 21748
945 Ga0501035_0051441 3300049822 Bacteria 3689
946 Ga0501035_0069252 3300049822 Bacteria 3128
947 Ga0501035_0072485 3300049822 Bacteria 3048
948 Ga0501035_0112283 3300049822 Bacteria 2388
949 Ga0501035_0130034 3300049822 Bacteria 2195
950 Ga0501035_0131129 3300049822 Bacteria 2185
951 Ga0501035_0148783 3300049822 Bacteria 2033
952 Ga0501035_0170660 3300049822 Bacteria 1879
953 Ga0501035_0174004 3300049822 Bacteria 1858
954 Ga0501035_0349400 3300049822 Bacteria 1237
955 Ga0501035_0526059 3300049822 Bacteria 971
956 Ga0501035_1054738 3300049822 Bacteria 637
957 Ga0501044_0014869 3300049823 Bacteria 8390
958 Ga0501044_0020894 3300049823 Bacteria 6989
959 Ga0501044_0059574 3300049823 Bacteria 3911
960 Ga0501044_0102799 3300049823 Bacteria 2872
961 Ga0501044_0115863 3300049823 Bacteria 2685
962 Ga0501044_0491605 3300049823 Bacteria 1129
963 Ga0501044_0962933 3300049823 Bacteria 726
964 Ga0501044_1263325 3300049823 Bacteria 605
965 Ga0501045_0116947 3300049824 Bacteria 1979
966 Ga0501045_0143901 3300049824 Bacteria 1773
967 nmdc:mga00v17_143788_c1 3300050491 Bacteria 1530
968 nmdc:mga0k408_113684_c1 3300050493 Bacteria 1601
969 nmdc:mga0k408_66584_c1 3300050493 Bacteria 2098
970 nmdc:mga0qj67_18581_c1 3300050509 Bacteria 5298
971 nmdc:mga0sz30_137565_c1 3300050516 Bacteria 1078
972 Ga0495595_0070125 3300053084 Bacteria 1656
973 Ga0495619_0005513 3300053085 Bacteria 8028
974 Ga0500643_000074 3300053087 Bacteria 111502
975 Ga0500644_0400606 3300053088 Bacteria 598
976 Ga0500562_026359 3300053108 Bacteria 1523
977 Ga0500568_0001210 3300053139 Bacteria 17205
978 Ga0500645_001728 3300053730 Bacteria 10609
979 Ga0500599_005582 3300053736 Bacteria 1585
980 Ga0501084_0007827 3300054114 Bacteria 8793
981 Ga0501084_0831738 3300054114 Bacteria 777
982 Ga0501082_0018624 3300060353 Bacteria 5984
983 Ga0501082_0044536 3300060353 Bacteria 3827
984 Ga0466962_0003425 3300061719 Bacteria 7552
985 Ga0466962_0008321 3300061719 Bacteria 4969
986 Ga0466962_0009529 3300061719 Bacteria 4657
987 Ga0466962_0016609 3300061719 Bacteria 3550
988 Ga0530510_0187427 3300061734 Bacteria 1535

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300010375 Ga0105239_10347138 Ga0105239_103471382 143
2 3300013105 Ga0157369_10130919 Ga0157369_101309195 143
3 3300013307 Ga0157372_10145276 Ga0157372_101452765 143
4 3300025918 Ga0207662_10203049 Ga0207662_102030491 151
5 iso_pu_bacteria 2936361878 2936362127 153
6 3300013100 Ga0157373_10009142 Ga0157373_100091423 154
7 3300013102 Ga0157371_10000949 Ga0157371_1000094917 154
8 iso_pu_bacteria 2883291878 2883296529 156
9 iso_pu_bacteria 2883354860 2883359236 156
10 iso_pu_bacteria 2501025501 2501072313 157
11 iso_pu_bacteria 2501025502 2501083068 157
12 iso_pu_bacteria 2501025504 2501409003 157
13 iso_pu_bacteria 2510917013 2511090959 157
14 iso_pu_bacteria 2510917014 2511098695 157
15 iso_pu_bacteria 2510917015 2511106278 157
16 iso_pu_bacteria 2513237082 2513556835 157
17 iso_pu_bacteria 2513237083 2513562759 157
18 iso_pu_bacteria 2515154189 2516020921 157
19 iso_pu_bacteria 2856287931 2856287985 157
20 iso_pu_bacteria 2857357740 2857358392 157
21 iso_pu_bacteria 2883087390 2883089179 157
22 iso_pu_bacteria 8003955200 8003959842 157
23 3300003323 rootH1_10116952 rootH1_101169522 158
24 3300005293 Ga0065715_10046227 Ga0065715_100462272 158
25 3300005327 Ga0070658_10056502 Ga0070658_100565024 158
26 3300005355 Ga0070671_100002542 Ga0070671_1000025427 158
27 3300017792 Ga0163161_10812087 Ga0163161_108120871 158
28 3300031903 Ga0307407_10737876 Ga0307407_107378762 158
29 3300031995 Ga0307409_101123161 Ga0307409_1011231611 158
30 3300046525 Ga0495663_0003305 Ga0495663_0003305_3224_3703 158
31 3300046537 Ga0495598_0013526 Ga0495598_0013526_1185_1664 158
32 3300046539 Ga0495621_0007430 Ga0495621_0007430_1346_1825 158
33 3300047318 Ga0495636_0117221 Ga0495636_0117221_287_766 158
34 3300047445 Ga0495677_0067846 Ga0495677_0067846_215_694 158
35 iso_pu_bacteria 2510065045 2510250421 158
36 iso_pu_bacteria 2512047030 2512347952 158
37 iso_pu_bacteria 2515154122 2515679023 158
38 iso_pu_bacteria 2519103095 2519458294 158
39 iso_pu_bacteria 2537561836 2538833367 158
40 iso_pu_bacteria 2582581311 2585294658 158
41 iso_pu_bacteria 2593339239 2595450423 158
42 iso_pu_bacteria 2643221562 2643831902 158
43 iso_pu_bacteria 2718217991 2719639569 158
44 iso_pu_bacteria 2718218334 2721029164 158
45 iso_pu_bacteria 2734482264 2735835252 158
46 iso_pu_bacteria 2738543009 2739229632 158
47 iso_pu_bacteria 2739367700 2739733374 158
48 iso_pu_bacteria 2816332253 2817260440 158
49 iso_pu_bacteria 2816332286 2817452633 158
50 iso_pu_bacteria 2818991440 2819564976 158
51 iso_pu_bacteria 2818991450 2819622189 158
52 iso_pu_bacteria 2884338543 2884342357 158
53 iso_pu_bacteria 2884411467 2884412915 158
54 iso_pu_bacteria 2885270888 2885273127 158
55 iso_pu_bacteria 2902682994 2902683030 158
56 iso_pu_bacteria 2904463128 2904465502 158
57 iso_pu_bacteria 2919404418 2919406977 158
58 iso_pu_bacteria 2928108538 2928113151 158
59 iso_pu_bacteria 2928135762 2928140310 158
60 iso_pu_bacteria 2928503688 2928507869 158
61 iso_pu_bacteria 2928963466 2928965477 158
62 iso_pu_bacteria 2941471342 2941474914 158
63 iso_pu_bacteria 2953994433 2953996866 158
64 iso_pu_bacteria 8020807995 8020811280 158
65 iso_pu_bacteria 8039098773 8039104294 158
66 iso_pu_bacteria 8040173305 8040176782 158
67 3300014326 Ga0157380_10007540 Ga0157380_100075406 159
68 3300025899 Ga0207642_10676486 Ga0207642_106764862 159
69 3300031731 Ga0307405_10714677 Ga0307405_107146771 159
70 3300005289 Ga0065704_10126300 Ga0065704_101263001 160
71 3300005295 Ga0065707_10082887 Ga0065707_100828878 160
72 3300005327 Ga0070658_10009305 Ga0070658_100093055 160
73 3300005331 Ga0070670_100097839 Ga0070670_1000978393 160
74 3300005336 Ga0070680_100044803 Ga0070680_1000448035 160
75 3300005339 Ga0070660_100000996 Ga0070660_10000099614 160
76 3300005341 Ga0070691_10000185 Ga0070691_1000018518 160
77 3300005341 Ga0070691_10000527 Ga0070691_1000052710 160
78 3300005343 Ga0070687_100220036 Ga0070687_1002200363 160
79 3300005344 Ga0070661_100663045 Ga0070661_1006630452 160
80 3300005347 Ga0070668_100022772 Ga0070668_1000227725 160
81 3300005354 Ga0070675_100167512 Ga0070675_1001675123 160
82 3300005366 Ga0070659_100010709 Ga0070659_1000107098 160
83 3300005434 Ga0070709_10002174 Ga0070709_1000217413 160
84 3300005434 Ga0070709_10143710 Ga0070709_101437103 160
85 3300005435 Ga0070714_100172444 Ga0070714_1001724443 160
86 3300005435 Ga0070714_100389172 Ga0070714_1003891722 160
87 3300005436 Ga0070713_100000141 Ga0070713_10000014157 160
88 3300005436 Ga0070713_100613007 Ga0070713_1006130072 160
89 3300005439 Ga0070711_100040650 Ga0070711_1000406503 160
90 3300005440 Ga0070705_100455529 Ga0070705_1004555292 160
91 3300005444 Ga0070694_100840581 Ga0070694_1008405811 160
92 3300005444 Ga0070694_101020317 Ga0070694_1010203171 160
93 3300005455 Ga0070663_100273696 Ga0070663_1002736962 160
94 3300005458 Ga0070681_10048156 Ga0070681_100481566 160
95 3300005468 Ga0070707_100756693 Ga0070707_1007566932 160
96 3300005530 Ga0070679_100082982 Ga0070679_1000829826 160
97 3300005530 Ga0070679_100672414 Ga0070679_1006724142 160
98 3300005535 Ga0070684_100099768 Ga0070684_1000997683 160
99 3300005539 Ga0068853_100047768 Ga0068853_1000477686 160
100 3300005539 Ga0068853_100119917 Ga0068853_1001199174 160
101 3300005545 Ga0070695_100005528 Ga0070695_1000055288 160
102 3300005545 Ga0070695_100518582 Ga0070695_1005185822 160
103 3300005547 Ga0070693_100075066 Ga0070693_1000750664 160
104 3300005549 Ga0070704_100145588 Ga0070704_1001455883 160
105 3300005563 Ga0068855_100021852 Ga0068855_1000218521 160
106 3300005563 Ga0068855_100060941 Ga0068855_1000609419 160
107 3300005577 Ga0068857_100002119 Ga0068857_10000211913 160
108 3300005578 Ga0068854_100055930 Ga0068854_1000559304 160
109 3300005578 Ga0068854_102061983 Ga0068854_1020619831 160
110 3300005614 Ga0068856_100000601 Ga0068856_10000060115 160
111 3300005614 Ga0068856_100001988 Ga0068856_10000198813 160
112 3300005614 Ga0068856_100393266 Ga0068856_1003932662 160
113 3300005616 Ga0068852_100007350 Ga0068852_1000073504 160
114 3300005618 Ga0068864_100650261 Ga0068864_1006502612 160
115 3300005719 Ga0068861_100004302 Ga0068861_1000043023 160
116 3300005834 Ga0068851_10184633 Ga0068851_101846332 160
