F488725
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1036 | 446 | 988 | 164 |
Family's Representative Sequence
| Representative Sequence | 3300044656|Ga0466969_0171810|Ga0466969_0171810_378_950 |
| Length | 190 |
| Sequence | MLRHVIALPLANCTERSILQPMFEIKASNNASKREQYADLVEQARGMLAGEPSLIANAANFAALVFHSLPDFNWAGFYLYDGKELVVGPFQGKPACIRIAIGRGVCGTAAQTRQTQVVRDVNAFDGHIACDAASQSEIVVPLVKADGTLLGVWDVDSPLVGRFDEEDRAGMEALCAVFMEAVGVGWVSAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 2 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 3 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 4 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 5 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 6 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 7 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 8 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 9 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 10 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 11 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 12 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 13 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 14 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 15 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 16 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 17 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 18 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 19 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 20 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 21 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 22 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 23 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 24 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 25 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 26 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 27 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 28 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 29 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 30 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 31 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 32 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 33 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 34 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 35 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 36 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 37 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 38 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 39 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 40 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 41 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 42 | 2936361878 | Neobacillus endophyticus BRMEA1 | Isolate | Unclassified |
| 43 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 44 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 45 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 46 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 47 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 48 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 49 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 50 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 51 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 52 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 53 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 54 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 55 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 56 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 57 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 58 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 59 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 60 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 61 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 62 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 63 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 64 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 65 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 66 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 67 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 68 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 69 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 70 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 71 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 72 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 73 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 74 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 79 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 81 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 83 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 92 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 103 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 104 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 105 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 107 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 108 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 109 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 110 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 114 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 115 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 117 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 118 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 119 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 120 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 121 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 122 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 123 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 124 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 125 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 126 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 127 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 128 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 130 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 131 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 132 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 133 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 134 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 135 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 136 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 137 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 138 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 139 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 141 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 142 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 143 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 144 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 145 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 147 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009982 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG | Metagenome | Rhizosphere |
| 159 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 162 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 163 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 174 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 177 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 178 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 179 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 180 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 182 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 183 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 184 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 193 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 194 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 197 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 198 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 200 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 202 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 203 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 205 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 207 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 256 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 260 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 261 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 262 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 263 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 264 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 265 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 266 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 267 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 268 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 269 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 270 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 271 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 272 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 273 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 274 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 275 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 277 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 278 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 279 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 280 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 281 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 282 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 283 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 284 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 285 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 286 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 287 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 288 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 289 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 290 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 291 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 292 | 3300044663 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR | Metagenome | Unclassified |
| 293 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 294 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 295 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 296 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 297 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 298 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 299 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 300 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 301 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 302 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 303 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 304 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 305 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 306 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 372 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 373 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 374 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 375 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 376 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 379 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 380 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 381 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 382 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 383 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 384 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 385 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 386 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 387 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 388 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 389 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 390 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 391 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 392 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 393 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 428 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 429 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 431 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 434 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 435 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 436 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 437 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 438 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 439 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 442 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 443 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 444 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 445 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 446 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.79 |
| Metatranscriptomes | 0.58 |
| Isolates | 4.63 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.85 |
| Nodule | 0.87 |
| Rhizoplane | 2.99 |
| Rhizosphere | 75.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1008608 | 3300001904 | Bacteria | 1694 |
| 2 | JGI24739J22299_10001810 | 3300001989 | Bacteria | 8145 |
| 3 | JGI24737J22298_10001918 | 3300001990 | Bacteria | 7434 |
| 4 | JGI24737J22298_10179732 | 3300001990 | Bacteria | 624 |
| 5 | JGI24735J21928_10002849 | 3300002067 | Bacteria | 5964 |
| 6 | JGI24735J21928_10007156 | 3300002067 | Bacteria | 3642 |
| 7 | JGI24735J21928_10045229 | 3300002067 | Bacteria | 1279 |
| 8 | JGI24738J21930_10045317 | 3300002075 | Bacteria | 894 |
| 9 | JGI25156J39149_1001007 | 3300002705 | Bacteria | 13267 |
| 10 | JGI25156J39149_1006545 | 3300002705 | Bacteria | 3168 |
| 11 | JGI25162J39368_1000538 | 3300002737 | Bacteria | 28189 |
| 12 | JGI25162J39368_1001470 | 3300002737 | Bacteria | 12379 |
| 13 | JGI25154J39366_1006550 | 3300002738 | Bacteria | 1689 |
| 14 | JGI25157J39369_1000731 | 3300002741 | Bacteria | 17502 |
| 15 | JGI25157J39369_1001489 | 3300002741 | Bacteria | 8621 |
| 16 | JGI25164J39214_1000064 | 3300002772 | Bacteria | 107073 |
| 17 | JGI25165J46597_1000278 | 3300003214 | Bacteria | 65807 |
| 18 | rootH1_10022311 | 3300003316 | Bacteria | 6739 |
| 19 | rootH2_10000507 | 3300003320 | Bacteria | 26810 |
| 20 | rootH2_10053565 | 3300003320 | Bacteria | 3133 |
| 21 | rootH1_10116952 | 3300003323 | Bacteria | 1231 |
| 22 | rootH1_10139123 | 3300003323 | Bacteria | 4538 |
| 23 | Ga0006562J51391_1027929 | 3300003578 | Bacteria | 3800 |
| 24 | Ga0006562J51391_1027930 | 3300003578 | Bacteria | 3120 |
| 25 | Ga0006562J51391_1033987 | 3300003578 | Bacteria | 5860 |
| 26 | Ga0006562J51391_1033988 | 3300003578 | Bacteria | 11310 |
| 27 | Ga0055539_1001315 | 3300003752 | Bacteria | 4829 |
| 28 | Ga0055533_1000716 | 3300003756 | Bacteria | 10802 |
| 29 | Ga0055533_1001494 | 3300003756 | Bacteria | 6137 |
| 30 | Ga0055525_1000043 | 3300003759 | Bacteria | 268656 |
| 31 | Ga0055527_1000028 | 3300003760 | Bacteria | 172877 |
| 32 | Ga0055527_1000068 | 3300003760 | Bacteria | 87357 |
| 33 | Ga0055527_1002157 | 3300003760 | Bacteria | 3494 |
| 34 | Ga0055535_1000081 | 3300003761 | Bacteria | 107148 |
| 35 | Ga0055535_1000090 | 3300003761 | Bacteria | 102120 |
| 36 | Ga0055535_1000351 | 3300003761 | Bacteria | 45382 |
| 37 | Ga0055535_1000368 | 3300003761 | Bacteria | 43481 |
| 38 | Ga0055535_1008265 | 3300003761 | Bacteria | 1896 |
| 39 | Ga0055542_1000053 | 3300003762 | Bacteria | 172877 |
| 40 | Ga0055542_1000093 | 3300003762 | Bacteria | 120262 |
| 41 | Ga0055542_1000113 | 3300003762 | Bacteria | 107148 |
| 42 | Ga0055542_1000417 | 3300003762 | Bacteria | 41501 |
| 43 | Ga0055542_1000450 | 3300003762 | Bacteria | 39041 |
| 44 | Ga0055529_1000104 | 3300003763 | Bacteria | 126692 |
| 45 | Ga0055529_1000281 | 3300003763 | Bacteria | 60403 |
| 46 | Ga0055529_1000312 | 3300003763 | Bacteria | 55812 |
| 47 | Ga0055526_1017184 | 3300003771 | Bacteria | 2781 |
| 48 | Ga0055524_1000715 | 3300003775 | Bacteria | 22817 |
| 49 | Ga0055534_1001790 | 3300003784 | Bacteria | 8087 |
| 50 | Ga0065704_10126300 | 3300005289 | Bacteria | 1691 |
| 51 | Ga0065712_10073660 | 3300005290 | Bacteria | 4317 |
| 52 | Ga0065715_10046227 | 3300005293 | Bacteria | 1216 |
| 53 | Ga0065707_10082887 | 3300005295 | Bacteria | 11574 |
| 54 | Ga0070658_10004443 | 3300005327 | Bacteria | 11421 |
| 55 | Ga0070658_10009305 | 3300005327 | Bacteria | 7902 |
| 56 | Ga0070658_10056502 | 3300005327 | Bacteria | 3190 |
| 57 | Ga0070658_10573874 | 3300005327 | Bacteria | 977 |
| 58 | Ga0070683_100182540 | 3300005329 | Bacteria | 1992 |
| 59 | Ga0070670_100097839 | 3300005331 | Bacteria | 2525 |
| 60 | Ga0070670_101469491 | 3300005331 | Bacteria | 625 |
| 61 | Ga0070666_10000001 | 3300005335 | Bacteria | 543080 |
| 62 | Ga0070666_10028903 | 3300005335 | Bacteria | 3641 |
| 63 | Ga0070680_100044803 | 3300005336 | Bacteria | 3595 |
| 64 | Ga0070682_100015838 | 3300005337 | Bacteria | 4375 |
| 65 | Ga0068868_100157861 | 3300005338 | Bacteria | 1871 |
| 66 | Ga0068868_100290290 | 3300005338 | Bacteria | 1386 |
| 67 | Ga0070660_100000996 | 3300005339 | Bacteria | 19003 |
| 68 | Ga0070660_100017448 | 3300005339 | Bacteria | 5232 |
| 69 | Ga0070660_100036930 | 3300005339 | Bacteria | 3702 |
| 70 | Ga0070660_100924514 | 3300005339 | Bacteria | 736 |
| 71 | Ga0070689_100007728 | 3300005340 | Bacteria | 7533 |
| 72 | Ga0070689_100012897 | 3300005340 | Bacteria | 6034 |
| 73 | Ga0070691_10000185 | 3300005341 | Bacteria | 20700 |
| 74 | Ga0070691_10000527 | 3300005341 | Bacteria | 14442 |
| 75 | Ga0070687_100220036 | 3300005343 | Bacteria | 1162 |
| 76 | Ga0070687_100504210 | 3300005343 | Bacteria | 815 |
| 77 | Ga0070661_100079076 | 3300005344 | Bacteria | 2426 |
| 78 | Ga0070661_100103377 | 3300005344 | Bacteria | 2121 |
| 79 | Ga0070661_100663045 | 3300005344 | Bacteria | 848 |
| 80 | Ga0070661_101081743 | 3300005344 | Bacteria | 668 |
| 81 | Ga0070661_101243723 | 3300005344 | Bacteria | 623 |
| 82 | Ga0070692_10108345 | 3300005345 | Bacteria | 1533 |
| 83 | Ga0070668_100022772 | 3300005347 | Bacteria | 4736 |
| 84 | Ga0070668_100160832 | 3300005347 | Bacteria | 1822 |
| 85 | Ga0070668_100288542 | 3300005347 | Bacteria | 1373 |
| 86 | Ga0070668_101662633 | 3300005347 | Bacteria | 586 |
| 87 | Ga0070675_100006757 | 3300005354 | Bacteria | 8815 |
| 88 | Ga0070675_100167512 | 3300005354 | Bacteria | 1893 |
| 89 | Ga0070671_100002542 | 3300005355 | Bacteria | 14135 |
| 90 | Ga0070671_100153698 | 3300005355 | Bacteria | 1943 |
| 91 | Ga0070671_100184508 | 3300005355 | Bacteria | 1767 |
| 92 | Ga0070673_100340416 | 3300005364 | Bacteria | 1329 |
| 93 | Ga0070673_100562856 | 3300005364 | Bacteria | 1037 |
| 94 | Ga0070688_100013718 | 3300005365 | Bacteria | 4578 |
| 95 | Ga0070688_100433004 | 3300005365 | Bacteria | 980 |
| 96 | Ga0070659_100005242 | 3300005366 | Bacteria | 9297 |
| 97 | Ga0070659_100010709 | 3300005366 | Bacteria | 6757 |
| 98 | Ga0070659_100029016 | 3300005366 | Bacteria | 4275 |
| 99 | Ga0070667_100021861 | 3300005367 | Bacteria | 5309 |
| 100 | Ga0070667_100031347 | 3300005367 | Bacteria | 4433 |
| 101 | Ga0070667_100148699 | 3300005367 | Bacteria | 2056 |
| 102 | Ga0070667_100382788 | 3300005367 | Bacteria | 1278 |
| 103 | Ga0070709_10002174 | 3300005434 | Bacteria | 10614 |
| 104 | Ga0070709_10143710 | 3300005434 | Bacteria | 1642 |
| 105 | Ga0070714_100172444 | 3300005435 | Bacteria | 1964 |
| 106 | Ga0070714_100389172 | 3300005435 | Bacteria | 1316 |
| 107 | Ga0070713_100000141 | 3300005436 | Bacteria | 47574 |
| 108 | Ga0070713_100613007 | 3300005436 | Bacteria | 1035 |
| 109 | Ga0070711_100040650 | 3300005439 | Bacteria | 3137 |
| 110 | Ga0070705_100455529 | 3300005440 | Bacteria | 961 |
| 111 | Ga0070694_100183911 | 3300005444 | Bacteria | 1547 |
| 112 | Ga0070694_100840581 | 3300005444 | Bacteria | 755 |
| 113 | Ga0070694_101020317 | 3300005444 | Bacteria | 687 |
| 114 | Ga0070663_100021903 | 3300005455 | Bacteria | 4260 |
| 115 | Ga0070663_100068878 | 3300005455 | Bacteria | 2569 |
| 116 | Ga0070663_100153281 | 3300005455 | Bacteria | 1769 |
| 117 | Ga0070663_100193484 | 3300005455 | Bacteria | 1584 |
| 118 | Ga0070663_100227861 | 3300005455 | Bacteria | 1466 |
| 119 | Ga0070663_100273696 | 3300005455 | Bacteria | 1343 |
| 120 | Ga0070662_100152837 | 3300005457 | Bacteria | 1799 |
| 121 | Ga0070681_10000073 | 3300005458 | Bacteria | 74242 |
| 122 | Ga0070681_10012053 | 3300005458 | Bacteria | 8575 |
| 123 | Ga0070681_10048156 | 3300005458 | Bacteria | 4260 |
| 124 | Ga0070681_10055196 | 3300005458 | Bacteria | 3956 |
| 125 | Ga0068867_100055314 | 3300005459 | Bacteria | 2934 |
| 126 | Ga0070685_10799127 | 3300005466 | Bacteria | 695 |
| 127 | Ga0070707_100756693 | 3300005468 | Bacteria | 935 |
| 128 | Ga0070679_100082982 | 3300005530 | Bacteria | 3194 |
| 129 | Ga0070679_100224206 | 3300005530 | Bacteria | 1840 |
| 130 | Ga0070679_100672414 | 3300005530 | Bacteria | 978 |
| 131 | Ga0070684_100099768 | 3300005535 | Bacteria | 2592 |
| 132 | Ga0070684_100513698 | 3300005535 | Bacteria | 1110 |
| 133 | Ga0068853_100006034 | 3300005539 | Bacteria | 9584 |
| 134 | Ga0068853_100047768 | 3300005539 | Bacteria | 3674 |
| 135 | Ga0068853_100119917 | 3300005539 | Bacteria | 2345 |
| 136 | Ga0068853_100201062 | 3300005539 | Bacteria | 1813 |
| 137 | Ga0068853_100558899 | 3300005539 | Bacteria | 1085 |
| 138 | Ga0068853_100733854 | 3300005539 | Bacteria | 943 |
| 139 | Ga0070695_100005528 | 3300005545 | Bacteria | 7442 |
| 140 | Ga0070695_100518582 | 3300005545 | Bacteria | 924 |
| 141 | Ga0070696_100095010 | 3300005546 | Bacteria | 2128 |
| 142 | Ga0070696_100379146 | 3300005546 | Bacteria | 1102 |
| 143 | Ga0070693_100002643 | 3300005547 | Bacteria | 8249 |
| 144 | Ga0070693_100030504 | 3300005547 | Bacteria | 2947 |
| 145 | Ga0070693_100075066 | 3300005547 | Bacteria | 2001 |
| 146 | Ga0070665_100077205 | 3300005548 | Bacteria | 3337 |
| 147 | Ga0070665_100081831 | 3300005548 | Bacteria | 3234 |
| 148 | Ga0070665_100141214 | 3300005548 | Bacteria | 2411 |
| 149 | Ga0070704_100145588 | 3300005549 | Bacteria | 1856 |
| 150 | Ga0068855_100007063 | 3300005563 | Bacteria | 13618 |
| 151 | Ga0068855_100021852 | 3300005563 | Bacteria | 7672 |
| 152 | Ga0068855_100041946 | 3300005563 | Bacteria | 5422 |
| 153 | Ga0068855_100060941 | 3300005563 | Bacteria | 4409 |
| 154 | Ga0068855_100089822 | 3300005563 | Bacteria | 3546 |
| 155 | Ga0068855_100117653 | 3300005563 | Bacteria | 3044 |
| 156 | Ga0068855_100184728 | 3300005563 | Bacteria | 2355 |
| 157 | Ga0068855_100201748 | 3300005563 | Bacteria | 2239 |
| 158 | Ga0068855_100954548 | 3300005563 | Bacteria | 903 |
| 159 | Ga0068855_100982820 | 3300005563 | Bacteria | 888 |
| 160 | Ga0070664_100160545 | 3300005564 | Bacteria | 1989 |
| 161 | Ga0068857_100002119 | 3300005577 | Bacteria | 16141 |
| 162 | Ga0068857_100025014 | 3300005577 | Bacteria | 5259 |
| 163 | Ga0068857_100033922 | 3300005577 | Bacteria | 4515 |
| 164 | Ga0068857_100107679 | 3300005577 | Bacteria | 2504 |
| 165 | Ga0068857_100158849 | 3300005577 | Bacteria | 2051 |
| 166 | Ga0068854_100000943 | 3300005578 | Bacteria | 17491 |
| 167 | Ga0068854_100015417 | 3300005578 | Bacteria | 5062 |
| 168 | Ga0068854_100027117 | 3300005578 | Bacteria | 3946 |
| 169 | Ga0068854_100055930 | 3300005578 | Bacteria | 2843 |
| 170 | Ga0068854_100097432 | 3300005578 | Bacteria | 2199 |
| 171 | Ga0068854_102061983 | 3300005578 | Bacteria | 526 |
| 172 | Ga0068856_100000207 | 3300005614 | Bacteria | 63158 |
| 173 | Ga0068856_100000601 | 3300005614 | Bacteria | 39402 |
| 174 | Ga0068856_100001988 | 3300005614 | Bacteria | 21316 |
| 175 | Ga0068856_100002737 | 3300005614 | Bacteria | 18051 |
| 176 | Ga0068856_100068183 | 3300005614 | Bacteria | 3516 |
| 177 | Ga0068856_100393266 | 3300005614 | Bacteria | 1406 |
| 178 | Ga0068856_100721415 | 3300005614 | Bacteria | 1017 |
| 179 | Ga0068852_100007350 | 3300005616 | Bacteria | 8036 |
| 180 | Ga0068852_100015672 | 3300005616 | Bacteria | 5888 |
| 181 | Ga0068852_100143084 | 3300005616 | Bacteria | 2215 |
| 182 | Ga0068859_100457976 | 3300005617 | Bacteria | 1371 |
| 183 | Ga0068864_100184874 | 3300005618 | Bacteria | 1907 |
| 184 | Ga0068864_100650261 | 3300005618 | Bacteria | 1027 |
| 185 | Ga0068866_10402514 | 3300005718 | Bacteria | 883 |
| 186 | Ga0068861_100004302 | 3300005719 | Bacteria | 9551 |
| 187 | Ga0068851_10172710 | 3300005834 | Bacteria | 1193 |
| 188 | Ga0068851_10184633 | 3300005834 | Bacteria | 1156 |
| 189 | Ga0068863_100638734 | 3300005841 | Bacteria | 1055 |
| 190 | Ga0068863_102264099 | 3300005841 | Bacteria | 553 |
| 191 | Ga0068858_100057882 | 3300005842 | Bacteria | 3582 |
| 192 | Ga0068858_100108013 | 3300005842 | Bacteria | 2598 |
| 193 | Ga0068858_100141583 | 3300005842 | Bacteria | 2258 |
| 194 | Ga0068858_100171745 | 3300005842 | Bacteria | 2044 |
| 195 | Ga0068858_100402966 | 3300005842 | Bacteria | 1314 |
| 196 | Ga0068860_100017690 | 3300005843 | Bacteria | 6943 |
| 197 | Ga0068860_100652674 | 3300005843 | Bacteria | 1060 |
| 198 | Ga0070717_10307105 | 3300006028 | Bacteria | 1411 |
| 199 | Ga0075365_10275431 | 3300006038 | Bacteria | 1184 |
| 200 | Ga0075368_10139733 | 3300006042 | Bacteria | 1009 |
| 201 | Ga0075363_100278658 | 3300006048 | Bacteria | 967 |
| 202 | Ga0075364_10081975 | 3300006051 | Bacteria | 2134 |
| 203 | Ga0075364_10086286 | 3300006051 | Bacteria | 2079 |
| 204 | Ga0070716_100118647 | 3300006173 | Bacteria | 1652 |
| 205 | Ga0070716_100126527 | 3300006173 | Bacteria | 1608 |
| 206 | Ga0070712_100000023 | 3300006175 | Bacteria | 80972 |
| 207 | Ga0070712_100000260 | 3300006175 | Bacteria | 29575 |
| 208 | Ga0075362_10229580 | 3300006177 | Bacteria | 909 |
| 209 | Ga0075367_10112841 | 3300006178 | Bacteria | 1670 |
| 210 | Ga0075367_10324976 | 3300006178 | Bacteria | 970 |
| 211 | Ga0075369_10012978 | 3300006186 | Bacteria | 3297 |
| 212 | Ga0075366_10010093 | 3300006195 | Bacteria | 5292 |
| 213 | Ga0097621_100029484 | 3300006237 | Bacteria | 4334 |
| 214 | Ga0097621_100769244 | 3300006237 | Unclassified | 890 |
| 215 | Ga0097621_100989596 | 3300006237 | Bacteria | 786 |
| 216 | Ga0068871_100106078 | 3300006358 | Bacteria | 2358 |
| 217 | Ga0068871_100136919 | 3300006358 | Bacteria | 2080 |
| 218 | Ga0068871_100346626 | 3300006358 | Bacteria | 1313 |
| 219 | Ga0068871_100742322 | 3300006358 | Bacteria | 902 |
| 220 | Ga0075430_100034074 | 3300006846 | Bacteria | 4321 |
| 221 | Ga0075434_100181992 | 3300006871 | Bacteria | 2122 |
| 222 | Ga0075434_101450578 | 3300006871 | Bacteria | 696 |
| 223 | Ga0068865_100031222 | 3300006881 | Bacteria | 3551 |
| 224 | Ga0068865_100450875 | 3300006881 | Unclassified | 1063 |
| 225 | Ga0075436_100000211 | 3300006914 | Bacteria | 36106 |
| 226 | Ga0075436_100001356 | 3300006914 | Bacteria | 16647 |
| 227 | Ga0097620_100457962 | 3300006931 | Bacteria | 1371 |
| 228 | Ga0075435_100027464 | 3300007076 | Bacteria | 4453 |
| 229 | Ga0075435_100890519 | 3300007076 | Bacteria | 776 |
| 230 | Ga0075435_101485324 | 3300007076 | Bacteria | 594 |
| 231 | Ga0105251_10000166 | 3300009011 | Bacteria | 67845 |
| 232 | Ga0105240_10003992 | 3300009093 | Bacteria | 22736 |
| 233 | Ga0105240_10007148 | 3300009093 | Bacteria | 16262 |
| 234 | Ga0105240_10007501 | 3300009093 | Bacteria | 15829 |
| 235 | Ga0105240_10013903 | 3300009093 | Bacteria | 11019 |
| 236 | Ga0105240_10018515 | 3300009093 | Bacteria | 9349 |
| 237 | Ga0105245_10808944 | 3300009098 | Bacteria | 975 |
| 238 | Ga0105245_11174931 | 3300009098 | Bacteria | 815 |
| 239 | Ga0105245_11814928 | 3300009098 | Bacteria | 663 |
| 240 | Ga0105245_12143627 | 3300009098 | Bacteria | 613 |
| 241 | Ga0105247_10012698 | 3300009101 | Bacteria | 5054 |
| 242 | Ga0105243_10952536 | 3300009148 | Bacteria | 858 |
| 243 | Ga0105241_10013790 | 3300009174 | Bacteria | 5920 |
| 244 | Ga0105241_10128958 | 3300009174 | Bacteria | 2045 |
| 245 | Ga0105241_10155939 | 3300009174 | Bacteria | 1872 |
| 246 | Ga0105241_10237112 | 3300009174 | Bacteria | 1540 |
| 247 | Ga0105241_10429916 | 3300009174 | Bacteria | 1164 |
| 248 | Ga0105241_11177058 | 3300009174 | Bacteria | 725 |
| 249 | Ga0105242_10009594 | 3300009176 | Bacteria | 7418 |
| 250 | Ga0105248_10012144 | 3300009177 | Bacteria | 9501 |
| 251 | Ga0105248_10044017 | 3300009177 | Bacteria | 5007 |
| 252 | Ga0105237_10000022 | 3300009545 | Bacteria | 228427 |
| 253 | Ga0105237_10008165 | 3300009545 | Bacteria | 11370 |
| 254 | Ga0105237_11249219 | 3300009545 | Bacteria | 749 |
| 255 | Ga0105238_10001476 | 3300009551 | Bacteria | 23610 |
| 256 | Ga0105238_10004707 | 3300009551 | Bacteria | 13487 |
| 257 | Ga0105238_10056363 | 3300009551 | Bacteria | 3943 |
| 258 | Ga0105238_10061673 | 3300009551 | Bacteria | 3751 |
| 259 | Ga0105238_10067278 | 3300009551 | Bacteria | 3584 |
| 260 | Ga0105238_10073952 | 3300009551 | Unclassified | 3402 |
| 261 | Ga0105238_10080064 | 3300009551 | Bacteria | 3256 |
| 262 | Ga0105238_10182997 | 3300009551 | Bacteria | 2072 |
| 263 | Ga0105238_10806858 | 3300009551 | Bacteria | 954 |
| 264 | Ga0105238_11226149 | 3300009551 | Bacteria | 775 |
| 265 | Ga0105249_10205327 | 3300009553 | Bacteria | 1930 |
| 266 | Ga0105249_11107020 | 3300009553 | Bacteria | 862 |
| 267 | Ga0105147_101012 | 3300009982 | Bacteria | 2244 |
| 268 | Ga0105239_10000480 | 3300010375 | Bacteria | 58268 |
| 269 | Ga0105239_10010740 | 3300010375 | Bacteria | 10229 |
| 270 | Ga0105239_10044538 | 3300010375 | Bacteria | 4864 |
| 271 | Ga0105239_10347138 | 3300010375 | Bacteria | 1675 |
| 272 | Ga0105239_10902952 | 3300010375 | Bacteria | 1014 |
| 273 | Ga0105246_10410841 | 3300011119 | Bacteria | 1127 |
| 274 | Ga0157314_1000016 | 3300012500 | Bacteria | 16679 |
| 275 | Ga0157347_1001364 | 3300012502 | Bacteria | 1897 |
| 276 | Ga0157373_10001427 | 3300013100 | Bacteria | 18228 |
| 277 | Ga0157373_10009142 | 3300013100 | Bacteria | 7328 |
| 278 | Ga0157373_10025784 | 3300013100 | Bacteria | 4249 |
| 279 | Ga0157373_10451038 | 3300013100 | Bacteria | 925 |
| 280 | Ga0157373_10724601 | 3300013100 | Bacteria | 730 |
| 281 | Ga0157371_10000949 | 3300013102 | Bacteria | 32394 |
| 282 | Ga0157371_10021378 | 3300013102 | Bacteria | 4751 |
| 283 | Ga0157371_10131813 | 3300013102 | Bacteria | 1779 |
| 284 | Ga0157370_10002571 | 3300013104 | Bacteria | 21783 |
| 285 | Ga0157370_10003277 | 3300013104 | Bacteria | 19077 |
| 286 | Ga0157370_10004924 | 3300013104 | Bacteria | 15119 |
| 287 | Ga0157370_10032119 | 3300013104 | Bacteria | 5129 |
| 288 | Ga0157370_10040527 | 3300013104 | Bacteria | 4497 |
| 289 | Ga0157370_10247442 | 3300013104 | Bacteria | 1649 |
| 290 | Ga0157370_11651885 | 3300013104 | Bacteria | 575 |
| 291 | Ga0157369_10062027 | 3300013105 | Bacteria | 4029 |
| 292 | Ga0157369_10063520 | 3300013105 | Bacteria | 3977 |
| 293 | Ga0157369_10128798 | 3300013105 | Bacteria | 2682 |
| 294 | Ga0157369_10130919 | 3300013105 | Bacteria | 2658 |
| 295 | Ga0157369_10281078 | 3300013105 | Bacteria | 1733 |
| 296 | Ga0157374_10086846 | 3300013296 | Bacteria | 2977 |
| 297 | Ga0157374_10327811 | 3300013296 | Bacteria | 1518 |
| 298 | Ga0157374_10665818 | 3300013296 | Bacteria | 1053 |
| 299 | Ga0157374_11080610 | 3300013296 | Bacteria | 822 |
| 300 | Ga0157378_10053485 | 3300013297 | Bacteria | 3594 |
| 301 | Ga0157378_10351037 | 3300013297 | Bacteria | 1441 |
| 302 | Ga0157378_11074736 | 3300013297 | Bacteria | 841 |
| 303 | Ga0163162_10000810 | 3300013306 | Bacteria | 29022 |
| 304 | Ga0163162_10130877 | 3300013306 | Bacteria | 2618 |
| 305 | Ga0163162_10197536 | 3300013306 | Bacteria | 2140 |
| 306 | Ga0163162_11741408 | 3300013306 | Unclassified | 712 |
| 307 | Ga0157372_10047613 | 3300013307 | Bacteria | 4764 |
| 308 | Ga0157372_10145276 | 3300013307 | Bacteria | 2735 |
| 309 | Ga0157372_10190530 | 3300013307 | Bacteria | 2375 |
| 310 | Ga0157372_10379465 | 3300013307 | Bacteria | 1647 |
| 311 | Ga0157372_11426743 | 3300013307 | Bacteria | 798 |
| 312 | Ga0163163_10501482 | 3300014325 | Bacteria | 1276 |
| 313 | Ga0163163_10704965 | 3300014325 | Bacteria | 1073 |
| 314 | Ga0163163_10793968 | 3300014325 | Bacteria | 1010 |
| 315 | Ga0157380_10005575 | 3300014326 | Bacteria | 8793 |
| 316 | Ga0157380_10007540 | 3300014326 | Bacteria | 7731 |
| 317 | Ga0182008_10039688 | 3300014497 | Bacteria | 2352 |
| 318 | Ga0182008_10084244 | 3300014497 | Bacteria | 1566 |
| 319 | Ga0157379_10003729 | 3300014968 | Bacteria | 12965 |
| 320 | Ga0157379_10800502 | 3300014968 | Bacteria | 890 |
| 321 | Ga0157379_11401652 | 3300014968 | Unclassified | 677 |
| 322 | Ga0157376_10065585 | 3300014969 | Bacteria | 3067 |
| 323 | Ga0157376_10351679 | 3300014969 | Bacteria | 1410 |
| 324 | Ga0182006_1000058 | 3300015261 | Bacteria | 167164 |
| 325 | Ga0182007_10000640 | 3300015262 | Bacteria | 20231 |
| 326 | Ga0182007_10017026 | 3300015262 | Bacteria | 2666 |
| 327 | Ga0182007_10145714 | 3300015262 | Bacteria | 803 |
| 328 | Ga0182005_1002232 | 3300015265 | Bacteria | 7120 |
| 329 | Ga0183368_1002 | 3300015687 | Bacteria | 1865598 |
| 330 | Ga0163161_10004052 | 3300017792 | Bacteria | 10245 |
| 331 | Ga0163161_10025432 | 3300017792 | Bacteria | 4190 |
| 332 | Ga0163161_10812087 | 3300017792 | Bacteria | 787 |
| 333 | Ga0206356_11117712 | 3300020070 | Bacteria | 680 |
| 334 | Ga0206353_10911170 | 3300020082 | Bacteria | 1033 |
| 335 | Ga0209435_113671 | 3300025206 | Bacteria | 862 |
| 336 | Ga0209566_104006 | 3300025225 | Bacteria | 2097 |
| 337 | Ga0209674_100014 | 3300025226 | Bacteria | 704989 |
| 338 | Ga0209674_100059 | 3300025226 | Bacteria | 282517 |
| 339 | Ga0209672_100004 | 3300025228 | Bacteria | 1467504 |
| 340 | Ga0209672_100008 | 3300025228 | Bacteria | 946876 |
| 341 | Ga0209672_100019 | 3300025228 | Bacteria | 432215 |
| 342 | Ga0209672_100148 | 3300025228 | Bacteria | 62818 |
| 343 | Ga0209672_100250 | 3300025228 | Bacteria | 40232 |
| 344 | Ga0209672_101111 | 3300025228 | Bacteria | 11363 |
| 345 | Ga0209147_100026 | 3300025229 | Bacteria | 421622 |
| 346 | Ga0209563_100036 | 3300025230 | Bacteria | 448275 |
| 347 | Ga0207427_100037 | 3300025231 | Bacteria | 303108 |
| 348 | Ga0209437_100213 | 3300025233 | Bacteria | 107087 |
| 349 | Ga0209437_100257 | 3300025233 | Bacteria | 82683 |
| 350 | Ga0209437_106796 | 3300025233 | Bacteria | 1890 |
| 351 | Ga0209258_100003 | 3300025242 | Bacteria | 1467504 |
| 352 | Ga0209258_100004 | 3300025242 | Bacteria | 1376422 |
| 353 | Ga0209258_100008 | 3300025242 | Bacteria | 1009355 |
| 354 | Ga0209258_100057 | 3300025242 | Bacteria | 334259 |
| 355 | Ga0209258_100106 | 3300025242 | Bacteria | 206622 |
| 356 | Ga0209258_100253 | 3300025242 | Bacteria | 96309 |
| 357 | Ga0209258_101587 | 3300025242 | Bacteria | 7532 |
| 358 | Ga0209258_102649 | 3300025242 | Bacteria | 4437 |
| 359 | Ga0209646_1000836 | 3300025246 | Bacteria | 10370 |
| 360 | Ga0209646_1000920 | 3300025246 | Bacteria | 9436 |
| 361 | Ga0209026_1000045 | 3300025250 | Bacteria | 263431 |
| 362 | Ga0209026_1000203 | 3300025250 | Bacteria | 82196 |
| 363 | Ga0209026_1000368 | 3300025250 | Bacteria | 41597 |
| 364 | Ga0209026_1001886 | 3300025250 | Bacteria | 8527 |
| 365 | Ga0209026_1005722 | 3300025250 | Bacteria | 3254 |
| 366 | Ga0209677_105222 | 3300025253 | Bacteria | 3456 |
| 367 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 368 | Ga0209148_1000016 | 3300025254 | Bacteria | 804369 |
| 369 | Ga0209148_1000042 | 3300025254 | Bacteria | 464111 |
| 370 | Ga0209148_1000068 | 3300025254 | Bacteria | 335510 |
| 371 | Ga0209148_1000200 | 3300025254 | Bacteria | 107200 |
| 372 | Ga0209148_1001546 | 3300025254 | Bacteria | 11159 |
| 373 | Ga0209759_1000117 | 3300025256 | Bacteria | 141785 |
| 374 | Ga0209759_1000185 | 3300025256 | Bacteria | 100505 |
| 375 | Ga0209759_1002855 | 3300025256 | Bacteria | 7285 |
| 376 | Ga0209759_1003448 | 3300025256 | Bacteria | 6297 |
| 377 | Ga0209129_1002704 | 3300025258 | Bacteria | 8321 |
| 378 | Ga0209129_1012943 | 3300025258 | Bacteria | 1872 |
| 379 | Ga0209233_1000096 | 3300025261 | Bacteria | 303482 |
| 380 | Ga0209233_1011598 | 3300025261 | Bacteria | 2592 |
| 381 | Ga0209233_1019797 | 3300025261 | Bacteria | 1780 |
| 382 | Ga0209233_1058431 | 3300025261 | Bacteria | 754 |
| 383 | Ga0209565_1000094 | 3300025263 | Bacteria | 134853 |
| 384 | Ga0209455_1000004 | 3300025272 | Bacteria | 1467504 |
| 385 | Ga0209455_1000007 | 3300025272 | Bacteria | 1157983 |
| 386 | Ga0209455_1000016 | 3300025272 | Bacteria | 753097 |
| 387 | Ga0209455_1000103 | 3300025272 | Bacteria | 201664 |
| 388 | Ga0209455_1000142 | 3300025272 | Bacteria | 138027 |
| 389 | Ga0209455_1003324 | 3300025272 | Bacteria | 5757 |
| 390 | Ga0209455_1005694 | 3300025272 | Bacteria | 3800 |
| 391 | Ga0209455_1007165 | 3300025272 | Bacteria | 3183 |
| 392 | Ga0209673_1058028 | 3300025273 | Bacteria | 982 |
| 393 | Ga0209675_1002994 | 3300025291 | Bacteria | 8317 |
| 394 | Ga0209025_1002073 | 3300025294 | Bacteria | 22764 |
| 395 | Ga0209564_1000942 | 3300025295 | Bacteria | 37527 |
| 396 | Ga0209758_1000491 | 3300025297 | Bacteria | 64678 |
| 397 | Ga0209758_1024734 | 3300025297 | Bacteria | 2665 |
| 398 | Ga0209758_1025701 | 3300025297 | Bacteria | 2573 |
| 399 | Ga0209256_1001544 | 3300025299 | Bacteria | 22970 |