117 3300005841 Ga0068863_102264099 Ga0068863_1022640991 160
118 3300005842 Ga0068858_100171745 Ga0068858_1001717453 160
119 3300006038 Ga0075365_10275431 Ga0075365_102754312 160
120 3300006042 Ga0075368_10139733 Ga0075368_101397333 160
121 3300006051 Ga0075364_10086286 Ga0075364_100862863 160
122 3300006173 Ga0070716_100118647 Ga0070716_1001186472 160
123 3300006173 Ga0070716_100126527 Ga0070716_1001265273 160
124 3300006175 Ga0070712_100000023 Ga0070712_10000002388 160
125 3300006175 Ga0070712_100000260 Ga0070712_1000002609 160
126 3300006178 Ga0075367_10112841 Ga0075367_101128412 160
127 3300006237 Ga0097621_100989596 Ga0097621_1009895962 160
128 3300006358 Ga0068871_100346626 Ga0068871_1003466262 160
129 3300006358 Ga0068871_100742322 Ga0068871_1007423221 160
130 3300006871 Ga0075434_100181992 Ga0075434_1001819923 160
131 3300006871 Ga0075434_101450578 Ga0075434_1014505781 160
132 3300006914 Ga0075436_100000211 Ga0075436_10000021137 160
133 3300006914 Ga0075436_100001356 Ga0075436_1000013567 160
134 3300007076 Ga0075435_100027464 Ga0075435_1000274643 160
135 3300007076 Ga0075435_101485324 Ga0075435_1014853241 160
136 3300009093 Ga0105240_10003992 Ga0105240_1000399219 160
137 3300009098 Ga0105245_10808944 Ga0105245_108089441 160
138 3300009098 Ga0105245_11814928 Ga0105245_118149282 160
139 3300009148 Ga0105243_10952536 Ga0105243_109525361 160
140 3300009174 Ga0105241_10013790 Ga0105241_100137907 160
141 3300009174 Ga0105241_10155939 Ga0105241_101559393 160
142 3300009174 Ga0105241_10237112 Ga0105241_102371121 160
143 3300009174 Ga0105241_10429916 Ga0105241_104299161 160
144 3300009176 Ga0105242_10009594 Ga0105242_100095945 160
145 3300009177 Ga0105248_10012144 Ga0105248_100121446 160
146 3300009545 Ga0105237_10008165 Ga0105237_1000816510 160
147 3300009551 Ga0105238_10001476 Ga0105238_1000147622 160
148 3300009551 Ga0105238_10004707 Ga0105238_100047077 160
149 3300009553 Ga0105249_11107020 Ga0105249_111070202 160
150 3300010375 Ga0105239_10010740 Ga0105239_100107409 160
151 3300013100 Ga0157373_10001427 Ga0157373_1000142711 160
152 3300013104 Ga0157370_10004924 Ga0157370_1000492411 160
153 3300013104 Ga0157370_10032119 Ga0157370_100321197 160
154 3300013105 Ga0157369_10128798 Ga0157369_101287983 160
155 3300013296 Ga0157374_10086846 Ga0157374_100868462 160
156 3300013297 Ga0157378_10053485 Ga0157378_100534853 160
157 3300013297 Ga0157378_11074736 Ga0157378_110747362 160
158 3300013306 Ga0163162_10197536 Ga0163162_101975362 160
159 3300013307 Ga0157372_10190530 Ga0157372_101905302 160
160 3300014325 Ga0163163_10501482 Ga0163163_105014821 160
161 3300014325 Ga0163163_10793968 Ga0163163_107939682 160
162 3300014968 Ga0157379_10003729 Ga0157379_1000372913 160
163 3300014968 Ga0157379_11401652 Ga0157379_114016521 160
164 3300025906 Ga0207699_10212014 Ga0207699_102120143 160
165 3300025909 Ga0207705_10000105 Ga0207705_1000010598 160
166 3300025912 Ga0207707_10001585 Ga0207707_100015857 160
167 3300025914 Ga0207671_10059601 Ga0207671_100596013 160
168 3300025916 Ga0207663_10317953 Ga0207663_103179533 160
169 3300025917 Ga0207660_10007467 Ga0207660_100074675 160
170 3300025919 Ga0207657_10004336 Ga0207657_1000433611 160
171 3300025921 Ga0207652_10002799 Ga0207652_100027993 160
172 3300025924 Ga0207694_10055667 Ga0207694_100556672 160
173 3300025924 Ga0207694_10438426 Ga0207694_104384262 160
174 3300025925 Ga0207650_10349698 Ga0207650_103496983 160
175 3300025932 Ga0207690_10021343 Ga0207690_100213438 160
176 3300025934 Ga0207686_10068642 Ga0207686_100686423 160
177 3300025935 Ga0207709_11411085 Ga0207709_114110851 160
178 3300025941 Ga0207711_10064907 Ga0207711_100649074 160
179 3300025949 Ga0207667_10002143 Ga0207667_1000214315 160
180 3300025949 Ga0207667_10008736 Ga0207667_100087368 160
181 3300025972 Ga0207668_10124865 Ga0207668_101248653 160
182 3300025981 Ga0207640_10015686 Ga0207640_100156864 160
183 3300026035 Ga0207703_10134009 Ga0207703_101340093 160
184 3300026041 Ga0207639_10141799 Ga0207639_101417993 160
185 3300026041 Ga0207639_10244031 Ga0207639_102440311 160
186 3300026067 Ga0207678_10223933 Ga0207678_102239332 160
187 3300026078 Ga0207702_10005755 Ga0207702_1000575511 160
188 3300026088 Ga0207641_10005694 Ga0207641_100056946 160
189 3300026116 Ga0207674_10000134 Ga0207674_1000013413 160
190 3300026118 Ga0207675_100004588 Ga0207675_1000045888 160
191 3300026118 Ga0207675_100406003 Ga0207675_1004060033 160
192 3300031456 Ga0307513_10201771 Ga0307513_102017713 160
193 3300031456 Ga0307513_10699977 Ga0307513_106999771 160
194 3300031548 Ga0307408_100448470 Ga0307408_1004484702 160
195 3300032005 Ga0307411_10360250 Ga0307411_103602502 160
196 3300035083 Ga0373926_0083976 Ga0373926_0083976_128_622 160
197 3300035691 Ga0373931_0006882 Ga0373931_0006882_3516_4004 160
198 3300035695 Ga0373927_0034762 Ga0373927_0034762_1692_2186 160
199 3300036401 Ga0373937_0006062 Ga0373937_0006062_4969_5466 160
200 3300037068 Ga0373925_0045596 Ga0373925_0045596_259_753 160
201 3300037068 Ga0373925_0335765 Ga0373925_0335765_160_648 160
202 3300037068 Ga0373925_0646457 Ga0373925_0646457_241_729 160
203 3300041997 Ga0439431_0084438 Ga0439431_0084438_232_732 160
204 3300042876 Ga0451577_0318117 Ga0451577_0318117_725_1219 160
205 3300046459 Ga0495629_0056246 Ga0495629_0056246_494_991 160
206 3300046460 Ga0495638_0008078 Ga0495638_0008078_3941_4435 160
207 3300046460 Ga0495638_0125300 Ga0495638_0125300_846_1346 160
208 3300046477 Ga0495664_0310201 Ga0495664_0310201_409_906 160
209 3300046492 Ga0495585_0281625 Ga0495585_0281625_264_761 160
210 3300046516 Ga0495628_0148849 Ga0495628_0148849_1082_1579 160
211 3300046543 Ga0495645_0085218 Ga0495645_0085218_939_1436 160
212 3300046559 Ga0495667_0116573 Ga0495667_0116573_170_667 160
213 3300046660 Ga0495625_0064695 Ga0495625_0064695_1335_1829 160
214 3300046663 Ga0495635_0033451 Ga0495635_0033451_2562_3059 160
215 3300046675 Ga0495657_0068025 Ga0495657_0068025_1163_1660 160
216 3300046681 Ga0495647_0318148 Ga0495647_0318148_31_525 160
217 3300046683 Ga0495658_0129605 Ga0495658_0129605_859_1356 160
218 3300047317 Ga0495604_0058823 Ga0495604_0058823_1900_2397 160
219 3300047320 Ga0495672_0149341 Ga0495672_0149341_567_1055 160
220 3300047444 Ga0495675_0257236 Ga0495675_0257236_287_775 160
221 3300047471 Ga0495684_0011976 Ga0495684_0011976_555_1052 160
222 3300048088 Ga0495602_0467633 Ga0495602_0467633_172_669 160
223 3300048911 Ga0496108_0047944 Ga0496108_0047944_1644_2129 160
224 3300048912 Ga0496109_0113065 Ga0496109_0113065_130_615 160
225 3300048914 Ga0496111_0268892 Ga0496111_0268892_319_807 160
226 3300048916 Ga0496113_0012014 Ga0496113_0012014_3952_4437 160
227 3300048924 Ga0496121_0084225 Ga0496121_0084225_709_1203 160
228 3300048928 Ga0496125_0024927 Ga0496125_0024927_1195_1680 160
229 3300048928 Ga0496125_0216524 Ga0496125_0216524_101_586 160
230 3300049571 Ga0501034_0181126 Ga0501034_0181126_1493_1984 160
231 3300049581 Ga0501047_0510192 Ga0501047_0510192_376_867 160
232 3300049589 Ga0501073_0082245 Ga0501073_0082245_161_652 160
233 3300049592 Ga0501076_0031032 Ga0501076_0031032_2133_2624 160
234 3300049742 Ga0501080_0070795 Ga0501080_0070795_1811_2302 160
235 3300049744 Ga0501083_0032266 Ga0501083_0032266_3090_3581 160
236 3300049824 Ga0501045_0116947 Ga0501045_0116947_1309_1800 160
237 3300050493 nmdc:mga0k408_113684_c1 nmdc:mga0k408_113684_c1_146_646 160
238 3300053085 Ga0495619_0005513 Ga0495619_0005513_749_1246 160
239 3300053139 Ga0500568_0001210 Ga0500568_0001210_1436_1924 160
240 3300054114 Ga0501084_0831738 Ga0501084_0831738_162_653 160
241 3300005290 Ga0065712_10073660 Ga0065712_100736604 161
242 3300005329 Ga0070683_100182540 Ga0070683_1001825402 161
243 3300005331 Ga0070670_101469491 Ga0070670_1014694911 161
244 3300005335 Ga0070666_10028903 Ga0070666_100289035 161
245 3300005338 Ga0068868_100157861 Ga0068868_1001578612 161
246 3300005338 Ga0068868_100290290 Ga0068868_1002902901 161
247 3300005340 Ga0070689_100012897 Ga0070689_1000128977 161
248 3300005343 Ga0070687_100504210 Ga0070687_1005042101 161
249 3300005347 Ga0070668_100288542 Ga0070668_1002885422 161
250 3300005354 Ga0070675_100006757 Ga0070675_1000067571 161
251 3300005355 Ga0070671_100153698 Ga0070671_1001536983 161
252 3300005355 Ga0070671_100184508 Ga0070671_1001845081 161
253 3300005364 Ga0070673_100340416 Ga0070673_1003404162 161