| 400 | Ga0209256_1012538 | 3300025299 | Bacteria | 3229 |
| 401 | Ga0209051_1018386 | 3300025303 | Bacteria | 3093 |
| 402 | Ga0207656_10048892 | 3300025321 | Bacteria | 1822 |
| 403 | Ga0207713_1000221 | 3300025735 | Bacteria | 76659 |
| 404 | Ga0207642_10676486 | 3300025899 | Bacteria | 649 |
| 405 | Ga0207710_10005665 | 3300025900 | Bacteria | 5375 |
| 406 | Ga0207680_10000003 | 3300025903 | Bacteria | 925264 |
| 407 | Ga0207680_10233838 | 3300025903 | Bacteria | 1264 |
| 408 | Ga0207647_10000005 | 3300025904 | Bacteria | 223490 |
| 409 | Ga0207647_10012567 | 3300025904 | Bacteria | 5888 |
| 410 | Ga0207647_10023640 | 3300025904 | Bacteria | 4062 |
| 411 | Ga0207699_10212014 | 3300025906 | Bacteria | 1318 |
| 412 | Ga0207645_10128939 | 3300025907 | Bacteria | 1646 |
| 413 | Ga0207705_10000105 | 3300025909 | Bacteria | 95742 |
| 414 | Ga0207705_10006165 | 3300025909 | Bacteria | 8917 |
| 415 | Ga0207654_10000066 | 3300025911 | Bacteria | 68652 |
| 416 | Ga0207707_10000105 | 3300025912 | Bacteria | 83206 |
| 417 | Ga0207707_10001585 | 3300025912 | Bacteria | 20960 |
| 418 | Ga0207707_10037229 | 3300025912 | Bacteria | 4251 |
| 419 | Ga0207695_10001444 | 3300025913 | Bacteria | 39750 |
| 420 | Ga0207695_10003927 | 3300025913 | Bacteria | 20570 |
| 421 | Ga0207695_10004251 | 3300025913 | Bacteria | 19672 |
| 422 | Ga0207695_10004499 | 3300025913 | Bacteria | 18977 |
| 423 | Ga0207695_10010604 | 3300025913 | Bacteria | 11263 |
| 424 | Ga0207695_10011161 | 3300025913 | Bacteria | 10903 |
| 425 | Ga0207671_10000009 | 3300025914 | Bacteria | 724862 |
| 426 | Ga0207671_10000205 | 3300025914 | Bacteria | 89701 |
| 427 | Ga0207671_10059601 | 3300025914 | Bacteria | 2831 |
| 428 | Ga0207671_10664502 | 3300025914 | Bacteria | 829 |
| 429 | Ga0207663_10317953 | 3300025916 | Bacteria | 1169 |
| 430 | Ga0207663_10980416 | 3300025916 | Bacteria | 677 |
| 431 | Ga0207660_10007467 | 3300025917 | Bacteria | 7071 |
| 432 | Ga0207662_10203049 | 3300025918 | Bacteria | 1284 |
| 433 | Ga0207657_10004336 | 3300025919 | Bacteria | 15025 |
| 434 | Ga0207657_10162213 | 3300025919 | Bacteria | 1815 |
| 435 | Ga0207657_10260605 | 3300025919 | Bacteria | 1380 |
| 436 | Ga0207649_10018912 | 3300025920 | Bacteria | 3929 |
| 437 | Ga0207649_10923662 | 3300025920 | Bacteria | 685 |
| 438 | Ga0207649_10950477 | 3300025920 | Bacteria | 675 |
| 439 | Ga0207652_10002799 | 3300025921 | Bacteria | 14635 |
| 440 | Ga0207652_10315168 | 3300025921 | Bacteria | 1412 |
| 441 | Ga0207652_10534002 | 3300025921 | Bacteria | 1055 |
| 442 | Ga0207694_10001033 | 3300025924 | Bacteria | 24240 |
| 443 | Ga0207694_10055667 | 3300025924 | Bacteria | 3070 |
| 444 | Ga0207694_10085965 | 3300025924 | Bacteria | 2476 |
| 445 | Ga0207694_10179922 | 3300025924 | Bacteria | 1714 |
| 446 | Ga0207694_10190707 | 3300025924 | Unclassified | 1665 |
| 447 | Ga0207694_10249918 | 3300025924 | Bacteria | 1451 |
| 448 | Ga0207694_10438426 | 3300025924 | Bacteria | 1090 |
| 449 | Ga0207694_10532769 | 3300025924 | Bacteria | 985 |
| 450 | Ga0207694_10621120 | 3300025924 | Bacteria | 909 |
| 451 | Ga0207650_10107709 | 3300025925 | Bacteria | 2153 |
| 452 | Ga0207650_10349698 | 3300025925 | Bacteria | 1216 |
| 453 | Ga0207687_10068943 | 3300025927 | Bacteria | 2521 |
| 454 | Ga0207664_10455141 | 3300025929 | Bacteria | 1143 |
| 455 | Ga0207690_10004742 | 3300025932 | Bacteria | 8029 |
| 456 | Ga0207690_10021343 | 3300025932 | Bacteria | 4015 |
| 457 | Ga0207690_10546571 | 3300025932 | Bacteria | 941 |
| 458 | Ga0207686_10009412 | 3300025934 | Bacteria | 5300 |
| 459 | Ga0207686_10068642 | 3300025934 | Bacteria | 2271 |
| 460 | Ga0207709_11411085 | 3300025935 | Bacteria | 577 |
| 461 | Ga0207670_10028380 | 3300025936 | Bacteria | 3552 |
| 462 | Ga0207670_10272851 | 3300025936 | Bacteria | 1315 |
| 463 | Ga0207704_10190400 | 3300025938 | Unclassified | 1492 |
| 464 | Ga0207711_10050655 | 3300025941 | Bacteria | 3555 |
| 465 | Ga0207711_10064907 | 3300025941 | Bacteria | 3155 |
| 466 | Ga0207711_10354843 | 3300025941 | Bacteria | 1358 |
| 467 | Ga0207689_10068293 | 3300025942 | Bacteria | 2921 |
| 468 | Ga0207679_10029011 | 3300025945 | Bacteria | 3848 |
| 469 | Ga0207667_10000193 | 3300025949 | Bacteria | 88949 |
| 470 | Ga0207667_10000244 | 3300025949 | Bacteria | 76441 |
| 471 | Ga0207667_10002143 | 3300025949 | Bacteria | 24745 |
| 472 | Ga0207667_10003976 | 3300025949 | Bacteria | 18166 |
| 473 | Ga0207667_10008736 | 3300025949 | Bacteria | 12009 |
| 474 | Ga0207667_10075772 | 3300025949 | Bacteria | 3492 |
| 475 | Ga0207667_10195614 | 3300025949 | Bacteria | 2074 |
| 476 | Ga0207667_10617780 | 3300025949 | Bacteria | 1092 |
| 477 | Ga0207651_10119037 | 3300025960 | Bacteria | 1999 |
| 478 | Ga0207651_10439986 | 3300025960 | Bacteria | 1117 |
| 479 | Ga0207712_10247187 | 3300025961 | Bacteria | 1440 |
| 480 | Ga0207668_10124865 | 3300025972 | Bacteria | 1955 |
| 481 | Ga0207668_10266626 | 3300025972 | Bacteria | 1398 |
| 482 | Ga0207640_10000169 | 3300025981 | Bacteria | 47286 |
| 483 | Ga0207640_10000961 | 3300025981 | Bacteria | 15990 |
| 484 | Ga0207640_10015686 | 3300025981 | Bacteria | 4390 |
| 485 | Ga0207640_10043770 | 3300025981 | Bacteria | 2864 |
| 486 | Ga0207640_10074513 | 3300025981 | Bacteria | 2297 |
| 487 | Ga0207640_10293452 | 3300025981 | Bacteria | 1283 |
| 488 | Ga0207658_10183357 | 3300025986 | Bacteria | 1734 |
| 489 | Ga0207658_10355862 | 3300025986 | Bacteria | 1276 |
| 490 | Ga0207658_10477769 | 3300025986 | Bacteria | 1107 |
| 491 | Ga0207658_11140685 | 3300025986 | Bacteria | 712 |
| 492 | Ga0207703_10083650 | 3300026035 | Bacteria | 2667 |
| 493 | Ga0207703_10117135 | 3300026035 | Bacteria | 2282 |
| 494 | Ga0207703_10134009 | 3300026035 | Bacteria | 2143 |
| 495 | Ga0207639_10034959 | 3300026041 | Bacteria | 3717 |
| 496 | Ga0207639_10141799 | 3300026041 | Bacteria | 2003 |
| 497 | Ga0207639_10244031 | 3300026041 | Bacteria | 1563 |
| 498 | Ga0207639_10477191 | 3300026041 | Bacteria | 1136 |
| 499 | Ga0207678_10012183 | 3300026067 | Bacteria | 7555 |
| 500 | Ga0207678_10021852 | 3300026067 | Bacteria | 5611 |
| 501 | Ga0207678_10087171 | 3300026067 | Bacteria | 2668 |
| 502 | Ga0207678_10183666 | 3300026067 | Bacteria | 1786 |
| 503 | Ga0207678_10196563 | 3300026067 | Bacteria | 1724 |
| 504 | Ga0207678_10223933 | 3300026067 | Bacteria | 1610 |
| 505 | Ga0207678_10297027 | 3300026067 | Bacteria | 1388 |
| 506 | Ga0207678_11235862 | 3300026067 | Bacteria | 661 |
| 507 | Ga0207702_10000279 | 3300026078 | Bacteria | 58912 |
| 508 | Ga0207702_10005755 | 3300026078 | Bacteria | 10786 |
| 509 | Ga0207702_10008212 | 3300026078 | Bacteria | 8825 |
| 510 | Ga0207702_11043160 | 3300026078 | Bacteria | 811 |
| 511 | Ga0207702_11486691 | 3300026078 | Bacteria | 671 |
| 512 | Ga0207641_10005694 | 3300026088 | Bacteria | 10602 |
| 513 | Ga0207641_10383426 | 3300026088 | Bacteria | 1346 |
| 514 | Ga0207648_10149152 | 3300026089 | Bacteria | 2063 |
| 515 | Ga0207676_10640214 | 3300026095 | Bacteria | 1025 |
| 516 | Ga0207674_10000134 | 3300026116 | Bacteria | 86377 |
| 517 | Ga0207674_10000401 | 3300026116 | Bacteria | 56126 |
| 518 | Ga0207674_10076088 | 3300026116 | Bacteria | 3366 |
| 519 | Ga0207674_10106286 | 3300026116 | Bacteria | 2784 |
| 520 | Ga0207674_10128797 | 3300026116 | Bacteria | 2495 |
| 521 | Ga0207674_10200995 | 3300026116 | Bacteria | 1942 |
| 522 | Ga0207674_10810171 | 3300026116 | Bacteria | 904 |
| 523 | Ga0207675_100004588 | 3300026118 | Bacteria | 13316 |
| 524 | Ga0207675_100406003 | 3300026118 | Bacteria | 1343 |
| 525 | Ga0207698_11022169 | 3300026142 | Bacteria | 838 |
| 526 | Ga0209282_1000056 | 3300027666 | Bacteria | 100584 |
| 527 | Ga0268266_10000011 | 3300028379 | Bacteria | 757403 |
| 528 | Ga0268266_10092294 | 3300028379 | Bacteria | 2656 |
| 529 | Ga0268266_10875245 | 3300028379 | Bacteria | 868 |
| 530 | Ga0268265_10757154 | 3300028380 | Bacteria | 943 |
| 531 | Ga0268264_10232993 | 3300028381 | Bacteria | 1701 |
| 532 | Ga0268264_10250318 | 3300028381 | Bacteria | 1646 |
| 533 | Ga0307517_10092418 | 3300028786 | Bacteria | 2462 |
| 534 | Ga0265327_10104843 | 3300031251 | Bacteria | 1359 |
| 535 | Ga0307513_10201771 | 3300031456 | Bacteria | 1829 |
| 536 | Ga0307513_10699977 | 3300031456 | Bacteria | 719 |
| 537 | Ga0307408_100448470 | 3300031548 | Bacteria | 1119 |
| 538 | Ga0307405_10714677 | 3300031731 | Bacteria | 831 |
| 539 | Ga0307413_10088260 | 3300031824 | Bacteria | 2011 |
| 540 | Ga0307413_10726263 | 3300031824 | Bacteria | 828 |
| 541 | Ga0307407_10737876 | 3300031903 | Bacteria | 745 |
| 542 | Ga0307409_101123161 | 3300031995 | Bacteria | 808 |
| 543 | Ga0307411_10360250 | 3300032005 | Bacteria | 1189 |
| 544 | Ga0307510_10040224 | 3300033180 | Bacteria | 5136 |
| 545 | Ga0373926_0083976 | 3300035083 | Bacteria | 1180 |
| 546 | Ga0373957_0248328 | 3300035120 | Bacteria | 748 |
| 547 | Ga0373955_0104792 | 3300035172 | Bacteria | 1628 |
| 548 | Ga0373931_0006882 | 3300035691 | Bacteria | 5346 |
| 549 | Ga0373935_0376423 | 3300035692 | Bacteria | 1016 |
| 550 | Ga0373927_0034762 | 3300035695 | Bacteria | 3278 |
| 551 | Ga0373937_0006062 | 3300036401 | Bacteria | 10406 |
| 552 | Ga0373925_0045596 | 3300037068 | Bacteria | 3257 |
| 553 | Ga0373925_0335765 | 3300037068 | Bacteria | 1225 |
| 554 | Ga0373925_0646457 | 3300037068 | Bacteria | 871 |
| 555 | Ga0395899_0000226 | 3300037312 | Bacteria | 76657 |
| 556 | Ga0395899_0003288 | 3300037312 | Bacteria | 12813 |
| 557 | Ga0395899_0003519 | 3300037312 | Bacteria | 12408 |
| 558 | Ga0395899_0292473 | 3300037312 | Bacteria | 1105 |
| 559 | Ga0395900_0000011 | 3300037418 | Bacteria | 421926 |
| 560 | Ga0395900_0000078 | 3300037418 | Bacteria | 179292 |
| 561 | Ga0395900_0008850 | 3300037418 | Bacteria | 10335 |
| 562 | Ga0395900_0778801 | 3300037418 | Bacteria | 885 |
| 563 | Ga0395898_0000029 | 3300037466 | Bacteria | 370667 |
| 564 | Ga0395898_0000336 | 3300037466 | Bacteria | 106457 |
| 565 | Ga0395898_0040001 | 3300037466 | Bacteria | 4639 |
| 566 | Ga0395898_0469500 | 3300037466 | Bacteria | 1197 |
| 567 | Ga0395905_0172296 | 3300037471 | Bacteria | 2033 |
| 568 | Ga0395901_0106861 | 3300038443 | Bacteria | 2937 |
| 569 | Ga0395901_0116900 | 3300038443 | Bacteria | 2802 |
| 570 | Ga0395901_0869160 | 3300038443 | Bacteria | 885 |
| 571 | Ga0451791_0401505 | 3300041451 | Bacteria | 4911 |
| 572 | Ga0451791_1329675 | 3300041451 | Bacteria | 765 |
| 573 | Ga0451802_1042238 | 3300041460 | Bacteria | 1692 |
| 574 | Ga0451804_0307298 | 3300041463 | Bacteria | 731 |
| 575 | Ga0451807_0155889 | 3300041486 | Bacteria | 2169 |
| 576 | Ga0451833_0261258 | 3300041491 | Bacteria | 1095 |
| 577 | Ga0451837_0107029 | 3300041494 | Bacteria | 4061 |
| 578 | Ga0451837_0381109 | 3300041494 | Bacteria | 2022 |
| 579 | Ga0439431_0084438 | 3300041997 | Bacteria | 859 |
| 580 | Ga0451577_0318117 | 3300042876 | Bacteria | 1411 |
| 581 | Ga0451577_0375764 | 3300042876 | Bacteria | 1289 |
| 582 | Ga0466969_0031836 | 3300044656 | Bacteria | 2683 |
| 583 | Ga0466969_0033388 | 3300044656 | Bacteria | 2612 |
| 584 | Ga0466969_0042658 | 3300044656 | Bacteria | 2263 |
| 585 | Ga0466969_0171810 | 3300044656 | Bacteria | 993 |
| 586 | Ga0466972_0033943 | 3300044658 | Bacteria | 2502 |
| 587 | Ga0466989_0019721 | 3300044663 | Bacteria | 3869 |
| 588 | Ga0466982_0000001 | 3300044672 | Bacteria | 514662 |
| 589 | Ga0466965_0113435 | 3300044683 | Bacteria | 1394 |
| 590 | Ga0466965_0152070 | 3300044683 | Bacteria | 1210 |
| 591 | Ga0466966_0004620 | 3300044684 | Bacteria | 9072 |
| 592 | Ga0466966_0007031 | 3300044684 | Bacteria | 7451 |
| 593 | Ga0466966_0011542 | 3300044684 | Bacteria | 5860 |
| 594 | Ga0466961_0001169 | 3300044693 | Bacteria | 16139 |
| 595 | Ga0466961_0001667 | 3300044693 | Bacteria | 13816 |
| 596 | Ga0466961_0023321 | 3300044693 | Bacteria | 3981 |
| 597 | Ga0466961_0025976 | 3300044693 | Bacteria | 3764 |
| 598 | Ga0466963_0011721 | 3300044694 | Bacteria | 5345 |
| 599 | Ga0466963_0096443 | 3300044694 | Bacteria | 2020 |
| 600 | Ga0466964_0004985 | 3300044706 | Bacteria | 4906 |
| 601 | Ga0466964_0275861 | 3300044706 | Bacteria | 838 |
| 602 | Ga0466964_0378005 | 3300044706 | Bacteria | 735 |
| 603 | Ga0466971_0007278 | 3300044719 | Bacteria | 4818 |
| 604 | Ga0466968_0015619 | 3300044735 | Bacteria | 3012 |
| 605 | Ga0466970_0001207 | 3300044765 | Bacteria | 12553 |
| 606 | Ga0466970_0042862 | 3300044765 | Bacteria | 2407 |
| 607 | Ga0466970_0050528 | 3300044765 | Bacteria | 2217 |
| 608 | Ga0466957_0123453 | 3300044842 | Bacteria | 1653 |
| 609 | Ga0466957_0127426 | 3300044842 | Bacteria | 1627 |
| 610 | Ga0466957_0139004 | 3300044842 | Bacteria | 1563 |
| 611 | Ga0466957_0478905 | 3300044842 | Bacteria | 861 |
| 612 | Ga0466960_0035701 | 3300044901 | Bacteria | 2324 |
| 613 | Ga0466959_0000006 | 3300045049 | Bacteria | 192678 |
| 614 | Ga0466959_0011279 | 3300045049 | Bacteria | 6414 |
| 615 | Ga0466959_0021454 | 3300045049 | Bacteria | 4763 |
| 616 | Ga0466959_0169706 | 3300045049 | Bacteria | 1530 |
| 617 | Ga0466959_0461067 | 3300045049 | Bacteria | 861 |
| 618 | Ga0466958_0023770 | 3300045836 | Bacteria | 3601 |
| 619 | Ga0466958_0042117 | 3300045836 | Bacteria | 2749 |
| 620 | Ga0466958_0121422 | 3300045836 | Bacteria | 1636 |
| 621 | Ga0466958_0162720 | 3300045836 | Bacteria | 1410 |
| 622 | Ga0495617_000040 | 3300046452 | Bacteria | 126637 |
| 623 | Ga0495617_001397 | 3300046452 | Bacteria | 10640 |
| 624 | Ga0495592_0120393 | 3300046454 | Bacteria | 1847 |
| 625 | Ga0495590_0071212 | 3300046457 | Bacteria | 1220 |
| 626 | Ga0495591_026505 | 3300046458 | Bacteria | 1800 |
| 627 | Ga0495629_0056246 | 3300046459 | Bacteria | 2751 |
| 628 | Ga0495638_0000339 | 3300046460 | Bacteria | 59031 |
| 629 | Ga0495638_0000670 | 3300046460 | Bacteria | 37267 |
| 630 | Ga0495638_0008078 | 3300046460 | Bacteria | 7488 |
| 631 | Ga0495638_0065452 | 3300046460 | Bacteria | 2237 |
| 632 | Ga0495638_0125300 | 3300046460 | Bacteria | 1514 |
| 633 | Ga0495651_0104976 | 3300046462 | Bacteria | 2097 |
| 634 | Ga0495650_0000112 | 3300046471 | Bacteria | 197339 |
| 635 | Ga0495650_0000852 | 3300046471 | Bacteria | 36650 |
| 636 | Ga0495650_0006997 | 3300046471 | Bacteria | 6887 |
| 637 | Ga0495650_0013554 | 3300046471 | Bacteria | 4303 |
| 638 | Ga0495605_0000834 | 3300046474 | Bacteria | 21724 |
| 639 | Ga0495605_0103498 | 3300046474 | Bacteria | 1306 |
| 640 | Ga0495664_0310201 | 3300046477 | Bacteria | 952 |
| 641 | Ga0495584_0002683 | 3300046491 | Bacteria | 10010 |
| 642 | Ga0495585_0000024 | 3300046492 | Bacteria | 148384 |
| 643 | Ga0495585_0012695 | 3300046492 | Bacteria | 4958 |
| 644 | Ga0495585_0281625 | 3300046492 | Bacteria | 822 |
| 645 | Ga0495596_0000060 | 3300046500 | Bacteria | 79429 |
| 646 | Ga0495607_0001134 | 3300046501 | Bacteria | 24157 |
| 647 | Ga0495607_0003270 | 3300046501 | Bacteria | 12466 |
| 648 | Ga0495607_0070767 | 3300046501 | Bacteria | 1948 |
| 649 | Ga0495583_0029981 | 3300046506 | Bacteria | 2655 |
| 650 | Ga0495606_0000902 | 3300046507 | Bacteria | 44174 |
| 651 | Ga0495606_0001920 | 3300046507 | Bacteria | 25804 |
| 652 | Ga0495606_0005113 | 3300046507 | Bacteria | 12741 |
| 653 | Ga0495606_0017472 | 3300046507 | Bacteria | 5421 |
| 654 | Ga0495606_0029881 | 3300046507 | Bacteria | 3818 |
| 655 | Ga0495606_0095395 | 3300046507 | Bacteria | 1822 |
| 656 | Ga0495608_0189403 | 3300046511 | Bacteria | 1299 |
| 657 | Ga0495610_0000235 | 3300046512 | Bacteria | 58396 |
| 658 | Ga0495610_0026982 | 3300046512 | Bacteria | 3059 |
| 659 | Ga0495616_0000496 | 3300046513 | Bacteria | 29907 |
| 660 | Ga0495616_0000948 | 3300046513 | Bacteria | 20871 |
| 661 | Ga0495616_0006065 | 3300046513 | Bacteria | 7364 |
| 662 | Ga0495620_0000348 | 3300046515 | Bacteria | 32030 |
| 663 | Ga0495620_0061047 | 3300046515 | Bacteria | 1569 |
| 664 | Ga0495628_0120775 | 3300046516 | Bacteria | 2011 |
| 665 | Ga0495628_0148849 | 3300046516 | Bacteria | 1784 |
| 666 | Ga0495631_0000331 | 3300046518 | Bacteria | 32429 |
| 667 | Ga0495631_0005220 | 3300046518 | Bacteria | 6837 |
| 668 | Ga0495631_0369941 | 3300046518 | Bacteria | 610 |
| 669 | Ga0495632_0000005 | 3300046519 | Bacteria | 362872 |
| 670 | Ga0495632_0002695 | 3300046519 | Bacteria | 13262 |
| 671 | Ga0495632_0015748 | 3300046519 | Bacteria | 4226 |
| 672 | Ga0495643_0037484 | 3300046522 | Bacteria | 2659 |
| 673 | Ga0495648_0004979 | 3300046524 | Bacteria | 11163 |
| 674 | Ga0495648_0006512 | 3300046524 | Bacteria | 9519 |
| 675 | Ga0495648_0020135 | 3300046524 | Bacteria | 4667 |
| 676 | Ga0495663_0003305 | 3300046525 | Bacteria | 4670 |
| 677 | Ga0495652_0174652 | 3300046529 | Bacteria | 1655 |
| 678 | Ga0495654_0265487 | 3300046530 | Bacteria | 710 |
| 679 | Ga0495587_0080671 | 3300046536 | Bacteria | 1885 |
| 680 | Ga0495598_0013526 | 3300046537 | Bacteria | 2025 |
| 681 | Ga0495609_0000573 | 3300046538 | Bacteria | 28911 |
| 682 | Ga0495609_0008691 | 3300046538 | Bacteria | 4953 |
| 683 | Ga0495621_0007430 | 3300046539 | Bacteria | 3245 |
| 684 | Ga0495645_0085218 | 3300046543 | Bacteria | 2262 |
| 685 | Ga0495645_0136859 | 3300046543 | Bacteria | 1712 |
| 686 | Ga0495622_0000954 | 3300046557 | Bacteria | 15501 |
| 687 | Ga0495667_0116573 | 3300046559 | Bacteria | 1725 |
| 688 | Ga0495667_0147015 | 3300046559 | Bacteria | 1518 |
| 689 | Ga0495656_0479924 | 3300046615 | Bacteria | 657 |
| 690 | Ga0495668_0007118 | 3300046616 | Bacteria | 7206 |
| 691 | Ga0495668_0135978 | 3300046616 | Bacteria | 1345 |
| 692 | Ga0495611_0000005 | 3300046648 | Bacteria | 284271 |
| 693 | Ga0495611_0000039 | 3300046648 | Bacteria | 100068 |
| 694 | Ga0495611_0239590 | 3300046648 | Bacteria | 842 |
| 695 | Ga0495625_0000066 | 3300046660 | Bacteria | 172144 |
| 696 | Ga0495625_0049565 | 3300046660 | Bacteria | 3018 |
| 697 | Ga0495625_0052521 | 3300046660 | Bacteria | 2918 |
| 698 | Ga0495625_0064695 | 3300046660 | Bacteria | 2579 |
| 699 | Ga0495625_0066875 | 3300046660 | Bacteria | 2531 |
| 700 | Ga0495625_0270106 | 3300046660 | Bacteria | 1097 |
| 701 | Ga0495635_0033451 | 3300046663 | Bacteria | 3566 |
| 702 | Ga0495661_0004104 | 3300046665 | Bacteria | 10608 |
| 703 | Ga0495661_0015165 | 3300046665 | Bacteria | 5145 |
| 704 | Ga0495661_0050806 | 3300046665 | Bacteria | 2507 |
| 705 | Ga0495657_0028273 | 3300046675 | Bacteria | 3947 |
| 706 | Ga0495657_0068025 | 3300046675 | Bacteria | 2336 |
| 707 | Ga0495623_0119945 | 3300046679 | Bacteria | 1584 |
| 708 | Ga0495647_0318148 | 3300046681 | Bacteria | 704 |
| 709 | Ga0495658_0129605 | 3300046683 | Bacteria | 1534 |
| 710 | Ga0495669_0019406 | 3300046684 | Bacteria | 2935 |
| 711 | Ga0495613_0624211 | 3300046689 | Bacteria | 715 |
| 712 | Ga0495670_0003480 | 3300046691 | Bacteria | 7736 |