254 3300005364 Ga0070673_100562856 Ga0070673_1005628562 161
255 3300005365 Ga0070688_100013718 Ga0070688_1000137183 161
256 3300005365 Ga0070688_100433004 Ga0070688_1004330042 161
257 3300005367 Ga0070667_100031347 Ga0070667_1000313473 161
258 3300005367 Ga0070667_100148699 Ga0070667_1001486993 161
259 3300005455 Ga0070663_100153281 Ga0070663_1001532812 161
260 3300005459 Ga0068867_100055314 Ga0068867_1000553143 161
261 3300005466 Ga0070685_10799127 Ga0070685_107991271 161
262 3300005535 Ga0070684_100513698 Ga0070684_1005136982 161
263 3300005539 Ga0068853_100733854 Ga0068853_1007338542 161
264 3300005546 Ga0070696_100095010 Ga0070696_1000950102 161
265 3300005547 Ga0070693_100002643 Ga0070693_1000026437 161
266 3300005548 Ga0070665_100081831 Ga0070665_1000818313 161
267 3300005563 Ga0068855_100117653 Ga0068855_1001176533 161
268 3300005563 Ga0068855_100954548 Ga0068855_1009545482 161
269 3300005564 Ga0070664_100160545 Ga0070664_1001605452 161
270 3300005577 Ga0068857_100033922 Ga0068857_1000339225 161
271 3300005578 Ga0068854_100027117 Ga0068854_1000271174 161
272 3300005614 Ga0068856_100068183 Ga0068856_1000681832 161
273 3300005616 Ga0068852_100143084 Ga0068852_1001430842 161
274 3300005617 Ga0068859_100457976 Ga0068859_1004579762 161
275 3300005618 Ga0068864_100184874 Ga0068864_1001848743 161
276 3300005718 Ga0068866_10402514 Ga0068866_104025142 161
277 3300005834 Ga0068851_10172710 Ga0068851_101727102 161
278 3300005841 Ga0068863_100638734 Ga0068863_1006387342 161
279 3300005842 Ga0068858_100108013 Ga0068858_1001080132 161
280 3300005842 Ga0068858_100402966 Ga0068858_1004029661 161
281 3300006028 Ga0070717_10307105 Ga0070717_103071052 161
282 3300006048 Ga0075363_100278658 Ga0075363_1002786581 161
283 3300006051 Ga0075364_10081975 Ga0075364_100819753 161
284 3300006177 Ga0075362_10229580 Ga0075362_102295802 161
285 3300006178 Ga0075367_10324976 Ga0075367_103249761 161
286 3300006195 Ga0075366_10010093 Ga0075366_100100934 161
287 3300006237 Ga0097621_100029484 Ga0097621_1000294843 161
288 3300006237 Ga0097621_100769244 Ga0097621_1007692442 161
289 3300006358 Ga0068871_100106078 Ga0068871_1001060783 161
290 3300006358 Ga0068871_100136919 Ga0068871_1001369193 161
291 3300006846 Ga0075430_100034074 Ga0075430_1000340741 161
292 3300006881 Ga0068865_100031222 Ga0068865_1000312224 161
293 3300006881 Ga0068865_100450875 Ga0068865_1004508752 161
294 3300006931 Ga0097620_100457962 Ga0097620_1004579622 161
295 3300007076 Ga0075435_100890519 Ga0075435_1008905191 161
296 3300009098 Ga0105245_11174931 Ga0105245_111749311 161
297 3300009098 Ga0105245_12143627 Ga0105245_121436271 161
298 3300009174 Ga0105241_10128958 Ga0105241_101289582 161
299 3300009177 Ga0105248_10044017 Ga0105248_100440175 161
300 3300009551 Ga0105238_10056363 Ga0105238_100563634 161
301 3300009551 Ga0105238_10073952 Ga0105238_100739524 161
302 3300009551 Ga0105238_10182997 Ga0105238_101829973 161
303 3300009553 Ga0105249_10205327 Ga0105249_102053272 161
304 3300011119 Ga0105246_10410841 Ga0105246_104108412 161
305 3300013296 Ga0157374_10327811 Ga0157374_103278113 161
306 3300013296 Ga0157374_10665818 Ga0157374_106658181 161
307 3300013297 Ga0157378_10351037 Ga0157378_103510371 161
308 3300013306 Ga0163162_10130877 Ga0163162_101308773 161
309 3300013306 Ga0163162_11741408 Ga0163162_117414082 161
310 3300013307 Ga0157372_11426743 Ga0157372_114267432 161
311 3300014325 Ga0163163_10704965 Ga0163163_107049652 161
312 3300014326 Ga0157380_10005575 Ga0157380_100055759 161
313 3300014968 Ga0157379_10800502 Ga0157379_108005022 161
314 3300014969 Ga0157376_10351679 Ga0157376_103516792 161
315 3300025261 Ga0209233_1011598 Ga0209233_10115984 161
316 3300025321 Ga0207656_10048892 Ga0207656_100488922 161
317 3300025911 Ga0207654_10000066 Ga0207654_1000006651 161
318 3300025924 Ga0207694_10085965 Ga0207694_100859653 161
319 3300025924 Ga0207694_10179922 Ga0207694_101799222 161
320 3300025924 Ga0207694_10190707 Ga0207694_101907072 161
321 3300025924 Ga0207694_10621120 Ga0207694_106211202 161
322 3300025925 Ga0207650_10107709 Ga0207650_101077093 161
323 3300025927 Ga0207687_10068943 Ga0207687_100689432 161
324 3300025934 Ga0207686_10009412 Ga0207686_100094126 161
325 3300025936 Ga0207670_10272851 Ga0207670_102728512 161
326 3300025938 Ga0207704_10190400 Ga0207704_101904002 161
327 3300025941 Ga0207711_10354843 Ga0207711_103548432 161
328 3300025942 Ga0207689_10068293 Ga0207689_100682933 161
329 3300025945 Ga0207679_10029011 Ga0207679_100290114 161
330 3300025949 Ga0207667_10195614 Ga0207667_101956143 161
331 3300025949 Ga0207667_10617780 Ga0207667_106177802 161
332 3300025960 Ga0207651_10119037 Ga0207651_101190373 161
333 3300025960 Ga0207651_10439986 Ga0207651_104399862 161
334 3300025961 Ga0207712_10247187 Ga0207712_102471873 161
335 3300025972 Ga0207668_10266626 Ga0207668_102666262 161
336 3300025981 Ga0207640_10074513 Ga0207640_100745133 161
337 3300025986 Ga0207658_10183357 Ga0207658_101833572 161
338 3300025986 Ga0207658_10355862 Ga0207658_103558621 161
339 3300026041 Ga0207639_10477191 Ga0207639_104771912 161
340 3300026078 Ga0207702_11043160 Ga0207702_110431601 161
341 3300026088 Ga0207641_10383426 Ga0207641_103834262 161
342 3300026089 Ga0207648_10149152 Ga0207648_101491522 161
343 3300026095 Ga0207676_10640214 Ga0207676_106402142 161
344 3300026116 Ga0207674_10076088 Ga0207674_100760883 161
345 3300026116 Ga0207674_10106286 Ga0207674_101062863 161
346 3300026116 Ga0207674_10810171 Ga0207674_108101712 161
347 3300026142 Ga0207698_11022169 Ga0207698_110221692 161
348 3300028379 Ga0268266_10092294 Ga0268266_100922944 161
349 3300031251 Ga0265327_10104843 Ga0265327_101048431 161
350 3300031824 Ga0307413_10088260 Ga0307413_100882603 161
351 3300031824 Ga0307413_10726263 Ga0307413_107262632 161
352 3300035120 Ga0373957_0248328 Ga0373957_0248328_126_623 161
353 3300035172 Ga0373955_0104792 Ga0373955_0104792_209_706 161
354 3300035692 Ga0373935_0376423 Ga0373935_0376423_72_569 161
355 3300041451 Ga0451791_0401505 Ga0451791_0401505_1610_2095 161
356 3300041451 Ga0451791_1329675 Ga0451791_1329675_109_594 161
357 3300041460 Ga0451802_1042238 Ga0451802_1042238_659_1144 161
358 3300041463 Ga0451804_0307298 Ga0451804_0307298_199_684 161
359 3300041486 Ga0451807_0155889 Ga0451807_0155889_677_1162 161
360 3300041494 Ga0451837_0107029 Ga0451837_0107029_1127_1612 161
361 3300041494 Ga0451837_0381109 Ga0451837_0381109_708_1193 161
362 3300042876 Ga0451577_0375764 Ga0451577_0375764_668_1165 161
363 3300046454 Ga0495592_0120393 Ga0495592_0120393_872_1369 161
364 3300046462 Ga0495651_0104976 Ga0495651_0104976_17_514 161
365 3300046511 Ga0495608_0189403 Ga0495608_0189403_333_830 161
366 3300046516 Ga0495628_0120775 Ga0495628_0120775_213_710 161
367 3300046529 Ga0495652_0174652 Ga0495652_0174652_252_749 161
368 3300046536 Ga0495587_0080671 Ga0495587_0080671_826_1323 161
369 3300046543 Ga0495645_0136859 Ga0495645_0136859_739_1236 161
370 3300046559 Ga0495667_0147015 Ga0495667_0147015_848_1345 161
371 3300046675 Ga0495657_0028273 Ga0495657_0028273_3168_3665 161
372 3300046679 Ga0495623_0119945 Ga0495623_0119945_872_1369 161
373 3300046689 Ga0495613_0624211 Ga0495613_0624211_59_556 161
374 3300047317 Ga0495604_0124017 Ga0495604_0124017_500_997 161
375 3300047471 Ga0495684_0346330 Ga0495684_0346330_298_795 161
376 3300048088 Ga0495602_0373648 Ga0495602_0373648_247_744 161
377 3300048905 Ga0496102_0734201 Ga0496102_0734201_243_743 161
378 3300048912 Ga0496109_0440352 Ga0496109_0440352_693_1181 161
379 3300048917 Ga0496114_1335055 Ga0496114_1335055_86_580 161
380 3300048924 Ga0496121_0141953 Ga0496121_0141953_332_832 161
381 3300048928 Ga0496125_0412248 Ga0496125_0412248_53_541 161
382 3300049568 Ga0501031_0039301 Ga0501031_0039301_2547_3041 161
383 3300049569 Ga0501032_0032581 Ga0501032_0032581_2374_2865 161
384 3300049569 Ga0501032_0200553 Ga0501032_0200553_563_1051 161
385 3300049570 Ga0501033_0074403 Ga0501033_0074403_893_1381 161
386 3300049571 Ga0501034_0001724 Ga0501034_0001724_23312_23800 161
387 3300049571 Ga0501034_0126272 Ga0501034_0126272_355_843 161
388 3300049571 Ga0501034_0146951 Ga0501034_0146951_1595_2086 161
389 3300049572 Ga0501036_0551496 Ga0501036_0551496_169_663 161
390 3300049572 Ga0501036_0653395 Ga0501036_0653395_333_821 161
391 3300049572 Ga0501036_1127952 Ga0501036_1127952_80_571 161
392 3300049573 Ga0501037_0150259 Ga0501037_0150259_28_522 161