| 713 | Ga0495670_0008096 | 3300046691 | Bacteria | 5165 |
| 714 | Ga0495670_0369262 | 3300046691 | Bacteria | 773 |
| 715 | Ga0495671_0002622 | 3300046692 | Bacteria | 11308 |
| 716 | Ga0495671_0009862 | 3300046692 | Bacteria | 5314 |
| 717 | Ga0495649_0009841 | 3300046694 | Bacteria | 5659 |
| 718 | Ga0495589_0000026 | 3300046794 | Bacteria | 184723 |
| 719 | Ga0495660_0000544 | 3300046810 | Bacteria | 30876 |
| 720 | Ga0495660_0012768 | 3300046810 | Bacteria | 4873 |
| 721 | Ga0495604_0058823 | 3300047317 | Bacteria | 2950 |
| 722 | Ga0495604_0124017 | 3300047317 | Bacteria | 1866 |
| 723 | Ga0495636_0117221 | 3300047318 | Bacteria | 1176 |
| 724 | Ga0495672_0028976 | 3300047320 | Bacteria | 3494 |
| 725 | Ga0495672_0149341 | 3300047320 | Bacteria | 1213 |
| 726 | Ga0495683_0001769 | 3300047323 | Bacteria | 13615 |
| 727 | Ga0495675_0257236 | 3300047444 | Bacteria | 1047 |
| 728 | Ga0495677_0067846 | 3300047445 | Bacteria | 1327 |
| 729 | Ga0495679_000010 | 3300047446 | Bacteria | 337760 |
| 730 | Ga0495679_034113 | 3300047446 | Bacteria | 1622 |
| 731 | Ga0495685_062513 | 3300047447 | Bacteria | 1253 |
| 732 | Ga0495673_0000038 | 3300047469 | Bacteria | 303785 |
| 733 | Ga0495673_0000045 | 3300047469 | Bacteria | 280765 |
| 734 | Ga0495673_0001306 | 3300047469 | Bacteria | 20288 |
| 735 | Ga0495684_0011976 | 3300047471 | Bacteria | 6689 |
| 736 | Ga0495684_0346330 | 3300047471 | Bacteria | 1056 |
| 737 | Ga0495686_0000050 | 3300047472 | Bacteria | 269010 |
| 738 | Ga0495686_0000297 | 3300047472 | Bacteria | 85762 |
| 739 | Ga0495686_0002453 | 3300047472 | Bacteria | 17478 |
| 740 | Ga0495686_0012390 | 3300047472 | Bacteria | 5965 |
| 741 | Ga0495686_0069393 | 3300047472 | Bacteria | 2172 |
| 742 | Ga0495602_0373648 | 3300048088 | Bacteria | 1023 |
| 743 | Ga0495602_0467633 | 3300048088 | Bacteria | 887 |
| 744 | Ga0496100_0106172 | 3300048903 | Bacteria | 1943 |
| 745 | Ga0496101_0135366 | 3300048904 | Bacteria | 1874 |
| 746 | Ga0496101_0263846 | 3300048904 | Bacteria | 1344 |
| 747 | Ga0496101_0871253 | 3300048904 | Bacteria | 709 |
| 748 | Ga0496102_0222324 | 3300048905 | Bacteria | 1780 |
| 749 | Ga0496102_0734201 | 3300048905 | Bacteria | 910 |
| 750 | Ga0496104_0071611 | 3300048907 | Bacteria | 3296 |
| 751 | Ga0496104_0145631 | 3300048907 | Bacteria | 2275 |
| 752 | Ga0496104_1062658 | 3300048907 | Bacteria | 713 |
| 753 | Ga0496105_0007857 | 3300048908 | Bacteria | 8282 |
| 754 | Ga0496105_0737563 | 3300048908 | Bacteria | 753 |
| 755 | Ga0496106_0000097 | 3300048909 | Bacteria | 66262 |
| 756 | Ga0496106_0917761 | 3300048909 | Bacteria | 691 |
| 757 | Ga0496106_1008555 | 3300048909 | Bacteria | 654 |
| 758 | Ga0496108_0047944 | 3300048911 | Bacteria | 3572 |
| 759 | Ga0496109_0113065 | 3300048912 | Bacteria | 2525 |
| 760 | Ga0496109_0440352 | 3300048912 | Bacteria | 1231 |
| 761 | Ga0496111_0268892 | 3300048914 | Bacteria | 1265 |
| 762 | Ga0496112_0271738 | 3300048915 | Bacteria | 1643 |
| 763 | Ga0496113_0012014 | 3300048916 | Bacteria | 5807 |
| 764 | Ga0496113_0222473 | 3300048916 | Bacteria | 1504 |
| 765 | Ga0496114_1335055 | 3300048917 | Bacteria | 604 |
| 766 | Ga0496115_0000283 | 3300048918 | Bacteria | 43828 |
| 767 | Ga0496115_0002834 | 3300048918 | Bacteria | 12471 |
| 768 | Ga0496115_0012403 | 3300048918 | Bacteria | 6413 |
| 769 | Ga0496115_1054726 | 3300048918 | Bacteria | 618 |
| 770 | Ga0496116_0002634 | 3300048919 | Bacteria | 18622 |
| 771 | Ga0496116_0056171 | 3300048919 | Bacteria | 2582 |
| 772 | Ga0496117_0076902 | 3300048920 | Bacteria | 2210 |
| 773 | Ga0496117_0077580 | 3300048920 | Bacteria | 2198 |
| 774 | Ga0496117_0082170 | 3300048920 | Bacteria | 2111 |
| 775 | Ga0496117_0163237 | 3300048920 | Bacteria | 1302 |
| 776 | Ga0496117_0507393 | 3300048920 | Bacteria | 583 |
| 777 | Ga0496118_0002818 | 3300048921 | Bacteria | 22746 |
| 778 | Ga0496118_0003470 | 3300048921 | Bacteria | 19795 |
| 779 | Ga0496118_0004496 | 3300048921 | Bacteria | 16495 |
| 780 | Ga0496118_0006149 | 3300048921 | Bacteria | 13319 |
| 781 | Ga0496118_0006461 | 3300048921 | Bacteria | 12872 |
| 782 | Ga0496119_0000291 | 3300048922 | Bacteria | 70213 |
| 783 | Ga0496119_0016378 | 3300048922 | Bacteria | 5644 |
| 784 | Ga0496120_0000397 | 3300048923 | Bacteria | 70206 |
| 785 | Ga0496120_0001574 | 3300048923 | Bacteria | 26674 |
| 786 | Ga0496121_0000531 | 3300048924 | Bacteria | 72444 |
| 787 | Ga0496121_0001099 | 3300048924 | Bacteria | 47710 |
| 788 | Ga0496121_0002812 | 3300048924 | Bacteria | 25735 |
| 789 | Ga0496121_0003485 | 3300048924 | Bacteria | 22401 |
| 790 | Ga0496121_0007940 | 3300048924 | Bacteria | 12682 |
| 791 | Ga0496121_0015521 | 3300048924 | Bacteria | 7970 |
| 792 | Ga0496121_0015815 | 3300048924 | Bacteria | 7854 |
| 793 | Ga0496121_0020023 | 3300048924 | Bacteria | 6652 |
| 794 | Ga0496121_0084225 | 3300048924 | Bacteria | 2508 |
| 795 | Ga0496121_0103775 | 3300048924 | Bacteria | 2186 |
| 796 | Ga0496121_0121910 | 3300048924 | Bacteria | 1967 |
| 797 | Ga0496121_0141953 | 3300048924 | Bacteria | 1780 |
| 798 | Ga0496121_0252139 | 3300048924 | Bacteria | 1223 |
| 799 | Ga0496122_0002324 | 3300048925 | Bacteria | 27434 |
| 800 | Ga0496122_0007927 | 3300048925 | Bacteria | 11626 |
| 801 | Ga0496122_0061502 | 3300048925 | Bacteria | 2756 |
| 802 | Ga0496122_0192599 | 3300048925 | Bacteria | 1201 |
| 803 | Ga0496122_0592492 | 3300048925 | Bacteria | 520 |
| 804 | Ga0496123_0002089 | 3300048926 | Bacteria | 25702 |
| 805 | Ga0496123_0026147 | 3300048926 | Bacteria | 4381 |
| 806 | Ga0496123_0027129 | 3300048926 | Bacteria | 4273 |
| 807 | Ga0496125_0000647 | 3300048928 | Bacteria | 58140 |
| 808 | Ga0496125_0012655 | 3300048928 | Bacteria | 8352 |
| 809 | Ga0496125_0024927 | 3300048928 | Bacteria | 5489 |
| 810 | Ga0496125_0216524 | 3300048928 | Bacteria | 1238 |
| 811 | Ga0496125_0412248 | 3300048928 | Bacteria | 786 |
| 812 | Ga0496126_0001015 | 3300048929 | Bacteria | 47751 |
| 813 | Ga0496126_0068693 | 3300048929 | Bacteria | 3163 |
| 814 | Ga0496126_0098442 | 3300048929 | Bacteria | 2562 |
| 815 | Ga0496126_0192114 | 3300048929 | Bacteria | 1729 |
| 816 | Ga0496126_0197252 | 3300048929 | Bacteria | 1702 |
| 817 | Ga0496126_0686034 | 3300048929 | Bacteria | 798 |
| 818 | Ga0495678_000672 | 3300049459 | Bacteria | 31401 |
| 819 | Ga0495682_0010314 | 3300049460 | Bacteria | 3621 |
| 820 | Ga0495682_0018766 | 3300049460 | Bacteria | 2604 |
| 821 | Ga0501031_0005471 | 3300049568 | Bacteria | 8265 |
| 822 | Ga0501031_0011536 | 3300049568 | Bacteria | 5761 |
| 823 | Ga0501031_0039301 | 3300049568 | Bacteria | 3087 |
| 824 | Ga0501032_0032581 | 3300049569 | Bacteria | 3571 |
| 825 | Ga0501032_0200553 | 3300049569 | Bacteria | 1302 |
| 826 | Ga0501032_0240022 | 3300049569 | Bacteria | 1177 |
| 827 | Ga0501033_0000289 | 3300049570 | Bacteria | 48277 |
| 828 | Ga0501033_0000339 | 3300049570 | Bacteria | 44797 |
| 829 | Ga0501033_0036019 | 3300049570 | Bacteria | 3709 |
| 830 | Ga0501033_0074403 | 3300049570 | Bacteria | 2494 |
| 831 | Ga0501033_0155948 | 3300049570 | Bacteria | 1645 |
| 832 | Ga0501033_0471617 | 3300049570 | Bacteria | 870 |
| 833 | Ga0501034_0001724 | 3300049571 | Bacteria | 28139 |
| 834 | Ga0501034_0012646 | 3300049571 | Bacteria | 8708 |
| 835 | Ga0501034_0023149 | 3300049571 | Bacteria | 6332 |
| 836 | Ga0501034_0126272 | 3300049571 | Bacteria | 2543 |
| 837 | Ga0501034_0146951 | 3300049571 | Bacteria | 2334 |
| 838 | Ga0501034_0169310 | 3300049571 | Bacteria | 2152 |
| 839 | Ga0501034_0181126 | 3300049571 | Bacteria | 2072 |
| 840 | Ga0501034_0195113 | 3300049571 | Bacteria | 1985 |
| 841 | Ga0501034_0692355 | 3300049571 | Bacteria | 918 |
| 842 | Ga0501036_0000051 | 3300049572 | Bacteria | 75057 |
| 843 | Ga0501036_0048851 | 3300049572 | Bacteria | 3582 |
| 844 | Ga0501036_0551496 | 3300049572 | Bacteria | 958 |
| 845 | Ga0501036_0653395 | 3300049572 | Bacteria | 870 |
| 846 | Ga0501036_0901850 | 3300049572 | Bacteria | 725 |
| 847 | Ga0501036_1127952 | 3300049572 | Bacteria | 640 |
| 848 | Ga0501037_0002569 | 3300049573 | Bacteria | 13111 |
| 849 | Ga0501037_0026579 | 3300049573 | Bacteria | 4278 |
| 850 | Ga0501037_0150259 | 3300049573 | Bacteria | 1665 |
| 851 | Ga0501037_0238428 | 3300049573 | Bacteria | 1275 |
| 852 | Ga0501037_0368517 | 3300049573 | Bacteria | 989 |
| 853 | Ga0501037_0401334 | 3300049573 | Bacteria | 940 |
| 854 | Ga0501037_0478779 | 3300049573 | Bacteria | 846 |
| 855 | Ga0501037_0738756 | 3300049573 | Bacteria | 653 |
| 856 | Ga0501038_0005817 | 3300049574 | Bacteria | 11412 |
| 857 | Ga0501038_0019453 | 3300049574 | Bacteria | 6120 |
| 858 | Ga0501038_0044246 | 3300049574 | Bacteria | 3870 |
| 859 | Ga0501038_0140701 | 3300049574 | Bacteria | 1974 |
| 860 | Ga0501038_0359075 | 3300049574 | Bacteria | 1133 |
| 861 | Ga0501038_0514752 | 3300049574 | Bacteria | 914 |
| 862 | Ga0501039_0027791 | 3300049575 | Bacteria | 4350 |
| 863 | Ga0501039_0030698 | 3300049575 | Bacteria | 4144 |
| 864 | Ga0501039_0221944 | 3300049575 | Bacteria | 1486 |
| 865 | Ga0501040_0202723 | 3300049576 | Bacteria | 1409 |
| 866 | Ga0501041_0007930 | 3300049577 | Bacteria | 6243 |
| 867 | Ga0501042_0079853 | 3300049578 | Bacteria | 2344 |
| 868 | Ga0501042_0305891 | 3300049578 | Bacteria | 1148 |
| 869 | Ga0501043_0003654 | 3300049579 | Bacteria | 12629 |
| 870 | Ga0501043_0015316 | 3300049579 | Bacteria | 6006 |
| 871 | Ga0501043_0051289 | 3300049579 | Bacteria | 3241 |
| 872 | Ga0501043_0127804 | 3300049579 | Bacteria | 1992 |
| 873 | Ga0501043_0128392 | 3300049579 | Bacteria | 1987 |
| 874 | Ga0501043_0132366 | 3300049579 | Bacteria | 1954 |
| 875 | Ga0501043_0164621 | 3300049579 | Bacteria | 1732 |
| 876 | Ga0501043_0320570 | 3300049579 | Bacteria | 1182 |
| 877 | Ga0501043_1105114 | 3300049579 | Bacteria | 560 |
| 878 | Ga0501046_0006257 | 3300049580 | Bacteria | 10560 |
| 879 | Ga0501046_0011629 | 3300049580 | Bacteria | 7523 |
| 880 | Ga0501046_0015448 | 3300049580 | Bacteria | 6413 |
| 881 | Ga0501046_0054043 | 3300049580 | Bacteria | 3161 |
| 882 | Ga0501046_0070261 | 3300049580 | Bacteria | 2722 |
| 883 | Ga0501046_0162254 | 3300049580 | Bacteria | 1680 |
| 884 | Ga0501046_0202997 | 3300049580 | Bacteria | 1474 |
| 885 | Ga0501046_0303782 | 3300049580 | Bacteria | 1165 |
| 886 | Ga0501047_0001196 | 3300049581 | Bacteria | 25704 |
| 887 | Ga0501047_0001416 | 3300049581 | Bacteria | 23526 |
| 888 | Ga0501047_0014773 | 3300049581 | Bacteria | 7431 |
| 889 | Ga0501047_0015511 | 3300049581 | Bacteria | 7259 |
| 890 | Ga0501047_0025910 | 3300049581 | Bacteria | 5638 |
| 891 | Ga0501047_0099896 | 3300049581 | Bacteria | 2781 |
| 892 | Ga0501047_0317447 | 3300049581 | Bacteria | 1398 |
| 893 | Ga0501047_0324912 | 3300049581 | Bacteria | 1378 |
| 894 | Ga0501047_0459337 | 3300049581 | Bacteria | 1102 |
| 895 | Ga0501047_0510192 | 3300049581 | Bacteria | 1029 |
| 896 | Ga0501047_1070930 | 3300049581 | Bacteria | 619 |
| 897 | Ga0501048_0023832 | 3300049582 | Bacteria | 4470 |
| 898 | Ga0501048_0081172 | 3300049582 | Bacteria | 2288 |
| 899 | Ga0501048_0086692 | 3300049582 | Bacteria | 2208 |
| 900 | Ga0501048_0226859 | 3300049582 | Bacteria | 1325 |
| 901 | Ga0501048_0413846 | 3300049582 | Bacteria | 964 |
| 902 | Ga0501048_0502865 | 3300049582 | Bacteria | 869 |
| 903 | Ga0501068_0077570 | 3300049584 | Bacteria | 2035 |
| 904 | Ga0501068_0266891 | 3300049584 | Bacteria | 1092 |
| 905 | Ga0501069_0017848 | 3300049585 | Bacteria | 3827 |
| 906 | Ga0501070_0001751 | 3300049586 | Bacteria | 19191 |
| 907 | Ga0501070_0002827 | 3300049586 | Bacteria | 15146 |
| 908 | Ga0501070_0050328 | 3300049586 | Bacteria | 3459 |
| 909 | Ga0501070_0090232 | 3300049586 | Bacteria | 2536 |
| 910 | Ga0501070_0221901 | 3300049586 | Bacteria | 1550 |
| 911 | Ga0501070_0748232 | 3300049586 | Bacteria | 770 |
| 912 | Ga0501071_0349800 | 3300049587 | Bacteria | 1124 |
| 913 | Ga0501072_0256236 | 3300049588 | Bacteria | 1393 |
| 914 | Ga0501072_0315842 | 3300049588 | Bacteria | 1242 |
| 915 | Ga0501073_0024817 | 3300049589 | Bacteria | 4303 |
| 916 | Ga0501073_0039910 | 3300049589 | Bacteria | 3324 |
| 917 | Ga0501073_0082245 | 3300049589 | Bacteria | 2240 |
| 918 | Ga0501073_0295662 | 3300049589 | Bacteria | 1117 |
| 919 | Ga0501074_0003781 | 3300049590 | Bacteria | 10754 |
| 920 | Ga0501074_0005065 | 3300049590 | Bacteria | 9459 |
| 921 | Ga0501074_0194285 | 3300049590 | Bacteria | 1447 |
| 922 | Ga0501074_0211829 | 3300049590 | Bacteria | 1380 |
| 923 | Ga0501074_0584540 | 3300049590 | Bacteria | 790 |
| 924 | Ga0501075_0118012 | 3300049591 | Bacteria | 2017 |
| 925 | Ga0501076_0031032 | 3300049592 | Bacteria | 4165 |
| 926 | Ga0501076_0036539 | 3300049592 | Bacteria | 3849 |
| 927 | Ga0501077_0297788 | 3300049593 | Bacteria | 1027 |
| 928 | Ga0501077_0470240 | 3300049593 | Bacteria | 805 |
| 929 | Ga0501079_0008655 | 3300049741 | Bacteria | 7719 |
| 930 | Ga0501079_0012401 | 3300049741 | Bacteria | 6504 |
| 931 | Ga0501079_0113180 | 3300049741 | Bacteria | 2109 |
| 932 | Ga0501079_0196934 | 3300049741 | Bacteria | 1573 |
| 933 | Ga0501079_0896104 | 3300049741 | Bacteria | 698 |
| 934 | Ga0501080_0009065 | 3300049742 | Bacteria | 9056 |
| 935 | Ga0501080_0021486 | 3300049742 | Bacteria | 5972 |
| 936 | Ga0501080_0070795 | 3300049742 | Bacteria | 3244 |
| 937 | Ga0501080_0072753 | 3300049742 | Bacteria | 3198 |
| 938 | Ga0501080_0097049 | 3300049742 | Bacteria | 2736 |
| 939 | Ga0501080_0125100 | 3300049742 | Bacteria | 2381 |
| 940 | Ga0501080_0236388 | 3300049742 | Bacteria | 1669 |
| 941 | Ga0501081_0110592 | 3300049743 | Bacteria | 1949 |
| 942 | Ga0501083_0032266 | 3300049744 | Bacteria | 3593 |
| 943 | Ga0501083_0723980 | 3300049744 | Bacteria | 647 |
| 944 | Ga0501035_0001784 | 3300049822 | Bacteria | 21748 |
| 945 | Ga0501035_0051441 | 3300049822 | Bacteria | 3689 |
| 946 | Ga0501035_0069252 | 3300049822 | Bacteria | 3128 |
| 947 | Ga0501035_0072485 | 3300049822 | Bacteria | 3048 |
| 948 | Ga0501035_0112283 | 3300049822 | Bacteria | 2388 |
| 949 | Ga0501035_0130034 | 3300049822 | Bacteria | 2195 |
| 950 | Ga0501035_0131129 | 3300049822 | Bacteria | 2185 |
| 951 | Ga0501035_0148783 | 3300049822 | Bacteria | 2033 |
| 952 | Ga0501035_0170660 | 3300049822 | Bacteria | 1879 |
| 953 | Ga0501035_0174004 | 3300049822 | Bacteria | 1858 |
| 954 | Ga0501035_0349400 | 3300049822 | Bacteria | 1237 |
| 955 | Ga0501035_0526059 | 3300049822 | Bacteria | 971 |
| 956 | Ga0501035_1054738 | 3300049822 | Bacteria | 637 |
| 957 | Ga0501044_0014869 | 3300049823 | Bacteria | 8390 |
| 958 | Ga0501044_0020894 | 3300049823 | Bacteria | 6989 |
| 959 | Ga0501044_0059574 | 3300049823 | Bacteria | 3911 |
| 960 | Ga0501044_0102799 | 3300049823 | Bacteria | 2872 |
| 961 | Ga0501044_0115863 | 3300049823 | Bacteria | 2685 |
| 962 | Ga0501044_0491605 | 3300049823 | Bacteria | 1129 |
| 963 | Ga0501044_0962933 | 3300049823 | Bacteria | 726 |
| 964 | Ga0501044_1263325 | 3300049823 | Bacteria | 605 |
| 965 | Ga0501045_0116947 | 3300049824 | Bacteria | 1979 |
| 966 | Ga0501045_0143901 | 3300049824 | Bacteria | 1773 |
| 967 | nmdc:mga00v17_143788_c1 | 3300050491 | Bacteria | 1530 |
| 968 | nmdc:mga0k408_113684_c1 | 3300050493 | Bacteria | 1601 |
| 969 | nmdc:mga0k408_66584_c1 | 3300050493 | Bacteria | 2098 |
| 970 | nmdc:mga0qj67_18581_c1 | 3300050509 | Bacteria | 5298 |
| 971 | nmdc:mga0sz30_137565_c1 | 3300050516 | Bacteria | 1078 |
| 972 | Ga0495595_0070125 | 3300053084 | Bacteria | 1656 |
| 973 | Ga0495619_0005513 | 3300053085 | Bacteria | 8028 |
| 974 | Ga0500643_000074 | 3300053087 | Bacteria | 111502 |
| 975 | Ga0500644_0400606 | 3300053088 | Bacteria | 598 |
| 976 | Ga0500562_026359 | 3300053108 | Bacteria | 1523 |
| 977 | Ga0500568_0001210 | 3300053139 | Bacteria | 17205 |
| 978 | Ga0500645_001728 | 3300053730 | Bacteria | 10609 |
| 979 | Ga0500599_005582 | 3300053736 | Bacteria | 1585 |
| 980 | Ga0501084_0007827 | 3300054114 | Bacteria | 8793 |
| 981 | Ga0501084_0831738 | 3300054114 | Bacteria | 777 |
| 982 | Ga0501082_0018624 | 3300060353 | Bacteria | 5984 |
| 983 | Ga0501082_0044536 | 3300060353 | Bacteria | 3827 |
| 984 | Ga0466962_0003425 | 3300061719 | Bacteria | 7552 |
| 985 | Ga0466962_0008321 | 3300061719 | Bacteria | 4969 |
| 986 | Ga0466962_0009529 | 3300061719 | Bacteria | 4657 |
| 987 | Ga0466962_0016609 | 3300061719 | Bacteria | 3550 |
| 988 | Ga0530510_0187427 | 3300061734 | Bacteria | 1535 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300010375 | Ga0105239_10347138 | Ga0105239_103471382 | 143 |
| 2 | 3300013105 | Ga0157369_10130919 | Ga0157369_101309195 | 143 |
| 3 | 3300013307 | Ga0157372_10145276 | Ga0157372_101452765 | 143 |
| 4 | 3300025918 | Ga0207662_10203049 | Ga0207662_102030491 | 151 |
| 5 | iso_pu_bacteria | 2936361878 | 2936362127 | 153 |
| 6 | 3300013100 | Ga0157373_10009142 | Ga0157373_100091423 | 154 |
| 7 | 3300013102 | Ga0157371_10000949 | Ga0157371_1000094917 | 154 |
| 8 | iso_pu_bacteria | 2883291878 | 2883296529 | 156 |
| 9 | iso_pu_bacteria | 2883354860 | 2883359236 | 156 |
| 10 | iso_pu_bacteria | 2501025501 | 2501072313 | 157 |
| 11 | iso_pu_bacteria | 2501025502 | 2501083068 | 157 |
| 12 | iso_pu_bacteria | 2501025504 | 2501409003 | 157 |
| 13 | iso_pu_bacteria | 2510917013 | 2511090959 | 157 |
| 14 | iso_pu_bacteria | 2510917014 | 2511098695 | 157 |
| 15 | iso_pu_bacteria | 2510917015 | 2511106278 | 157 |
| 16 | iso_pu_bacteria | 2513237082 | 2513556835 | 157 |
| 17 | iso_pu_bacteria | 2513237083 | 2513562759 | 157 |
| 18 | iso_pu_bacteria | 2515154189 | 2516020921 | 157 |
| 19 | iso_pu_bacteria | 2856287931 | 2856287985 | 157 |
| 20 | iso_pu_bacteria | 2857357740 | 2857358392 | 157 |
| 21 | iso_pu_bacteria | 2883087390 | 2883089179 | 157 |
| 22 | iso_pu_bacteria | 8003955200 | 8003959842 | 157 |
| 23 | 3300003323 | rootH1_10116952 | rootH1_101169522 | 158 |
| 24 | 3300005293 | Ga0065715_10046227 | Ga0065715_100462272 | 158 |
| 25 | 3300005327 | Ga0070658_10056502 | Ga0070658_100565024 | 158 |
| 26 | 3300005355 | Ga0070671_100002542 | Ga0070671_1000025427 | 158 |
| 27 | 3300017792 | Ga0163161_10812087 | Ga0163161_108120871 | 158 |
| 28 | 3300031903 | Ga0307407_10737876 | Ga0307407_107378762 | 158 |
| 29 | 3300031995 | Ga0307409_101123161 | Ga0307409_1011231611 | 158 |
| 30 | 3300046525 | Ga0495663_0003305 | Ga0495663_0003305_3224_3703 | 158 |
| 31 | 3300046537 | Ga0495598_0013526 | Ga0495598_0013526_1185_1664 | 158 |
| 32 | 3300046539 | Ga0495621_0007430 | Ga0495621_0007430_1346_1825 | 158 |
| 33 | 3300047318 | Ga0495636_0117221 | Ga0495636_0117221_287_766 | 158 |
| 34 | 3300047445 | Ga0495677_0067846 | Ga0495677_0067846_215_694 | 158 |
| 35 | iso_pu_bacteria | 2510065045 | 2510250421 | 158 |
| 36 | iso_pu_bacteria | 2512047030 | 2512347952 | 158 |
| 37 | iso_pu_bacteria | 2515154122 | 2515679023 | 158 |
| 38 | iso_pu_bacteria | 2519103095 | 2519458294 | 158 |
| 39 | iso_pu_bacteria | 2537561836 | 2538833367 | 158 |
| 40 | iso_pu_bacteria | 2582581311 | 2585294658 | 158 |
| 41 | iso_pu_bacteria | 2593339239 | 2595450423 | 158 |
| 42 | iso_pu_bacteria | 2643221562 | 2643831902 | 158 |
| 43 | iso_pu_bacteria | 2718217991 | 2719639569 | 158 |
| 44 | iso_pu_bacteria | 2718218334 | 2721029164 | 158 |
| 45 | iso_pu_bacteria | 2734482264 | 2735835252 | 158 |
| 46 | iso_pu_bacteria | 2738543009 | 2739229632 | 158 |
| 47 | iso_pu_bacteria | 2739367700 | 2739733374 | 158 |
| 48 | iso_pu_bacteria | 2816332253 | 2817260440 | 158 |
| 49 | iso_pu_bacteria | 2816332286 | 2817452633 | 158 |
| 50 | iso_pu_bacteria | 2818991440 | 2819564976 | 158 |
| 51 | iso_pu_bacteria | 2818991450 | 2819622189 | 158 |
| 52 | iso_pu_bacteria | 2884338543 | 2884342357 | 158 |
| 53 | iso_pu_bacteria | 2884411467 | 2884412915 | 158 |
| 54 | iso_pu_bacteria | 2885270888 | 2885273127 | 158 |
| 55 | iso_pu_bacteria | 2902682994 | 2902683030 | 158 |
| 56 | iso_pu_bacteria | 2904463128 | 2904465502 | 158 |
| 57 | iso_pu_bacteria | 2919404418 | 2919406977 | 158 |
| 58 | iso_pu_bacteria | 2928108538 | 2928113151 | 158 |
| 59 | iso_pu_bacteria | 2928135762 | 2928140310 | 158 |
| 60 | iso_pu_bacteria | 2928503688 | 2928507869 | 158 |
| 61 | iso_pu_bacteria | 2928963466 | 2928965477 | 158 |
| 62 | iso_pu_bacteria | 2941471342 | 2941474914 | 158 |
| 63 | iso_pu_bacteria | 2953994433 | 2953996866 | 158 |
| 64 | iso_pu_bacteria | 8020807995 | 8020811280 | 158 |
| 65 | iso_pu_bacteria | 8039098773 | 8039104294 | 158 |
| 66 | iso_pu_bacteria | 8040173305 | 8040176782 | 158 |
| 67 | 3300014326 | Ga0157380_10007540 | Ga0157380_100075406 | 159 |
| 68 | 3300025899 | Ga0207642_10676486 | Ga0207642_106764862 | 159 |
| 69 | 3300031731 | Ga0307405_10714677 | Ga0307405_107146771 | 159 |
| 70 | 3300005289 | Ga0065704_10126300 | Ga0065704_101263001 | 160 |
| 71 | 3300005295 | Ga0065707_10082887 | Ga0065707_100828878 | 160 |
| 72 | 3300005327 | Ga0070658_10009305 | Ga0070658_100093055 | 160 |
| 73 | 3300005331 | Ga0070670_100097839 | Ga0070670_1000978393 | 160 |
| 74 | 3300005336 | Ga0070680_100044803 | Ga0070680_1000448035 | 160 |
| 75 | 3300005339 | Ga0070660_100000996 | Ga0070660_10000099614 | 160 |
| 76 | 3300005341 | Ga0070691_10000185 | Ga0070691_1000018518 | 160 |
| 77 | 3300005341 | Ga0070691_10000527 | Ga0070691_1000052710 | 160 |
| 78 | 3300005343 | Ga0070687_100220036 | Ga0070687_1002200363 | 160 |
| 79 | 3300005344 | Ga0070661_100663045 | Ga0070661_1006630452 | 160 |
| 80 | 3300005347 | Ga0070668_100022772 | Ga0070668_1000227725 | 160 |
| 81 | 3300005354 | Ga0070675_100167512 | Ga0070675_1001675123 | 160 |
| 82 | 3300005366 | Ga0070659_100010709 | Ga0070659_1000107098 | 160 |
| 83 | 3300005434 | Ga0070709_10002174 | Ga0070709_1000217413 | 160 |
| 84 | 3300005434 | Ga0070709_10143710 | Ga0070709_101437103 | 160 |
| 85 | 3300005435 | Ga0070714_100172444 | Ga0070714_1001724443 | 160 |
| 86 | 3300005435 | Ga0070714_100389172 | Ga0070714_1003891722 | 160 |
| 87 | 3300005436 | Ga0070713_100000141 | Ga0070713_10000014157 | 160 |
| 88 | 3300005436 | Ga0070713_100613007 | Ga0070713_1006130072 | 160 |
| 89 | 3300005439 | Ga0070711_100040650 | Ga0070711_1000406503 | 160 |
| 90 | 3300005440 | Ga0070705_100455529 | Ga0070705_1004555292 | 160 |
| 91 | 3300005444 | Ga0070694_100840581 | Ga0070694_1008405811 | 160 |
| 92 | 3300005444 | Ga0070694_101020317 | Ga0070694_1010203171 | 160 |
| 93 | 3300005455 | Ga0070663_100273696 | Ga0070663_1002736962 | 160 |
| 94 | 3300005458 | Ga0070681_10048156 | Ga0070681_100481566 | 160 |
| 95 | 3300005468 | Ga0070707_100756693 | Ga0070707_1007566932 | 160 |
| 96 | 3300005530 | Ga0070679_100082982 | Ga0070679_1000829826 | 160 |
| 97 | 3300005530 | Ga0070679_100672414 | Ga0070679_1006724142 | 160 |
| 98 | 3300005535 | Ga0070684_100099768 | Ga0070684_1000997683 | 160 |
| 99 | 3300005539 | Ga0068853_100047768 | Ga0068853_1000477686 | 160 |
| 100 | 3300005539 | Ga0068853_100119917 | Ga0068853_1001199174 | 160 |
| 101 | 3300005545 | Ga0070695_100005528 | Ga0070695_1000055288 | 160 |
| 102 | 3300005545 | Ga0070695_100518582 | Ga0070695_1005185822 | 160 |
| 103 | 3300005547 | Ga0070693_100075066 | Ga0070693_1000750664 | 160 |
| 104 | 3300005549 | Ga0070704_100145588 | Ga0070704_1001455883 | 160 |
| 105 | 3300005563 | Ga0068855_100021852 | Ga0068855_1000218521 | 160 |
| 106 | 3300005563 | Ga0068855_100060941 | Ga0068855_1000609419 | 160 |
| 107 | 3300005577 | Ga0068857_100002119 | Ga0068857_10000211913 | 160 |
| 108 | 3300005578 | Ga0068854_100055930 | Ga0068854_1000559304 | 160 |
| 109 | 3300005578 | Ga0068854_102061983 | Ga0068854_1020619831 | 160 |
| 110 | 3300005614 | Ga0068856_100000601 | Ga0068856_10000060115 | 160 |
| 111 | 3300005614 | Ga0068856_100001988 | Ga0068856_10000198813 | 160 |
| 112 | 3300005614 | Ga0068856_100393266 | Ga0068856_1003932662 | 160 |
| 113 | 3300005616 | Ga0068852_100007350 | Ga0068852_1000073504 | 160 |
| 114 | 3300005618 | Ga0068864_100650261 | Ga0068864_1006502612 | 160 |
| 115 | 3300005719 | Ga0068861_100004302 | Ga0068861_1000043023 | 160 |
| 116 | 3300005834 | Ga0068851_10184633 | Ga0068851_101846332 | 160 |
| 117 | 3300005841 | Ga0068863_102264099 | Ga0068863_1022640991 | 160 |
| 118 | 3300005842 | Ga0068858_100171745 | Ga0068858_1001717453 | 160 |
| 119 | 3300006038 | Ga0075365_10275431 | Ga0075365_102754312 | 160 |
| 120 | 3300006042 | Ga0075368_10139733 | Ga0075368_101397333 | 160 |
| 121 | 3300006051 | Ga0075364_10086286 | Ga0075364_100862863 | 160 |
| 122 | 3300006173 | Ga0070716_100118647 | Ga0070716_1001186472 | 160 |
| 123 | 3300006173 | Ga0070716_100126527 | Ga0070716_1001265273 | 160 |
| 124 | 3300006175 | Ga0070712_100000023 | Ga0070712_10000002388 | 160 |
| 125 | 3300006175 | Ga0070712_100000260 | Ga0070712_1000002609 | 160 |
| 126 | 3300006178 | Ga0075367_10112841 | Ga0075367_101128412 | 160 |
| 127 | 3300006237 | Ga0097621_100989596 | Ga0097621_1009895962 | 160 |
| 128 | 3300006358 | Ga0068871_100346626 | Ga0068871_1003466262 | 160 |
| 129 | 3300006358 | Ga0068871_100742322 | Ga0068871_1007423221 | 160 |
| 130 | 3300006871 | Ga0075434_100181992 | Ga0075434_1001819923 | 160 |
| 131 | 3300006871 | Ga0075434_101450578 | Ga0075434_1014505781 | 160 |
| 132 | 3300006914 | Ga0075436_100000211 | Ga0075436_10000021137 | 160 |
| 133 | 3300006914 | Ga0075436_100001356 | Ga0075436_1000013567 | 160 |
| 134 | 3300007076 | Ga0075435_100027464 | Ga0075435_1000274643 | 160 |
| 135 | 3300007076 | Ga0075435_101485324 | Ga0075435_1014853241 | 160 |
| 136 | 3300009093 | Ga0105240_10003992 | Ga0105240_1000399219 | 160 |
| 137 | 3300009098 | Ga0105245_10808944 | Ga0105245_108089441 | 160 |
| 138 | 3300009098 | Ga0105245_11814928 | Ga0105245_118149282 | 160 |
| 139 | 3300009148 | Ga0105243_10952536 | Ga0105243_109525361 | 160 |
| 140 | 3300009174 | Ga0105241_10013790 | Ga0105241_100137907 | 160 |
| 141 | 3300009174 | Ga0105241_10155939 | Ga0105241_101559393 | 160 |
| 142 | 3300009174 | Ga0105241_10237112 | Ga0105241_102371121 | 160 |
| 143 | 3300009174 | Ga0105241_10429916 | Ga0105241_104299161 | 160 |
| 144 | 3300009176 | Ga0105242_10009594 | Ga0105242_100095945 | 160 |
| 145 | 3300009177 | Ga0105248_10012144 | Ga0105248_100121446 | 160 |
| 146 | 3300009545 | Ga0105237_10008165 | Ga0105237_1000816510 | 160 |
| 147 | 3300009551 | Ga0105238_10001476 | Ga0105238_1000147622 | 160 |
| 148 | 3300009551 | Ga0105238_10004707 | Ga0105238_100047077 | 160 |
| 149 | 3300009553 | Ga0105249_11107020 | Ga0105249_111070202 | 160 |
| 150 | 3300010375 | Ga0105239_10010740 | Ga0105239_100107409 | 160 |
| 151 | 3300013100 | Ga0157373_10001427 | Ga0157373_1000142711 | 160 |
| 152 | 3300013104 | Ga0157370_10004924 | Ga0157370_1000492411 | 160 |
| 153 | 3300013104 | Ga0157370_10032119 | Ga0157370_100321197 | 160 |
| 154 | 3300013105 | Ga0157369_10128798 | Ga0157369_101287983 | 160 |
| 155 | 3300013296 | Ga0157374_10086846 | Ga0157374_100868462 | 160 |
| 156 | 3300013297 | Ga0157378_10053485 | Ga0157378_100534853 | 160 |
| 157 | 3300013297 | Ga0157378_11074736 | Ga0157378_110747362 | 160 |
| 158 | 3300013306 | Ga0163162_10197536 | Ga0163162_101975362 | 160 |
| 159 | 3300013307 | Ga0157372_10190530 | Ga0157372_101905302 | 160 |
| 160 | 3300014325 | Ga0163163_10501482 | Ga0163163_105014821 | 160 |
| 161 | 3300014325 | Ga0163163_10793968 | Ga0163163_107939682 | 160 |
| 162 | 3300014968 | Ga0157379_10003729 | Ga0157379_1000372913 | 160 |
| 163 | 3300014968 | Ga0157379_11401652 | Ga0157379_114016521 | 160 |
| 164 | 3300025906 | Ga0207699_10212014 | Ga0207699_102120143 | 160 |
| 165 | 3300025909 | Ga0207705_10000105 | Ga0207705_1000010598 | 160 |
| 166 | 3300025912 | Ga0207707_10001585 | Ga0207707_100015857 | 160 |
| 167 | 3300025914 | Ga0207671_10059601 | Ga0207671_100596013 | 160 |
| 168 | 3300025916 | Ga0207663_10317953 | Ga0207663_103179533 | 160 |
| 169 | 3300025917 | Ga0207660_10007467 | Ga0207660_100074675 | 160 |
| 170 | 3300025919 | Ga0207657_10004336 | Ga0207657_1000433611 | 160 |
| 171 | 3300025921 | Ga0207652_10002799 | Ga0207652_100027993 | 160 |
| 172 | 3300025924 | Ga0207694_10055667 | Ga0207694_100556672 | 160 |
| 173 | 3300025924 | Ga0207694_10438426 | Ga0207694_104384262 | 160 |
| 174 | 3300025925 | Ga0207650_10349698 | Ga0207650_103496983 | 160 |
| 175 | 3300025932 | Ga0207690_10021343 | Ga0207690_100213438 | 160 |
| 176 | 3300025934 | Ga0207686_10068642 | Ga0207686_100686423 | 160 |
| 177 | 3300025935 | Ga0207709_11411085 | Ga0207709_114110851 | 160 |
| 178 | 3300025941 | Ga0207711_10064907 | Ga0207711_100649074 | 160 |
| 179 | 3300025949 | Ga0207667_10002143 | Ga0207667_1000214315 | 160 |
| 180 | 3300025949 | Ga0207667_10008736 | Ga0207667_100087368 | 160 |
| 181 | 3300025972 | Ga0207668_10124865 | Ga0207668_101248653 | 160 |
| 182 | 3300025981 | Ga0207640_10015686 | Ga0207640_100156864 | 160 |
| 183 | 3300026035 | Ga0207703_10134009 | Ga0207703_101340093 | 160 |
| 184 | 3300026041 | Ga0207639_10141799 | Ga0207639_101417993 | 160 |
| 185 | 3300026041 | Ga0207639_10244031 | Ga0207639_102440311 | 160 |
| 186 | 3300026067 | Ga0207678_10223933 | Ga0207678_102239332 | 160 |
| 187 | 3300026078 | Ga0207702_10005755 | Ga0207702_1000575511 | 160 |
| 188 | 3300026088 | Ga0207641_10005694 | Ga0207641_100056946 | 160 |
| 189 | 3300026116 | Ga0207674_10000134 | Ga0207674_1000013413 | 160 |
| 190 | 3300026118 | Ga0207675_100004588 | Ga0207675_1000045888 | 160 |
| 191 | 3300026118 | Ga0207675_100406003 | Ga0207675_1004060033 | 160 |
| 192 | 3300031456 | Ga0307513_10201771 | Ga0307513_102017713 | 160 |
| 193 | 3300031456 | Ga0307513_10699977 | Ga0307513_106999771 | 160 |
| 194 | 3300031548 | Ga0307408_100448470 | Ga0307408_1004484702 | 160 |
| 195 | 3300032005 | Ga0307411_10360250 | Ga0307411_103602502 | 160 |
| 196 | 3300035083 | Ga0373926_0083976 | Ga0373926_0083976_128_622 | 160 |
| 197 | 3300035691 | Ga0373931_0006882 | Ga0373931_0006882_3516_4004 | 160 |
| 198 | 3300035695 | Ga0373927_0034762 | Ga0373927_0034762_1692_2186 | 160 |
| 199 | 3300036401 | Ga0373937_0006062 | Ga0373937_0006062_4969_5466 | 160 |
| 200 | 3300037068 | Ga0373925_0045596 | Ga0373925_0045596_259_753 | 160 |
| 201 | 3300037068 | Ga0373925_0335765 | Ga0373925_0335765_160_648 | 160 |
| 202 | 3300037068 | Ga0373925_0646457 | Ga0373925_0646457_241_729 | 160 |
| 203 | 3300041997 | Ga0439431_0084438 | Ga0439431_0084438_232_732 | 160 |
| 204 | 3300042876 | Ga0451577_0318117 | Ga0451577_0318117_725_1219 | 160 |
| 205 | 3300046459 | Ga0495629_0056246 | Ga0495629_0056246_494_991 | 160 |
| 206 | 3300046460 | Ga0495638_0008078 | Ga0495638_0008078_3941_4435 | 160 |
| 207 | 3300046460 | Ga0495638_0125300 | Ga0495638_0125300_846_1346 | 160 |
| 208 | 3300046477 | Ga0495664_0310201 | Ga0495664_0310201_409_906 | 160 |
| 209 | 3300046492 | Ga0495585_0281625 | Ga0495585_0281625_264_761 | 160 |
| 210 | 3300046516 | Ga0495628_0148849 | Ga0495628_0148849_1082_1579 | 160 |
| 211 | 3300046543 | Ga0495645_0085218 | Ga0495645_0085218_939_1436 | 160 |
| 212 | 3300046559 | Ga0495667_0116573 | Ga0495667_0116573_170_667 | 160 |
| 213 | 3300046660 | Ga0495625_0064695 | Ga0495625_0064695_1335_1829 | 160 |
| 214 | 3300046663 | Ga0495635_0033451 | Ga0495635_0033451_2562_3059 | 160 |
| 215 | 3300046675 | Ga0495657_0068025 | Ga0495657_0068025_1163_1660 | 160 |
| 216 | 3300046681 | Ga0495647_0318148 | Ga0495647_0318148_31_525 | 160 |
| 217 | 3300046683 | Ga0495658_0129605 | Ga0495658_0129605_859_1356 | 160 |
| 218 | 3300047317 | Ga0495604_0058823 | Ga0495604_0058823_1900_2397 | 160 |
| 219 | 3300047320 | Ga0495672_0149341 | Ga0495672_0149341_567_1055 | 160 |
| 220 | 3300047444 | Ga0495675_0257236 | Ga0495675_0257236_287_775 | 160 |
| 221 | 3300047471 | Ga0495684_0011976 | Ga0495684_0011976_555_1052 | 160 |
| 222 | 3300048088 | Ga0495602_0467633 | Ga0495602_0467633_172_669 | 160 |
| 223 | 3300048911 | Ga0496108_0047944 | Ga0496108_0047944_1644_2129 | 160 |
| 224 | 3300048912 | Ga0496109_0113065 | Ga0496109_0113065_130_615 | 160 |
| 225 | 3300048914 | Ga0496111_0268892 | Ga0496111_0268892_319_807 | 160 |
| 226 | 3300048916 | Ga0496113_0012014 | Ga0496113_0012014_3952_4437 | 160 |
| 227 | 3300048924 | Ga0496121_0084225 | Ga0496121_0084225_709_1203 | 160 |
| 228 | 3300048928 | Ga0496125_0024927 | Ga0496125_0024927_1195_1680 | 160 |
| 229 | 3300048928 | Ga0496125_0216524 | Ga0496125_0216524_101_586 | 160 |
| 230 | 3300049571 | Ga0501034_0181126 | Ga0501034_0181126_1493_1984 | 160 |
| 231 | 3300049581 | Ga0501047_0510192 | Ga0501047_0510192_376_867 | 160 |
| 232 | 3300049589 | Ga0501073_0082245 | Ga0501073_0082245_161_652 | 160 |
| 233 | 3300049592 | Ga0501076_0031032 | Ga0501076_0031032_2133_2624 | 160 |
| 234 | 3300049742 | Ga0501080_0070795 | Ga0501080_0070795_1811_2302 | 160 |
| 235 | 3300049744 | Ga0501083_0032266 | Ga0501083_0032266_3090_3581 | 160 |
| 236 | 3300049824 | Ga0501045_0116947 | Ga0501045_0116947_1309_1800 | 160 |
| 237 | 3300050493 | nmdc:mga0k408_113684_c1 | nmdc:mga0k408_113684_c1_146_646 | 160 |
| 238 | 3300053085 | Ga0495619_0005513 | Ga0495619_0005513_749_1246 | 160 |
| 239 | 3300053139 | Ga0500568_0001210 | Ga0500568_0001210_1436_1924 | 160 |
| 240 | 3300054114 | Ga0501084_0831738 | Ga0501084_0831738_162_653 | 160 |
| 241 | 3300005290 | Ga0065712_10073660 | Ga0065712_100736604 | 161 |
| 242 | 3300005329 | Ga0070683_100182540 | Ga0070683_1001825402 | 161 |
| 243 | 3300005331 | Ga0070670_101469491 | Ga0070670_1014694911 | 161 |
| 244 | 3300005335 | Ga0070666_10028903 | Ga0070666_100289035 | 161 |
| 245 | 3300005338 | Ga0068868_100157861 | Ga0068868_1001578612 | 161 |
| 246 | 3300005338 | Ga0068868_100290290 | Ga0068868_1002902901 | 161 |
| 247 | 3300005340 | Ga0070689_100012897 | Ga0070689_1000128977 | 161 |
| 248 | 3300005343 | Ga0070687_100504210 | Ga0070687_1005042101 | 161 |
| 249 | 3300005347 | Ga0070668_100288542 | Ga0070668_1002885422 | 161 |
| 250 | 3300005354 | Ga0070675_100006757 | Ga0070675_1000067571 | 161 |
| 251 | 3300005355 | Ga0070671_100153698 | Ga0070671_1001536983 | 161 |
| 252 | 3300005355 | Ga0070671_100184508 | Ga0070671_1001845081 | 161 |
| 253 | 3300005364 | Ga0070673_100340416 | Ga0070673_1003404162 | 161 |
| 254 | 3300005364 | Ga0070673_100562856 | Ga0070673_1005628562 | 161 |
| 255 | 3300005365 | Ga0070688_100013718 | Ga0070688_1000137183 | 161 |
| 256 | 3300005365 | Ga0070688_100433004 | Ga0070688_1004330042 | 161 |
| 257 | 3300005367 | Ga0070667_100031347 | Ga0070667_1000313473 | 161 |
| 258 | 3300005367 | Ga0070667_100148699 | Ga0070667_1001486993 | 161 |
| 259 | 3300005455 | Ga0070663_100153281 | Ga0070663_1001532812 | 161 |
| 260 | 3300005459 | Ga0068867_100055314 | Ga0068867_1000553143 | 161 |
| 261 | 3300005466 | Ga0070685_10799127 | Ga0070685_107991271 | 161 |
| 262 | 3300005535 | Ga0070684_100513698 | Ga0070684_1005136982 | 161 |
| 263 | 3300005539 | Ga0068853_100733854 | Ga0068853_1007338542 | 161 |
| 264 | 3300005546 | Ga0070696_100095010 | Ga0070696_1000950102 | 161 |
| 265 | 3300005547 | Ga0070693_100002643 | Ga0070693_1000026437 | 161 |
| 266 | 3300005548 | Ga0070665_100081831 | Ga0070665_1000818313 | 161 |
| 267 | 3300005563 | Ga0068855_100117653 | Ga0068855_1001176533 | 161 |
| 268 | 3300005563 | Ga0068855_100954548 | Ga0068855_1009545482 | 161 |
| 269 | 3300005564 | Ga0070664_100160545 | Ga0070664_1001605452 | 161 |
| 270 | 3300005577 | Ga0068857_100033922 | Ga0068857_1000339225 | 161 |
| 271 | 3300005578 | Ga0068854_100027117 | Ga0068854_1000271174 | 161 |
| 272 | 3300005614 | Ga0068856_100068183 | Ga0068856_1000681832 | 161 |
| 273 | 3300005616 | Ga0068852_100143084 | Ga0068852_1001430842 | 161 |
| 274 | 3300005617 | Ga0068859_100457976 | Ga0068859_1004579762 | 161 |
| 275 | 3300005618 | Ga0068864_100184874 | Ga0068864_1001848743 | 161 |
| 276 | 3300005718 | Ga0068866_10402514 | Ga0068866_104025142 | 161 |
| 277 | 3300005834 | Ga0068851_10172710 | Ga0068851_101727102 | 161 |
| 278 | 3300005841 | Ga0068863_100638734 | Ga0068863_1006387342 | 161 |
| 279 | 3300005842 | Ga0068858_100108013 | Ga0068858_1001080132 | 161 |
| 280 | 3300005842 | Ga0068858_100402966 | Ga0068858_1004029661 | 161 |
| 281 | 3300006028 | Ga0070717_10307105 | Ga0070717_103071052 | 161 |
| 282 | 3300006048 | Ga0075363_100278658 | Ga0075363_1002786581 | 161 |
| 283 | 3300006051 | Ga0075364_10081975 | Ga0075364_100819753 | 161 |
| 284 | 3300006177 | Ga0075362_10229580 | Ga0075362_102295802 | 161 |
| 285 | 3300006178 | Ga0075367_10324976 | Ga0075367_103249761 | 161 |
| 286 | 3300006195 | Ga0075366_10010093 | Ga0075366_100100934 | 161 |
| 287 | 3300006237 | Ga0097621_100029484 | Ga0097621_1000294843 | 161 |
| 288 | 3300006237 | Ga0097621_100769244 | Ga0097621_1007692442 | 161 |
| 289 | 3300006358 | Ga0068871_100106078 | Ga0068871_1001060783 | 161 |
| 290 | 3300006358 | Ga0068871_100136919 | Ga0068871_1001369193 | 161 |
| 291 | 3300006846 | Ga0075430_100034074 | Ga0075430_1000340741 | 161 |
| 292 | 3300006881 | Ga0068865_100031222 | Ga0068865_1000312224 | 161 |
| 293 | 3300006881 | Ga0068865_100450875 | Ga0068865_1004508752 | 161 |
| 294 | 3300006931 | Ga0097620_100457962 | Ga0097620_1004579622 | 161 |
| 295 | 3300007076 | Ga0075435_100890519 | Ga0075435_1008905191 | 161 |
| 296 | 3300009098 | Ga0105245_11174931 | Ga0105245_111749311 | 161 |
| 297 | 3300009098 | Ga0105245_12143627 | Ga0105245_121436271 | 161 |
| 298 | 3300009174 | Ga0105241_10128958 | Ga0105241_101289582 | 161 |
| 299 | 3300009177 | Ga0105248_10044017 | Ga0105248_100440175 | 161 |
| 300 | 3300009551 | Ga0105238_10056363 | Ga0105238_100563634 | 161 |
| 301 | 3300009551 | Ga0105238_10073952 | Ga0105238_100739524 | 161 |