393 3300049573 Ga0501037_0238428 Ga0501037_0238428_29_520 161
394 3300049574 Ga0501038_0019453 Ga0501038_0019453_3085_3579 161
395 3300049574 Ga0501038_0359075 Ga0501038_0359075_107_595 161
396 3300049575 Ga0501039_0030698 Ga0501039_0030698_3262_3756 161
397 3300049575 Ga0501039_0221944 Ga0501039_0221944_664_1152 161
398 3300049577 Ga0501041_0007930 Ga0501041_0007930_5133_5627 161
399 3300049578 Ga0501042_0305891 Ga0501042_0305891_256_750 161
400 3300049579 Ga0501043_0003654 Ga0501043_0003654_5911_6399 161
401 3300049579 Ga0501043_0132366 Ga0501043_0132366_1015_1509 161
402 3300049579 Ga0501043_0164621 Ga0501043_0164621_617_1111 161
403 3300049580 Ga0501046_0015448 Ga0501046_0015448_1229_1723 161
404 3300049580 Ga0501046_0054043 Ga0501046_0054043_13_501 161
405 3300049580 Ga0501046_0162254 Ga0501046_0162254_787_1281 161
406 3300049581 Ga0501047_0001196 Ga0501047_0001196_9529_10023 161
407 3300049581 Ga0501047_0001416 Ga0501047_0001416_9416_9904 161
408 3300049581 Ga0501047_1070930 Ga0501047_1070930_74_562 161
409 3300049582 Ga0501048_0081172 Ga0501048_0081172_716_1204 161
410 3300049582 Ga0501048_0413846 Ga0501048_0413846_110_604 161
411 3300049582 Ga0501048_0502865 Ga0501048_0502865_169_663 161
412 3300049584 Ga0501068_0077570 Ga0501068_0077570_34_528 161
413 3300049584 Ga0501068_0266891 Ga0501068_0266891_580_1068 161
414 3300049585 Ga0501069_0017848 Ga0501069_0017848_1250_1744 161
415 3300049586 Ga0501070_0001751 Ga0501070_0001751_10852_11340 161
416 3300049586 Ga0501070_0002827 Ga0501070_0002827_168_656 161
417 3300049586 Ga0501070_0050328 Ga0501070_0050328_2538_3032 161
418 3300049586 Ga0501070_0090232 Ga0501070_0090232_1868_2356 161
419 3300049587 Ga0501071_0349800 Ga0501071_0349800_617_1111 161
420 3300049588 Ga0501072_0256236 Ga0501072_0256236_168_656 161
421 3300049588 Ga0501072_0315842 Ga0501072_0315842_263_757 161
422 3300049589 Ga0501073_0039910 Ga0501073_0039910_538_1026 161
423 3300049589 Ga0501073_0295662 Ga0501073_0295662_74_568 161
424 3300049590 Ga0501074_0003781 Ga0501074_0003781_5665_6159 161
425 3300049590 Ga0501074_0005065 Ga0501074_0005065_3475_3963 161
426 3300049590 Ga0501074_0211829 Ga0501074_0211829_848_1342 161
427 3300049591 Ga0501075_0118012 Ga0501075_0118012_1085_1579 161
428 3300049592 Ga0501076_0036539 Ga0501076_0036539_2902_3396 161
429 3300049593 Ga0501077_0470240 Ga0501077_0470240_25_519 161
430 3300049741 Ga0501079_0008655 Ga0501079_0008655_7098_7592 161
431 3300049741 Ga0501079_0012401 Ga0501079_0012401_53_541 161
432 3300049741 Ga0501079_0113180 Ga0501079_0113180_297_785 161
433 3300049741 Ga0501079_0896104 Ga0501079_0896104_187_681 161
434 3300049742 Ga0501080_0009065 Ga0501080_0009065_4468_4956 161
435 3300049742 Ga0501080_0021486 Ga0501080_0021486_913_1407 161
436 3300049742 Ga0501080_0072753 Ga0501080_0072753_532_1026 161
437 3300049742 Ga0501080_0125100 Ga0501080_0125100_28_516 161
438 3300049742 Ga0501080_0236388 Ga0501080_0236388_562_1050 161
439 3300049743 Ga0501081_0110592 Ga0501081_0110592_454_948 161
440 3300049744 Ga0501083_0723980 Ga0501083_0723980_49_537 161
441 3300049822 Ga0501035_0112283 Ga0501035_0112283_1342_1836 161
442 3300049822 Ga0501035_0131129 Ga0501035_0131129_1437_1925 161
443 3300049822 Ga0501035_1054738 Ga0501035_1054738_86_574 161
444 3300049823 Ga0501044_0115863 Ga0501044_0115863_1673_2161 161
445 3300049823 Ga0501044_0962933 Ga0501044_0962933_142_630 161
446 3300049824 Ga0501045_0143901 Ga0501045_0143901_565_1059 161
447 3300050491 nmdc:mga00v17_143788_c1 nmdc:mga00v17_143788_c1_25_528 161
448 3300050493 nmdc:mga0k408_66584_c1 nmdc:mga0k408_66584_c1_628_1131 161
449 3300050509 nmdc:mga0qj67_18581_c1 nmdc:mga0qj67_18581_c1_126_623 161
450 3300053084 Ga0495595_0070125 Ga0495595_0070125_32_529 161
451 3300053736 Ga0500599_005582 Ga0500599_005582_858_1379 161
452 3300054114 Ga0501084_0007827 Ga0501084_0007827_2384_2878 161
453 3300060353 Ga0501082_0018624 Ga0501082_0018624_269_763 161
454 3300060353 Ga0501082_0044536 Ga0501082_0044536_3021_3515 161
455 3300061734 Ga0530510_0187427 Ga0530510_0187427_169_663 161
456 3300001904 JGI24736J21556_1008608 JGI24736J21556_10086082 162
457 3300001989 JGI24739J22299_10001810 JGI24739J22299_100018109 162
458 3300001990 JGI24737J22298_10001918 JGI24737J22298_100019186 162
459 3300001990 JGI24737J22298_10179732 JGI24737J22298_101797321 162
460 3300002067 JGI24735J21928_10002849 JGI24735J21928_100028493 162
461 3300002067 JGI24735J21928_10007156 JGI24735J21928_100071564 162
462 3300002067 JGI24735J21928_10045229 JGI24735J21928_100452293 162
463 3300002075 JGI24738J21930_10045317 JGI24738J21930_100453172 162
464 3300002705 JGI25156J39149_1001007 JGI25156J39149_10010075 162
465 3300002705 JGI25156J39149_1006545 JGI25156J39149_10065454 162
466 3300002737 JGI25162J39368_1000538 JGI25162J39368_100053826 162
467 3300002737 JGI25162J39368_1001470 JGI25162J39368_100147010 162
468 3300002738 JGI25154J39366_1006550 JGI25154J39366_10065503 162
469 3300002741 JGI25157J39369_1000731 JGI25157J39369_10007312 162
470 3300002741 JGI25157J39369_1001489 JGI25157J39369_10014892 162
471 3300002772 JGI25164J39214_1000064 JGI25164J39214_100006433 162
472 3300003214 JGI25165J46597_1000278 JGI25165J46597_100027832 162
473 3300003316 rootH1_10022311 rootH1_100223115 162
474 3300003320 rootH2_10000507 rootH2_1000050723 162
475 3300003320 rootH2_10053565 rootH2_100535652 162
476 3300003323 rootH1_10139123 rootH1_101391234 162
477 3300003578 Ga0006562J51391_1027929 Ga0006562J51391_10279291 162
478 3300003578 Ga0006562J51391_1027930 Ga0006562J51391_10279304 162
479 3300003578 Ga0006562J51391_1033987 Ga0006562J51391_10339874 162
480 3300003578 Ga0006562J51391_1033988 Ga0006562J51391_10339884 162
481 3300003752 Ga0055539_1001315 Ga0055539_10013153 162
482 3300003756 Ga0055533_1000716 Ga0055533_10007165 162
483 3300003756 Ga0055533_1001494 Ga0055533_10014944 162
484 3300003759 Ga0055525_1000043 Ga0055525_100004385 162
485 3300003760 Ga0055527_1000028 Ga0055527_1000028149 162
486 3300003760 Ga0055527_1000068 Ga0055527_100006816 162
487 3300003760 Ga0055527_1002157 Ga0055527_10021573 162
488 3300003761 Ga0055535_1000081 Ga0055535_100008116 162
489 3300003761 Ga0055535_1000090 Ga0055535_100009016 162
490 3300003761 Ga0055535_1000351 Ga0055535_100035113 162
491 3300003761 Ga0055535_1000368 Ga0055535_100036836 162
492 3300003761 Ga0055535_1008265 Ga0055535_10082653 162
493 3300003762 Ga0055542_1000053 Ga0055542_1000053149 162
494 3300003762 Ga0055542_1000093 Ga0055542_100009316 162
495 3300003762 Ga0055542_1000113 Ga0055542_100011379 162
496 3300003762 Ga0055542_1000417 Ga0055542_10004174 162
497 3300003762 Ga0055542_1000450 Ga0055542_100045015 162
498 3300003763 Ga0055529_1000104 Ga0055529_1000104101 162
499 3300003763 Ga0055529_1000281 Ga0055529_100028116 162
500 3300003763 Ga0055529_1000312 Ga0055529_100031222 162
501 3300003771 Ga0055526_1017184 Ga0055526_10171842 162
502 3300003775 Ga0055524_1000715 Ga0055524_10007159 162
503 3300003784 Ga0055534_1001790 Ga0055534_10017909 162
504 3300005327 Ga0070658_10004443 Ga0070658_100044439 162
505 3300005327 Ga0070658_10573874 Ga0070658_105738742 162
506 3300005335 Ga0070666_10000001 Ga0070666_1000000110 162
507 3300005337 Ga0070682_100015838 Ga0070682_1000158383 162
508 3300005339 Ga0070660_100017448 Ga0070660_1000174483 162
509 3300005339 Ga0070660_100036930 Ga0070660_1000369303 162
510 3300005339 Ga0070660_100924514 Ga0070660_1009245141 162
511 3300005340 Ga0070689_100007728 Ga0070689_1000077285 162
512 3300005344 Ga0070661_100079076 Ga0070661_1000790761 162
513 3300005344 Ga0070661_100103377 Ga0070661_1001033773 162
514 3300005344 Ga0070661_101081743 Ga0070661_1010817431 162
515 3300005344 Ga0070661_101243723 Ga0070661_1012437231 162
516 3300005345 Ga0070692_10108345 Ga0070692_101083451 162
517 3300005347 Ga0070668_100160832 Ga0070668_1001608322 162
518 3300005347 Ga0070668_101662633 Ga0070668_1016626331 162
519 3300005366 Ga0070659_100005242 Ga0070659_1000052425 162
520 3300005366 Ga0070659_100029016 Ga0070659_1000290164 162
521 3300005367 Ga0070667_100021861 Ga0070667_1000218611 162
522 3300005367 Ga0070667_100382788 Ga0070667_1003827882 162
523 3300005444 Ga0070694_100183911 Ga0070694_1001839113 162
524 3300005455 Ga0070663_100021903 Ga0070663_1000219031 162
525 3300005455 Ga0070663_100068878 Ga0070663_1000688782 162
526 3300005455 Ga0070663_100193484 Ga0070663_1001934843 162
527 3300005455 Ga0070663_100227861 Ga0070663_1002278612 162
528 3300005457 Ga0070662_100152837 Ga0070662_1001528372 162
529 3300005458 Ga0070681_10000073 Ga0070681_1000007375 162
530 3300005458 Ga0070681_10012053 Ga0070681_100120533 162
531 3300005458 Ga0070681_10055196 Ga0070681_100551964 162
532 3300005530 Ga0070679_100224206 Ga0070679_1002242062 162
533 3300005539 Ga0068853_100006034 Ga0068853_1000060343 162
534 3300005539 Ga0068853_100201062 Ga0068853_1002010622 162
535 3300005539 Ga0068853_100558899 Ga0068853_1005588992 162
536 3300005546 Ga0070696_100379146 Ga0070696_1003791461 162
537 3300005547 Ga0070693_100030504 Ga0070693_1000305041 162
538 3300005548 Ga0070665_100077205 Ga0070665_1000772052 162
539 3300005548 Ga0070665_100141214 Ga0070665_1001412143 162
540 3300005563 Ga0068855_100007063 Ga0068855_10000706313 162
541 3300005563 Ga0068855_100041946 Ga0068855_1000419465 162
542 3300005563 Ga0068855_100089822 Ga0068855_1000898222 162
543 3300005563 Ga0068855_100184728 Ga0068855_1001847283 162
544 3300005563 Ga0068855_100201748 Ga0068855_1002017481 162
545 3300005563 Ga0068855_100982820 Ga0068855_1009828202 162
546 3300005577 Ga0068857_100025014 Ga0068857_1000250146 162
547 3300005577 Ga0068857_100107679 Ga0068857_1001076793 162
548 3300005577 Ga0068857_100158849 Ga0068857_1001588492 162
549 3300005578 Ga0068854_100000943 Ga0068854_10000094313 162
550 3300005578 Ga0068854_100015417 Ga0068854_1000154173 162
551 3300005578 Ga0068854_100097432 Ga0068854_1000974322 162
552 3300005614 Ga0068856_100000207 Ga0068856_10000020748 162
553 3300005614 Ga0068856_100002737 Ga0068856_1000027378 162
554 3300005614 Ga0068856_100721415 Ga0068856_1007214152 162
555 3300005616 Ga0068852_100015672 Ga0068852_1000156724 162
556 3300005842 Ga0068858_100057882 Ga0068858_1000578824 162
557 3300005842 Ga0068858_100141583 Ga0068858_1001415833 162
558 3300005843 Ga0068860_100017690 Ga0068860_1000176903 162
559 3300005843 Ga0068860_100652674 Ga0068860_1006526742 162
560 3300006186 Ga0075369_10012978 Ga0075369_100129783 162
561 3300009011 Ga0105251_10000166 Ga0105251_1000016658 162
562 3300009093 Ga0105240_10007148 Ga0105240_100071486 162
563 3300009093 Ga0105240_10007501 Ga0105240_100075017 162
564 3300009093 Ga0105240_10013903 Ga0105240_1001390311 162
565 3300009093 Ga0105240_10018515 Ga0105240_100185152 162
566 3300009101 Ga0105247_10012698 Ga0105247_100126985 162
567 3300009174 Ga0105241_11177058 Ga0105241_111770581 162
568 3300009545 Ga0105237_10000022 Ga0105237_1000002230 162
569 3300009545 Ga0105237_11249219 Ga0105237_112492191 162
570 3300009551 Ga0105238_10061673 Ga0105238_100616734 162
571 3300009551 Ga0105238_10067278 Ga0105238_100672782 162
572 3300009551 Ga0105238_10080064 Ga0105238_100800644 162
573 3300009551 Ga0105238_10806858 Ga0105238_108068582 162
574 3300009551 Ga0105238_11226149 Ga0105238_112261492 162
575 3300009982 Ga0105147_101012 Ga0105147_1010122 162
576 3300010375 Ga0105239_10000480 Ga0105239_1000048037 162
577 3300010375 Ga0105239_10044538 Ga0105239_100445382 162
578 3300010375 Ga0105239_10902952 Ga0105239_109029522 162
579 3300012500 Ga0157314_1000016 Ga0157314_100001611 162
580 3300012502 Ga0157347_1001364 Ga0157347_10013642 162
581 3300013100 Ga0157373_10025784 Ga0157373_100257844 162
582 3300013100 Ga0157373_10451038 Ga0157373_104510381 162
583 3300013100 Ga0157373_10724601 Ga0157373_107246011 162
584 3300013102 Ga0157371_10021378 Ga0157371_100213784 162
585 3300013102 Ga0157371_10131813 Ga0157371_101318133 162
586 3300013104 Ga0157370_10002571 Ga0157370_1000257114 162
587 3300013104 Ga0157370_10003277 Ga0157370_100032774 162
588 3300013104 Ga0157370_10040527 Ga0157370_100405271 162
589 3300013104 Ga0157370_10247442 Ga0157370_102474422 162
590 3300013104 Ga0157370_11651885 Ga0157370_116518851 162
591 3300013105 Ga0157369_10062027 Ga0157369_100620274 162
592 3300013105 Ga0157369_10063520 Ga0157369_100635204 162
593 3300013105 Ga0157369_10281078 Ga0157369_102810781 162
594 3300013296 Ga0157374_11080610 Ga0157374_110806102 162
595 3300013306 Ga0163162_10000810 Ga0163162_100008103 162
596 3300013307 Ga0157372_10047613 Ga0157372_100476134 162
597 3300013307 Ga0157372_10379465 Ga0157372_103794652 162
598 3300014497 Ga0182008_10039688 Ga0182008_100396884 162
599 3300014497 Ga0182008_10084244 Ga0182008_100842441 162
600 3300014969 Ga0157376_10065585 Ga0157376_100655854 162
601 3300015261 Ga0182006_1000058 Ga0182006_10000589 162
602 3300015262 Ga0182007_10000640 Ga0182007_1000064013 162
603 3300015262 Ga0182007_10017026 Ga0182007_100170262 162
604 3300015262 Ga0182007_10145714 Ga0182007_101457142 162
605 3300015265 Ga0182005_1002232 Ga0182005_10022325 162
606 3300015687 Ga0183368_1002 Ga0183368_10021048 162
607 3300017792 Ga0163161_10004052 Ga0163161_100040522 162
608 3300017792 Ga0163161_10025432 Ga0163161_100254324 162
609 3300020070 Ga0206356_11117712 Ga0206356_111177121 162
610 3300020082 Ga0206353_10911170 Ga0206353_109111702 162
611 3300025206 Ga0209435_113671 Ga0209435_1136711 162
612 3300025225 Ga0209566_104006 Ga0209566_1040062 162
613 3300025226 Ga0209674_100014 Ga0209674_100014412 162
614 3300025226 Ga0209674_100059 Ga0209674_100059144 162
615 3300025228 Ga0209672_100004 Ga0209672_100004682 162
616 3300025228 Ga0209672_100008 Ga0209672_100008586 162
617 3300025228 Ga0209672_100019 Ga0209672_100019284 162
618 3300025228 Ga0209672_100148 Ga0209672_10014840 162
619 3300025228 Ga0209672_100250 Ga0209672_1002504 162
620 3300025228 Ga0209672_101111 Ga0209672_1011117 162
621 3300025229 Ga0209147_100026 Ga0209147_100026284 162
622 3300025230 Ga0209563_100036 Ga0209563_100036213 162
623 3300025231 Ga0207427_100037 Ga0207427_100037231 162
624 3300025233 Ga0209437_100213 Ga0209437_10021332 162
625 3300025233 Ga0209437_100257 Ga0209437_10025731 162
626 3300025233 Ga0209437_106796 Ga0209437_1067962 162
627 3300025242 Ga0209258_100003 Ga0209258_100003682 162
628 3300025242 Ga0209258_100004 Ga0209258_100004604 162
629 3300025242 Ga0209258_100008 Ga0209258_100008229 162
630 3300025242 Ga0209258_100057 Ga0209258_10005785 162
631 3300025242 Ga0209258_100106 Ga0209258_100106114 162
632 3300025242 Ga0209258_100253 Ga0209258_10025350 162
633 3300025242 Ga0209258_101587 Ga0209258_1015874 162
634 3300025242 Ga0209258_102649 Ga0209258_1026494 162
635 3300025246 Ga0209646_1000836 Ga0209646_10008369 162
636 3300025246 Ga0209646_1000920 Ga0209646_10009209 162
637 3300025250 Ga0209026_1000045 Ga0209026_1000045225 162
638 3300025250 Ga0209026_1000203 Ga0209026_100020369 162
639 3300025250 Ga0209026_1000368 Ga0209026_100036814 162
640 3300025250 Ga0209026_1001886 Ga0209026_10018869 162
641 3300025250 Ga0209026_1005722 Ga0209026_10057222 162
642 3300025253 Ga0209677_105222 Ga0209677_1052222 162
643 3300025254 Ga0209148_1000002 Ga0209148_1000002594 162
644 3300025254 Ga0209148_1000016 Ga0209148_1000016682 162
645 3300025254 Ga0209148_1000042 Ga0209148_1000042240 162
646 3300025254 Ga0209148_1000068 Ga0209148_100006885 162
647 3300025254 Ga0209148_1000200 Ga0209148_100020079 162
648 3300025254 Ga0209148_1001546 Ga0209148_10015469 162
649 3300025256 Ga0209759_1000117 Ga0209759_100011711 162
650 3300025256 Ga0209759_1000185 Ga0209759_100018517 162
651 3300025256 Ga0209759_1002855 Ga0209759_10028554 162
652 3300025256 Ga0209759_1003448 Ga0209759_10034482 162
653 3300025258 Ga0209129_1002704 Ga0209129_10027042 162
654 3300025258 Ga0209129_1012943 Ga0209129_10129433 162
655 3300025261 Ga0209233_1000096 Ga0209233_1000096232 162
656 3300025261 Ga0209233_1019797 Ga0209233_10197972 162
657 3300025261 Ga0209233_1058431 Ga0209233_10584312 162
658 3300025263 Ga0209565_1000094 Ga0209565_100009440 162
659 3300025272 Ga0209455_1000004 Ga0209455_1000004682 162
660 3300025272 Ga0209455_1000007 Ga0209455_1000007349 162
661 3300025272 Ga0209455_1000016 Ga0209455_1000016495 162
662 3300025272 Ga0209455_1000103 Ga0209455_1000103173 162
663 3300025272 Ga0209455_1000142 Ga0209455_1000142115 162
664 3300025272 Ga0209455_1003324 Ga0209455_10033247 162
665 3300025272 Ga0209455_1005694 Ga0209455_10056945 162
666 3300025272 Ga0209455_1007165 Ga0209455_10071653 162
667 3300025273 Ga0209673_1058028 Ga0209673_10580282 162
668 3300025291 Ga0209675_1002994 Ga0209675_10029948 162
669 3300025294 Ga0209025_1002073 Ga0209025_100207311 162