| 302 | 3300009551 | Ga0105238_10182997 | Ga0105238_101829973 | 161 |
| 303 | 3300009553 | Ga0105249_10205327 | Ga0105249_102053272 | 161 |
| 304 | 3300011119 | Ga0105246_10410841 | Ga0105246_104108412 | 161 |
| 305 | 3300013296 | Ga0157374_10327811 | Ga0157374_103278113 | 161 |
| 306 | 3300013296 | Ga0157374_10665818 | Ga0157374_106658181 | 161 |
| 307 | 3300013297 | Ga0157378_10351037 | Ga0157378_103510371 | 161 |
| 308 | 3300013306 | Ga0163162_10130877 | Ga0163162_101308773 | 161 |
| 309 | 3300013306 | Ga0163162_11741408 | Ga0163162_117414082 | 161 |
| 310 | 3300013307 | Ga0157372_11426743 | Ga0157372_114267432 | 161 |
| 311 | 3300014325 | Ga0163163_10704965 | Ga0163163_107049652 | 161 |
| 312 | 3300014326 | Ga0157380_10005575 | Ga0157380_100055759 | 161 |
| 313 | 3300014968 | Ga0157379_10800502 | Ga0157379_108005022 | 161 |
| 314 | 3300014969 | Ga0157376_10351679 | Ga0157376_103516792 | 161 |
| 315 | 3300025261 | Ga0209233_1011598 | Ga0209233_10115984 | 161 |
| 316 | 3300025321 | Ga0207656_10048892 | Ga0207656_100488922 | 161 |
| 317 | 3300025911 | Ga0207654_10000066 | Ga0207654_1000006651 | 161 |
| 318 | 3300025924 | Ga0207694_10085965 | Ga0207694_100859653 | 161 |
| 319 | 3300025924 | Ga0207694_10179922 | Ga0207694_101799222 | 161 |
| 320 | 3300025924 | Ga0207694_10190707 | Ga0207694_101907072 | 161 |
| 321 | 3300025924 | Ga0207694_10621120 | Ga0207694_106211202 | 161 |
| 322 | 3300025925 | Ga0207650_10107709 | Ga0207650_101077093 | 161 |
| 323 | 3300025927 | Ga0207687_10068943 | Ga0207687_100689432 | 161 |
| 324 | 3300025934 | Ga0207686_10009412 | Ga0207686_100094126 | 161 |
| 325 | 3300025936 | Ga0207670_10272851 | Ga0207670_102728512 | 161 |
| 326 | 3300025938 | Ga0207704_10190400 | Ga0207704_101904002 | 161 |
| 327 | 3300025941 | Ga0207711_10354843 | Ga0207711_103548432 | 161 |
| 328 | 3300025942 | Ga0207689_10068293 | Ga0207689_100682933 | 161 |
| 329 | 3300025945 | Ga0207679_10029011 | Ga0207679_100290114 | 161 |
| 330 | 3300025949 | Ga0207667_10195614 | Ga0207667_101956143 | 161 |
| 331 | 3300025949 | Ga0207667_10617780 | Ga0207667_106177802 | 161 |
| 332 | 3300025960 | Ga0207651_10119037 | Ga0207651_101190373 | 161 |
| 333 | 3300025960 | Ga0207651_10439986 | Ga0207651_104399862 | 161 |
| 334 | 3300025961 | Ga0207712_10247187 | Ga0207712_102471873 | 161 |
| 335 | 3300025972 | Ga0207668_10266626 | Ga0207668_102666262 | 161 |
| 336 | 3300025981 | Ga0207640_10074513 | Ga0207640_100745133 | 161 |
| 337 | 3300025986 | Ga0207658_10183357 | Ga0207658_101833572 | 161 |
| 338 | 3300025986 | Ga0207658_10355862 | Ga0207658_103558621 | 161 |
| 339 | 3300026041 | Ga0207639_10477191 | Ga0207639_104771912 | 161 |
| 340 | 3300026078 | Ga0207702_11043160 | Ga0207702_110431601 | 161 |
| 341 | 3300026088 | Ga0207641_10383426 | Ga0207641_103834262 | 161 |
| 342 | 3300026089 | Ga0207648_10149152 | Ga0207648_101491522 | 161 |
| 343 | 3300026095 | Ga0207676_10640214 | Ga0207676_106402142 | 161 |
| 344 | 3300026116 | Ga0207674_10076088 | Ga0207674_100760883 | 161 |
| 345 | 3300026116 | Ga0207674_10106286 | Ga0207674_101062863 | 161 |
| 346 | 3300026116 | Ga0207674_10810171 | Ga0207674_108101712 | 161 |
| 347 | 3300026142 | Ga0207698_11022169 | Ga0207698_110221692 | 161 |
| 348 | 3300028379 | Ga0268266_10092294 | Ga0268266_100922944 | 161 |
| 349 | 3300031251 | Ga0265327_10104843 | Ga0265327_101048431 | 161 |
| 350 | 3300031824 | Ga0307413_10088260 | Ga0307413_100882603 | 161 |
| 351 | 3300031824 | Ga0307413_10726263 | Ga0307413_107262632 | 161 |
| 352 | 3300035120 | Ga0373957_0248328 | Ga0373957_0248328_126_623 | 161 |
| 353 | 3300035172 | Ga0373955_0104792 | Ga0373955_0104792_209_706 | 161 |
| 354 | 3300035692 | Ga0373935_0376423 | Ga0373935_0376423_72_569 | 161 |
| 355 | 3300041451 | Ga0451791_0401505 | Ga0451791_0401505_1610_2095 | 161 |
| 356 | 3300041451 | Ga0451791_1329675 | Ga0451791_1329675_109_594 | 161 |
| 357 | 3300041460 | Ga0451802_1042238 | Ga0451802_1042238_659_1144 | 161 |
| 358 | 3300041463 | Ga0451804_0307298 | Ga0451804_0307298_199_684 | 161 |
| 359 | 3300041486 | Ga0451807_0155889 | Ga0451807_0155889_677_1162 | 161 |
| 360 | 3300041494 | Ga0451837_0107029 | Ga0451837_0107029_1127_1612 | 161 |
| 361 | 3300041494 | Ga0451837_0381109 | Ga0451837_0381109_708_1193 | 161 |
| 362 | 3300042876 | Ga0451577_0375764 | Ga0451577_0375764_668_1165 | 161 |
| 363 | 3300046454 | Ga0495592_0120393 | Ga0495592_0120393_872_1369 | 161 |
| 364 | 3300046462 | Ga0495651_0104976 | Ga0495651_0104976_17_514 | 161 |
| 365 | 3300046511 | Ga0495608_0189403 | Ga0495608_0189403_333_830 | 161 |
| 366 | 3300046516 | Ga0495628_0120775 | Ga0495628_0120775_213_710 | 161 |
| 367 | 3300046529 | Ga0495652_0174652 | Ga0495652_0174652_252_749 | 161 |
| 368 | 3300046536 | Ga0495587_0080671 | Ga0495587_0080671_826_1323 | 161 |
| 369 | 3300046543 | Ga0495645_0136859 | Ga0495645_0136859_739_1236 | 161 |
| 370 | 3300046559 | Ga0495667_0147015 | Ga0495667_0147015_848_1345 | 161 |
| 371 | 3300046675 | Ga0495657_0028273 | Ga0495657_0028273_3168_3665 | 161 |
| 372 | 3300046679 | Ga0495623_0119945 | Ga0495623_0119945_872_1369 | 161 |
| 373 | 3300046689 | Ga0495613_0624211 | Ga0495613_0624211_59_556 | 161 |
| 374 | 3300047317 | Ga0495604_0124017 | Ga0495604_0124017_500_997 | 161 |
| 375 | 3300047471 | Ga0495684_0346330 | Ga0495684_0346330_298_795 | 161 |
| 376 | 3300048088 | Ga0495602_0373648 | Ga0495602_0373648_247_744 | 161 |
| 377 | 3300048905 | Ga0496102_0734201 | Ga0496102_0734201_243_743 | 161 |
| 378 | 3300048912 | Ga0496109_0440352 | Ga0496109_0440352_693_1181 | 161 |
| 379 | 3300048917 | Ga0496114_1335055 | Ga0496114_1335055_86_580 | 161 |
| 380 | 3300048924 | Ga0496121_0141953 | Ga0496121_0141953_332_832 | 161 |
| 381 | 3300048928 | Ga0496125_0412248 | Ga0496125_0412248_53_541 | 161 |
| 382 | 3300049568 | Ga0501031_0039301 | Ga0501031_0039301_2547_3041 | 161 |
| 383 | 3300049569 | Ga0501032_0032581 | Ga0501032_0032581_2374_2865 | 161 |
| 384 | 3300049569 | Ga0501032_0200553 | Ga0501032_0200553_563_1051 | 161 |
| 385 | 3300049570 | Ga0501033_0074403 | Ga0501033_0074403_893_1381 | 161 |
| 386 | 3300049571 | Ga0501034_0001724 | Ga0501034_0001724_23312_23800 | 161 |
| 387 | 3300049571 | Ga0501034_0126272 | Ga0501034_0126272_355_843 | 161 |
| 388 | 3300049571 | Ga0501034_0146951 | Ga0501034_0146951_1595_2086 | 161 |
| 389 | 3300049572 | Ga0501036_0551496 | Ga0501036_0551496_169_663 | 161 |
| 390 | 3300049572 | Ga0501036_0653395 | Ga0501036_0653395_333_821 | 161 |
| 391 | 3300049572 | Ga0501036_1127952 | Ga0501036_1127952_80_571 | 161 |
| 392 | 3300049573 | Ga0501037_0150259 | Ga0501037_0150259_28_522 | 161 |
| 393 | 3300049573 | Ga0501037_0238428 | Ga0501037_0238428_29_520 | 161 |
| 394 | 3300049574 | Ga0501038_0019453 | Ga0501038_0019453_3085_3579 | 161 |
| 395 | 3300049574 | Ga0501038_0359075 | Ga0501038_0359075_107_595 | 161 |
| 396 | 3300049575 | Ga0501039_0030698 | Ga0501039_0030698_3262_3756 | 161 |
| 397 | 3300049575 | Ga0501039_0221944 | Ga0501039_0221944_664_1152 | 161 |
| 398 | 3300049577 | Ga0501041_0007930 | Ga0501041_0007930_5133_5627 | 161 |
| 399 | 3300049578 | Ga0501042_0305891 | Ga0501042_0305891_256_750 | 161 |
| 400 | 3300049579 | Ga0501043_0003654 | Ga0501043_0003654_5911_6399 | 161 |
| 401 | 3300049579 | Ga0501043_0132366 | Ga0501043_0132366_1015_1509 | 161 |
| 402 | 3300049579 | Ga0501043_0164621 | Ga0501043_0164621_617_1111 | 161 |
| 403 | 3300049580 | Ga0501046_0015448 | Ga0501046_0015448_1229_1723 | 161 |
| 404 | 3300049580 | Ga0501046_0054043 | Ga0501046_0054043_13_501 | 161 |
| 405 | 3300049580 | Ga0501046_0162254 | Ga0501046_0162254_787_1281 | 161 |
| 406 | 3300049581 | Ga0501047_0001196 | Ga0501047_0001196_9529_10023 | 161 |
| 407 | 3300049581 | Ga0501047_0001416 | Ga0501047_0001416_9416_9904 | 161 |
| 408 | 3300049581 | Ga0501047_1070930 | Ga0501047_1070930_74_562 | 161 |
| 409 | 3300049582 | Ga0501048_0081172 | Ga0501048_0081172_716_1204 | 161 |
| 410 | 3300049582 | Ga0501048_0413846 | Ga0501048_0413846_110_604 | 161 |
| 411 | 3300049582 | Ga0501048_0502865 | Ga0501048_0502865_169_663 | 161 |
| 412 | 3300049584 | Ga0501068_0077570 | Ga0501068_0077570_34_528 | 161 |
| 413 | 3300049584 | Ga0501068_0266891 | Ga0501068_0266891_580_1068 | 161 |
| 414 | 3300049585 | Ga0501069_0017848 | Ga0501069_0017848_1250_1744 | 161 |
| 415 | 3300049586 | Ga0501070_0001751 | Ga0501070_0001751_10852_11340 | 161 |
| 416 | 3300049586 | Ga0501070_0002827 | Ga0501070_0002827_168_656 | 161 |
| 417 | 3300049586 | Ga0501070_0050328 | Ga0501070_0050328_2538_3032 | 161 |
| 418 | 3300049586 | Ga0501070_0090232 | Ga0501070_0090232_1868_2356 | 161 |
| 419 | 3300049587 | Ga0501071_0349800 | Ga0501071_0349800_617_1111 | 161 |
| 420 | 3300049588 | Ga0501072_0256236 | Ga0501072_0256236_168_656 | 161 |
| 421 | 3300049588 | Ga0501072_0315842 | Ga0501072_0315842_263_757 | 161 |
| 422 | 3300049589 | Ga0501073_0039910 | Ga0501073_0039910_538_1026 | 161 |
| 423 | 3300049589 | Ga0501073_0295662 | Ga0501073_0295662_74_568 | 161 |
| 424 | 3300049590 | Ga0501074_0003781 | Ga0501074_0003781_5665_6159 | 161 |
| 425 | 3300049590 | Ga0501074_0005065 | Ga0501074_0005065_3475_3963 | 161 |
| 426 | 3300049590 | Ga0501074_0211829 | Ga0501074_0211829_848_1342 | 161 |
| 427 | 3300049591 | Ga0501075_0118012 | Ga0501075_0118012_1085_1579 | 161 |
| 428 | 3300049592 | Ga0501076_0036539 | Ga0501076_0036539_2902_3396 | 161 |
| 429 | 3300049593 | Ga0501077_0470240 | Ga0501077_0470240_25_519 | 161 |
| 430 | 3300049741 | Ga0501079_0008655 | Ga0501079_0008655_7098_7592 | 161 |
| 431 | 3300049741 | Ga0501079_0012401 | Ga0501079_0012401_53_541 | 161 |
| 432 | 3300049741 | Ga0501079_0113180 | Ga0501079_0113180_297_785 | 161 |
| 433 | 3300049741 | Ga0501079_0896104 | Ga0501079_0896104_187_681 | 161 |
| 434 | 3300049742 | Ga0501080_0009065 | Ga0501080_0009065_4468_4956 | 161 |
| 435 | 3300049742 | Ga0501080_0021486 | Ga0501080_0021486_913_1407 | 161 |
| 436 | 3300049742 | Ga0501080_0072753 | Ga0501080_0072753_532_1026 | 161 |
| 437 | 3300049742 | Ga0501080_0125100 | Ga0501080_0125100_28_516 | 161 |
| 438 | 3300049742 | Ga0501080_0236388 | Ga0501080_0236388_562_1050 | 161 |
| 439 | 3300049743 | Ga0501081_0110592 | Ga0501081_0110592_454_948 | 161 |
| 440 | 3300049744 | Ga0501083_0723980 | Ga0501083_0723980_49_537 | 161 |
| 441 | 3300049822 | Ga0501035_0112283 | Ga0501035_0112283_1342_1836 | 161 |
| 442 | 3300049822 | Ga0501035_0131129 | Ga0501035_0131129_1437_1925 | 161 |
| 443 | 3300049822 | Ga0501035_1054738 | Ga0501035_1054738_86_574 | 161 |
| 444 | 3300049823 | Ga0501044_0115863 | Ga0501044_0115863_1673_2161 | 161 |
| 445 | 3300049823 | Ga0501044_0962933 | Ga0501044_0962933_142_630 | 161 |
| 446 | 3300049824 | Ga0501045_0143901 | Ga0501045_0143901_565_1059 | 161 |
| 447 | 3300050491 | nmdc:mga00v17_143788_c1 | nmdc:mga00v17_143788_c1_25_528 | 161 |
| 448 | 3300050493 | nmdc:mga0k408_66584_c1 | nmdc:mga0k408_66584_c1_628_1131 | 161 |
| 449 | 3300050509 | nmdc:mga0qj67_18581_c1 | nmdc:mga0qj67_18581_c1_126_623 | 161 |
| 450 | 3300053084 | Ga0495595_0070125 | Ga0495595_0070125_32_529 | 161 |
| 451 | 3300053736 | Ga0500599_005582 | Ga0500599_005582_858_1379 | 161 |
| 452 | 3300054114 | Ga0501084_0007827 | Ga0501084_0007827_2384_2878 | 161 |
| 453 | 3300060353 | Ga0501082_0018624 | Ga0501082_0018624_269_763 | 161 |
| 454 | 3300060353 | Ga0501082_0044536 | Ga0501082_0044536_3021_3515 | 161 |
| 455 | 3300061734 | Ga0530510_0187427 | Ga0530510_0187427_169_663 | 161 |
| 456 | 3300001904 | JGI24736J21556_1008608 | JGI24736J21556_10086082 | 162 |
| 457 | 3300001989 | JGI24739J22299_10001810 | JGI24739J22299_100018109 | 162 |
| 458 | 3300001990 | JGI24737J22298_10001918 | JGI24737J22298_100019186 | 162 |
| 459 | 3300001990 | JGI24737J22298_10179732 | JGI24737J22298_101797321 | 162 |
| 460 | 3300002067 | JGI24735J21928_10002849 | JGI24735J21928_100028493 | 162 |
| 461 | 3300002067 | JGI24735J21928_10007156 | JGI24735J21928_100071564 | 162 |
| 462 | 3300002067 | JGI24735J21928_10045229 | JGI24735J21928_100452293 | 162 |
| 463 | 3300002075 | JGI24738J21930_10045317 | JGI24738J21930_100453172 | 162 |
| 464 | 3300002705 | JGI25156J39149_1001007 | JGI25156J39149_10010075 | 162 |
| 465 | 3300002705 | JGI25156J39149_1006545 | JGI25156J39149_10065454 | 162 |
| 466 | 3300002737 | JGI25162J39368_1000538 | JGI25162J39368_100053826 | 162 |
| 467 | 3300002737 | JGI25162J39368_1001470 | JGI25162J39368_100147010 | 162 |
| 468 | 3300002738 | JGI25154J39366_1006550 | JGI25154J39366_10065503 | 162 |
| 469 | 3300002741 | JGI25157J39369_1000731 | JGI25157J39369_10007312 | 162 |
| 470 | 3300002741 | JGI25157J39369_1001489 | JGI25157J39369_10014892 | 162 |
| 471 | 3300002772 | JGI25164J39214_1000064 | JGI25164J39214_100006433 | 162 |
| 472 | 3300003214 | JGI25165J46597_1000278 | JGI25165J46597_100027832 | 162 |
| 473 | 3300003316 | rootH1_10022311 | rootH1_100223115 | 162 |
| 474 | 3300003320 | rootH2_10000507 | rootH2_1000050723 | 162 |
| 475 | 3300003320 | rootH2_10053565 | rootH2_100535652 | 162 |
| 476 | 3300003323 | rootH1_10139123 | rootH1_101391234 | 162 |
| 477 | 3300003578 | Ga0006562J51391_1027929 | Ga0006562J51391_10279291 | 162 |
| 478 | 3300003578 | Ga0006562J51391_1027930 | Ga0006562J51391_10279304 | 162 |
| 479 | 3300003578 | Ga0006562J51391_1033987 | Ga0006562J51391_10339874 | 162 |
| 480 | 3300003578 | Ga0006562J51391_1033988 | Ga0006562J51391_10339884 | 162 |
| 481 | 3300003752 | Ga0055539_1001315 | Ga0055539_10013153 | 162 |
| 482 | 3300003756 | Ga0055533_1000716 | Ga0055533_10007165 | 162 |
| 483 | 3300003756 | Ga0055533_1001494 | Ga0055533_10014944 | 162 |
| 484 | 3300003759 | Ga0055525_1000043 | Ga0055525_100004385 | 162 |
| 485 | 3300003760 | Ga0055527_1000028 | Ga0055527_1000028149 | 162 |
| 486 | 3300003760 | Ga0055527_1000068 | Ga0055527_100006816 | 162 |
| 487 | 3300003760 | Ga0055527_1002157 | Ga0055527_10021573 | 162 |
| 488 | 3300003761 | Ga0055535_1000081 | Ga0055535_100008116 | 162 |
| 489 | 3300003761 | Ga0055535_1000090 | Ga0055535_100009016 | 162 |
| 490 | 3300003761 | Ga0055535_1000351 | Ga0055535_100035113 | 162 |
| 491 | 3300003761 | Ga0055535_1000368 | Ga0055535_100036836 | 162 |
| 492 | 3300003761 | Ga0055535_1008265 | Ga0055535_10082653 | 162 |
| 493 | 3300003762 | Ga0055542_1000053 | Ga0055542_1000053149 | 162 |
| 494 | 3300003762 | Ga0055542_1000093 | Ga0055542_100009316 | 162 |
| 495 | 3300003762 | Ga0055542_1000113 | Ga0055542_100011379 | 162 |
| 496 | 3300003762 | Ga0055542_1000417 | Ga0055542_10004174 | 162 |
| 497 | 3300003762 | Ga0055542_1000450 | Ga0055542_100045015 | 162 |
| 498 | 3300003763 | Ga0055529_1000104 | Ga0055529_1000104101 | 162 |
| 499 | 3300003763 | Ga0055529_1000281 | Ga0055529_100028116 | 162 |
| 500 | 3300003763 | Ga0055529_1000312 | Ga0055529_100031222 | 162 |
| 501 | 3300003771 | Ga0055526_1017184 | Ga0055526_10171842 | 162 |
| 502 | 3300003775 | Ga0055524_1000715 | Ga0055524_10007159 | 162 |
| 503 | 3300003784 | Ga0055534_1001790 | Ga0055534_10017909 | 162 |
| 504 | 3300005327 | Ga0070658_10004443 | Ga0070658_100044439 | 162 |
| 505 | 3300005327 | Ga0070658_10573874 | Ga0070658_105738742 | 162 |
| 506 | 3300005335 | Ga0070666_10000001 | Ga0070666_1000000110 | 162 |
| 507 | 3300005337 | Ga0070682_100015838 | Ga0070682_1000158383 | 162 |
| 508 | 3300005339 | Ga0070660_100017448 | Ga0070660_1000174483 | 162 |
| 509 | 3300005339 | Ga0070660_100036930 | Ga0070660_1000369303 | 162 |
| 510 | 3300005339 | Ga0070660_100924514 | Ga0070660_1009245141 | 162 |
| 511 | 3300005340 | Ga0070689_100007728 | Ga0070689_1000077285 | 162 |
| 512 | 3300005344 | Ga0070661_100079076 | Ga0070661_1000790761 | 162 |
| 513 | 3300005344 | Ga0070661_100103377 | Ga0070661_1001033773 | 162 |
| 514 | 3300005344 | Ga0070661_101081743 | Ga0070661_1010817431 | 162 |
| 515 | 3300005344 | Ga0070661_101243723 | Ga0070661_1012437231 | 162 |
| 516 | 3300005345 | Ga0070692_10108345 | Ga0070692_101083451 | 162 |
| 517 | 3300005347 | Ga0070668_100160832 | Ga0070668_1001608322 | 162 |
| 518 | 3300005347 | Ga0070668_101662633 | Ga0070668_1016626331 | 162 |
| 519 | 3300005366 | Ga0070659_100005242 | Ga0070659_1000052425 | 162 |
| 520 | 3300005366 | Ga0070659_100029016 | Ga0070659_1000290164 | 162 |
| 521 | 3300005367 | Ga0070667_100021861 | Ga0070667_1000218611 | 162 |
| 522 | 3300005367 | Ga0070667_100382788 | Ga0070667_1003827882 | 162 |
| 523 | 3300005444 | Ga0070694_100183911 | Ga0070694_1001839113 | 162 |
| 524 | 3300005455 | Ga0070663_100021903 | Ga0070663_1000219031 | 162 |
| 525 | 3300005455 | Ga0070663_100068878 | Ga0070663_1000688782 | 162 |
| 526 | 3300005455 | Ga0070663_100193484 | Ga0070663_1001934843 | 162 |
| 527 | 3300005455 | Ga0070663_100227861 | Ga0070663_1002278612 | 162 |
| 528 | 3300005457 | Ga0070662_100152837 | Ga0070662_1001528372 | 162 |
| 529 | 3300005458 | Ga0070681_10000073 | Ga0070681_1000007375 | 162 |
| 530 | 3300005458 | Ga0070681_10012053 | Ga0070681_100120533 | 162 |
| 531 | 3300005458 | Ga0070681_10055196 | Ga0070681_100551964 | 162 |
| 532 | 3300005530 | Ga0070679_100224206 | Ga0070679_1002242062 | 162 |
| 533 | 3300005539 | Ga0068853_100006034 | Ga0068853_1000060343 | 162 |
| 534 | 3300005539 | Ga0068853_100201062 | Ga0068853_1002010622 | 162 |
| 535 | 3300005539 | Ga0068853_100558899 | Ga0068853_1005588992 | 162 |
| 536 | 3300005546 | Ga0070696_100379146 | Ga0070696_1003791461 | 162 |
| 537 | 3300005547 | Ga0070693_100030504 | Ga0070693_1000305041 | 162 |
| 538 | 3300005548 | Ga0070665_100077205 | Ga0070665_1000772052 | 162 |
| 539 | 3300005548 | Ga0070665_100141214 | Ga0070665_1001412143 | 162 |
| 540 | 3300005563 | Ga0068855_100007063 | Ga0068855_10000706313 | 162 |
| 541 | 3300005563 | Ga0068855_100041946 | Ga0068855_1000419465 | 162 |
| 542 | 3300005563 | Ga0068855_100089822 | Ga0068855_1000898222 | 162 |
| 543 | 3300005563 | Ga0068855_100184728 | Ga0068855_1001847283 | 162 |
| 544 | 3300005563 | Ga0068855_100201748 | Ga0068855_1002017481 | 162 |
| 545 | 3300005563 | Ga0068855_100982820 | Ga0068855_1009828202 | 162 |
| 546 | 3300005577 | Ga0068857_100025014 | Ga0068857_1000250146 | 162 |
| 547 | 3300005577 | Ga0068857_100107679 | Ga0068857_1001076793 | 162 |
| 548 | 3300005577 | Ga0068857_100158849 | Ga0068857_1001588492 | 162 |
| 549 | 3300005578 | Ga0068854_100000943 | Ga0068854_10000094313 | 162 |
| 550 | 3300005578 | Ga0068854_100015417 | Ga0068854_1000154173 | 162 |
| 551 | 3300005578 | Ga0068854_100097432 | Ga0068854_1000974322 | 162 |
| 552 | 3300005614 | Ga0068856_100000207 | Ga0068856_10000020748 | 162 |
| 553 | 3300005614 | Ga0068856_100002737 | Ga0068856_1000027378 | 162 |
| 554 | 3300005614 | Ga0068856_100721415 | Ga0068856_1007214152 | 162 |
| 555 | 3300005616 | Ga0068852_100015672 | Ga0068852_1000156724 | 162 |