670 3300025295 Ga0209564_1000942 Ga0209564_100094229 162
671 3300025297 Ga0209758_1000491 Ga0209758_100049126 162
672 3300025297 Ga0209758_1024734 Ga0209758_10247343 162
673 3300025297 Ga0209758_1025701 Ga0209758_10257013 162
674 3300025299 Ga0209256_1001544 Ga0209256_10015449 162
675 3300025299 Ga0209256_1012538 Ga0209256_10125383 162
676 3300025303 Ga0209051_1018386 Ga0209051_10183863 162
677 3300025735 Ga0207713_1000221 Ga0207713_100022137 162
678 3300025900 Ga0207710_10005665 Ga0207710_100056656 162
679 3300025903 Ga0207680_10000003 Ga0207680_1000000365 162
680 3300025903 Ga0207680_10233838 Ga0207680_102338382 162
681 3300025904 Ga0207647_10000005 Ga0207647_10000005105 162
682 3300025904 Ga0207647_10012567 Ga0207647_100125674 162
683 3300025904 Ga0207647_10023640 Ga0207647_100236404 162
684 3300025907 Ga0207645_10128939 Ga0207645_101289392 162
685 3300025909 Ga0207705_10006165 Ga0207705_100061654 162
686 3300025912 Ga0207707_10000105 Ga0207707_1000010515 162
687 3300025912 Ga0207707_10037229 Ga0207707_100372294 162
688 3300025913 Ga0207695_10001444 Ga0207695_1000144420 162
689 3300025913 Ga0207695_10003927 Ga0207695_1000392718 162
690 3300025913 Ga0207695_10004251 Ga0207695_100042516 162
691 3300025913 Ga0207695_10004499 Ga0207695_1000449913 162
692 3300025913 Ga0207695_10010604 Ga0207695_100106046 162
693 3300025913 Ga0207695_10011161 Ga0207695_100111612 162
694 3300025914 Ga0207671_10000009 Ga0207671_10000009600 162
695 3300025914 Ga0207671_10000205 Ga0207671_1000020572 162
696 3300025914 Ga0207671_10664502 Ga0207671_106645021 162
697 3300025916 Ga0207663_10980416 Ga0207663_109804161 162
698 3300025919 Ga0207657_10162213 Ga0207657_101622132 162
699 3300025919 Ga0207657_10260605 Ga0207657_102606052 162
700 3300025920 Ga0207649_10018912 Ga0207649_100189124 162
701 3300025920 Ga0207649_10923662 Ga0207649_109236622 162
702 3300025920 Ga0207649_10950477 Ga0207649_109504771 162
703 3300025921 Ga0207652_10315168 Ga0207652_103151682 162
704 3300025921 Ga0207652_10534002 Ga0207652_105340022 162
705 3300025924 Ga0207694_10001033 Ga0207694_1000103311 162
706 3300025924 Ga0207694_10249918 Ga0207694_102499182 162
707 3300025924 Ga0207694_10532769 Ga0207694_105327691 162
708 3300025929 Ga0207664_10455141 Ga0207664_104551412 162
709 3300025932 Ga0207690_10004742 Ga0207690_100047425 162
710 3300025932 Ga0207690_10546571 Ga0207690_105465712 162
711 3300025936 Ga0207670_10028380 Ga0207670_100283803 162
712 3300025941 Ga0207711_10050655 Ga0207711_100506555 162
713 3300025949 Ga0207667_10000193 Ga0207667_1000019347 162
714 3300025949 Ga0207667_10000244 Ga0207667_1000024453 162
715 3300025949 Ga0207667_10003976 Ga0207667_100039763 162
716 3300025949 Ga0207667_10075772 Ga0207667_100757723 162
717 3300025981 Ga0207640_10000169 Ga0207640_1000016921 162
718 3300025981 Ga0207640_10000961 Ga0207640_1000096111 162
719 3300025981 Ga0207640_10043770 Ga0207640_100437703 162
720 3300025981 Ga0207640_10293452 Ga0207640_102934522 162
721 3300025986 Ga0207658_10477769 Ga0207658_104777693 162
722 3300025986 Ga0207658_11140685 Ga0207658_111406852 162
723 3300026035 Ga0207703_10083650 Ga0207703_100836504 162
724 3300026035 Ga0207703_10117135 Ga0207703_101171353 162
725 3300026041 Ga0207639_10034959 Ga0207639_100349592 162
726 3300026067 Ga0207678_10012183 Ga0207678_100121837 162
727 3300026067 Ga0207678_10021852 Ga0207678_100218527 162
728 3300026067 Ga0207678_10087171 Ga0207678_100871713 162
729 3300026067 Ga0207678_10183666 Ga0207678_101836662 162
730 3300026067 Ga0207678_10196563 Ga0207678_101965632 162
731 3300026067 Ga0207678_10297027 Ga0207678_102970273 162
732 3300026067 Ga0207678_11235862 Ga0207678_112358621 162
733 3300026078 Ga0207702_10000279 Ga0207702_1000027952 162
734 3300026078 Ga0207702_10008212 Ga0207702_100082124 162
735 3300026078 Ga0207702_11486691 Ga0207702_114866911 162
736 3300026116 Ga0207674_10000401 Ga0207674_1000040133 162
737 3300026116 Ga0207674_10128797 Ga0207674_101287972 162
738 3300026116 Ga0207674_10200995 Ga0207674_102009952 162
739 3300027666 Ga0209282_1000056 Ga0209282_10000565 162
740 3300028379 Ga0268266_10000011 Ga0268266_1000001141 162
741 3300028379 Ga0268266_10875245 Ga0268266_108752452 162
742 3300028380 Ga0268265_10757154 Ga0268265_107571542 162
743 3300028381 Ga0268264_10232993 Ga0268264_102329932 162
744 3300028381 Ga0268264_10250318 Ga0268264_102503181 162
745 3300028786 Ga0307517_10092418 Ga0307517_100924183 162
746 3300033180 Ga0307510_10040224 Ga0307510_100402245 162
747 3300037312 Ga0395899_0000226 Ga0395899_0000226_172_660 162
748 3300037312 Ga0395899_0003288 Ga0395899_0003288_5428_5919 162
749 3300037312 Ga0395899_0003519 Ga0395899_0003519_11128_11619 162
750 3300037312 Ga0395899_0292473 Ga0395899_0292473_116_607 162
751 3300037418 Ga0395900_0000011 Ga0395900_0000011_345057_345545 162
752 3300037418 Ga0395900_0000078 Ga0395900_0000078_32657_33145 162
753 3300037418 Ga0395900_0008850 Ga0395900_0008850_3237_3728 162
754 3300037418 Ga0395900_0778801 Ga0395900_0778801_50_541 162
755 3300037466 Ga0395898_0000029 Ga0395898_0000029_101822_102310 162
756 3300037466 Ga0395898_0000336 Ga0395898_0000336_93192_93683 162
757 3300037466 Ga0395898_0040001 Ga0395898_0040001_1485_1973 162
758 3300037466 Ga0395898_0469500 Ga0395898_0469500_50_541 162
759 3300037471 Ga0395905_0172296 Ga0395905_0172296_834_1325 162
760 3300038443 Ga0395901_0106861 Ga0395901_0106861_743_1231 162
761 3300038443 Ga0395901_0116900 Ga0395901_0116900_2193_2684 162
762 3300038443 Ga0395901_0869160 Ga0395901_0869160_345_836 162
763 3300041491 Ga0451833_0261258 Ga0451833_0261258_134_622 162
764 3300044656 Ga0466969_0031836 Ga0466969_0031836_314_805 162
765 3300044656 Ga0466969_0033388 Ga0466969_0033388_1726_2235 162
766 3300044656 Ga0466969_0042658 Ga0466969_0042658_1510_2010 162
767 3300044656 Ga0466969_0171810 Ga0466969_0171810_378_950 162
768 3300044658 Ga0466972_0033943 Ga0466972_0033943_812_1312 162
769 3300044663 Ga0466989_0019721 Ga0466989_0019721_3243_3734 162
770 3300044672 Ga0466982_0000001 Ga0466982_0000001_224041_224541 162
771 3300044683 Ga0466965_0113435 Ga0466965_0113435_380_880 162
772 3300044683 Ga0466965_0152070 Ga0466965_0152070_502_1053 162
773 3300044684 Ga0466966_0004620 Ga0466966_0004620_6409_6909 162
774 3300044684 Ga0466966_0007031 Ga0466966_0007031_5116_5607 162
775 3300044684 Ga0466966_0011542 Ga0466966_0011542_946_1434 162
776 3300044693 Ga0466961_0001169 Ga0466961_0001169_1250_1738 162
777 3300044693 Ga0466961_0001667 Ga0466961_0001667_11954_12454 162
778 3300044693 Ga0466961_0023321 Ga0466961_0023321_3095_3604 162
779 3300044693 Ga0466961_0025976 Ga0466961_0025976_1150_1641 162
780 3300044694 Ga0466963_0011721 Ga0466963_0011721_3393_3890 162
781 3300044694 Ga0466963_0096443 Ga0466963_0096443_1435_1926 162
782 3300044706 Ga0466964_0004985 Ga0466964_0004985_3332_3832 162
783 3300044706 Ga0466964_0275861 Ga0466964_0275861_100_588 162
784 3300044706 Ga0466964_0378005 Ga0466964_0378005_51_542 162
785 3300044719 Ga0466971_0007278 Ga0466971_0007278_2224_2724 162
786 3300044735 Ga0466968_0015619 Ga0466968_0015619_438_938 162
787 3300044765 Ga0466970_0001207 Ga0466970_0001207_929_1417 162
788 3300044765 Ga0466970_0042862 Ga0466970_0042862_1008_1499 162
789 3300044765 Ga0466970_0050528 Ga0466970_0050528_777_1286 162
790 3300044842 Ga0466957_0123453 Ga0466957_0123453_581_1072 162
791 3300044842 Ga0466957_0127426 Ga0466957_0127426_239_730 162
792 3300044842 Ga0466957_0139004 Ga0466957_0139004_94_582 162
793 3300044842 Ga0466957_0478905 Ga0466957_0478905_331_822 162
794 3300044901 Ga0466960_0035701 Ga0466960_0035701_1271_1771 162
795 3300045049 Ga0466959_0000006 Ga0466959_0000006_79578_80087 162
796 3300045049 Ga0466959_0011279 Ga0466959_0011279_4932_5423 162
797 3300045049 Ga0466959_0021454 Ga0466959_0021454_3360_3851 162
798 3300045049 Ga0466959_0169706 Ga0466959_0169706_792_1280 162
799 3300045049 Ga0466959_0461067 Ga0466959_0461067_25_525 162
800 3300045836 Ga0466958_0023770 Ga0466958_0023770_1457_2008 162
801 3300045836 Ga0466958_0042117 Ga0466958_0042117_694_1194 162
802 3300045836 Ga0466958_0121422 Ga0466958_0121422_151_642 162
803 3300045836 Ga0466958_0162720 Ga0466958_0162720_638_1129 162
804 3300046452 Ga0495617_000040 Ga0495617_000040_105668_106156 162
805 3300046452 Ga0495617_001397 Ga0495617_001397_5650_6138 162
806 3300046457 Ga0495590_0071212 Ga0495590_0071212_449_937 162