| 556 | 3300005842 | Ga0068858_100057882 | Ga0068858_1000578824 | 162 |
| 557 | 3300005842 | Ga0068858_100141583 | Ga0068858_1001415833 | 162 |
| 558 | 3300005843 | Ga0068860_100017690 | Ga0068860_1000176903 | 162 |
| 559 | 3300005843 | Ga0068860_100652674 | Ga0068860_1006526742 | 162 |
| 560 | 3300006186 | Ga0075369_10012978 | Ga0075369_100129783 | 162 |
| 561 | 3300009011 | Ga0105251_10000166 | Ga0105251_1000016658 | 162 |
| 562 | 3300009093 | Ga0105240_10007148 | Ga0105240_100071486 | 162 |
| 563 | 3300009093 | Ga0105240_10007501 | Ga0105240_100075017 | 162 |
| 564 | 3300009093 | Ga0105240_10013903 | Ga0105240_1001390311 | 162 |
| 565 | 3300009093 | Ga0105240_10018515 | Ga0105240_100185152 | 162 |
| 566 | 3300009101 | Ga0105247_10012698 | Ga0105247_100126985 | 162 |
| 567 | 3300009174 | Ga0105241_11177058 | Ga0105241_111770581 | 162 |
| 568 | 3300009545 | Ga0105237_10000022 | Ga0105237_1000002230 | 162 |
| 569 | 3300009545 | Ga0105237_11249219 | Ga0105237_112492191 | 162 |
| 570 | 3300009551 | Ga0105238_10061673 | Ga0105238_100616734 | 162 |
| 571 | 3300009551 | Ga0105238_10067278 | Ga0105238_100672782 | 162 |
| 572 | 3300009551 | Ga0105238_10080064 | Ga0105238_100800644 | 162 |
| 573 | 3300009551 | Ga0105238_10806858 | Ga0105238_108068582 | 162 |
| 574 | 3300009551 | Ga0105238_11226149 | Ga0105238_112261492 | 162 |
| 575 | 3300009982 | Ga0105147_101012 | Ga0105147_1010122 | 162 |
| 576 | 3300010375 | Ga0105239_10000480 | Ga0105239_1000048037 | 162 |
| 577 | 3300010375 | Ga0105239_10044538 | Ga0105239_100445382 | 162 |
| 578 | 3300010375 | Ga0105239_10902952 | Ga0105239_109029522 | 162 |
| 579 | 3300012500 | Ga0157314_1000016 | Ga0157314_100001611 | 162 |
| 580 | 3300012502 | Ga0157347_1001364 | Ga0157347_10013642 | 162 |
| 581 | 3300013100 | Ga0157373_10025784 | Ga0157373_100257844 | 162 |
| 582 | 3300013100 | Ga0157373_10451038 | Ga0157373_104510381 | 162 |
| 583 | 3300013100 | Ga0157373_10724601 | Ga0157373_107246011 | 162 |
| 584 | 3300013102 | Ga0157371_10021378 | Ga0157371_100213784 | 162 |
| 585 | 3300013102 | Ga0157371_10131813 | Ga0157371_101318133 | 162 |
| 586 | 3300013104 | Ga0157370_10002571 | Ga0157370_1000257114 | 162 |
| 587 | 3300013104 | Ga0157370_10003277 | Ga0157370_100032774 | 162 |
| 588 | 3300013104 | Ga0157370_10040527 | Ga0157370_100405271 | 162 |
| 589 | 3300013104 | Ga0157370_10247442 | Ga0157370_102474422 | 162 |
| 590 | 3300013104 | Ga0157370_11651885 | Ga0157370_116518851 | 162 |
| 591 | 3300013105 | Ga0157369_10062027 | Ga0157369_100620274 | 162 |
| 592 | 3300013105 | Ga0157369_10063520 | Ga0157369_100635204 | 162 |
| 593 | 3300013105 | Ga0157369_10281078 | Ga0157369_102810781 | 162 |
| 594 | 3300013296 | Ga0157374_11080610 | Ga0157374_110806102 | 162 |
| 595 | 3300013306 | Ga0163162_10000810 | Ga0163162_100008103 | 162 |
| 596 | 3300013307 | Ga0157372_10047613 | Ga0157372_100476134 | 162 |
| 597 | 3300013307 | Ga0157372_10379465 | Ga0157372_103794652 | 162 |
| 598 | 3300014497 | Ga0182008_10039688 | Ga0182008_100396884 | 162 |
| 599 | 3300014497 | Ga0182008_10084244 | Ga0182008_100842441 | 162 |
| 600 | 3300014969 | Ga0157376_10065585 | Ga0157376_100655854 | 162 |
| 601 | 3300015261 | Ga0182006_1000058 | Ga0182006_10000589 | 162 |
| 602 | 3300015262 | Ga0182007_10000640 | Ga0182007_1000064013 | 162 |
| 603 | 3300015262 | Ga0182007_10017026 | Ga0182007_100170262 | 162 |
| 604 | 3300015262 | Ga0182007_10145714 | Ga0182007_101457142 | 162 |
| 605 | 3300015265 | Ga0182005_1002232 | Ga0182005_10022325 | 162 |
| 606 | 3300015687 | Ga0183368_1002 | Ga0183368_10021048 | 162 |
| 607 | 3300017792 | Ga0163161_10004052 | Ga0163161_100040522 | 162 |
| 608 | 3300017792 | Ga0163161_10025432 | Ga0163161_100254324 | 162 |
| 609 | 3300020070 | Ga0206356_11117712 | Ga0206356_111177121 | 162 |
| 610 | 3300020082 | Ga0206353_10911170 | Ga0206353_109111702 | 162 |
| 611 | 3300025206 | Ga0209435_113671 | Ga0209435_1136711 | 162 |
| 612 | 3300025225 | Ga0209566_104006 | Ga0209566_1040062 | 162 |
| 613 | 3300025226 | Ga0209674_100014 | Ga0209674_100014412 | 162 |
| 614 | 3300025226 | Ga0209674_100059 | Ga0209674_100059144 | 162 |
| 615 | 3300025228 | Ga0209672_100004 | Ga0209672_100004682 | 162 |
| 616 | 3300025228 | Ga0209672_100008 | Ga0209672_100008586 | 162 |
| 617 | 3300025228 | Ga0209672_100019 | Ga0209672_100019284 | 162 |
| 618 | 3300025228 | Ga0209672_100148 | Ga0209672_10014840 | 162 |
| 619 | 3300025228 | Ga0209672_100250 | Ga0209672_1002504 | 162 |
| 620 | 3300025228 | Ga0209672_101111 | Ga0209672_1011117 | 162 |
| 621 | 3300025229 | Ga0209147_100026 | Ga0209147_100026284 | 162 |
| 622 | 3300025230 | Ga0209563_100036 | Ga0209563_100036213 | 162 |
| 623 | 3300025231 | Ga0207427_100037 | Ga0207427_100037231 | 162 |
| 624 | 3300025233 | Ga0209437_100213 | Ga0209437_10021332 | 162 |
| 625 | 3300025233 | Ga0209437_100257 | Ga0209437_10025731 | 162 |
| 626 | 3300025233 | Ga0209437_106796 | Ga0209437_1067962 | 162 |
| 627 | 3300025242 | Ga0209258_100003 | Ga0209258_100003682 | 162 |
| 628 | 3300025242 | Ga0209258_100004 | Ga0209258_100004604 | 162 |
| 629 | 3300025242 | Ga0209258_100008 | Ga0209258_100008229 | 162 |
| 630 | 3300025242 | Ga0209258_100057 | Ga0209258_10005785 | 162 |
| 631 | 3300025242 | Ga0209258_100106 | Ga0209258_100106114 | 162 |
| 632 | 3300025242 | Ga0209258_100253 | Ga0209258_10025350 | 162 |
| 633 | 3300025242 | Ga0209258_101587 | Ga0209258_1015874 | 162 |
| 634 | 3300025242 | Ga0209258_102649 | Ga0209258_1026494 | 162 |
| 635 | 3300025246 | Ga0209646_1000836 | Ga0209646_10008369 | 162 |
| 636 | 3300025246 | Ga0209646_1000920 | Ga0209646_10009209 | 162 |
| 637 | 3300025250 | Ga0209026_1000045 | Ga0209026_1000045225 | 162 |
| 638 | 3300025250 | Ga0209026_1000203 | Ga0209026_100020369 | 162 |
| 639 | 3300025250 | Ga0209026_1000368 | Ga0209026_100036814 | 162 |
| 640 | 3300025250 | Ga0209026_1001886 | Ga0209026_10018869 | 162 |
| 641 | 3300025250 | Ga0209026_1005722 | Ga0209026_10057222 | 162 |
| 642 | 3300025253 | Ga0209677_105222 | Ga0209677_1052222 | 162 |
| 643 | 3300025254 | Ga0209148_1000002 | Ga0209148_1000002594 | 162 |
| 644 | 3300025254 | Ga0209148_1000016 | Ga0209148_1000016682 | 162 |
| 645 | 3300025254 | Ga0209148_1000042 | Ga0209148_1000042240 | 162 |
| 646 | 3300025254 | Ga0209148_1000068 | Ga0209148_100006885 | 162 |
| 647 | 3300025254 | Ga0209148_1000200 | Ga0209148_100020079 | 162 |
| 648 | 3300025254 | Ga0209148_1001546 | Ga0209148_10015469 | 162 |
| 649 | 3300025256 | Ga0209759_1000117 | Ga0209759_100011711 | 162 |
| 650 | 3300025256 | Ga0209759_1000185 | Ga0209759_100018517 | 162 |
| 651 | 3300025256 | Ga0209759_1002855 | Ga0209759_10028554 | 162 |
| 652 | 3300025256 | Ga0209759_1003448 | Ga0209759_10034482 | 162 |
| 653 | 3300025258 | Ga0209129_1002704 | Ga0209129_10027042 | 162 |
| 654 | 3300025258 | Ga0209129_1012943 | Ga0209129_10129433 | 162 |
| 655 | 3300025261 | Ga0209233_1000096 | Ga0209233_1000096232 | 162 |
| 656 | 3300025261 | Ga0209233_1019797 | Ga0209233_10197972 | 162 |
| 657 | 3300025261 | Ga0209233_1058431 | Ga0209233_10584312 | 162 |
| 658 | 3300025263 | Ga0209565_1000094 | Ga0209565_100009440 | 162 |
| 659 | 3300025272 | Ga0209455_1000004 | Ga0209455_1000004682 | 162 |
| 660 | 3300025272 | Ga0209455_1000007 | Ga0209455_1000007349 | 162 |
| 661 | 3300025272 | Ga0209455_1000016 | Ga0209455_1000016495 | 162 |
| 662 | 3300025272 | Ga0209455_1000103 | Ga0209455_1000103173 | 162 |
| 663 | 3300025272 | Ga0209455_1000142 | Ga0209455_1000142115 | 162 |
| 664 | 3300025272 | Ga0209455_1003324 | Ga0209455_10033247 | 162 |
| 665 | 3300025272 | Ga0209455_1005694 | Ga0209455_10056945 | 162 |
| 666 | 3300025272 | Ga0209455_1007165 | Ga0209455_10071653 | 162 |
| 667 | 3300025273 | Ga0209673_1058028 | Ga0209673_10580282 | 162 |
| 668 | 3300025291 | Ga0209675_1002994 | Ga0209675_10029948 | 162 |
| 669 | 3300025294 | Ga0209025_1002073 | Ga0209025_100207311 | 162 |
| 670 | 3300025295 | Ga0209564_1000942 | Ga0209564_100094229 | 162 |
| 671 | 3300025297 | Ga0209758_1000491 | Ga0209758_100049126 | 162 |
| 672 | 3300025297 | Ga0209758_1024734 | Ga0209758_10247343 | 162 |
| 673 | 3300025297 | Ga0209758_1025701 | Ga0209758_10257013 | 162 |
| 674 | 3300025299 | Ga0209256_1001544 | Ga0209256_10015449 | 162 |
| 675 | 3300025299 | Ga0209256_1012538 | Ga0209256_10125383 | 162 |
| 676 | 3300025303 | Ga0209051_1018386 | Ga0209051_10183863 | 162 |
| 677 | 3300025735 | Ga0207713_1000221 | Ga0207713_100022137 | 162 |
| 678 | 3300025900 | Ga0207710_10005665 | Ga0207710_100056656 | 162 |
| 679 | 3300025903 | Ga0207680_10000003 | Ga0207680_1000000365 | 162 |
| 680 | 3300025903 | Ga0207680_10233838 | Ga0207680_102338382 | 162 |
| 681 | 3300025904 | Ga0207647_10000005 | Ga0207647_10000005105 | 162 |
| 682 | 3300025904 | Ga0207647_10012567 | Ga0207647_100125674 | 162 |
| 683 | 3300025904 | Ga0207647_10023640 | Ga0207647_100236404 | 162 |
| 684 | 3300025907 | Ga0207645_10128939 | Ga0207645_101289392 | 162 |
| 685 | 3300025909 | Ga0207705_10006165 | Ga0207705_100061654 | 162 |
| 686 | 3300025912 | Ga0207707_10000105 | Ga0207707_1000010515 | 162 |
| 687 | 3300025912 | Ga0207707_10037229 | Ga0207707_100372294 | 162 |
| 688 | 3300025913 | Ga0207695_10001444 | Ga0207695_1000144420 | 162 |
| 689 | 3300025913 | Ga0207695_10003927 | Ga0207695_1000392718 | 162 |
| 690 | 3300025913 | Ga0207695_10004251 | Ga0207695_100042516 | 162 |
| 691 | 3300025913 | Ga0207695_10004499 | Ga0207695_1000449913 | 162 |
| 692 | 3300025913 | Ga0207695_10010604 | Ga0207695_100106046 | 162 |
| 693 | 3300025913 | Ga0207695_10011161 | Ga0207695_100111612 | 162 |
| 694 | 3300025914 | Ga0207671_10000009 | Ga0207671_10000009600 | 162 |
| 695 | 3300025914 | Ga0207671_10000205 | Ga0207671_1000020572 | 162 |
| 696 | 3300025914 | Ga0207671_10664502 | Ga0207671_106645021 | 162 |
| 697 | 3300025916 | Ga0207663_10980416 | Ga0207663_109804161 | 162 |
| 698 | 3300025919 | Ga0207657_10162213 | Ga0207657_101622132 | 162 |
| 699 | 3300025919 | Ga0207657_10260605 | Ga0207657_102606052 | 162 |
| 700 | 3300025920 | Ga0207649_10018912 | Ga0207649_100189124 | 162 |
| 701 | 3300025920 | Ga0207649_10923662 | Ga0207649_109236622 | 162 |
| 702 | 3300025920 | Ga0207649_10950477 | Ga0207649_109504771 | 162 |
| 703 | 3300025921 | Ga0207652_10315168 | Ga0207652_103151682 | 162 |
| 704 | 3300025921 | Ga0207652_10534002 | Ga0207652_105340022 | 162 |
| 705 | 3300025924 | Ga0207694_10001033 | Ga0207694_1000103311 | 162 |
| 706 | 3300025924 | Ga0207694_10249918 | Ga0207694_102499182 | 162 |
| 707 | 3300025924 | Ga0207694_10532769 | Ga0207694_105327691 | 162 |
| 708 | 3300025929 | Ga0207664_10455141 | Ga0207664_104551412 | 162 |
| 709 | 3300025932 | Ga0207690_10004742 | Ga0207690_100047425 | 162 |
| 710 | 3300025932 | Ga0207690_10546571 | Ga0207690_105465712 | 162 |
| 711 | 3300025936 | Ga0207670_10028380 | Ga0207670_100283803 | 162 |
| 712 | 3300025941 | Ga0207711_10050655 | Ga0207711_100506555 | 162 |
| 713 | 3300025949 | Ga0207667_10000193 | Ga0207667_1000019347 | 162 |
| 714 | 3300025949 | Ga0207667_10000244 | Ga0207667_1000024453 | 162 |
| 715 | 3300025949 | Ga0207667_10003976 | Ga0207667_100039763 | 162 |
| 716 | 3300025949 | Ga0207667_10075772 | Ga0207667_100757723 | 162 |
| 717 | 3300025981 | Ga0207640_10000169 | Ga0207640_1000016921 | 162 |
| 718 | 3300025981 | Ga0207640_10000961 | Ga0207640_1000096111 | 162 |
| 719 | 3300025981 | Ga0207640_10043770 | Ga0207640_100437703 | 162 |
| 720 | 3300025981 | Ga0207640_10293452 | Ga0207640_102934522 | 162 |
| 721 | 3300025986 | Ga0207658_10477769 | Ga0207658_104777693 | 162 |
| 722 | 3300025986 | Ga0207658_11140685 | Ga0207658_111406852 | 162 |
| 723 | 3300026035 | Ga0207703_10083650 | Ga0207703_100836504 | 162 |
| 724 | 3300026035 | Ga0207703_10117135 | Ga0207703_101171353 | 162 |
| 725 | 3300026041 | Ga0207639_10034959 | Ga0207639_100349592 | 162 |
| 726 | 3300026067 | Ga0207678_10012183 | Ga0207678_100121837 | 162 |
| 727 | 3300026067 | Ga0207678_10021852 | Ga0207678_100218527 | 162 |
| 728 | 3300026067 | Ga0207678_10087171 | Ga0207678_100871713 | 162 |
| 729 | 3300026067 | Ga0207678_10183666 | Ga0207678_101836662 | 162 |
| 730 | 3300026067 | Ga0207678_10196563 | Ga0207678_101965632 | 162 |
| 731 | 3300026067 | Ga0207678_10297027 | Ga0207678_102970273 | 162 |
| 732 | 3300026067 | Ga0207678_11235862 | Ga0207678_112358621 | 162 |
| 733 | 3300026078 | Ga0207702_10000279 | Ga0207702_1000027952 | 162 |
| 734 | 3300026078 | Ga0207702_10008212 | Ga0207702_100082124 | 162 |
| 735 | 3300026078 | Ga0207702_11486691 | Ga0207702_114866911 | 162 |
| 736 | 3300026116 | Ga0207674_10000401 | Ga0207674_1000040133 | 162 |
| 737 | 3300026116 | Ga0207674_10128797 | Ga0207674_101287972 | 162 |
| 738 | 3300026116 | Ga0207674_10200995 | Ga0207674_102009952 | 162 |
| 739 | 3300027666 | Ga0209282_1000056 | Ga0209282_10000565 | 162 |
| 740 | 3300028379 | Ga0268266_10000011 | Ga0268266_1000001141 | 162 |
| 741 | 3300028379 | Ga0268266_10875245 | Ga0268266_108752452 | 162 |
| 742 | 3300028380 | Ga0268265_10757154 | Ga0268265_107571542 | 162 |
| 743 | 3300028381 | Ga0268264_10232993 | Ga0268264_102329932 | 162 |
| 744 | 3300028381 | Ga0268264_10250318 | Ga0268264_102503181 | 162 |
| 745 | 3300028786 | Ga0307517_10092418 | Ga0307517_100924183 | 162 |
| 746 | 3300033180 | Ga0307510_10040224 | Ga0307510_100402245 | 162 |
| 747 | 3300037312 | Ga0395899_0000226 | Ga0395899_0000226_172_660 | 162 |
| 748 | 3300037312 | Ga0395899_0003288 | Ga0395899_0003288_5428_5919 | 162 |
| 749 | 3300037312 | Ga0395899_0003519 | Ga0395899_0003519_11128_11619 | 162 |
| 750 | 3300037312 | Ga0395899_0292473 | Ga0395899_0292473_116_607 | 162 |
| 751 | 3300037418 | Ga0395900_0000011 | Ga0395900_0000011_345057_345545 | 162 |
| 752 | 3300037418 | Ga0395900_0000078 | Ga0395900_0000078_32657_33145 | 162 |
| 753 | 3300037418 | Ga0395900_0008850 | Ga0395900_0008850_3237_3728 | 162 |
| 754 | 3300037418 | Ga0395900_0778801 | Ga0395900_0778801_50_541 | 162 |
| 755 | 3300037466 | Ga0395898_0000029 | Ga0395898_0000029_101822_102310 | 162 |
| 756 | 3300037466 | Ga0395898_0000336 | Ga0395898_0000336_93192_93683 | 162 |
| 757 | 3300037466 | Ga0395898_0040001 | Ga0395898_0040001_1485_1973 | 162 |
| 758 | 3300037466 | Ga0395898_0469500 | Ga0395898_0469500_50_541 | 162 |
| 759 | 3300037471 | Ga0395905_0172296 | Ga0395905_0172296_834_1325 | 162 |
| 760 | 3300038443 | Ga0395901_0106861 | Ga0395901_0106861_743_1231 | 162 |
| 761 | 3300038443 | Ga0395901_0116900 | Ga0395901_0116900_2193_2684 | 162 |
| 762 | 3300038443 | Ga0395901_0869160 | Ga0395901_0869160_345_836 | 162 |
| 763 | 3300041491 | Ga0451833_0261258 | Ga0451833_0261258_134_622 | 162 |
| 764 | 3300044656 | Ga0466969_0031836 | Ga0466969_0031836_314_805 | 162 |
| 765 | 3300044656 | Ga0466969_0033388 | Ga0466969_0033388_1726_2235 | 162 |
| 766 | 3300044656 | Ga0466969_0042658 | Ga0466969_0042658_1510_2010 | 162 |
| 767 | 3300044656 | Ga0466969_0171810 | Ga0466969_0171810_378_950 | 162 |
| 768 | 3300044658 | Ga0466972_0033943 | Ga0466972_0033943_812_1312 | 162 |
| 769 | 3300044663 | Ga0466989_0019721 | Ga0466989_0019721_3243_3734 | 162 |
| 770 | 3300044672 | Ga0466982_0000001 | Ga0466982_0000001_224041_224541 | 162 |
| 771 | 3300044683 | Ga0466965_0113435 | Ga0466965_0113435_380_880 | 162 |
| 772 | 3300044683 | Ga0466965_0152070 | Ga0466965_0152070_502_1053 | 162 |
| 773 | 3300044684 | Ga0466966_0004620 | Ga0466966_0004620_6409_6909 | 162 |
| 774 | 3300044684 | Ga0466966_0007031 | Ga0466966_0007031_5116_5607 | 162 |
| 775 | 3300044684 | Ga0466966_0011542 | Ga0466966_0011542_946_1434 | 162 |
| 776 | 3300044693 | Ga0466961_0001169 | Ga0466961_0001169_1250_1738 | 162 |
| 777 | 3300044693 | Ga0466961_0001667 | Ga0466961_0001667_11954_12454 | 162 |
| 778 | 3300044693 | Ga0466961_0023321 | Ga0466961_0023321_3095_3604 | 162 |
| 779 | 3300044693 | Ga0466961_0025976 | Ga0466961_0025976_1150_1641 | 162 |
| 780 | 3300044694 | Ga0466963_0011721 | Ga0466963_0011721_3393_3890 | 162 |
| 781 | 3300044694 | Ga0466963_0096443 | Ga0466963_0096443_1435_1926 | 162 |
| 782 | 3300044706 | Ga0466964_0004985 | Ga0466964_0004985_3332_3832 | 162 |
| 783 | 3300044706 | Ga0466964_0275861 | Ga0466964_0275861_100_588 | 162 |
| 784 | 3300044706 | Ga0466964_0378005 | Ga0466964_0378005_51_542 | 162 |
| 785 | 3300044719 | Ga0466971_0007278 | Ga0466971_0007278_2224_2724 | 162 |
| 786 | 3300044735 | Ga0466968_0015619 | Ga0466968_0015619_438_938 | 162 |
| 787 | 3300044765 | Ga0466970_0001207 | Ga0466970_0001207_929_1417 | 162 |
| 788 | 3300044765 | Ga0466970_0042862 | Ga0466970_0042862_1008_1499 | 162 |
| 789 | 3300044765 | Ga0466970_0050528 | Ga0466970_0050528_777_1286 | 162 |
| 790 | 3300044842 | Ga0466957_0123453 | Ga0466957_0123453_581_1072 | 162 |
| 791 | 3300044842 | Ga0466957_0127426 | Ga0466957_0127426_239_730 | 162 |
| 792 | 3300044842 | Ga0466957_0139004 | Ga0466957_0139004_94_582 | 162 |
| 793 | 3300044842 | Ga0466957_0478905 | Ga0466957_0478905_331_822 | 162 |
| 794 | 3300044901 | Ga0466960_0035701 | Ga0466960_0035701_1271_1771 | 162 |
| 795 | 3300045049 | Ga0466959_0000006 | Ga0466959_0000006_79578_80087 | 162 |
| 796 | 3300045049 | Ga0466959_0011279 | Ga0466959_0011279_4932_5423 | 162 |
| 797 | 3300045049 | Ga0466959_0021454 | Ga0466959_0021454_3360_3851 | 162 |
| 798 | 3300045049 | Ga0466959_0169706 | Ga0466959_0169706_792_1280 | 162 |
| 799 | 3300045049 | Ga0466959_0461067 | Ga0466959_0461067_25_525 | 162 |
| 800 | 3300045836 | Ga0466958_0023770 | Ga0466958_0023770_1457_2008 | 162 |
| 801 | 3300045836 | Ga0466958_0042117 | Ga0466958_0042117_694_1194 | 162 |
| 802 | 3300045836 | Ga0466958_0121422 | Ga0466958_0121422_151_642 | 162 |
| 803 | 3300045836 | Ga0466958_0162720 | Ga0466958_0162720_638_1129 | 162 |
| 804 | 3300046452 | Ga0495617_000040 | Ga0495617_000040_105668_106156 | 162 |
| 805 | 3300046452 | Ga0495617_001397 | Ga0495617_001397_5650_6138 | 162 |
| 806 | 3300046457 | Ga0495590_0071212 | Ga0495590_0071212_449_937 | 162 |
| 807 | 3300046458 | Ga0495591_026505 | Ga0495591_026505_168_677 | 162 |
| 808 | 3300046460 | Ga0495638_0000339 | Ga0495638_0000339_35913_36407 | 162 |
| 809 | 3300046460 | Ga0495638_0000670 | Ga0495638_0000670_20733_21227 | 162 |
| 810 | 3300046460 | Ga0495638_0065452 | Ga0495638_0065452_981_1469 | 162 |
| 811 | 3300046471 | Ga0495650_0000112 | Ga0495650_0000112_193457_193951 | 162 |
| 812 | 3300046471 | Ga0495650_0000852 | Ga0495650_0000852_28040_28531 | 162 |
| 813 | 3300046471 | Ga0495650_0006997 | Ga0495650_0006997_1270_1758 | 162 |
| 814 | 3300046471 | Ga0495650_0013554 | Ga0495650_0013554_1988_2476 | 162 |
| 815 | 3300046474 | Ga0495605_0000834 | Ga0495605_0000834_4614_5123 | 162 |
| 816 | 3300046474 | Ga0495605_0103498 | Ga0495605_0103498_458_946 | 162 |