807 3300046458 Ga0495591_026505 Ga0495591_026505_168_677 162
808 3300046460 Ga0495638_0000339 Ga0495638_0000339_35913_36407 162
809 3300046460 Ga0495638_0000670 Ga0495638_0000670_20733_21227 162
810 3300046460 Ga0495638_0065452 Ga0495638_0065452_981_1469 162
811 3300046471 Ga0495650_0000112 Ga0495650_0000112_193457_193951 162
812 3300046471 Ga0495650_0000852 Ga0495650_0000852_28040_28531 162
813 3300046471 Ga0495650_0006997 Ga0495650_0006997_1270_1758 162
814 3300046471 Ga0495650_0013554 Ga0495650_0013554_1988_2476 162
815 3300046474 Ga0495605_0000834 Ga0495605_0000834_4614_5123 162
816 3300046474 Ga0495605_0103498 Ga0495605_0103498_458_946 162
817 3300046491 Ga0495584_0002683 Ga0495584_0002683_4187_4675 162
818 3300046492 Ga0495585_0000024 Ga0495585_0000024_5178_5666 162
819 3300046492 Ga0495585_0012695 Ga0495585_0012695_1821_2309 162
820 3300046500 Ga0495596_0000060 Ga0495596_0000060_44595_45104 162
821 3300046501 Ga0495607_0001134 Ga0495607_0001134_15453_15941 162
822 3300046501 Ga0495607_0003270 Ga0495607_0003270_2087_2596 162
823 3300046501 Ga0495607_0070767 Ga0495607_0070767_622_1110 162
824 3300046506 Ga0495583_0029981 Ga0495583_0029981_822_1310 162
825 3300046507 Ga0495606_0000902 Ga0495606_0000902_11499_11987 162
826 3300046507 Ga0495606_0001920 Ga0495606_0001920_6148_6636 162
827 3300046507 Ga0495606_0005113 Ga0495606_0005113_5915_6403 162
828 3300046507 Ga0495606_0017472 Ga0495606_0017472_2237_2731 162
829 3300046507 Ga0495606_0029881 Ga0495606_0029881_1839_2327 162
830 3300046507 Ga0495606_0095395 Ga0495606_0095395_777_1268 162
831 3300046512 Ga0495610_0000235 Ga0495610_0000235_4270_4779 162
832 3300046512 Ga0495610_0026982 Ga0495610_0026982_1858_2346 162
833 3300046513 Ga0495616_0000496 Ga0495616_0000496_19428_19916 162
834 3300046513 Ga0495616_0000948 Ga0495616_0000948_1586_2095 162
835 3300046513 Ga0495616_0006065 Ga0495616_0006065_3678_4166 162
836 3300046515 Ga0495620_0000348 Ga0495620_0000348_12220_12708 162
837 3300046515 Ga0495620_0061047 Ga0495620_0061047_714_1202 162
838 3300046518 Ga0495631_0000331 Ga0495631_0000331_30153_30641 162
839 3300046518 Ga0495631_0005220 Ga0495631_0005220_5460_5948 162
840 3300046518 Ga0495631_0369941 Ga0495631_0369941_84_572 162
841 3300046519 Ga0495632_0000005 Ga0495632_0000005_222136_222624 162
842 3300046519 Ga0495632_0002695 Ga0495632_0002695_8525_9013 162
843 3300046519 Ga0495632_0015748 Ga0495632_0015748_1998_2486 162
844 3300046522 Ga0495643_0037484 Ga0495643_0037484_1581_2090 162
845 3300046524 Ga0495648_0004979 Ga0495648_0004979_5364_5852 162
846 3300046524 Ga0495648_0006512 Ga0495648_0006512_841_1329 162
847 3300046524 Ga0495648_0020135 Ga0495648_0020135_1344_1853 162
848 3300046530 Ga0495654_0265487 Ga0495654_0265487_73_582 162
849 3300046538 Ga0495609_0000573 Ga0495609_0000573_25767_26276 162
850 3300046538 Ga0495609_0008691 Ga0495609_0008691_4189_4677 162
851 3300046557 Ga0495622_0000954 Ga0495622_0000954_5434_5928 162
852 3300046615 Ga0495656_0479924 Ga0495656_0479924_81_590 162
853 3300046616 Ga0495668_0007118 Ga0495668_0007118_2585_3073 162
854 3300046616 Ga0495668_0135978 Ga0495668_0135978_100_588 162
855 3300046648 Ga0495611_0000005 Ga0495611_0000005_138204_138692 162
856 3300046648 Ga0495611_0000039 Ga0495611_0000039_91963_92451 162
857 3300046648 Ga0495611_0239590 Ga0495611_0239590_242_751 162
858 3300046660 Ga0495625_0000066 Ga0495625_0000066_110968_111456 162
859 3300046660 Ga0495625_0049565 Ga0495625_0049565_1436_1930 162
860 3300046660 Ga0495625_0052521 Ga0495625_0052521_2394_2882 162
861 3300046660 Ga0495625_0066875 Ga0495625_0066875_1120_1611 162
862 3300046660 Ga0495625_0270106 Ga0495625_0270106_549_1037 162
863 3300046665 Ga0495661_0004104 Ga0495661_0004104_5379_5867 162
864 3300046665 Ga0495661_0015165 Ga0495661_0015165_348_857 162
865 3300046665 Ga0495661_0050806 Ga0495661_0050806_757_1245 162
866 3300046684 Ga0495669_0019406 Ga0495669_0019406_328_837 162
867 3300046691 Ga0495670_0003480 Ga0495670_0003480_2406_2894 162
868 3300046691 Ga0495670_0008096 Ga0495670_0008096_563_1051 162
869 3300046691 Ga0495670_0369262 Ga0495670_0369262_192_701 162
870 3300046692 Ga0495671_0002622 Ga0495671_0002622_6323_6832 162
871 3300046692 Ga0495671_0009862 Ga0495671_0009862_3730_4218 162
872 3300046694 Ga0495649_0009841 Ga0495649_0009841_2635_3129 162
873 3300046794 Ga0495589_0000026 Ga0495589_0000026_94283_94771 162
874 3300046810 Ga0495660_0000544 Ga0495660_0000544_19942_20430 162
875 3300046810 Ga0495660_0012768 Ga0495660_0012768_1745_2233 162
876 3300047320 Ga0495672_0028976 Ga0495672_0028976_2156_2665 162
877 3300047323 Ga0495683_0001769 Ga0495683_0001769_2515_3003 162
878 3300047446 Ga0495679_000010 Ga0495679_000010_111791_112279 162
879 3300047446 Ga0495679_034113 Ga0495679_034113_795_1289 162
880 3300047447 Ga0495685_062513 Ga0495685_062513_483_992 162
881 3300047469 Ga0495673_0000038 Ga0495673_0000038_143420_143908 162
882 3300047469 Ga0495673_0000045 Ga0495673_0000045_103531_104019 162
883 3300047469 Ga0495673_0001306 Ga0495673_0001306_9440_9928 162
884 3300047472 Ga0495686_0000050 Ga0495686_0000050_138584_139072 162
885 3300047472 Ga0495686_0000297 Ga0495686_0000297_10958_11446 162
886 3300047472 Ga0495686_0002453 Ga0495686_0002453_2674_3162 162
887 3300047472 Ga0495686_0012390 Ga0495686_0012390_4462_4950 162
888 3300047472 Ga0495686_0069393 Ga0495686_0069393_1397_1885 162
889 3300048903 Ga0496100_0106172 Ga0496100_0106172_1074_1562 162
890 3300048904 Ga0496101_0135366 Ga0496101_0135366_50_538 162
891 3300048904 Ga0496101_0263846 Ga0496101_0263846_823_1311 162
892 3300048904 Ga0496101_0871253 Ga0496101_0871253_188_685 162
893 3300048905 Ga0496102_0222324 Ga0496102_0222324_28_516 162
894 3300048907 Ga0496104_0071611 Ga0496104_0071611_1844_2335 162
895 3300048907 Ga0496104_0145631 Ga0496104_0145631_396_890 162
896 3300048907 Ga0496104_1062658 Ga0496104_1062658_112_609 162
897 3300048908 Ga0496105_0007857 Ga0496105_0007857_1192_1689 162
898 3300048908 Ga0496105_0737563 Ga0496105_0737563_232_723 162
899 3300048909 Ga0496106_0000097 Ga0496106_0000097_37192_37680 162
900 3300048909 Ga0496106_0917761 Ga0496106_0917761_99_593 162
901 3300048909 Ga0496106_1008555 Ga0496106_1008555_127_624 162
902 3300048915 Ga0496112_0271738 Ga0496112_0271738_320_811 162
903 3300048916 Ga0496113_0222473 Ga0496113_0222473_915_1406 162
904 3300048918 Ga0496115_0000283 Ga0496115_0000283_33685_34176 162
905 3300048918 Ga0496115_0002834 Ga0496115_0002834_9746_10240 162
906 3300048918 Ga0496115_0012403 Ga0496115_0012403_3814_4308 162
907 3300048918 Ga0496115_1054726 Ga0496115_1054726_79_576 162
908 3300048919 Ga0496116_0002634 Ga0496116_0002634_13187_13696 162
909 3300048919 Ga0496116_0056171 Ga0496116_0056171_151_648 162
910 3300048920 Ga0496117_0076902 Ga0496117_0076902_1135_1632 162
911 3300048920 Ga0496117_0077580 Ga0496117_0077580_499_996 162
912 3300048920 Ga0496117_0082170 Ga0496117_0082170_71_559 162
913 3300048920 Ga0496117_0163237 Ga0496117_0163237_791_1288 162
914 3300048920 Ga0496117_0507393 Ga0496117_0507393_63_551 162
915 3300048921 Ga0496118_0002818 Ga0496118_0002818_22098_22595 162
916 3300048921 Ga0496118_0003470 Ga0496118_0003470_5569_6066 162
917 3300048921 Ga0496118_0004496 Ga0496118_0004496_4526_5014 162
918 3300048921 Ga0496118_0006149 Ga0496118_0006149_6575_7072 162
919 3300048921 Ga0496118_0006461 Ga0496118_0006461_12309_12797 162
920 3300048922 Ga0496119_0000291 Ga0496119_0000291_63259_63756 162
921 3300048922 Ga0496119_0016378 Ga0496119_0016378_4434_4937 162
922 3300048923 Ga0496120_0000397 Ga0496120_0000397_6451_6948 162
923 3300048923 Ga0496120_0001574 Ga0496120_0001574_21720_22223 162
924 3300048924 Ga0496121_0000531 Ga0496121_0000531_29842_30339 162
925 3300048924 Ga0496121_0001099 Ga0496121_0001099_72_560 162
926 3300048924 Ga0496121_0002812 Ga0496121_0002812_19295_19783 162
927 3300048924 Ga0496121_0003485 Ga0496121_0003485_2561_3049 162
928 3300048924 Ga0496121_0007940 Ga0496121_0007940_8187_8696 162
929 3300048924 Ga0496121_0015521 Ga0496121_0015521_4330_4830 162
930 3300048924 Ga0496121_0015815 Ga0496121_0015815_3828_4316 162
931 3300048924 Ga0496121_0020023 Ga0496121_0020023_52_543 162
932 3300048924 Ga0496121_0103775 Ga0496121_0103775_65_559 162
933 3300048924 Ga0496121_0121910 Ga0496121_0121910_386_883 162
934 3300048924 Ga0496121_0252139 Ga0496121_0252139_670_1158 162
935 3300048925 Ga0496122_0002324 Ga0496122_0002324_14449_14958 162
936 3300048925 Ga0496122_0007927 Ga0496122_0007927_10346_10834 162
937 3300048925 Ga0496122_0061502 Ga0496122_0061502_649_1140 162
938 3300048925 Ga0496122_0192599 Ga0496122_0192599_276_764 162
939 3300048925 Ga0496122_0592492 Ga0496122_0592492_12_500 162
940 3300048926 Ga0496123_0002089 Ga0496123_0002089_20629_21138 162
941 3300048926 Ga0496123_0026147 Ga0496123_0026147_1210_1698 162
942 3300048926 Ga0496123_0027129 Ga0496123_0027129_3660_4148 162
943 3300048928 Ga0496125_0000647 Ga0496125_0000647_32444_32944 162
944 3300048928 Ga0496125_0012655 Ga0496125_0012655_4323_4811 162
945 3300048929 Ga0496126_0001015 Ga0496126_0001015_160_657 162
946 3300048929 Ga0496126_0068693 Ga0496126_0068693_855_1364 162
947 3300048929 Ga0496126_0098442 Ga0496126_0098442_914_1405 162
948 3300048929 Ga0496126_0192114 Ga0496126_0192114_629_1123 162
949 3300048929 Ga0496126_0197252 Ga0496126_0197252_358_846 162
950 3300048929 Ga0496126_0686034 Ga0496126_0686034_111_605 162
951 3300049459 Ga0495678_000672 Ga0495678_000672_8108_8596 162
952 3300049460 Ga0495682_0010314 Ga0495682_0010314_859_1347 162
953 3300049460 Ga0495682_0018766 Ga0495682_0018766_1243_1731 162
954 3300049568 Ga0501031_0005471 Ga0501031_0005471_7524_8015 162
955 3300049568 Ga0501031_0011536 Ga0501031_0011536_2332_2829 162
956 3300049569 Ga0501032_0240022 Ga0501032_0240022_371_862 162
957 3300049570 Ga0501033_0000289 Ga0501033_0000289_19842_20339 162
958 3300049570 Ga0501033_0000339 Ga0501033_0000339_36849_37340 162
959 3300049570 Ga0501033_0036019 Ga0501033_0036019_83_592 162
960 3300049570 Ga0501033_0155948 Ga0501033_0155948_1115_1606 162
961 3300049570 Ga0501033_0471617 Ga0501033_0471617_250_741 162
962 3300049571 Ga0501034_0012646 Ga0501034_0012646_3117_3614 162
963 3300049571 Ga0501034_0023149 Ga0501034_0023149_3015_3515 162
964 3300049571 Ga0501034_0169310 Ga0501034_0169310_294_785 162
965 3300049571 Ga0501034_0195113 Ga0501034_0195113_1457_1969 162
966 3300049571 Ga0501034_0692355 Ga0501034_0692355_24_512 162
967 3300049572 Ga0501036_0000051 Ga0501036_0000051_13382_13879 162
968 3300049572 Ga0501036_0048851 Ga0501036_0048851_1291_1803 162
969 3300049572 Ga0501036_0901850 Ga0501036_0901850_216_707 162
970 3300049573 Ga0501037_0002569 Ga0501037_0002569_6306_6803 162
971 3300049573 Ga0501037_0026579 Ga0501037_0026579_1735_2235 162
972 3300049573 Ga0501037_0368517 Ga0501037_0368517_54_545 162
973 3300049573 Ga0501037_0401334 Ga0501037_0401334_32_523 162
974 3300049573 Ga0501037_0478779 Ga0501037_0478779_212_703 162
975 3300049573 Ga0501037_0738756 Ga0501037_0738756_45_548 162
976 3300049574 Ga0501038_0005817 Ga0501038_0005817_6960_7457 162
977 3300049574 Ga0501038_0044246 Ga0501038_0044246_162_653 162
978 3300049574 Ga0501038_0140701 Ga0501038_0140701_53_544 162
979 3300049574 Ga0501038_0514752 Ga0501038_0514752_397_888 162
980 3300049575 Ga0501039_0027791 Ga0501039_0027791_3709_4200 162
981 3300049576 Ga0501040_0202723 Ga0501040_0202723_434_922 162
982 3300049578 Ga0501042_0079853 Ga0501042_0079853_649_1140 162
983 3300049579 Ga0501043_0015316 Ga0501043_0015316_2666_3166 162
984 3300049579 Ga0501043_0051289 Ga0501043_0051289_730_1227 162
985 3300049579 Ga0501043_0127804 Ga0501043_0127804_561_1070 162
986 3300049579 Ga0501043_0128392 Ga0501043_0128392_262_753 162
987 3300049579 Ga0501043_0320570 Ga0501043_0320570_79_576 162
988 3300049579 Ga0501043_1105114 Ga0501043_1105114_54_545 162
989 3300049580 Ga0501046_0006257 Ga0501046_0006257_1324_1821 162
990 3300049580 Ga0501046_0011629 Ga0501046_0011629_5320_5820 162
991 3300049580 Ga0501046_0070261 Ga0501046_0070261_1011_1502 162
992 3300049580 Ga0501046_0202997 Ga0501046_0202997_745_1242 162
993 3300049580 Ga0501046_0303782 Ga0501046_0303782_248_742 162
994 3300049581 Ga0501047_0014773 Ga0501047_0014773_3597_4088 162
995 3300049581 Ga0501047_0015511 Ga0501047_0015511_5300_5791 162
996 3300049581 Ga0501047_0025910 Ga0501047_0025910_4967_5464 162
997 3300049581 Ga0501047_0099896 Ga0501047_0099896_1340_1834 162
998 3300049581 Ga0501047_0317447 Ga0501047_0317447_140_640 162
999 3300049581 Ga0501047_0324912 Ga0501047_0324912_25_519 162
1000 3300049581 Ga0501047_0459337 Ga0501047_0459337_386_877 162
1001 3300049582 Ga0501048_0023832 Ga0501048_0023832_958_1446 162
1002 3300049582 Ga0501048_0086692 Ga0501048_0086692_1493_1984 162
1003 3300049582 Ga0501048_0226859 Ga0501048_0226859_378_875 162
1004 3300049586 Ga0501070_0221901 Ga0501070_0221901_686_1177 162
1005 3300049586 Ga0501070_0748232 Ga0501070_0748232_227_718 162
1006 3300049589 Ga0501073_0024817 Ga0501073_0024817_1773_2264 162
1007 3300049590 Ga0501074_0194285 Ga0501074_0194285_720_1208 162
1008 3300049590 Ga0501074_0584540 Ga0501074_0584540_222_713 162
1009 3300049593 Ga0501077_0297788 Ga0501077_0297788_23_514 162
1010 3300049741 Ga0501079_0196934 Ga0501079_0196934_430_918 162
1011 3300049742 Ga0501080_0097049 Ga0501080_0097049_231_722 162
1012 3300049822 Ga0501035_0001784 Ga0501035_0001784_16595_17092 162
1013 3300049822 Ga0501035_0051441 Ga0501035_0051441_922_1413 162
1014 3300049822 Ga0501035_0069252 Ga0501035_0069252_2168_2662 162
1015 3300049822 Ga0501035_0072485 Ga0501035_0072485_2165_2674 162
1016 3300049822 Ga0501035_0130034 Ga0501035_0130034_400_891 162
1017 3300049822 Ga0501035_0148783 Ga0501035_0148783_1075_1572 162
1018 3300049822 Ga0501035_0170660 Ga0501035_0170660_213_704 162
1019 3300049822 Ga0501035_0174004 Ga0501035_0174004_532_1023 162
1020 3300049822 Ga0501035_0349400 Ga0501035_0349400_213_704 162
1021 3300049822 Ga0501035_0526059 Ga0501035_0526059_291_782 162
1022 3300049823 Ga0501044_0014869 Ga0501044_0014869_5000_5494 162
1023 3300049823 Ga0501044_0020894 Ga0501044_0020894_5438_5935 162
1024 3300049823 Ga0501044_0059574 Ga0501044_0059574_760_1272 162
1025 3300049823 Ga0501044_0102799 Ga0501044_0102799_995_1486 162
1026 3300049823 Ga0501044_0491605 Ga0501044_0491605_171_671 162
1027 3300049823 Ga0501044_1263325 Ga0501044_1263325_58_552 162
1028 3300050516 nmdc:mga0sz30_137565_c1 nmdc:mga0sz30_137565_c1_295_786 162
1029 3300053087 Ga0500643_000074 Ga0500643_000074_36002_36490 162
1030 3300053088 Ga0500644_0400606 Ga0500644_0400606_60_551 162
1031 3300053108 Ga0500562_026359 Ga0500562_026359_846_1334 162
1032 3300053730 Ga0500645_001728 Ga0500645_001728_4770_5258 162
1033 3300061719 Ga0466962_0003425 Ga0466962_0003425_2936_3427 162
1034 3300061719 Ga0466962_0008321 Ga0466962_0008321_1569_2060 162
1035 3300061719 Ga0466962_0009529 Ga0466962_0009529_1956_2456 162
1036 3300061719 Ga0466962_0016609 Ga0466962_0016609_2309_2860 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01590

GAF

GAF domain

38

182

0.86

PF13185

GAF_2

GAF domain

56

182

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hl6-assembly1.cif.gz_A crystal structure of a putative gaf sensor protein from burkholderia vietnamiensis 0.9805 11 160
3rfb-assembly1.cif.gz_A structure of frmsr 0.9764 14 160
3ksf-assembly3.cif.gz_F structure of frmsr of staphylococcus aureus (reduced form) 0.9682 16 162
8dgd-assembly1.cif.gz_A crystal structure of gaf domain-containing protein, from klebsiella pneumoniae 0.9626 7 161
1vhm-assembly1.cif.gz_A crystal structure of an hypothetical protein 0.9583 11 161
ID Description Score Start End Superfamily
3rfbA00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9764 14 160 3.30.450.40
1vhmA00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9583 11 161 3.30.450.40
af_Q8MTJ7_3_158_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9424 3 158 3.30.450.40
af_Q8MTJ7_3_158_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9309 3 158 3.30.450.40
af_Q4DSC2_14_185_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9298 11 162 3.30.450.40
ID Description Score Start End GO Terms
AF-A0A227J7W3-F1-model_v4 GAF domain-containing protein 0.9959 15 106
AF-A0A7X5UCN6-F1-model_v4 GAF domain-containing protein 0.9936 1 161 GO:0005829
GO:0033745
AF-A0A446CPK9-F1-model_v4 Free methionine-R-sulfoxide reductase (EC 1.8.4.14) 0.9912 1 162 GO:0005829
GO:0033745
AF-A0A085U834-F1-model_v4 Free methionine-(R)-sulfoxide reductase (Gaf domain-containing protein (EC 1.8.4.14)) 0.9902 11 161 GO:0005829
GO:0033745
AF-A0A173J5I7-F1-model_v4 deleted 0.9895 16 160

Feature Viewer

pLDDT pTM Quality
94.46 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map