| 817 | 3300046491 | Ga0495584_0002683 | Ga0495584_0002683_4187_4675 | 162 |
| 818 | 3300046492 | Ga0495585_0000024 | Ga0495585_0000024_5178_5666 | 162 |
| 819 | 3300046492 | Ga0495585_0012695 | Ga0495585_0012695_1821_2309 | 162 |
| 820 | 3300046500 | Ga0495596_0000060 | Ga0495596_0000060_44595_45104 | 162 |
| 821 | 3300046501 | Ga0495607_0001134 | Ga0495607_0001134_15453_15941 | 162 |
| 822 | 3300046501 | Ga0495607_0003270 | Ga0495607_0003270_2087_2596 | 162 |
| 823 | 3300046501 | Ga0495607_0070767 | Ga0495607_0070767_622_1110 | 162 |
| 824 | 3300046506 | Ga0495583_0029981 | Ga0495583_0029981_822_1310 | 162 |
| 825 | 3300046507 | Ga0495606_0000902 | Ga0495606_0000902_11499_11987 | 162 |
| 826 | 3300046507 | Ga0495606_0001920 | Ga0495606_0001920_6148_6636 | 162 |
| 827 | 3300046507 | Ga0495606_0005113 | Ga0495606_0005113_5915_6403 | 162 |
| 828 | 3300046507 | Ga0495606_0017472 | Ga0495606_0017472_2237_2731 | 162 |
| 829 | 3300046507 | Ga0495606_0029881 | Ga0495606_0029881_1839_2327 | 162 |
| 830 | 3300046507 | Ga0495606_0095395 | Ga0495606_0095395_777_1268 | 162 |
| 831 | 3300046512 | Ga0495610_0000235 | Ga0495610_0000235_4270_4779 | 162 |
| 832 | 3300046512 | Ga0495610_0026982 | Ga0495610_0026982_1858_2346 | 162 |
| 833 | 3300046513 | Ga0495616_0000496 | Ga0495616_0000496_19428_19916 | 162 |
| 834 | 3300046513 | Ga0495616_0000948 | Ga0495616_0000948_1586_2095 | 162 |
| 835 | 3300046513 | Ga0495616_0006065 | Ga0495616_0006065_3678_4166 | 162 |
| 836 | 3300046515 | Ga0495620_0000348 | Ga0495620_0000348_12220_12708 | 162 |
| 837 | 3300046515 | Ga0495620_0061047 | Ga0495620_0061047_714_1202 | 162 |
| 838 | 3300046518 | Ga0495631_0000331 | Ga0495631_0000331_30153_30641 | 162 |
| 839 | 3300046518 | Ga0495631_0005220 | Ga0495631_0005220_5460_5948 | 162 |
| 840 | 3300046518 | Ga0495631_0369941 | Ga0495631_0369941_84_572 | 162 |
| 841 | 3300046519 | Ga0495632_0000005 | Ga0495632_0000005_222136_222624 | 162 |
| 842 | 3300046519 | Ga0495632_0002695 | Ga0495632_0002695_8525_9013 | 162 |
| 843 | 3300046519 | Ga0495632_0015748 | Ga0495632_0015748_1998_2486 | 162 |
| 844 | 3300046522 | Ga0495643_0037484 | Ga0495643_0037484_1581_2090 | 162 |
| 845 | 3300046524 | Ga0495648_0004979 | Ga0495648_0004979_5364_5852 | 162 |
| 846 | 3300046524 | Ga0495648_0006512 | Ga0495648_0006512_841_1329 | 162 |
| 847 | 3300046524 | Ga0495648_0020135 | Ga0495648_0020135_1344_1853 | 162 |
| 848 | 3300046530 | Ga0495654_0265487 | Ga0495654_0265487_73_582 | 162 |
| 849 | 3300046538 | Ga0495609_0000573 | Ga0495609_0000573_25767_26276 | 162 |
| 850 | 3300046538 | Ga0495609_0008691 | Ga0495609_0008691_4189_4677 | 162 |
| 851 | 3300046557 | Ga0495622_0000954 | Ga0495622_0000954_5434_5928 | 162 |
| 852 | 3300046615 | Ga0495656_0479924 | Ga0495656_0479924_81_590 | 162 |
| 853 | 3300046616 | Ga0495668_0007118 | Ga0495668_0007118_2585_3073 | 162 |
| 854 | 3300046616 | Ga0495668_0135978 | Ga0495668_0135978_100_588 | 162 |
| 855 | 3300046648 | Ga0495611_0000005 | Ga0495611_0000005_138204_138692 | 162 |
| 856 | 3300046648 | Ga0495611_0000039 | Ga0495611_0000039_91963_92451 | 162 |
| 857 | 3300046648 | Ga0495611_0239590 | Ga0495611_0239590_242_751 | 162 |
| 858 | 3300046660 | Ga0495625_0000066 | Ga0495625_0000066_110968_111456 | 162 |
| 859 | 3300046660 | Ga0495625_0049565 | Ga0495625_0049565_1436_1930 | 162 |
| 860 | 3300046660 | Ga0495625_0052521 | Ga0495625_0052521_2394_2882 | 162 |
| 861 | 3300046660 | Ga0495625_0066875 | Ga0495625_0066875_1120_1611 | 162 |
| 862 | 3300046660 | Ga0495625_0270106 | Ga0495625_0270106_549_1037 | 162 |
| 863 | 3300046665 | Ga0495661_0004104 | Ga0495661_0004104_5379_5867 | 162 |
| 864 | 3300046665 | Ga0495661_0015165 | Ga0495661_0015165_348_857 | 162 |
| 865 | 3300046665 | Ga0495661_0050806 | Ga0495661_0050806_757_1245 | 162 |
| 866 | 3300046684 | Ga0495669_0019406 | Ga0495669_0019406_328_837 | 162 |
| 867 | 3300046691 | Ga0495670_0003480 | Ga0495670_0003480_2406_2894 | 162 |
| 868 | 3300046691 | Ga0495670_0008096 | Ga0495670_0008096_563_1051 | 162 |
| 869 | 3300046691 | Ga0495670_0369262 | Ga0495670_0369262_192_701 | 162 |
| 870 | 3300046692 | Ga0495671_0002622 | Ga0495671_0002622_6323_6832 | 162 |
| 871 | 3300046692 | Ga0495671_0009862 | Ga0495671_0009862_3730_4218 | 162 |
| 872 | 3300046694 | Ga0495649_0009841 | Ga0495649_0009841_2635_3129 | 162 |
| 873 | 3300046794 | Ga0495589_0000026 | Ga0495589_0000026_94283_94771 | 162 |
| 874 | 3300046810 | Ga0495660_0000544 | Ga0495660_0000544_19942_20430 | 162 |
| 875 | 3300046810 | Ga0495660_0012768 | Ga0495660_0012768_1745_2233 | 162 |
| 876 | 3300047320 | Ga0495672_0028976 | Ga0495672_0028976_2156_2665 | 162 |
| 877 | 3300047323 | Ga0495683_0001769 | Ga0495683_0001769_2515_3003 | 162 |
| 878 | 3300047446 | Ga0495679_000010 | Ga0495679_000010_111791_112279 | 162 |
| 879 | 3300047446 | Ga0495679_034113 | Ga0495679_034113_795_1289 | 162 |
| 880 | 3300047447 | Ga0495685_062513 | Ga0495685_062513_483_992 | 162 |
| 881 | 3300047469 | Ga0495673_0000038 | Ga0495673_0000038_143420_143908 | 162 |
| 882 | 3300047469 | Ga0495673_0000045 | Ga0495673_0000045_103531_104019 | 162 |
| 883 | 3300047469 | Ga0495673_0001306 | Ga0495673_0001306_9440_9928 | 162 |
| 884 | 3300047472 | Ga0495686_0000050 | Ga0495686_0000050_138584_139072 | 162 |
| 885 | 3300047472 | Ga0495686_0000297 | Ga0495686_0000297_10958_11446 | 162 |
| 886 | 3300047472 | Ga0495686_0002453 | Ga0495686_0002453_2674_3162 | 162 |
| 887 | 3300047472 | Ga0495686_0012390 | Ga0495686_0012390_4462_4950 | 162 |
| 888 | 3300047472 | Ga0495686_0069393 | Ga0495686_0069393_1397_1885 | 162 |
| 889 | 3300048903 | Ga0496100_0106172 | Ga0496100_0106172_1074_1562 | 162 |
| 890 | 3300048904 | Ga0496101_0135366 | Ga0496101_0135366_50_538 | 162 |
| 891 | 3300048904 | Ga0496101_0263846 | Ga0496101_0263846_823_1311 | 162 |
| 892 | 3300048904 | Ga0496101_0871253 | Ga0496101_0871253_188_685 | 162 |
| 893 | 3300048905 | Ga0496102_0222324 | Ga0496102_0222324_28_516 | 162 |
| 894 | 3300048907 | Ga0496104_0071611 | Ga0496104_0071611_1844_2335 | 162 |
| 895 | 3300048907 | Ga0496104_0145631 | Ga0496104_0145631_396_890 | 162 |
| 896 | 3300048907 | Ga0496104_1062658 | Ga0496104_1062658_112_609 | 162 |
| 897 | 3300048908 | Ga0496105_0007857 | Ga0496105_0007857_1192_1689 | 162 |
| 898 | 3300048908 | Ga0496105_0737563 | Ga0496105_0737563_232_723 | 162 |
| 899 | 3300048909 | Ga0496106_0000097 | Ga0496106_0000097_37192_37680 | 162 |
| 900 | 3300048909 | Ga0496106_0917761 | Ga0496106_0917761_99_593 | 162 |
| 901 | 3300048909 | Ga0496106_1008555 | Ga0496106_1008555_127_624 | 162 |
| 902 | 3300048915 | Ga0496112_0271738 | Ga0496112_0271738_320_811 | 162 |
| 903 | 3300048916 | Ga0496113_0222473 | Ga0496113_0222473_915_1406 | 162 |
| 904 | 3300048918 | Ga0496115_0000283 | Ga0496115_0000283_33685_34176 | 162 |
| 905 | 3300048918 | Ga0496115_0002834 | Ga0496115_0002834_9746_10240 | 162 |
| 906 | 3300048918 | Ga0496115_0012403 | Ga0496115_0012403_3814_4308 | 162 |
| 907 | 3300048918 | Ga0496115_1054726 | Ga0496115_1054726_79_576 | 162 |
| 908 | 3300048919 | Ga0496116_0002634 | Ga0496116_0002634_13187_13696 | 162 |
| 909 | 3300048919 | Ga0496116_0056171 | Ga0496116_0056171_151_648 | 162 |
| 910 | 3300048920 | Ga0496117_0076902 | Ga0496117_0076902_1135_1632 | 162 |
| 911 | 3300048920 | Ga0496117_0077580 | Ga0496117_0077580_499_996 | 162 |
| 912 | 3300048920 | Ga0496117_0082170 | Ga0496117_0082170_71_559 | 162 |
| 913 | 3300048920 | Ga0496117_0163237 | Ga0496117_0163237_791_1288 | 162 |
| 914 | 3300048920 | Ga0496117_0507393 | Ga0496117_0507393_63_551 | 162 |
| 915 | 3300048921 | Ga0496118_0002818 | Ga0496118_0002818_22098_22595 | 162 |
| 916 | 3300048921 | Ga0496118_0003470 | Ga0496118_0003470_5569_6066 | 162 |
| 917 | 3300048921 | Ga0496118_0004496 | Ga0496118_0004496_4526_5014 | 162 |
| 918 | 3300048921 | Ga0496118_0006149 | Ga0496118_0006149_6575_7072 | 162 |
| 919 | 3300048921 | Ga0496118_0006461 | Ga0496118_0006461_12309_12797 | 162 |
| 920 | 3300048922 | Ga0496119_0000291 | Ga0496119_0000291_63259_63756 | 162 |
| 921 | 3300048922 | Ga0496119_0016378 | Ga0496119_0016378_4434_4937 | 162 |
| 922 | 3300048923 | Ga0496120_0000397 | Ga0496120_0000397_6451_6948 | 162 |
| 923 | 3300048923 | Ga0496120_0001574 | Ga0496120_0001574_21720_22223 | 162 |
| 924 | 3300048924 | Ga0496121_0000531 | Ga0496121_0000531_29842_30339 | 162 |
| 925 | 3300048924 | Ga0496121_0001099 | Ga0496121_0001099_72_560 | 162 |
| 926 | 3300048924 | Ga0496121_0002812 | Ga0496121_0002812_19295_19783 | 162 |
| 927 | 3300048924 | Ga0496121_0003485 | Ga0496121_0003485_2561_3049 | 162 |
| 928 | 3300048924 | Ga0496121_0007940 | Ga0496121_0007940_8187_8696 | 162 |
| 929 | 3300048924 | Ga0496121_0015521 | Ga0496121_0015521_4330_4830 | 162 |
| 930 | 3300048924 | Ga0496121_0015815 | Ga0496121_0015815_3828_4316 | 162 |
| 931 | 3300048924 | Ga0496121_0020023 | Ga0496121_0020023_52_543 | 162 |
| 932 | 3300048924 | Ga0496121_0103775 | Ga0496121_0103775_65_559 | 162 |
| 933 | 3300048924 | Ga0496121_0121910 | Ga0496121_0121910_386_883 | 162 |
| 934 | 3300048924 | Ga0496121_0252139 | Ga0496121_0252139_670_1158 | 162 |
| 935 | 3300048925 | Ga0496122_0002324 | Ga0496122_0002324_14449_14958 | 162 |
| 936 | 3300048925 | Ga0496122_0007927 | Ga0496122_0007927_10346_10834 | 162 |
| 937 | 3300048925 | Ga0496122_0061502 | Ga0496122_0061502_649_1140 | 162 |
| 938 | 3300048925 | Ga0496122_0192599 | Ga0496122_0192599_276_764 | 162 |
| 939 | 3300048925 | Ga0496122_0592492 | Ga0496122_0592492_12_500 | 162 |
| 940 | 3300048926 | Ga0496123_0002089 | Ga0496123_0002089_20629_21138 | 162 |
| 941 | 3300048926 | Ga0496123_0026147 | Ga0496123_0026147_1210_1698 | 162 |
| 942 | 3300048926 | Ga0496123_0027129 | Ga0496123_0027129_3660_4148 | 162 |
| 943 | 3300048928 | Ga0496125_0000647 | Ga0496125_0000647_32444_32944 | 162 |
| 944 | 3300048928 | Ga0496125_0012655 | Ga0496125_0012655_4323_4811 | 162 |
| 945 | 3300048929 | Ga0496126_0001015 | Ga0496126_0001015_160_657 | 162 |
| 946 | 3300048929 | Ga0496126_0068693 | Ga0496126_0068693_855_1364 | 162 |
| 947 | 3300048929 | Ga0496126_0098442 | Ga0496126_0098442_914_1405 | 162 |
| 948 | 3300048929 | Ga0496126_0192114 | Ga0496126_0192114_629_1123 | 162 |
| 949 | 3300048929 | Ga0496126_0197252 | Ga0496126_0197252_358_846 | 162 |
| 950 | 3300048929 | Ga0496126_0686034 | Ga0496126_0686034_111_605 | 162 |
| 951 | 3300049459 | Ga0495678_000672 | Ga0495678_000672_8108_8596 | 162 |
| 952 | 3300049460 | Ga0495682_0010314 | Ga0495682_0010314_859_1347 | 162 |
| 953 | 3300049460 | Ga0495682_0018766 | Ga0495682_0018766_1243_1731 | 162 |
| 954 | 3300049568 | Ga0501031_0005471 | Ga0501031_0005471_7524_8015 | 162 |
| 955 | 3300049568 | Ga0501031_0011536 | Ga0501031_0011536_2332_2829 | 162 |
| 956 | 3300049569 | Ga0501032_0240022 | Ga0501032_0240022_371_862 | 162 |
| 957 | 3300049570 | Ga0501033_0000289 | Ga0501033_0000289_19842_20339 | 162 |
| 958 | 3300049570 | Ga0501033_0000339 | Ga0501033_0000339_36849_37340 | 162 |
| 959 | 3300049570 | Ga0501033_0036019 | Ga0501033_0036019_83_592 | 162 |
| 960 | 3300049570 | Ga0501033_0155948 | Ga0501033_0155948_1115_1606 | 162 |
| 961 | 3300049570 | Ga0501033_0471617 | Ga0501033_0471617_250_741 | 162 |
| 962 | 3300049571 | Ga0501034_0012646 | Ga0501034_0012646_3117_3614 | 162 |
| 963 | 3300049571 | Ga0501034_0023149 | Ga0501034_0023149_3015_3515 | 162 |
| 964 | 3300049571 | Ga0501034_0169310 | Ga0501034_0169310_294_785 | 162 |
| 965 | 3300049571 | Ga0501034_0195113 | Ga0501034_0195113_1457_1969 | 162 |
| 966 | 3300049571 | Ga0501034_0692355 | Ga0501034_0692355_24_512 | 162 |
| 967 | 3300049572 | Ga0501036_0000051 | Ga0501036_0000051_13382_13879 | 162 |
| 968 | 3300049572 | Ga0501036_0048851 | Ga0501036_0048851_1291_1803 | 162 |
| 969 | 3300049572 | Ga0501036_0901850 | Ga0501036_0901850_216_707 | 162 |
| 970 | 3300049573 | Ga0501037_0002569 | Ga0501037_0002569_6306_6803 | 162 |
| 971 | 3300049573 | Ga0501037_0026579 | Ga0501037_0026579_1735_2235 | 162 |
| 972 | 3300049573 | Ga0501037_0368517 | Ga0501037_0368517_54_545 | 162 |
| 973 | 3300049573 | Ga0501037_0401334 | Ga0501037_0401334_32_523 | 162 |
| 974 | 3300049573 | Ga0501037_0478779 | Ga0501037_0478779_212_703 | 162 |
| 975 | 3300049573 | Ga0501037_0738756 | Ga0501037_0738756_45_548 | 162 |
| 976 | 3300049574 | Ga0501038_0005817 | Ga0501038_0005817_6960_7457 | 162 |
| 977 | 3300049574 | Ga0501038_0044246 | Ga0501038_0044246_162_653 | 162 |
| 978 | 3300049574 | Ga0501038_0140701 | Ga0501038_0140701_53_544 | 162 |
| 979 | 3300049574 | Ga0501038_0514752 | Ga0501038_0514752_397_888 | 162 |
| 980 | 3300049575 | Ga0501039_0027791 | Ga0501039_0027791_3709_4200 | 162 |
| 981 | 3300049576 | Ga0501040_0202723 | Ga0501040_0202723_434_922 | 162 |
| 982 | 3300049578 | Ga0501042_0079853 | Ga0501042_0079853_649_1140 | 162 |
| 983 | 3300049579 | Ga0501043_0015316 | Ga0501043_0015316_2666_3166 | 162 |
| 984 | 3300049579 | Ga0501043_0051289 | Ga0501043_0051289_730_1227 | 162 |
| 985 | 3300049579 | Ga0501043_0127804 | Ga0501043_0127804_561_1070 | 162 |
| 986 | 3300049579 | Ga0501043_0128392 | Ga0501043_0128392_262_753 | 162 |
| 987 | 3300049579 | Ga0501043_0320570 | Ga0501043_0320570_79_576 | 162 |
| 988 | 3300049579 | Ga0501043_1105114 | Ga0501043_1105114_54_545 | 162 |
| 989 | 3300049580 | Ga0501046_0006257 | Ga0501046_0006257_1324_1821 | 162 |
| 990 | 3300049580 | Ga0501046_0011629 | Ga0501046_0011629_5320_5820 | 162 |
| 991 | 3300049580 | Ga0501046_0070261 | Ga0501046_0070261_1011_1502 | 162 |
| 992 | 3300049580 | Ga0501046_0202997 | Ga0501046_0202997_745_1242 | 162 |
| 993 | 3300049580 | Ga0501046_0303782 | Ga0501046_0303782_248_742 | 162 |
| 994 | 3300049581 | Ga0501047_0014773 | Ga0501047_0014773_3597_4088 | 162 |
| 995 | 3300049581 | Ga0501047_0015511 | Ga0501047_0015511_5300_5791 | 162 |
| 996 | 3300049581 | Ga0501047_0025910 | Ga0501047_0025910_4967_5464 | 162 |
| 997 | 3300049581 | Ga0501047_0099896 | Ga0501047_0099896_1340_1834 | 162 |
| 998 | 3300049581 | Ga0501047_0317447 | Ga0501047_0317447_140_640 | 162 |
| 999 | 3300049581 | Ga0501047_0324912 | Ga0501047_0324912_25_519 | 162 |
| 1000 | 3300049581 | Ga0501047_0459337 | Ga0501047_0459337_386_877 | 162 |
| 1001 | 3300049582 | Ga0501048_0023832 | Ga0501048_0023832_958_1446 | 162 |
| 1002 | 3300049582 | Ga0501048_0086692 | Ga0501048_0086692_1493_1984 | 162 |
| 1003 | 3300049582 | Ga0501048_0226859 | Ga0501048_0226859_378_875 | 162 |
| 1004 | 3300049586 | Ga0501070_0221901 | Ga0501070_0221901_686_1177 | 162 |
| 1005 | 3300049586 | Ga0501070_0748232 | Ga0501070_0748232_227_718 | 162 |
| 1006 | 3300049589 | Ga0501073_0024817 | Ga0501073_0024817_1773_2264 | 162 |
| 1007 | 3300049590 | Ga0501074_0194285 | Ga0501074_0194285_720_1208 | 162 |
| 1008 | 3300049590 | Ga0501074_0584540 | Ga0501074_0584540_222_713 | 162 |
| 1009 | 3300049593 | Ga0501077_0297788 | Ga0501077_0297788_23_514 | 162 |
| 1010 | 3300049741 | Ga0501079_0196934 | Ga0501079_0196934_430_918 | 162 |
| 1011 | 3300049742 | Ga0501080_0097049 | Ga0501080_0097049_231_722 | 162 |
| 1012 | 3300049822 | Ga0501035_0001784 | Ga0501035_0001784_16595_17092 | 162 |
| 1013 | 3300049822 | Ga0501035_0051441 | Ga0501035_0051441_922_1413 | 162 |
| 1014 | 3300049822 | Ga0501035_0069252 | Ga0501035_0069252_2168_2662 | 162 |
| 1015 | 3300049822 | Ga0501035_0072485 | Ga0501035_0072485_2165_2674 | 162 |
| 1016 | 3300049822 | Ga0501035_0130034 | Ga0501035_0130034_400_891 | 162 |
| 1017 | 3300049822 | Ga0501035_0148783 | Ga0501035_0148783_1075_1572 | 162 |
| 1018 | 3300049822 | Ga0501035_0170660 | Ga0501035_0170660_213_704 | 162 |
| 1019 | 3300049822 | Ga0501035_0174004 | Ga0501035_0174004_532_1023 | 162 |
| 1020 | 3300049822 | Ga0501035_0349400 | Ga0501035_0349400_213_704 | 162 |
| 1021 | 3300049822 | Ga0501035_0526059 | Ga0501035_0526059_291_782 | 162 |
| 1022 | 3300049823 | Ga0501044_0014869 | Ga0501044_0014869_5000_5494 | 162 |
| 1023 | 3300049823 | Ga0501044_0020894 | Ga0501044_0020894_5438_5935 | 162 |
| 1024 | 3300049823 | Ga0501044_0059574 | Ga0501044_0059574_760_1272 | 162 |
| 1025 | 3300049823 | Ga0501044_0102799 | Ga0501044_0102799_995_1486 | 162 |
| 1026 | 3300049823 | Ga0501044_0491605 | Ga0501044_0491605_171_671 | 162 |
| 1027 | 3300049823 | Ga0501044_1263325 | Ga0501044_1263325_58_552 | 162 |
| 1028 | 3300050516 | nmdc:mga0sz30_137565_c1 | nmdc:mga0sz30_137565_c1_295_786 | 162 |
| 1029 | 3300053087 | Ga0500643_000074 | Ga0500643_000074_36002_36490 | 162 |
| 1030 | 3300053088 | Ga0500644_0400606 | Ga0500644_0400606_60_551 | 162 |
| 1031 | 3300053108 | Ga0500562_026359 | Ga0500562_026359_846_1334 | 162 |
| 1032 | 3300053730 | Ga0500645_001728 | Ga0500645_001728_4770_5258 | 162 |
| 1033 | 3300061719 | Ga0466962_0003425 | Ga0466962_0003425_2936_3427 | 162 |
| 1034 | 3300061719 | Ga0466962_0008321 | Ga0466962_0008321_1569_2060 | 162 |
| 1035 | 3300061719 | Ga0466962_0009529 | Ga0466962_0009529_1956_2456 | 162 |
| 1036 | 3300061719 | Ga0466962_0016609 | Ga0466962_0016609_2309_2860 | 162 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5hl6-assembly1.cif.gz_A | crystal structure of a putative gaf sensor protein from burkholderia vietnamiensis | 0.9805 | 11 | 160 |
| 3rfb-assembly1.cif.gz_A | structure of frmsr | 0.9764 | 14 | 160 |
| 3ksf-assembly3.cif.gz_F | structure of frmsr of staphylococcus aureus (reduced form) | 0.9682 | 16 | 162 |
| 8dgd-assembly1.cif.gz_A | crystal structure of gaf domain-containing protein, from klebsiella pneumoniae | 0.9626 | 7 | 161 |
| 1vhm-assembly1.cif.gz_A | crystal structure of an hypothetical protein | 0.9583 | 11 | 161 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3rfbA00 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.9764 | 14 | 160 | 3.30.450.40 |
| 1vhmA00 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.9583 | 11 | 161 | 3.30.450.40 |
| af_Q8MTJ7_3_158_3.30.450.40 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.9424 | 3 | 158 | 3.30.450.40 |
| af_Q8MTJ7_3_158_3.30.450.40 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.9309 | 3 | 158 | 3.30.450.40 |
| af_Q4DSC2_14_185_3.30.450.40 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.9298 | 11 | 162 | 3.30.450.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A227J7W3-F1-model_v4 | GAF domain-containing protein | 0.9959 | 15 | 106 |
|
| AF-A0A7X5UCN6-F1-model_v4 | GAF domain-containing protein | 0.9936 | 1 | 161 |
GO:0005829
GO:0033745 |
| AF-A0A446CPK9-F1-model_v4 | Free methionine-R-sulfoxide reductase (EC 1.8.4.14) | 0.9912 | 1 | 162 |
GO:0005829
GO:0033745 |
| AF-A0A085U834-F1-model_v4 | Free methionine-(R)-sulfoxide reductase (Gaf domain-containing protein (EC 1.8.4.14)) | 0.9902 | 11 | 161 |
GO:0005829
GO:0033745 |
| AF-A0A173J5I7-F1-model_v4 | deleted | 0.9895 | 16 | 160 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar