F488704

General Info

Members Datasets Scaffolds Average Seq Length
1036 329 2072 113

Family's Representative Sequence

Representative Sequence 3300002459|JGI24751J29686_10025059|JGI24751J29686_100250592
Length 113
Sequence MNVKTDQSGGVAIVRVGETRLMYPILSDFSTAVSGLVAAGQKQILIDLTPVTYVDSATIGCLMDLYRQVHNAGGHLKLSGVQKRVETMLTMTGAQNFLEIHADEPTAVKSFGA

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
93 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
110 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
189 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
190 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
191 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
192 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
198 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
199 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
200 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
201 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
202 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
203 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
204 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
205 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
206 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
207 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
208 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
209 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
211 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
213 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
214 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
215 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
216 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
217 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
218 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
219 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
220 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
221 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
222 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
223 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
224 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
225 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
226 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
228 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
229 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
232 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
233 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
234 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
235 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
236 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
237 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
238 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
239 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
240 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
241 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
242 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
243 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
244 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
245 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
246 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
247 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
248 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
249 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
250 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
251 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
252 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
253 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
254 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
255 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
256 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
257 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
258 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
259 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
260 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
261 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
262 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
263 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
264 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
265 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
266 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
267 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
268 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
269 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
270 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
271 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
272 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
273 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
274 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
275 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
276 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
277 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
278 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
279 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
280 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
281 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
282 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
283 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
284 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
285 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
286 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
287 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
288 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
289 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
290 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
291 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
292 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
293 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
294 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
295 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
296 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
297 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
298 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
299 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
300 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
301 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
302 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
303 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
304 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
305 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
306 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
310 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
311 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
312 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
313 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
314 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
315 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
316 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
317 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
318 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
319 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
320 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
321 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
322 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
323 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
324 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
325 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
326 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
327 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
328 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
329 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.9
Metatranscriptomes 0.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.1
Nodule 0
Rhizoplane 4.05
Rhizosphere 95.17
Stem 0
Stem Tuber 0
Unclassified 17.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10025059 3300002459 Bacteria 1238
2 Ga0058862_12589893 3300004803 Unclassified 695
3 Ga0065712_10012992 3300005290 Bacteria 2788
4 Ga0065712_10125629 3300005290 Bacteria 1611
5 Ga0065712_10196658 3300005290 Bacteria 1125
6 Ga0065712_10632838 3300005290 Bacteria 575
7 Ga0065715_10223744 3300005293 Unclassified 1259
8 Ga0065715_10285742 3300005293 Bacteria 1075
9 Ga0065715_10953072 3300005293 Unclassified 558
10 Ga0065707_10045080 3300005295 Bacteria 921
11 Ga0065707_10585883 3300005295 Unclassified 699
12 Ga0065707_10824312 3300005295 Bacteria 591
13 Ga0070658_10292078 3300005327 Bacteria 1389
14 Ga0070658_10592358 3300005327 Bacteria 961
15 Ga0070676_10016576 3300005328 Bacteria 4076
16 Ga0070676_10019769 3300005328 Bacteria 3752
17 Ga0070676_11189797 3300005328 Bacteria 579
18 Ga0070683_100112285 3300005329 Bacteria 2572
19 Ga0070683_100117782 3300005329 Bacteria 2508
20 Ga0070683_100386897 3300005329 Bacteria 1333
21 Ga0070683_100528046 3300005329 Bacteria 1128
22 Ga0070683_101293580 3300005329 Bacteria 701
23 Ga0070690_100005627 3300005330 Bacteria 7051
24 Ga0070690_100105546 3300005330 Bacteria 1873
25 Ga0070690_100267116 3300005330 Bacteria 1216
26 Ga0070677_10257568 3300005333 Bacteria 869
27 Ga0070677_10351139 3300005333 Bacteria 764
28 Ga0070677_10650437 3300005333 Bacteria 589
29 Ga0068869_100122037 3300005334 Bacteria 1994
30 Ga0068869_100328065 3300005334 Bacteria 1243
31 Ga0068869_101266515 3300005334 Unclassified 650
32 Ga0070666_10028024 3300005335 Bacteria 3694
33 Ga0070666_10242332 3300005335 Unclassified 1275
34 Ga0070666_10308826 3300005335 Bacteria 1127
35 Ga0070666_10575280 3300005335 Bacteria 821
36 Ga0070666_10657732 3300005335 Bacteria 767
37 Ga0070680_100293582 3300005336 Bacteria 1378
38 Ga0070680_100333392 3300005336 Bacteria 1288
39 Ga0070680_100890363 3300005336 Unclassified 768
40 Ga0068868_100078080 3300005338 Bacteria 2650
41 Ga0068868_100212373 3300005338 Bacteria 1618
42 Ga0068868_100398212 3300005338 Unclassified 1188
43 Ga0068868_100720075 3300005338 Bacteria 894
44 Ga0068868_100856015 3300005338 Unclassified 824
45 Ga0068868_101401641 3300005338 Unclassified 652
46 Ga0068868_101995133 3300005338 Bacteria 551
47 Ga0068868_102100726 3300005338 Bacteria 537
48 Ga0070660_100010623 3300005339 Bacteria 6508
49 Ga0070660_100360243 3300005339 Bacteria 1199
50 Ga0070689_100116052 3300005340 Bacteria 2134
51 Ga0070689_100278230 3300005340 Bacteria 1387
52 Ga0070689_100764070 3300005340 Bacteria 848
53 Ga0070689_101830466 3300005340 Unclassified 554
54 Ga0070691_10001160 3300005341 Bacteria 10988
55 Ga0070691_10491838 3300005341 Unclassified 707
56 Ga0070687_100331674 3300005343 Unclassified 976
57 Ga0070661_100135368 3300005344 Bacteria 1854
58 Ga0070692_10239505 3300005345 Bacteria 1081
59 Ga0070692_10311990 3300005345 Bacteria 964
60 Ga0070692_10796522 3300005345 Bacteria 645
61 Ga0070692_11222294 3300005345 Bacteria 536
62 Ga0070668_100025206 3300005347 Bacteria 4508
63 Ga0070668_100030655 3300005347 Bacteria 4090
64 Ga0070668_100703152 3300005347 Bacteria 892
65 Ga0070669_100006846 3300005353 Bacteria 8198
66 Ga0070669_100030062 3300005353 Bacteria 3918
67 Ga0070669_100263497 3300005353 Unclassified 1376
68 Ga0070669_100329000 3300005353 Bacteria 1236
69 Ga0070669_100479984 3300005353 Bacteria 1028
70 Ga0070669_100886273 3300005353 Unclassified 762
71 Ga0070669_101057861 3300005353 Unclassified 698
72 Ga0070675_100002731 3300005354 Bacteria 13262
73 Ga0070675_100021629 3300005354 Bacteria 5139
74 Ga0070675_100745134 3300005354 Bacteria 894
75 Ga0070675_101709204 3300005354 Bacteria 581
76 Ga0070675_102122736 3300005354 Bacteria 518
77 Ga0070671_100035123 3300005355 Bacteria 4152
78 Ga0070671_100676202 3300005355 Bacteria 895
79 Ga0070674_100017447 3300005356 Bacteria 4517
80 Ga0070674_100074607 3300005356 Bacteria 2407
81 Ga0070674_100174629 3300005356 Bacteria 1641
82 Ga0070674_100844308 3300005356 Bacteria 794
83 Ga0070674_100907281 3300005356 Unclassified 768
84 Ga0070674_101224777 3300005356 Unclassified 667
85 Ga0070674_101369270 3300005356 Unclassified 633
86 Ga0070673_100153046 3300005364 Bacteria 1955
87 Ga0070673_100179151 3300005364 Bacteria 1813
88 Ga0070673_100451359 3300005364 Bacteria 1157
89 Ga0070673_100964561 3300005364 Unclassified 793
90 Ga0070673_100997242 3300005364 Unclassified 780
91 Ga0070673_101102177 3300005364 Bacteria 742
92 Ga0070673_102076897 3300005364 Bacteria 540
93 Ga0070688_100024211 3300005365 Bacteria 3579
94 Ga0070688_100168009 3300005365 Bacteria 1511
95 Ga0070688_100285402 3300005365 Bacteria 1188
96 Ga0070688_100671846 3300005365 Bacteria 800
97 Ga0070688_101813415 3300005365 Bacteria 501
98 Ga0070659_100102874 3300005366 Bacteria 2300
99 Ga0070659_100364918 3300005366 Bacteria 1214
100 Ga0070659_100394858 3300005366 Bacteria 1167
101 Ga0070667_100029648 3300005367 Bacteria 4561
102 Ga0070703_10241302 3300005406 Bacteria 729
103 Ga0070709_10029541 3300005434 Bacteria 3280
104 Ga0070714_100236525 3300005435 Bacteria 1684
105 Ga0070713_100078755 3300005436 Bacteria 2806
106 Ga0070713_100188607 3300005436 Bacteria 1857
107 Ga0070713_100234950 3300005436 Bacteria 1668
108 Ga0070713_101948858 3300005436 Unclassified 570
109 Ga0070710_10868540 3300005437 Bacteria 649
110 Ga0070710_11299477 3300005437 Bacteria 541
111 Ga0070701_10020918 3300005438 Bacteria 3114
112 Ga0070701_10344086 3300005438 Bacteria 930
113 Ga0070701_10439861 3300005438 Bacteria 835
114 Ga0070701_10522818 3300005438 Unclassified 774
115 Ga0070711_100158702 3300005439 Bacteria 1713
116 Ga0070711_100443721 3300005439 Bacteria 1061
117 Ga0070705_100035667 3300005440 Bacteria 2790
118 Ga0070705_100229769 3300005440 Bacteria 1290
119 Ga0070705_100404460 3300005440 Bacteria 1012
120 Ga0070705_101089668 3300005440 Bacteria 653
121 Ga0070700_100004634 3300005441 Bacteria 7201
122 Ga0070700_100048761 3300005441 Bacteria 2626
123 Ga0070700_100135031 3300005441 Bacteria 1670
124 Ga0070700_100549861 3300005441 Bacteria 897
125 Ga0070700_100630845 3300005441 Unclassified 844
126 Ga0070694_100088350 3300005444 Bacteria 2170
127 Ga0070694_100272585 3300005444 Bacteria 1287
128 Ga0070694_100822357 3300005444 Bacteria 763
129 Ga0070694_101050971 3300005444 Bacteria 678
130 Ga0070678_100224804 3300005456 Bacteria 1562
131 Ga0070678_100448341 3300005456 Bacteria 1130
132 Ga0070662_100144677 3300005457 Bacteria 1846
133 Ga0070662_100192480 3300005457 Bacteria 1614
134 Ga0070662_101044856 3300005457 Bacteria 700
135 Ga0070662_101194976 3300005457 Unclassified 654
136 Ga0070681_10117075 3300005458 Bacteria 2601
137 Ga0070681_10714916 3300005458 Bacteria 918
138 Ga0070681_11058823 3300005458 Bacteria 732
139 Ga0068867_100060799 3300005459 Bacteria 2803
140 Ga0068867_100263245 3300005459 Bacteria 1407
141 Ga0068867_100270725 3300005459 Bacteria 1389
142 Ga0068867_100295892 3300005459 Unclassified 1333
143 Ga0068867_100664462 3300005459 Bacteria 916
144 Ga0068867_100688773 3300005459 Bacteria 901
145 Ga0068867_100914018 3300005459 Bacteria 791
146 Ga0068867_102390562 3300005459 Bacteria 503
147 Ga0070685_10444545 3300005466 Bacteria 907
148 Ga0070685_11442817 3300005466 Bacteria 529
149 Ga0070707_101137489 3300005468 Bacteria 747
150 Ga0070707_101711150 3300005468 Bacteria 596
151 Ga0070698_100045156 3300005471 Bacteria 4510
152 Ga0070698_100091381 3300005471 Bacteria 3027
153 Ga0070698_101097546 3300005471 Bacteria 744
154 Ga0070698_101329659 3300005471 Bacteria 669
155 Ga0070699_100094598 3300005518 Bacteria 2616
156 Ga0070699_100457135 3300005518 Unclassified 1158
157 Ga0070699_100462546 3300005518 Bacteria 1151
158 Ga0070699_100505950 3300005518 Bacteria 1097
159 Ga0070699_101109393 3300005518 Bacteria 726
160 Ga0070679_100035626 3300005530 Bacteria 4938
161 Ga0070679_100243641 3300005530 Bacteria 1755
162 Ga0070684_100145242 3300005535 Bacteria 2147
163 Ga0070684_102327123 3300005535 Bacteria 505
164 Ga0070697_100218359 3300005536 Bacteria 1625
165 Ga0070697_100490202 3300005536 Unclassified 1074
166 Ga0070697_100956250 3300005536 Bacteria 761
167 Ga0070697_102084048 3300005536 Unclassified 508
168 Ga0068853_100382312 3300005539 Bacteria 1315
169 Ga0068853_100571975 3300005539 Bacteria 1072
170 Ga0070672_100018280 3300005543 Bacteria 5062
171 Ga0070672_100104949 3300005543 Bacteria 2297
172 Ga0070672_100150200 3300005543 Bacteria 1927
173 Ga0070672_100164691 3300005543 Bacteria 1841
174 Ga0070672_100182666 3300005543 Bacteria 1748
175 Ga0070672_100852132 3300005543 Bacteria 803
176 Ga0070672_101254393 3300005543 Bacteria 661
177 Ga0070686_100000438 3300005544 Bacteria 25888
178 Ga0070686_100179573 3300005544 Bacteria 1503
179 Ga0070686_100415199 3300005544 Bacteria 1027
180 Ga0070686_100620794 3300005544 Unclassified 854
181 Ga0070686_101000523 3300005544 Unclassified 686
182 Ga0070686_101000524 3300005544 Unclassified 686
183 Ga0070686_101700296 3300005544 Bacteria 535
184 Ga0070695_100000640 3300005545 Bacteria 18572
185 Ga0070695_100094932 3300005545 Bacteria 1998
186 Ga0070695_100200791 3300005545 Bacteria 1425
187 Ga0070695_100258562 3300005545 Bacteria 1270
188 Ga0070695_100876702 3300005545 Bacteria 723
189 Ga0070696_100012154 3300005546 Bacteria 5770
190 Ga0070696_100114310 3300005546 Unclassified 1947
191 Ga0070696_100342344 3300005546 Bacteria 1156
192 Ga0070693_100084801 3300005547 Bacteria 1897
193 Ga0070693_100334369 3300005547 Bacteria 1032
194 Ga0070665_100001991 3300005548 Bacteria 22972
195 Ga0070665_100003081 3300005548 Bacteria 17957
196 Ga0070665_100166618 3300005548 Bacteria 2205
197 Ga0070665_100441345 3300005548 Bacteria 1311
198 Ga0070704_100118653 3300005549 Bacteria 2027
199 Ga0070704_100840041 3300005549 Bacteria 823
200 Ga0068855_100040397 3300005563 Bacteria 5537
201 Ga0068855_100903627 3300005563 Bacteria 933
202 Ga0070664_100080681 3300005564 Bacteria 2803
203 Ga0070664_101193792 3300005564 Unclassified 718
204 Ga0068857_100746781 3300005577 Bacteria 932
205 Ga0068857_101235540 3300005577 Unclassified 724
206 Ga0068854_100008454 3300005578 Bacteria 6618
207 Ga0068854_100449648 3300005578 Unclassified 1076
208 Ga0068856_100339141 3300005614 Unclassified 1521
209 Ga0068856_102058173 3300005614 Unclassified 581
210 Ga0070702_100001407 3300005615 Bacteria 9827
211 Ga0070702_100281581 3300005615 Bacteria 1142
212 Ga0068852_100623592 3300005616 Bacteria 1084
213 Ga0068852_100793696 3300005616 Unclassified 961
214 Ga0068852_101868203 3300005616 Bacteria 623
215 Ga0068852_102516692 3300005616 Bacteria 535
216 Ga0068852_102553839 3300005616 Bacteria 531
217 Ga0068859_100082269 3300005617 Bacteria 3262
218 Ga0068859_100185341 3300005617 Bacteria 2165
219 Ga0068859_100375805 3300005617 Bacteria 1517
220 Ga0068859_100631495 3300005617 Bacteria 1163
221 Ga0068859_101136069 3300005617 Bacteria 860
222 Ga0068864_100080988 3300005618 Bacteria 2846
223 Ga0068864_100091453 3300005618 Bacteria 2684
224 Ga0068864_100742504 3300005618 Bacteria 961
225 Ga0068864_101358572 3300005618 Bacteria 712
226 Ga0068864_101914685 3300005618 Bacteria 599
227 Ga0068866_10010564 3300005718 Bacteria 3963
228 Ga0068866_10079614 3300005718 Bacteria 1756
229 Ga0068866_10170721 3300005718 Bacteria 1276
230 Ga0068866_10385273 3300005718 Bacteria 900
231 Ga0068866_10619678 3300005718 Unclassified 733
232 Ga0068861_100090535 3300005719 Bacteria 2413
233 Ga0068861_100129225 3300005719 Bacteria 2049
234 Ga0068861_100129403 3300005719 Bacteria 2047
235 Ga0068861_100296798 3300005719 Bacteria 1398
236 Ga0068861_100387525 3300005719 Bacteria 1236
237 Ga0068851_10133594 3300005834 Bacteria 1344
238 Ga0068851_10427781 3300005834 Unclassified 783
239 Ga0068851_10645932 3300005834 Unclassified 647
240 Ga0068870_10213196 3300005840 Bacteria 1177
241 Ga0068870_10378536 3300005840 Bacteria 916
242 Ga0068863_100510470 3300005841 Bacteria 1184
243 Ga0068863_101086074 3300005841 Unclassified 804
244 Ga0068863_101330352 3300005841 Bacteria 726
245 Ga0068858_100011466 3300005842 Bacteria 8365
246 Ga0068858_100048479 3300005842 Bacteria 3935
247 Ga0068858_100074514 3300005842 Bacteria 3151
248 Ga0068858_100090123 3300005842 Bacteria 2853
249 Ga0068858_100107960 3300005842 Bacteria 2598
250 Ga0068858_100110006 3300005842 Bacteria 2573
251 Ga0068858_100161673 3300005842 Bacteria 2108
252 Ga0068858_100215538 3300005842 Bacteria 1817
253 Ga0068858_100316492 3300005842 Bacteria 1491
254 Ga0068858_100677721 3300005842 Bacteria 1002
255 Ga0068858_101317633 3300005842 Bacteria 711
256 Ga0068858_101901977 3300005842 Bacteria 588
257 Ga0068860_100170384 3300005843 Bacteria 2103
258 Ga0068860_100171355 3300005843 Bacteria 2097
259 Ga0068860_100192591 3300005843 Bacteria 1973
260 Ga0068860_100227823 3300005843 Unclassified 1811
261 Ga0068860_100238445 3300005843 Bacteria 1769
262 Ga0068860_100281781 3300005843 Bacteria 1624
263 Ga0068860_100433953 3300005843 Unclassified 1304
264 Ga0068860_100540305 3300005843 Bacteria 1167
265 Ga0068860_100572876 3300005843 Bacteria 1133
266 Ga0068860_101775099 3300005843 Bacteria 639
267 Ga0068860_102182774 3300005843 Bacteria 575
268 Ga0068862_100056030 3300005844 Bacteria 3376
269 Ga0068862_100112153 3300005844 Bacteria 2395
270 Ga0068862_100165407 3300005844 Bacteria 1977
271 Ga0068862_100205029 3300005844 Bacteria 1779
272 Ga0068862_100230484 3300005844 Bacteria 1680
273 Ga0068862_100729792 3300005844 Unclassified 962
274 Ga0068862_101669285 3300005844 Unclassified 645
275 Ga0081455_10076279 3300005937 Bacteria 2762
276 Ga0081455_10111396 3300005937 Bacteria 2174
277 Ga0081455_10326435 3300005937 Bacteria 1091
278 Ga0081540_1069737 3300005983 Bacteria 1632
279 Ga0070717_10048729 3300006028 Bacteria 3476
280 Ga0070717_11212388 3300006028 Bacteria 687
281 Ga0070715_10073808 3300006163 Bacteria 1531
282 Ga0070716_100037217 3300006173 Bacteria 2688
283 Ga0070716_100446653 3300006173 Bacteria 941
284 Ga0070716_101150456 3300006173 Bacteria 621
285 Ga0070716_101304953 3300006173 Unclassified 587
286 Ga0097621_100004373 3300006237 Bacteria 9827
287 Ga0097621_100012075 3300006237 Bacteria 6392
288 Ga0097621_100048363 3300006237 Bacteria 3450
289 Ga0097621_100061657 3300006237 Bacteria 3076
290 Ga0097621_100136567 3300006237 Bacteria 2092
291 Ga0097621_100261658 3300006237 Unclassified 1518
292 Ga0097621_100417979 3300006237 Unclassified 1203
293 Ga0097621_100631029 3300006237 Bacteria 982
294 Ga0097621_100808976 3300006237 Unclassified 869
295 Ga0097621_101625200 3300006237 Unclassified 614
296 Ga0068871_100000309 3300006358 Bacteria 33960
297 Ga0068871_100032086 3300006358 Bacteria 4145
298 Ga0068871_100061183 3300006358 Bacteria 3074
299 Ga0068871_100108237 3300006358 Bacteria 2335
300 Ga0068871_100119594 3300006358 Bacteria 2224
301 Ga0068871_100201690 3300006358 Bacteria 1717
302 Ga0068871_100317624 3300006358 Bacteria 1371
303 Ga0068871_100525049 3300006358 Bacteria 1069
304 Ga0068871_100566523 3300006358 Bacteria 1030
305 Ga0068871_101422369 3300006358 Bacteria 654
306 Ga0068871_101756497 3300006358 Archaea 589
307 Ga0075428_100921207 3300006844 Unclassified 926
308 Ga0075428_101152454 3300006844 Bacteria 818
309 Ga0075428_101681425 3300006844 Unclassified 662
310 Ga0075433_10040318 3300006852 Bacteria 4042
311 Ga0075433_10066707 3300006852 Bacteria 3158
312 Ga0075433_10078604 3300006852 Bacteria 2907
313 Ga0075433_10094565 3300006852 Bacteria 2645
314 Ga0075433_10498927 3300006852 Bacteria 1071
315 Ga0075433_10942359 3300006852 Bacteria 753
316 Ga0075433_11755965 3300006852 Bacteria 534
317 Ga0075434_100001704 3300006871 Bacteria 18818
318 Ga0075434_100047802 3300006871 Bacteria 4245
319 Ga0075434_100127702 3300006871 Bacteria 2560
320 Ga0075434_100131318 3300006871 Unclassified 2524
321 Ga0075434_100201848 3300006871 Bacteria 2008
322 Ga0075434_100338041 3300006871 Bacteria 1526
323 Ga0075434_100377356 3300006871 Bacteria 1439
324 Ga0075434_100777777 3300006871 Bacteria 974
325 Ga0075429_100157569 3300006880 Bacteria 1988
326 Ga0075429_100269032 3300006880 Bacteria 1492
327 Ga0068865_100054768 3300006881 Bacteria 2773
328 Ga0068865_100589053 3300006881 Bacteria 938
329 Ga0068865_100719524 3300006881 Unclassified 855
330 Ga0068865_100868006 3300006881 Unclassified 783
331 Ga0075436_100005845 3300006914 Bacteria 8451
332 Ga0075436_100008656 3300006914 Bacteria 6956
333 Ga0075436_100027748 3300006914 Bacteria 3897
334 Ga0075436_100030552 3300006914 Bacteria 3708
335 Ga0075436_100376039 3300006914 Bacteria 1027
336 Ga0075436_100553315 3300006914 Unclassified 845
337 Ga0075436_100936068 3300006914 Bacteria 649
338 Ga0097620_100082269 3300006931 Bacteria 3262
339 Ga0097620_100185339 3300006931 Bacteria 2165
340 Ga0097620_100375798 3300006931 Bacteria 1517
341 Ga0097620_100631485 3300006931 Bacteria 1163
342 Ga0097620_101136152 3300006931 Bacteria 860
343 Ga0075435_100000911 3300007076 Bacteria 18610
344 Ga0075435_100001374 3300007076 Bacteria 15713
345 Ga0075435_100013307 3300007076 Bacteria 6115
346 Ga0075435_100056079 3300007076 Bacteria 3184
347 Ga0075435_100281975 3300007076 Bacteria 1418
348 Ga0075435_101163482 3300007076 Bacteria 675
349 Ga0075435_101231588 3300007076 Bacteria 655
350 Ga0099794_10123321 3300007265 Bacteria 1305
351 Ga0099794_10157109 3300007265 Bacteria 1156
352 Ga0099794_10625638 3300007265 Archaea 571
353 Ga0099795_10098176 3300007788 Bacteria 1145
354 Ga0099795_10268929 3300007788 Bacteria 740
355 Ga0105251_10316157 3300009011 Bacteria 709
356 Ga0105240_10935536 3300009093 Bacteria 930
357 Ga0105240_11121295 3300009093 Bacteria 836
358 Ga0105240_11387462 3300009093 Archaea 739
359 Ga0111539_10001119 3300009094 Bacteria 35455
360 Ga0111539_10023793 3300009094 Bacteria 7527
361 Ga0111539_10188307 3300009094 Unclassified 2409
362 Ga0111539_10333096 3300009094 Bacteria 1767
363 Ga0111539_10507772 3300009094 Unclassified 1404
364 Ga0111539_12092698 3300009094 Bacteria 657
365 Ga0111539_12789225 3300009094 Unclassified 566
366 Ga0105245_10107633 3300009098 Bacteria 2588
367 Ga0105245_10211329 3300009098 Unclassified 1867
368 Ga0105245_10254755 3300009098 Bacteria 1706
369 Ga0105245_10534124 3300009098 Bacteria 1193
370 Ga0105245_10575990 3300009098 Bacteria 1150
371 Ga0105245_11157318 3300009098 Bacteria 821
372 Ga0105245_12853641 3300009098 Bacteria 536
373 Ga0105247_10047760 3300009101 Unclassified 2629
374 Ga0105247_10142650 3300009101 Bacteria 1571
375 Ga0105247_10203235 3300009101 Unclassified 1332
376 Ga0105247_10269984 3300009101 Bacteria 1170
377 Ga0105247_10366827 3300009101 Bacteria 1017
378 Ga0105247_10466700 3300009101 Bacteria 913
379 Ga0114129_10000997 3300009147 Bacteria 36967
380 Ga0114129_10007386 3300009147 Bacteria 15642
381 Ga0114129_10010826 3300009147 Bacteria 12996
382 Ga0114129_10018177 3300009147 Bacteria 10009
383 Ga0114129_10042294 3300009147 Bacteria 6416
384 Ga0114129_10046338 3300009147 Bacteria 6110
385 Ga0114129_10631097 3300009147 Bacteria 1385
386 Ga0114129_11669690 3300009147 Bacteria 778
387 Ga0105243_10097038 3300009148 Bacteria 2439
388 Ga0105243_10372934 3300009148 Bacteria 1317
389 Ga0105243_10457102 3300009148 Bacteria 1200
390 Ga0105243_11744977 3300009148 Bacteria 652
391 Ga0105241_10058600 3300009174 Bacteria 2958
392 Ga0105241_11001518 3300009174 Unclassified 782
393 Ga0105241_11021313 3300009174 Unclassified 775
394 Ga0105241_12047405 3300009174 Unclassified 564
395 Ga0105241_12144858 3300009174 Unclassified 553
396 Ga0105242_10001515 3300009176 Bacteria 18256
397 Ga0105242_10042859 3300009176 Bacteria 3657
398 Ga0105242_10681950 3300009176 Unclassified 1003
399 Ga0105242_11190939 3300009176 Bacteria 781
400 Ga0105242_12064152 3300009176 Unclassified 613
401 Ga0105242_12112595 3300009176 Bacteria 607
402 Ga0105242_12846389 3300009176 Unclassified 534
403 Ga0105248_10063569 3300009177 Bacteria 4143
404 Ga0105248_10169061 3300009177 Bacteria 2464
405 Ga0105248_10258294 3300009177 Bacteria 1961
406 Ga0105248_10345404 3300009177 Bacteria 1675
407 Ga0105248_10739565 3300009177 Bacteria 1110
408 Ga0105248_10756066 3300009177 Unclassified 1097
409 Ga0105248_11475166 3300009177 Bacteria 770
410 Ga0105248_11719719 3300009177 Bacteria 711
411 Ga0105237_11079206 3300009545 Unclassified 810
412 Ga0105238_10540365 3300009551 Bacteria 1169
413 Ga0105238_10689825 3300009551 Bacteria 1033
414 Ga0105249_10356635 3300009553 Bacteria 1483
415 Ga0105249_10387650 3300009553 Bacteria 1425
416 Ga0105249_10682646 3300009553 Bacteria 1086
417 Ga0105249_10998532 3300009553 Bacteria 906
418 Ga0105249_11106378 3300009553 Bacteria 862
419 Ga0105249_11966976 3300009553 Unclassified 657
420 Ga0105249_12974212 3300009553 Unclassified 544
421 Ga0099796_10136619 3300010159 Bacteria 955
422 Ga0105239_11389389 3300010375 Unclassified 810
423 Ga0105239_11841298 3300010375 Bacteria 701
424 Ga0105239_12969542 3300010375 Unclassified 553
425 Ga0105246_10289922 3300011119 Bacteria 1316
426 Ga0105246_10381813 3300011119 Bacteria 1164
427 Ga0105246_10623360 3300011119 Bacteria 935
428 Ga0157324_1014110 3300012506 Bacteria 731
429 Ga0157315_1029595 3300012508 Bacteria 634
430 Ga0157370_10073957 3300013104 Bacteria 3215
431 Ga0157370_11170424 3300013104 Bacteria 694
432 Ga0157374_10019997 3300013296 Bacteria 5935
433 Ga0157374_10157407 3300013296 Bacteria 2212
434 Ga0157374_10209043 3300013296 Bacteria 1913
435 Ga0157374_10467346 3300013296 Bacteria 1264
436 Ga0157378_10031942 3300013297 Bacteria 4650
437 Ga0157378_10089055 3300013297 Bacteria 2802
438 Ga0157378_10151473 3300013297 Bacteria 2161
439 Ga0157378_10823089 3300013297 Bacteria 955
440 Ga0157378_11794420 3300013297 Bacteria 661
441 Ga0157378_12807620 3300013297 Bacteria 539
442 Ga0163162_10703375 3300013306 Bacteria 1132
443 Ga0163162_10734634 3300013306 Bacteria 1107
444 Ga0163162_11106447 3300013306 Unclassified 898
445 Ga0163162_11756817 3300013306 Bacteria 709
446 Ga0163162_12477755 3300013306 Unclassified 597
447 Ga0157372_11281980 3300013307 Bacteria 846
448 Ga0157375_10113069 3300013308 Bacteria 2816
449 Ga0157375_10246137 3300013308 Bacteria 1948
450 Ga0157375_10305212 3300013308 Bacteria 1756
451 Ga0157375_10308417 3300013308 Bacteria 1747
452 Ga0157375_10312157 3300013308 Bacteria 1737
453 Ga0157375_11303280 3300013308 Bacteria 854
454 Ga0157375_11799916 3300013308 Bacteria 726
455 Ga0157375_12193575 3300013308 Bacteria 658
456 Ga0157375_12753954 3300013308 Bacteria 588
457 Ga0163163_10094081 3300014325 Bacteria 3014
458 Ga0163163_10152529 3300014325 Bacteria 2354
459 Ga0163163_10186927 3300014325 Bacteria 2119
460 Ga0163163_10536616 3300014325 Bacteria 1232
461 Ga0163163_10854080 3300014325 Bacteria 974
462 Ga0163163_11379865 3300014325 Bacteria 766
463 Ga0163163_11973131 3300014325 Bacteria 643
464 Ga0157380_10036836 3300014326 Bacteria 3788
465 Ga0157380_10114556 3300014326 Bacteria 2272
466 Ga0157380_10302169 3300014326 Unclassified 1475
467 Ga0157380_10376823 3300014326 Bacteria 1338
468 Ga0157380_10569941 3300014326 Bacteria 1114
469 Ga0157380_11537468 3300014326 Unclassified 719
470 Ga0157380_12211231 3300014326 Unclassified 614
471 Ga0157377_10123435 3300014745 Bacteria 1572
472 Ga0157377_10318713 3300014745 Bacteria 1032
473 Ga0157377_10344025 3300014745 Unclassified 998
474 Ga0157377_10454000 3300014745 Bacteria 885
475 Ga0157379_10011179 3300014968 Bacteria 7824
476 Ga0157379_10015545 3300014968 Bacteria 6681
477 Ga0157379_10027405 3300014968 Bacteria 5073
478 Ga0157379_10295721 3300014968 Bacteria 1475
479 Ga0157379_10534830 3300014968 Unclassified 1089
480 Ga0157379_10804514 3300014968 Bacteria 887
481 Ga0157379_10907699 3300014968 Bacteria 836
482 Ga0157379_10958906 3300014968 Bacteria 814
483 Ga0157379_11293719 3300014968 Bacteria 704
484 Ga0157376_10073450 3300014969 Bacteria 2913
485 Ga0157376_10095058 3300014969 Bacteria 2591
486 Ga0157376_10161236 3300014969 Bacteria 2033
487 Ga0157376_10294275 3300014969 Unclassified 1534
488 Ga0157376_10599049 3300014969 Unclassified 1097
489 Ga0157376_10669374 3300014969 Bacteria 1040
490 Ga0157376_10819405 3300014969 Bacteria 944
491 Ga0157376_11015402 3300014969 Bacteria 852
492 Ga0157376_12274710 3300014969 Bacteria 581
493 Ga0163161_10100993 3300017792 Bacteria 2147
494 Ga0163161_10389659 3300017792 Bacteria 1115
495 Ga0163161_10493084 3300017792 Unclassified 996
496 Ga0163161_10502375 3300017792 Bacteria 988
497 Ga0163161_10530538 3300017792 Bacteria 962
498 Ga0163161_11818229 3300017792 Unclassified 542
499 Ga0207697_10016040 3300025315 Bacteria 3090
500 Ga0207697_10234080 3300025315 Bacteria 811
501 Ga0207656_10195697 3300025321 Bacteria 975
502 Ga0207656_10493552 3300025321 Archaea 621
503 Ga0207656_10556299 3300025321 Bacteria 584
504 Ga0207682_10126131 3300025893 Bacteria 1139
505 Ga0207682_10327032 3300025893 Bacteria 720
506 Ga0207682_10419719 3300025893 Unclassified 633
507 Ga0207642_10225771 3300025899 Bacteria 1049
508 Ga0207642_10555422 3300025899 Bacteria 710
509 Ga0207642_10644423 3300025899 Bacteria 663
510 Ga0207710_10019224 3300025900 Bacteria 2914
511 Ga0207710_10144264 3300025900 Bacteria 1151
512 Ga0207710_10155432 3300025900 Bacteria 1112
513 Ga0207710_10293139 3300025900 Bacteria 821
514 Ga0207710_10512330 3300025900 Bacteria 623
515 Ga0207688_10139972 3300025901 Bacteria 1424
516 Ga0207688_10144892 3300025901 Bacteria 1400
517 Ga0207680_10034286 3300025903 Bacteria 2903
518 Ga0207680_10060165 3300025903 Unclassified 2311
519 Ga0207680_10143728 3300025903 Bacteria 1584
520 Ga0207680_10213620 3300025903 Bacteria 1320
521 Ga0207680_10423384 3300025903 Unclassified 943
522 Ga0207680_10650495 3300025903 Bacteria 755
523 Ga0207680_10704746 3300025903 Unclassified 723
524 Ga0207685_10038372 3300025905 Bacteria 1770
525 Ga0207685_10049987 3300025905 Bacteria 1608
526 Ga0207685_10279971 3300025905 Unclassified 818
527 Ga0207685_10433918 3300025905 Bacteria 680
528 Ga0207685_10769920 3300025905 Bacteria 528
529 Ga0207685_10795547 3300025905 Unclassified 521
530 Ga0207699_11234115 3300025906 Bacteria 553
531 Ga0207645_10011108 3300025907 Bacteria 6160
532 Ga0207645_10030127 3300025907 Bacteria 3496
533 Ga0207645_10347069 3300025907 Bacteria 993
534 Ga0207645_10650882 3300025907 Bacteria 716
535 Ga0207643_10061700 3300025908 Bacteria 2141
536 Ga0207643_10412155 3300025908 Unclassified 856
537 Ga0207705_10210281 3300025909 Bacteria 1476
538 Ga0207705_10795818 3300025909 Bacteria 734
539 Ga0207684_10568016 3300025910 Bacteria 970
540 Ga0207684_11729664 3300025910 Bacteria 503
541 Ga0207654_10041969 3300025911 Bacteria 2586
542 Ga0207707_10393843 3300025912 Bacteria 1190
543 Ga0207707_10526000 3300025912 Bacteria 1007
544 Ga0207707_10888488 3300025912 Unclassified 737
545 Ga0207695_10863683 3300025913 Bacteria 785
546 Ga0207695_11208182 3300025913 Bacteria 636
547 Ga0207663_10036104 3300025916 Bacteria 2971
548 Ga0207663_10335139 3300025916 Bacteria 1141
549 Ga0207660_10023392 3300025917 Bacteria 4173
550 Ga0207660_10264842 3300025917 Bacteria 1360
551 Ga0207660_11166852 3300025917 Unclassified 627
552 Ga0207660_11295021 3300025917 Bacteria 592
553 Ga0207662_10078047 3300025918 Bacteria 2015
554 Ga0207662_10214175 3300025918 Bacteria 1252
555 Ga0207657_10007831 3300025919 Bacteria 10903
556 Ga0207657_11192089 3300025919 Bacteria 579
557 Ga0207649_10091573 3300025920 Bacteria 1992
558 Ga0207649_10575341 3300025920 Bacteria 864
559 Ga0207652_10192850 3300025921 Unclassified 1832
560 Ga0207652_10244526 3300025921 Bacteria 1618
561 Ga0207652_10623351 3300025921 Bacteria 966
562 Ga0207646_10551319 3300025922 Unclassified 1036
563 Ga0207646_11038937 3300025922 Bacteria 723
564 Ga0207646_11041680 3300025922 Bacteria 722
565 Ga0207646_11520912 3300025922 Bacteria 579
566 Ga0207681_10046132 3300025923 Bacteria 2930
567 Ga0207681_10080744 3300025923 Bacteria 2294
568 Ga0207681_10273676 3300025923 Bacteria 1327
569 Ga0207681_10441389 3300025923 Bacteria 1057
570 Ga0207681_10641579 3300025923 Bacteria 880
571 Ga0207681_10685533 3300025923 Unclassified 851
572 Ga0207681_10716014 3300025923 Bacteria 833
573 Ga0207681_11170096 3300025923 Bacteria 646
574 Ga0207694_10356930 3300025924 Bacteria 1211
575 Ga0207650_11697676 3300025925 Bacteria 535
576 Ga0207659_10000072 3300025926 Bacteria 64525
577 Ga0207659_10055763 3300025926 Bacteria 2828
578 Ga0207659_10409452 3300025926 Bacteria 1136
579 Ga0207659_10917017 3300025926 Bacteria 753
580 Ga0207687_10009098 3300025927 Bacteria 6495
581 Ga0207687_10067308 3300025927 Bacteria 2548
582 Ga0207687_10248731 3300025927 Unclassified 1412
583 Ga0207687_10317586 3300025927 Bacteria 1260
584 Ga0207687_10349423 3300025927 Bacteria 1204
585 Ga0207687_10493315 3300025927 Bacteria 1021
586 Ga0207700_10003434 3300025928 Bacteria 9209
587 Ga0207700_10145831 3300025928 Bacteria 1951
588 Ga0207700_10906430 3300025928 Bacteria 789
589 Ga0207644_10081885 3300025931 Bacteria 2386
590 Ga0207644_10460184 3300025931 Bacteria 1046
591 Ga0207644_10488042 3300025931 Bacteria 1015
592 Ga0207690_10119998 3300025932 Bacteria 1908
593 Ga0207690_10171404 3300025932 Unclassified 1626
594 Ga0207690_10356087 3300025932 Bacteria 1158
595 Ga0207690_10468672 3300025932 Bacteria 1015
596 Ga0207706_10094855 3300025933 Bacteria 2625
597 Ga0207706_10411699 3300025933 Bacteria 1172
598 Ga0207706_10611205 3300025933 Unclassified 936
599 Ga0207706_10632974 3300025933 Bacteria 917
600 Ga0207706_11553418 3300025933 Bacteria 538
601 Ga0207686_10041899 3300025934 Bacteria 2795
602 Ga0207686_10117886 3300025934 Bacteria 1802
603 Ga0207686_10282832 3300025934 Bacteria 1225
604 Ga0207709_10234583 3300025935 Bacteria 1331
605 Ga0207709_10464931 3300025935 Bacteria 980
606 Ga0207709_11656290 3300025935 Bacteria 532
607 Ga0207709_11751428 3300025935 Bacteria 517
608 Ga0207670_10011567 3300025936 Bacteria 5129
609 Ga0207670_10097455 3300025936 Bacteria 2093
610 Ga0207670_10530775 3300025936 Bacteria 959
611 Ga0207670_10627063 3300025936 Unclassified 885
612 Ga0207670_10674557 3300025936 Bacteria 854
613 Ga0207670_11266824 3300025936 Unclassified 625
614 Ga0207669_10076627 3300025937 Bacteria 2123
615 Ga0207669_10215935 3300025937 Bacteria 1404
616 Ga0207669_10357324 3300025937 Bacteria 1131
617 Ga0207669_10706587 3300025937 Unclassified 829
618 Ga0207669_11064850 3300025937 Unclassified 681
619 Ga0207669_11601833 3300025937 Bacteria 556
620 Ga0207704_10047165 3300025938 Bacteria 2573
621 Ga0207704_10048179 3300025938 Bacteria 2553
622 Ga0207704_10099823 3300025938 Bacteria 1932
623 Ga0207704_10185798 3300025938 Bacteria 1507
624 Ga0207704_10664956 3300025938 Bacteria 859
625 Ga0207704_10743945 3300025938 Bacteria 815
626 Ga0207665_10106451 3300025939 Bacteria 1965
627 Ga0207665_10294494 3300025939 Unclassified 1211
628 Ga0207665_10324517 3300025939 Bacteria 1156
629 Ga0207665_10805112 3300025939 Bacteria 743
630 Ga0207691_10027750 3300025940 Bacteria 5306
631 Ga0207691_10036456 3300025940 Bacteria 4557
632 Ga0207691_10094654 3300025940 Bacteria 2672
633 Ga0207691_10160903 3300025940 Bacteria 1970
634 Ga0207691_10168968 3300025940 Bacteria 1915
635 Ga0207691_10514192 3300025940 Bacteria 1016
636 Ga0207691_10820001 3300025940 Bacteria 781
637 Ga0207691_11255741 3300025940 Bacteria 613
638 Ga0207711_10008385 3300025941 Bacteria 8647
639 Ga0207711_10024991 3300025941 Bacteria 5011
640 Ga0207711_10071051 3300025941 Bacteria 3020
641 Ga0207711_10277044 3300025941 Bacteria 1544
642 Ga0207711_10498579 3300025941 Bacteria 1135
643 Ga0207711_10654892 3300025941 Unclassified 980
644 Ga0207711_10953753 3300025941 Bacteria 797
645 Ga0207711_11244733 3300025941 Bacteria 686
646 Ga0207689_10079882 3300025942 Bacteria 2688
647 Ga0207689_10137682 3300025942 Bacteria 2010
648 Ga0207689_10157181 3300025942 Bacteria 1874
649 Ga0207689_10446261 3300025942 Bacteria 1081
650 Ga0207689_10459871 3300025942 Bacteria 1064
651 Ga0207689_10582593 3300025942 Bacteria 941
652 Ga0207689_10894218 3300025942 Unclassified 749
653 Ga0207661_10089035 3300025944 Bacteria 2567
654 Ga0207661_10965810 3300025944 Unclassified 785
655 Ga0207661_11795626 3300025944 Bacteria 559
656 Ga0207679_10108137 3300025945 Bacteria 2189
657 Ga0207679_10567069 3300025945 Bacteria 1020
658 Ga0207679_11083787 3300025945 Bacteria 735
659 Ga0207679_11945817 3300025945 Bacteria 536
660 Ga0207651_10063928 3300025960 Bacteria 2573
661 Ga0207651_10070442 3300025960 Bacteria 2474
662 Ga0207651_10154198 3300025960 Bacteria 1792
663 Ga0207651_10247180 3300025960 Bacteria 1457
664 Ga0207651_10935455 3300025960 Bacteria 773
665 Ga0207651_10941880 3300025960 Unclassified 770
666 Ga0207712_10315627 3300025961 Bacteria 1288
667 Ga0207712_10380179 3300025961 Bacteria 1182
668 Ga0207712_10747078 3300025961 Bacteria 857
669 Ga0207712_10951450 3300025961 Unclassified 761
670 Ga0207668_10047267 3300025972 Bacteria 2946
671 Ga0207668_10110631 3300025972 Bacteria 2060
672 Ga0207640_10067645 3300025981 Bacteria 2391
673 Ga0207640_10283257 3300025981 Bacteria 1303
674 Ga0207640_10285790 3300025981 Bacteria 1298
675 Ga0207658_10054499 3300025986 Bacteria 2959
676 Ga0207658_10375258 3300025986 Bacteria 1244
677 Ga0207677_10088428 3300026023 Bacteria 2246
678 Ga0207677_10109757 3300026023 Bacteria 2052
679 Ga0207677_10182354 3300026023 Bacteria 1652
680 Ga0207677_10398381 3300026023 Bacteria 1167
681 Ga0207677_10425275 3300026023 Bacteria 1132
682 Ga0207677_10471038 3300026023 Bacteria 1080
683 Ga0207677_11215317 3300026023 Unclassified 690
684 Ga0207677_11645178 3300026023 Bacteria 595
685 Ga0207703_10008225 3300026035 Bacteria 8243
686 Ga0207703_10058167 3300026035 Bacteria 3154
687 Ga0207703_10080469 3300026035 Bacteria 2713
688 Ga0207703_10124942 3300026035 Bacteria 2214
689 Ga0207703_10249072 3300026035 Bacteria 1600
690 Ga0207703_10321622 3300026035 Bacteria 1417
691 Ga0207703_10444585 3300026035 Bacteria 1210
692 Ga0207703_11322296 3300026035 Bacteria 693
693 Ga0207703_11673781 3300026035 Bacteria 612
694 Ga0207703_11942156 3300026035 Bacteria 565
695 Ga0207639_10749230 3300026041 Bacteria 908
696 Ga0207708_10009239 3300026075 Bacteria 7298
697 Ga0207708_10026867 3300026075 Bacteria 4357
698 Ga0207708_10054229 3300026075 Bacteria 3056
699 Ga0207708_10369408 3300026075 Bacteria 1181
700 Ga0207708_10897707 3300026075 Bacteria 767
701 Ga0207702_10826174 3300026078 Unclassified 917
702 Ga0207641_10756502 3300026088 Bacteria 959
703 Ga0207641_10955912 3300026088 Unclassified 852
704 Ga0207648_10050261 3300026089 Bacteria 3646
705 Ga0207648_10073340 3300026089 Bacteria 2983
706 Ga0207648_10205744 3300026089 Bacteria 1747
707 Ga0207648_10299622 3300026089 Bacteria 1441
708 Ga0207648_10317199 3300026089 Bacteria 1400
709 Ga0207648_10376404 3300026089 Bacteria 1283
710 Ga0207648_10566168 3300026089 Bacteria 1045
711 Ga0207676_10105923 3300026095 Bacteria 2342
712 Ga0207676_10289644 3300026095 Bacteria 1490
713 Ga0207676_10929095 3300026095 Bacteria 854
714 Ga0207676_12090749 3300026095 Unclassified 565
715 Ga0207674_10688973 3300026116 Unclassified 987
716 Ga0207675_100002502 3300026118 Bacteria 18179
717 Ga0207675_100052252 3300026118 Bacteria 3813
718 Ga0207675_100126025 3300026118 Bacteria 2425
719 Ga0207675_100160796 3300026118 Bacteria 2142
720 Ga0207675_100176579 3300026118 Bacteria 2044
721 Ga0207675_100359154 3300026118 Bacteria 1429
722 Ga0207675_100581398 3300026118 Bacteria 1121
723 Ga0207675_100711343 3300026118 Bacteria 1014
724 Ga0207675_100822501 3300026118 Unclassified 943
725 Ga0207675_101074087 3300026118 Unclassified 824
726 Ga0207683_10086211 3300026121 Bacteria 2792
727 Ga0207683_10563352 3300026121 Bacteria 1054
728 Ga0207683_11064094 3300026121 Bacteria 751
729 Ga0207698_10139053 3300026142 Bacteria 2089
730 Ga0207698_10916983 3300026142 Bacteria 884
731 Ga0207698_10945499 3300026142 Unclassified 871
732 Ga0207698_11039490 3300026142 Unclassified 831
733 Ga0207698_12153439 3300026142 Bacteria 571
734 Ga0207698_12370243 3300026142 Bacteria 542
735 Ga0209998_10014387 3300027717 Bacteria 1651
736 Ga0207428_10010977 3300027907 Bacteria 8055
737 Ga0207428_10028520 3300027907 Bacteria 4636
738 Ga0207428_10100679 3300027907 Bacteria 2233
739 Ga0207428_10462738 3300027907 Unclassified 924
740 Ga0268266_10011058 3300028379 Bacteria 7858
741 Ga0268266_10034103 3300028379 Bacteria 4327
742 Ga0268266_10124591 3300028379 Bacteria 2297
743 Ga0268265_10015631 3300028380 Bacteria 5197
744 Ga0268265_10018528 3300028380 Bacteria 4826
745 Ga0268265_10097260 3300028380 Bacteria 2368
746 Ga0268265_10104516 3300028380 Bacteria 2296
747 Ga0268265_10219188 3300028380 Unclassified 1663
748 Ga0268265_10863086 3300028380 Unclassified 886
749 Ga0268265_10993501 3300028380 Bacteria 829
750 Ga0268265_11568626 3300028380 Unclassified 663
751 Ga0268264_10035635 3300028381 Bacteria 4096
752 Ga0268264_10051010 3300028381 Bacteria 3447
753 Ga0268264_10102969 3300028381 Unclassified 2485
754 Ga0268264_10180716 3300028381 Bacteria 1916
755 Ga0268264_10225196 3300028381 Bacteria 1729
756 Ga0268264_10389812 3300028381 Bacteria 1336
757 Ga0268264_10474019 3300028381 Bacteria 1216
758 Ga0268264_10637707 3300028381 Bacteria 1053
759 Ga0268264_10702675 3300028381 Bacteria 1004
760 Ga0268264_11994121 3300028381 Unclassified 590
761 Ga0268264_12114387 3300028381 Unclassified 571
762 Ga0265318_10071255 3300028577 Bacteria 1288
763 Ga0307517_10373570 3300028786 Unclassified 765
764 Ga0265332_10024452 3300031238 Bacteria 2658
765 Ga0307513_10365269 3300031456 Bacteria 1187
766 Ga0307408_100907340 3300031548 Unclassified 807
767 Ga0307405_11634265 3300031731 Unclassified 569
768 Ga0307412_11061059 3300031911 Unclassified 719
769 Ga0307416_103223965 3300032002 Unclassified 546
770 Ga0307411_10942950 3300032005 Bacteria 769
771 Ga0373930_0003342 3300034816 Bacteria 2537
772 Ga0373948_0001613 3300034817 Bacteria 3175
773 Ga0373948_0030444 3300034817 Unclassified 1085
774 Ga0373950_0002273 3300034818 Bacteria 2629
775 Ga0373950_0050115 3300034818 Bacteria 819
776 Ga0373950_0078960 3300034818 Unclassified 685
777 Ga0373959_0001811 3300034820 Bacteria 3409
778 Ga0373938_0001023 3300034957 Bacteria 4499
779 Ga0373929_0002353 3300035085 Bacteria 3475
780 Ga0373934_0093330 3300035086 Bacteria 1214
781 Ga0373934_0273235 3300035086 Unclassified 700
782 Ga0373940_0003660 3300035088 Bacteria 3162
783 Ga0373944_0013677 3300035089 Bacteria 2256
784 Ga0373949_0001604 3300035090 Bacteria 6370
785 Ga0373951_0001636 3300035091 Bacteria 5873
786 Ga0373952_0001201 3300035092 Bacteria 4719
787 Ga0373923_0190345 3300035111 Unclassified 945
788 Ga0373923_0291579 3300035111 Archaea 771
789 Ga0373932_0001001 3300035112 Bacteria 8175
790 Ga0373932_0249850 3300035112 Unclassified 647
791 Ga0373932_0264196 3300035112 Bacteria 632
792 Ga0373936_0037543 3300035113 Bacteria 1935
793 Ga0373936_0637653 3300035113 Unclassified 502
794 Ga0373939_0000747 3300035114 Bacteria 8008
795 Ga0373941_0001198 3300035115 Bacteria 5418
796 Ga0373945_0382579 3300035116 Unclassified 615
797 Ga0373953_0317651 3300035117 Bacteria 681
798 Ga0373954_0306306 3300035118 Bacteria 784
799 Ga0373956_0132932 3300035119 Bacteria 1166
800 Ga0373956_0259975 3300035119 Unclassified 825
801 Ga0373956_0324545 3300035119 Unclassified 734
802 Ga0373960_0008376 3300035121 Bacteria 2476
803 Ga0373943_0076339 3300035170 Bacteria 1709
804 Ga0373943_0186733 3300035170 Unclassified 1142
805 Ga0373943_0532031 3300035170 Archaea 689
806 Ga0373955_0058623 3300035172 Bacteria 2119
807 Ga0373955_0155408 3300035172 Bacteria 1348
808 Ga0373955_0232175 3300035172 Bacteria 1104
809 Ga0373942_0004032 3300035207 Bacteria 3428
810 Ga0373961_0001136 3300035241 Bacteria 8359
811 Ga0373962_0000651 3300035242 Bacteria 7891
812 Ga0373924_0022675 3300035410 Bacteria 2455
813 Ga0373924_0027617 3300035410 Bacteria 2258
814 Ga0373924_0101121 3300035410 Unclassified 1240
815 Ga0373931_0009113 3300035691 Bacteria 4735
816 Ga0373931_0874451 3300035691 Bacteria 603
817 Ga0373931_0922360 3300035691 Bacteria 588
818 Ga0373935_0445927 3300035692 Bacteria 934
819 Ga0373933_0599284 3300035724 Unclassified 723
820 Ga0373947_0045551 3300035725 Bacteria 2625
821 Ga0373947_0139903 3300035725 Bacteria 1552
822 Ga0373947_0311834 3300035725 Bacteria 1051
823 Ga0373947_0806596 3300035725 Unclassified 641
824 Ga0373937_0124685 3300036401 Bacteria 2402
825 Ga0373937_0144311 3300036401 Bacteria 2228
826 Ga0373937_0364800 3300036401 Bacteria 1369
827 Ga0373937_0537059 3300036401 Bacteria 1111
828 Ga0373937_0626062 3300036401 Bacteria 1021
829 Ga0373925_0008010 3300037068 Bacteria 7695
830 Ga0373925_0093282 3300037068 Bacteria 2304
831 Ga0395898_0675886 3300037466 Bacteria 975
832 Ga0436365_1418626 3300039437 Bacteria 757
833 Ga0436365_1707679 3300039437 Bacteria 613
834 Ga0436363_0863700 3300039450 Bacteria 751
835 Ga0439439_0033587 3300041406 Bacteria 1314
836 Ga0451807_0661252 3300041486 Unclassified 1363
837 Ga0451807_1235903 3300041486 Bacteria 628
838 Ga0451807_1277086 3300041486 Bacteria 586
839 Ga0451839_1388944 3300041496 Bacteria 576
840 Ga0451853_0628758 3300041512 Unclassified 662
841 Ga0439441_072835 3300042001 Bacteria 739
842 Ga0450917_026935 3300042120 Bacteria 536
843 Ga0450894_022590 3300042131 Bacteria 853
844 Ga0450896_008585 3300042133 Bacteria 1420
845 Ga0450916_004966 3300042530 Unclassified 1521
846 Ga0466963_0299266 3300044694 Bacteria 1131
847 Ga0466957_0738048 3300044842 Bacteria 697
848 Ga0466960_0615625 3300044901 Bacteria 646
849 Ga0451576_0009854 3300045051 Bacteria 11040
850 Ga0451576_0265115 3300045051 Bacteria 1796
851 Ga0451576_1533002 3300045051 Unclassified 692
852 Ga0466967_0330676 3300045976 Bacteria 1472
853 Ga0495592_0043582 3300046454 Unclassified 3356
854 Ga0495603_0314848 3300046455 Bacteria 899
855 Ga0495603_0677610 3300046455 Unclassified 590
856 Ga0495590_0154335 3300046457 Unclassified 833
857 Ga0495629_0112720 3300046459 Bacteria 1896
858 Ga0495629_0237693 3300046459 Bacteria 1255
859 Ga0495651_0675003 3300046462 Archaea 646
860 Ga0495653_0347897 3300046463 Bacteria 954
861 Ga0495580_0094881 3300046472 Bacteria 2075
862 Ga0495580_0398917 3300046472 Bacteria 928
863 Ga0495580_0478978 3300046472 Unclassified 833
864 Ga0495580_0790056 3300046472 Unclassified 616
865 Ga0495582_0236623 3300046473 Unclassified 1046
866 Ga0495582_0720765 3300046473 Bacteria 577
867 Ga0495594_0833360 3300046499 Unclassified 519
868 Ga0495618_0421274 3300046514 Archaea 814
869 Ga0495628_0162789 3300046516 Bacteria 1695
870 Ga0495628_0642912 3300046516 Bacteria 754
871 Ga0495630_0852549 3300046517 Unclassified 695
872 Ga0495630_1147213 3300046517 Unclassified 588
873 Ga0495652_0183350 3300046529 Unclassified 1604
874 Ga0495665_0152758 3300046531 Bacteria 1205
875 Ga0495640_0680288 3300046533 Bacteria 618
876 Ga0495586_0091873 3300046535 Bacteria 1678
877 Ga0495586_0584114 3300046535 Unclassified 645
878 Ga0495587_0197669 3300046536 Bacteria 1138
879 Ga0495587_0502414 3300046536 Unclassified 670
880 Ga0495621_0185661 3300046539 Bacteria 832
881 Ga0495621_0346009 3300046539 Bacteria 623
882 Ga0495645_0004640 3300046543 Bacteria 9377
883 Ga0495645_0148883 3300046543 Bacteria 1628
884 Ga0495633_0322818 3300046558 Bacteria 701
885 Ga0495667_0802577 3300046559 Bacteria 580
886 Ga0495656_0207839 3300046615 Bacteria 974
887 Ga0495656_0492450 3300046615 Unclassified 649
888 Ga0495668_0185133 3300046616 Unclassified 1141
889 Ga0495634_0065643 3300046642 Bacteria 2405
890 Ga0495634_0403075 3300046642 Unclassified 812
891 Ga0495634_0498394 3300046642 Bacteria 714
892 Ga0495635_0139161 3300046663 Bacteria 1653
893 Ga0495635_0269770 3300046663 Bacteria 1145
894 Ga0495635_0546251 3300046663 Bacteria 760
895 Ga0495588_0510070 3300046674 Unclassified 630
896 Ga0495599_0522613 3300046678 Unclassified 697
897 Ga0495623_0105471 3300046679 Bacteria 1713
898 Ga0495623_0425546 3300046679 Bacteria 711
899 Ga0495647_0069805 3300046681 Bacteria 1404
900 Ga0495647_0086452 3300046681 Bacteria 1279
901 Ga0495647_0096514 3300046681 Bacteria 1219
902 Ga0495647_0191734 3300046681 Unclassified 893
903 Ga0495647_0454527 3300046681 Bacteria 593
904 Ga0495658_0011794 3300046683 Bacteria 4407
905 Ga0495658_0024130 3300046683 Bacteria 3236
906 Ga0495658_0221124 3300046683 Bacteria 1185
907 Ga0495658_0562105 3300046683 Unclassified 730
908 Ga0495669_0208683 3300046684 Unclassified 935
909 Ga0495669_0242280 3300046684 Bacteria 865
910 Ga0495669_0486306 3300046684 Bacteria 600
911 Ga0495613_0000477 3300046689 Bacteria 34167
912 Ga0495613_0287410 3300046689 Unclassified 1141
913 Ga0495670_0485099 3300046691 Unclassified 671
914 Ga0495671_0188649 3300046692 Bacteria 1001
915 Ga0495649_0596856 3300046694 Bacteria 545
916 Ga0495600_0058500 3300046809 Bacteria 2518
917 Ga0495581_0405713 3300047315 Unclassified 795
918 Ga0495581_0543980 3300047315 Bacteria 674
919 Ga0495604_0017753 3300047317 Bacteria 5693
920 Ga0495674_0092595 3300047319 Bacteria 2580
921 Ga0495674_0684191 3300047319 Unclassified 806
922 Ga0495677_0325354 3300047445 Bacteria 606
923 Ga0495684_0000091 3300047471 Bacteria 63223
924 Ga0495684_0825006 3300047471 Bacteria 604
925 Ga0495614_0133214 3300048089 Bacteria 1101
926 Ga0495614_0226713 3300048089 Bacteria 851
927 Ga0496100_0807360 3300048903 Bacteria 735
928 Ga0496100_1094907 3300048903 Bacteria 628
929 Ga0496101_0070883 3300048904 Bacteria 2553
930 Ga0496102_0098595 3300048905 Bacteria 2712
931 Ga0496102_0784571 3300048905 Unclassified 875
932 Ga0496103_0790009 3300048906 Bacteria 599
933 Ga0496104_0020319 3300048907 Bacteria 6085
934 Ga0496104_0070293 3300048907 Bacteria 3328
935 Ga0496104_0154960 3300048907 Bacteria 2199
936 Ga0496104_0568476 3300048907 Bacteria 1044
937 Ga0496105_0064547 3300048908 Bacteria 3021
938 Ga0496105_0077127 3300048908 Bacteria 2752
939 Ga0496106_0200879 3300048909 Bacteria 1586
940 Ga0496106_0309350 3300048909 Bacteria 1268
941 Ga0496106_0542458 3300048909 Bacteria 933
942 Ga0496107_0016684 3300048910 Bacteria 5162
943 Ga0496107_0053921 3300048910 Bacteria 2901
944 Ga0496107_0278167 3300048910 Bacteria 1246
945 Ga0496108_0021997 3300048911 Bacteria 5241
946 Ga0496108_0783481 3300048911 Bacteria 823
947 Ga0496109_0167109 3300048912 Bacteria 2063
948 Ga0496109_0185147 3300048912 Bacteria 1957
949 Ga0496109_0385004 3300048912 Bacteria 1325
950 Ga0496109_0442985 3300048912 Bacteria 1227
951 Ga0496110_0302101 3300048913 Bacteria 1458
952 Ga0496110_0778056 3300048913 Bacteria 861
953 Ga0496111_0659326 3300048914 Bacteria 763
954 Ga0496112_0067520 3300048915 Bacteria 3529
955 Ga0496112_0456737 3300048915 Bacteria 1215
956 Ga0496112_0643998 3300048915 Bacteria 990
957 Ga0496113_0260596 3300048916 Bacteria 1385
958 Ga0496114_0063228 3300048917 Bacteria 3098
959 Ga0496114_0094083 3300048917 Bacteria 2549
960 Ga0496114_0095041 3300048917 Bacteria 2536
961 Ga0496114_0361364 3300048917 Bacteria 1284
962 Ga0496114_0498029 3300048917 Bacteria 1078
963 Ga0496114_1054095 3300048917 Unclassified 697
964 Ga0496114_1136382 3300048917 Bacteria 666
965 Ga0496115_0055505 3300048918 Bacteria 3182
966 Ga0501033_0312825 3300049570 Bacteria 1104
967 Ga0501036_0931115 3300049572 Bacteria 713
968 Ga0501038_1212004 3300049574 Unclassified 548
969 Ga0501067_0149511 3300049583 Bacteria 1301
970 Ga0501067_0446013 3300049583 Unclassified 723
971 Ga0501067_0704011 3300049583 Bacteria 568
972 Ga0501069_0651084 3300049585 Unclassified 634
973 Ga0501072_0551427 3300049588 Bacteria 910
974 Ga0501075_0615342 3300049591 Bacteria 828
975 Ga0501075_0763190 3300049591 Bacteria 736
976 Ga0501075_1136454 3300049591 Unclassified 593
977 Ga0501077_0566311 3300049593 Unclassified 729
978 Ga0501079_0590083 3300049741 Bacteria 874
979 Ga0501080_0671308 3300049742 Bacteria 916
980 Ga0501081_0267985 3300049743 Bacteria 1249
981 Ga0501083_0745993 3300049744 Bacteria 637
982 nmdc:mga05p37_1000_c1 3300050507 Bacteria 32217
983 nmdc:mga05p37_102416_c1 3300050507 Bacteria 3526
984 nmdc:mga05p37_140839_c1 3300050507 Bacteria 2955
985 nmdc:mga05p37_19814_c1 3300050507 Bacteria 8139
986 nmdc:mga05p37_239836_c1 3300050507 Bacteria 2181
987 nmdc:mga05p37_364859_c1 3300050507 Bacteria 1697
988 nmdc:mga05p37_40764_c1 3300050507 Bacteria 5702
989 nmdc:mga05p37_6316_c1 3300050507 Bacteria 13955
990 nmdc:mga05p37_655616_c1 3300050507 Bacteria 1174
991 nmdc:mga09592_1261574_c1 3300050508 Unclassified 609
992 nmdc:mga09592_380155_c1 3300050508 Bacteria 1221
993 nmdc:mga06r32_1077734_c1 3300050510 Bacteria 753
994 nmdc:mga06r32_35719_c1 3300050510 Bacteria 4170
995 nmdc:mga08y16_11269_c1 3300050511 Bacteria 9391
996 nmdc:mga08y16_152898_c1 3300050511 Bacteria 2398
997 nmdc:mga08y16_2096917_c1 3300050511 Bacteria 513
998 nmdc:mga08y16_5673_c1 3300050511 Bacteria 13079
999 nmdc:mga0n895_11359_c1 3300050512 Bacteria 7940
1000 nmdc:mga0n895_117152_c1 3300050512 Bacteria 2683
1001 nmdc:mga0n895_117210_c1 3300050512 Unclassified 2682
1002 nmdc:mga0n895_11_c1 3300050512 Bacteria 112540
1003 nmdc:mga0n895_1247572_c1 3300050512 Bacteria 716
1004 nmdc:mga0n895_1536449_c1 3300050512 Bacteria 631
1005 nmdc:mga0n895_236227_c1 3300050512 Bacteria 1855
1006 nmdc:mga0n895_290279_c1 3300050512 Bacteria 1658
1007 nmdc:mga0n895_65163_c1 3300050512 Bacteria 3606
1008 nmdc:mga0n895_676935_c1 3300050512 Bacteria 1029
1009 nmdc:mga0rr50_1520_c1 3300050513 Bacteria 12786
1010 nmdc:mga0rr50_1736800_c1 3300050513 Bacteria 526
1011 nmdc:mga0rr50_182435_c1 3300050513 Bacteria 1716
1012 nmdc:mga0rr50_185445_c1 3300050513 Bacteria 1703
1013 nmdc:mga0rr50_19872_c1 3300050513 Bacteria 4546
1014 nmdc:mga0rr50_19_c1 3300050513 Bacteria 158236
1015 nmdc:mga0rr50_80530_c1 3300050513 Bacteria 2511
1016 nmdc:mga08x19_129268_c1 3300050514 Bacteria 1698
1017 nmdc:mga08x19_49827_c1 3300050514 Bacteria 2687
1018 nmdc:mga08x19_684_c1 3300050514 Bacteria 21764
1019 nmdc:mga08x19_889653_c1 3300050514 Bacteria 633
1020 nmdc:mga0a205_115772_c1 3300050515 Bacteria 2579
1021 nmdc:mga0a205_1169000_c1 3300050515 Bacteria 617
1022 nmdc:mga0a205_1578418_c1 3300050515 Bacteria 505
1023 nmdc:mga0a205_18872_c1 3300050515 Bacteria 6494
1024 nmdc:mga0a205_43710_c1 3300050515 Bacteria 4318
1025 nmdc:mga0a205_438801_c1 3300050515 Bacteria 1166
1026 nmdc:mga0a205_734768_c1 3300050515 Bacteria 836
1027 nmdc:mga0a205_802481_c1 3300050515 Bacteria 789
1028 nmdc:mga0a205_84683_c1 3300050515 Bacteria 3063
1029 Ga0495601_0001700 3300053077 Bacteria 12158
1030 Ga0495601_0016644 3300053077 Bacteria 4458
1031 Ga0495601_0359467 3300053077 Archaea 946
1032 Ga0495612_0341166 3300053078 Bacteria 676
1033 Ga0495619_0090727 3300053085 Bacteria 2069
1034 Ga0495619_0095840 3300053085 Bacteria 2014
1035 Ga0495619_0553521 3300053085 Archaea 789
1036 Ga0500658_0296893 3300053134 Unclassified 743
1037 JGI24751J29686_10025059
1038 Ga0058862_12589893
1039 Ga0065712_10012992
1040 Ga0065712_10125629
1041 Ga0065712_10196658
1042 Ga0065712_10632838
1043 Ga0065715_10223744
1044 Ga0065715_10285742
1045 Ga0065715_10953072
1046 Ga0065707_10045080
1047 Ga0065707_10585883
1048 Ga0065707_10824312
1049 Ga0070658_10292078
1050 Ga0070658_10592358
1051 Ga0070676_10016576
1052 Ga0070676_10019769
1053 Ga0070676_11189797
1054 Ga0070683_100112285
1055 Ga0070683_100117782
1056 Ga0070683_100386897
1057 Ga0070683_100528046
1058 Ga0070683_101293580
1059 Ga0070690_100005627
1060 Ga0070690_100105546
1061 Ga0070690_100267116
1062 Ga0070677_10257568
1063 Ga0070677_10351139
1064 Ga0070677_10650437
1065 Ga0068869_100122037
1066 Ga0068869_100328065
1067 Ga0068869_101266515
1068 Ga0070666_10028024
1069 Ga0070666_10242332
1070 Ga0070666_10308826
1071 Ga0070666_10575280
1072 Ga0070666_10657732
1073 Ga0070680_100293582
1074 Ga0070680_100333392
1075 Ga0070680_100890363
1076 Ga0068868_100078080
1077 Ga0068868_100212373
1078 Ga0068868_100398212
1079 Ga0068868_100720075
1080 Ga0068868_100856015
1081 Ga0068868_101401641
1082 Ga0068868_101995133
1083 Ga0068868_102100726
1084 Ga0070660_100010623
1085 Ga0070660_100360243
1086 Ga0070689_100116052
1087 Ga0070689_100278230
1088 Ga0070689_100764070
1089 Ga0070689_101830466
1090 Ga0070691_10001160
1091 Ga0070691_10491838
1092 Ga0070687_100331674
1093 Ga0070661_100135368
1094 Ga0070692_10239505
1095 Ga0070692_10311990
1096 Ga0070692_10796522
1097 Ga0070692_11222294
1098 Ga0070668_100025206
1099 Ga0070668_100030655
1100 Ga0070668_100703152
1101 Ga0070669_100006846
1102 Ga0070669_100030062
1103 Ga0070669_100263497
1104 Ga0070669_100329000
1105 Ga0070669_100479984
1106 Ga0070669_100886273
1107 Ga0070669_101057861
1108 Ga0070675_100002731
1109 Ga0070675_100021629
1110 Ga0070675_100745134
1111 Ga0070675_101709204
1112 Ga0070675_102122736
1113 Ga0070671_100035123
1114 Ga0070671_100676202
1115 Ga0070674_100017447
1116 Ga0070674_100074607
1117 Ga0070674_100174629
1118 Ga0070674_100844308
1119 Ga0070674_100907281
1120 Ga0070674_101224777
1121 Ga0070674_101369270
1122 Ga0070673_100153046
1123 Ga0070673_100179151
1124 Ga0070673_100451359
1125 Ga0070673_100964561
1126 Ga0070673_100997242
1127 Ga0070673_101102177
1128 Ga0070673_102076897
1129 Ga0070688_100024211
1130 Ga0070688_100168009
1131 Ga0070688_100285402
1132 Ga0070688_100671846
1133 Ga0070688_101813415
1134 Ga0070659_100102874
1135 Ga0070659_100364918
1136 Ga0070659_100394858
1137 Ga0070667_100029648
1138 Ga0070703_10241302
1139 Ga0070709_10029541
1140 Ga0070714_100236525
1141 Ga0070713_100078755
1142 Ga0070713_100188607
1143 Ga0070713_100234950
1144 Ga0070713_101948858
1145 Ga0070710_10868540
1146 Ga0070710_11299477
1147 Ga0070701_10020918
1148 Ga0070701_10344086
1149 Ga0070701_10439861
1150 Ga0070701_10522818
1151 Ga0070711_100158702
1152 Ga0070711_100443721
1153 Ga0070705_100035667
1154 Ga0070705_100229769
1155 Ga0070705_100404460
1156 Ga0070705_101089668
1157 Ga0070700_100004634
1158 Ga0070700_100048761
1159 Ga0070700_100135031
1160 Ga0070700_100549861
1161 Ga0070700_100630845
1162 Ga0070694_100088350
1163 Ga0070694_100272585
1164 Ga0070694_100822357
1165 Ga0070694_101050971
1166 Ga0070678_100224804
1167 Ga0070678_100448341
1168 Ga0070662_100144677
1169 Ga0070662_100192480
1170 Ga0070662_101044856
1171 Ga0070662_101194976
1172 Ga0070681_10117075
1173 Ga0070681_10714916
1174 Ga0070681_11058823
1175 Ga0068867_100060799
1176 Ga0068867_100263245
1177 Ga0068867_100270725
1178 Ga0068867_100295892
1179 Ga0068867_100664462
1180 Ga0068867_100688773
1181 Ga0068867_100914018
1182 Ga0068867_102390562
1183 Ga0070685_10444545
1184 Ga0070685_11442817
1185 Ga0070707_101137489
1186 Ga0070707_101711150
1187 Ga0070698_100045156
1188 Ga0070698_100091381
1189 Ga0070698_101097546
1190 Ga0070698_101329659
1191 Ga0070699_100094598
1192 Ga0070699_100457135
1193 Ga0070699_100462546
1194 Ga0070699_100505950
1195 Ga0070699_101109393
1196 Ga0070679_100035626
1197 Ga0070679_100243641
1198 Ga0070684_100145242
1199 Ga0070684_102327123
1200 Ga0070697_100218359
1201 Ga0070697_100490202
1202 Ga0070697_100956250
1203 Ga0070697_102084048
1204 Ga0068853_100382312
1205 Ga0068853_100571975
1206 Ga0070672_100018280
1207 Ga0070672_100104949
1208 Ga0070672_100150200
1209 Ga0070672_100164691
1210 Ga0070672_100182666
1211 Ga0070672_100852132
1212 Ga0070672_101254393
1213 Ga0070686_100000438
1214 Ga0070686_100179573
1215 Ga0070686_100415199
1216 Ga0070686_100620794
1217 Ga0070686_101000523
1218 Ga0070686_101000524
1219 Ga0070686_101700296
1220 Ga0070695_100000640
1221 Ga0070695_100094932
1222 Ga0070695_100200791
1223 Ga0070695_100258562
1224 Ga0070695_100876702
1225 Ga0070696_100012154
1226 Ga0070696_100114310
1227 Ga0070696_100342344
1228 Ga0070693_100084801
1229 Ga0070693_100334369
1230 Ga0070665_100001991
1231 Ga0070665_100003081
1232 Ga0070665_100166618
1233 Ga0070665_100441345
1234 Ga0070704_100118653
1235 Ga0070704_100840041
1236 Ga0068855_100040397
1237 Ga0068855_100903627
1238 Ga0070664_100080681
1239 Ga0070664_101193792
1240 Ga0068857_100746781
1241 Ga0068857_101235540
1242 Ga0068854_100008454
1243 Ga0068854_100449648
1244 Ga0068856_100339141
1245 Ga0068856_102058173
1246 Ga0070702_100001407
1247 Ga0070702_100281581
1248 Ga0068852_100623592
1249 Ga0068852_100793696
1250 Ga0068852_101868203
1251 Ga0068852_102516692
1252 Ga0068852_102553839
1253 Ga0068859_100082269
1254 Ga0068859_100185341
1255 Ga0068859_100375805
1256 Ga0068859_100631495
1257 Ga0068859_101136069
1258 Ga0068864_100080988
1259 Ga0068864_100091453
1260 Ga0068864_100742504
1261 Ga0068864_101358572
1262 Ga0068864_101914685
1263 Ga0068866_10010564
1264 Ga0068866_10079614
1265 Ga0068866_10170721
1266 Ga0068866_10385273
1267 Ga0068866_10619678
1268 Ga0068861_100090535
1269 Ga0068861_100129225
1270 Ga0068861_100129403
1271 Ga0068861_100296798
1272 Ga0068861_100387525
1273 Ga0068851_10133594
1274 Ga0068851_10427781
1275 Ga0068851_10645932
1276 Ga0068870_10213196
1277 Ga0068870_10378536
1278 Ga0068863_100510470
1279 Ga0068863_101086074
1280 Ga0068863_101330352
1281 Ga0068858_100011466
1282 Ga0068858_100048479
1283 Ga0068858_100074514
1284 Ga0068858_100090123
1285 Ga0068858_100107960
1286 Ga0068858_100110006
1287 Ga0068858_100161673
1288 Ga0068858_100215538
1289 Ga0068858_100316492
1290 Ga0068858_100677721
1291 Ga0068858_101317633
1292 Ga0068858_101901977
1293 Ga0068860_100170384
1294 Ga0068860_100171355
1295 Ga0068860_100192591
1296 Ga0068860_100227823
1297 Ga0068860_100238445
1298 Ga0068860_100281781
1299 Ga0068860_100433953
1300 Ga0068860_100540305
1301 Ga0068860_100572876
1302 Ga0068860_101775099
1303 Ga0068860_102182774
1304 Ga0068862_100056030
1305 Ga0068862_100112153
1306 Ga0068862_100165407
1307 Ga0068862_100205029
1308 Ga0068862_100230484
1309 Ga0068862_100729792
1310 Ga0068862_101669285
1311 Ga0081455_10076279
1312 Ga0081455_10111396
1313 Ga0081455_10326435
1314 Ga0081540_1069737
1315 Ga0070717_10048729
1316 Ga0070717_11212388
1317 Ga0070715_10073808
1318 Ga0070716_100037217
1319 Ga0070716_100446653
1320 Ga0070716_101150456
1321 Ga0070716_101304953
1322 Ga0097621_100004373
1323 Ga0097621_100012075
1324 Ga0097621_100048363
1325 Ga0097621_100061657
1326 Ga0097621_100136567
1327 Ga0097621_100261658
1328 Ga0097621_100417979
1329 Ga0097621_100631029
1330 Ga0097621_100808976
1331 Ga0097621_101625200
1332 Ga0068871_100000309
1333 Ga0068871_100032086
1334 Ga0068871_100061183
1335 Ga0068871_100108237
1336 Ga0068871_100119594
1337 Ga0068871_100201690
1338 Ga0068871_100317624
1339 Ga0068871_100525049
1340 Ga0068871_100566523
1341 Ga0068871_101422369
1342 Ga0068871_101756497
1343 Ga0075428_100921207
1344 Ga0075428_101152454
1345 Ga0075428_101681425
1346 Ga0075433_10040318
1347 Ga0075433_10066707
1348 Ga0075433_10078604
1349 Ga0075433_10094565
1350 Ga0075433_10498927
1351 Ga0075433_10942359
1352 Ga0075433_11755965
1353 Ga0075434_100001704
1354 Ga0075434_100047802
1355 Ga0075434_100127702
1356 Ga0075434_100131318
1357 Ga0075434_100201848
1358 Ga0075434_100338041
1359 Ga0075434_100377356
1360 Ga0075434_100777777
1361 Ga0075429_100157569
1362 Ga0075429_100269032
1363 Ga0068865_100054768
1364 Ga0068865_100589053
1365 Ga0068865_100719524
1366 Ga0068865_100868006
1367 Ga0075436_100005845
1368 Ga0075436_100008656
1369 Ga0075436_100027748
1370 Ga0075436_100030552
1371 Ga0075436_100376039
1372 Ga0075436_100553315
1373 Ga0075436_100936068
1374 Ga0097620_100082269
1375 Ga0097620_100185339
1376 Ga0097620_100375798
1377 Ga0097620_100631485
1378 Ga0097620_101136152
1379 Ga0075435_100000911
1380 Ga0075435_100001374
1381 Ga0075435_100013307
1382 Ga0075435_100056079
1383 Ga0075435_100281975
1384 Ga0075435_101163482
1385 Ga0075435_101231588
1386 Ga0099794_10123321
1387 Ga0099794_10157109
1388 Ga0099794_10625638
1389 Ga0099795_10098176
1390 Ga0099795_10268929
1391 Ga0105251_10316157
1392 Ga0105240_10935536
1393 Ga0105240_11121295
1394 Ga0105240_11387462
1395 Ga0111539_10001119
1396 Ga0111539_10023793
1397 Ga0111539_10188307
1398 Ga0111539_10333096
1399 Ga0111539_10507772
1400 Ga0111539_12092698
1401 Ga0111539_12789225
1402 Ga0105245_10107633
1403 Ga0105245_10211329
1404 Ga0105245_10254755
1405 Ga0105245_10534124
1406 Ga0105245_10575990
1407 Ga0105245_11157318
1408 Ga0105245_12853641
1409 Ga0105247_10047760
1410 Ga0105247_10142650
1411 Ga0105247_10203235
1412 Ga0105247_10269984
1413 Ga0105247_10366827
1414 Ga0105247_10466700
1415 Ga0114129_10000997
1416 Ga0114129_10007386
1417 Ga0114129_10010826
1418 Ga0114129_10018177
1419 Ga0114129_10042294
1420 Ga0114129_10046338
1421 Ga0114129_10631097
1422 Ga0114129_11669690
1423 Ga0105243_10097038
1424 Ga0105243_10372934
1425 Ga0105243_10457102
1426 Ga0105243_11744977
1427 Ga0105241_10058600
1428 Ga0105241_11001518
1429 Ga0105241_11021313
1430 Ga0105241_12047405
1431 Ga0105241_12144858
1432 Ga0105242_10001515
1433 Ga0105242_10042859
1434 Ga0105242_10681950
1435 Ga0105242_11190939
1436 Ga0105242_12064152
1437 Ga0105242_12112595
1438 Ga0105242_12846389
1439 Ga0105248_10063569
1440 Ga0105248_10169061
1441 Ga0105248_10258294
1442 Ga0105248_10345404
1443 Ga0105248_10739565
1444 Ga0105248_10756066
1445 Ga0105248_11475166
1446 Ga0105248_11719719
1447 Ga0105237_11079206
1448 Ga0105238_10540365
1449 Ga0105238_10689825
1450 Ga0105249_10356635
1451 Ga0105249_10387650
1452 Ga0105249_10682646
1453 Ga0105249_10998532
1454 Ga0105249_11106378
1455 Ga0105249_11966976
1456 Ga0105249_12974212
1457 Ga0099796_10136619
1458 Ga0105239_11389389
1459 Ga0105239_11841298
1460 Ga0105239_12969542
1461 Ga0105246_10289922
1462 Ga0105246_10381813
1463 Ga0105246_10623360
1464 Ga0157324_1014110
1465 Ga0157315_1029595
1466 Ga0157370_10073957
1467 Ga0157370_11170424
1468 Ga0157374_10019997
1469 Ga0157374_10157407
1470 Ga0157374_10209043
1471 Ga0157374_10467346
1472 Ga0157378_10031942
1473 Ga0157378_10089055
1474 Ga0157378_10151473
1475 Ga0157378_10823089
1476 Ga0157378_11794420
1477 Ga0157378_12807620
1478 Ga0163162_10703375
1479 Ga0163162_10734634
1480 Ga0163162_11106447
1481 Ga0163162_11756817
1482 Ga0163162_12477755
1483 Ga0157372_11281980
1484 Ga0157375_10113069
1485 Ga0157375_10246137
1486 Ga0157375_10305212
1487 Ga0157375_10308417
1488 Ga0157375_10312157
1489 Ga0157375_11303280
1490 Ga0157375_11799916
1491 Ga0157375_12193575
1492 Ga0157375_12753954
1493 Ga0163163_10094081
1494 Ga0163163_10152529
1495 Ga0163163_10186927
1496 Ga0163163_10536616
1497 Ga0163163_10854080
1498 Ga0163163_11379865
1499 Ga0163163_11973131
1500 Ga0157380_10036836
1501 Ga0157380_10114556
1502 Ga0157380_10302169
1503 Ga0157380_10376823
1504 Ga0157380_10569941
1505 Ga0157380_11537468
1506 Ga0157380_12211231
1507 Ga0157377_10123435
1508 Ga0157377_10318713
1509 Ga0157377_10344025
1510 Ga0157377_10454000
1511 Ga0157379_10011179
1512 Ga0157379_10015545
1513 Ga0157379_10027405
1514 Ga0157379_10295721
1515 Ga0157379_10534830
1516 Ga0157379_10804514
1517 Ga0157379_10907699
1518 Ga0157379_10958906
1519 Ga0157379_11293719
1520 Ga0157376_10073450
1521 Ga0157376_10095058
1522 Ga0157376_10161236
1523 Ga0157376_10294275
1524 Ga0157376_10599049
1525 Ga0157376_10669374
1526 Ga0157376_10819405
1527 Ga0157376_11015402
1528 Ga0157376_12274710
1529 Ga0163161_10100993
1530 Ga0163161_10389659
1531 Ga0163161_10493084
1532 Ga0163161_10502375
1533 Ga0163161_10530538
1534 Ga0163161_11818229
1535 Ga0207697_10016040
1536 Ga0207697_10234080
1537 Ga0207656_10195697
1538 Ga0207656_10493552
1539 Ga0207656_10556299
1540 Ga0207682_10126131
1541 Ga0207682_10327032
1542 Ga0207682_10419719
1543 Ga0207642_10225771
1544 Ga0207642_10555422
1545 Ga0207642_10644423
1546 Ga0207710_10019224
1547 Ga0207710_10144264
1548 Ga0207710_10155432
1549 Ga0207710_10293139
1550 Ga0207710_10512330
1551 Ga0207688_10139972
1552 Ga0207688_10144892
1553 Ga0207680_10034286
1554 Ga0207680_10060165
1555 Ga0207680_10143728
1556 Ga0207680_10213620
1557 Ga0207680_10423384
1558 Ga0207680_10650495
1559 Ga0207680_10704746
1560 Ga0207685_10038372
1561 Ga0207685_10049987
1562 Ga0207685_10279971
1563 Ga0207685_10433918
1564 Ga0207685_10769920
1565 Ga0207685_10795547
1566 Ga0207699_11234115
1567 Ga0207645_10011108
1568 Ga0207645_10030127
1569 Ga0207645_10347069
1570 Ga0207645_10650882
1571 Ga0207643_10061700
1572 Ga0207643_10412155
1573 Ga0207705_10210281
1574 Ga0207705_10795818
1575 Ga0207684_10568016
1576 Ga0207684_11729664
1577 Ga0207654_10041969
1578 Ga0207707_10393843
1579 Ga0207707_10526000
1580 Ga0207707_10888488
1581 Ga0207695_10863683
1582 Ga0207695_11208182
1583 Ga0207663_10036104
1584 Ga0207663_10335139
1585 Ga0207660_10023392
1586 Ga0207660_10264842
1587 Ga0207660_11166852
1588 Ga0207660_11295021
1589 Ga0207662_10078047
1590 Ga0207662_10214175
1591 Ga0207657_10007831
1592 Ga0207657_11192089
1593 Ga0207649_10091573
1594 Ga0207649_10575341
1595 Ga0207652_10192850
1596 Ga0207652_10244526
1597 Ga0207652_10623351
1598 Ga0207646_10551319
1599 Ga0207646_11038937
1600 Ga0207646_11041680
1601 Ga0207646_11520912
1602 Ga0207681_10046132
1603 Ga0207681_10080744
1604 Ga0207681_10273676
1605 Ga0207681_10441389
1606 Ga0207681_10641579
1607 Ga0207681_10685533
1608 Ga0207681_10716014
1609 Ga0207681_11170096
1610 Ga0207694_10356930
1611 Ga0207650_11697676
1612 Ga0207659_10000072
1613 Ga0207659_10055763
1614 Ga0207659_10409452
1615 Ga0207659_10917017
1616 Ga0207687_10009098
1617 Ga0207687_10067308
1618 Ga0207687_10248731
1619 Ga0207687_10317586
1620 Ga0207687_10349423
1621 Ga0207687_10493315
1622 Ga0207700_10003434
1623 Ga0207700_10145831
1624 Ga0207700_10906430
1625 Ga0207644_10081885
1626 Ga0207644_10460184
1627 Ga0207644_10488042
1628 Ga0207690_10119998
1629 Ga0207690_10171404
1630 Ga0207690_10356087
1631 Ga0207690_10468672
1632 Ga0207706_10094855
1633 Ga0207706_10411699
1634 Ga0207706_10611205
1635 Ga0207706_10632974
1636 Ga0207706_11553418
1637 Ga0207686_10041899
1638 Ga0207686_10117886
1639 Ga0207686_10282832
1640 Ga0207709_10234583
1641 Ga0207709_10464931
1642 Ga0207709_11656290
1643 Ga0207709_11751428
1644 Ga0207670_10011567
1645 Ga0207670_10097455
1646 Ga0207670_10530775
1647 Ga0207670_10627063
1648 Ga0207670_10674557
1649 Ga0207670_11266824
1650 Ga0207669_10076627
1651 Ga0207669_10215935
1652 Ga0207669_10357324
1653 Ga0207669_10706587
1654 Ga0207669_11064850
1655 Ga0207669_11601833
1656 Ga0207704_10047165
1657 Ga0207704_10048179
1658 Ga0207704_10099823
1659 Ga0207704_10185798
1660 Ga0207704_10664956
1661 Ga0207704_10743945
1662 Ga0207665_10106451
1663 Ga0207665_10294494
1664 Ga0207665_10324517
1665 Ga0207665_10805112
1666 Ga0207691_10027750
1667 Ga0207691_10036456
1668 Ga0207691_10094654
1669 Ga0207691_10160903
1670 Ga0207691_10168968
1671 Ga0207691_10514192
1672 Ga0207691_10820001
1673 Ga0207691_11255741
1674 Ga0207711_10008385
1675 Ga0207711_10024991
1676 Ga0207711_10071051
1677 Ga0207711_10277044
1678 Ga0207711_10498579
1679 Ga0207711_10654892
1680 Ga0207711_10953753
1681 Ga0207711_11244733
1682 Ga0207689_10079882
1683 Ga0207689_10137682
1684 Ga0207689_10157181
1685 Ga0207689_10446261
1686 Ga0207689_10459871
1687 Ga0207689_10582593
1688 Ga0207689_10894218
1689 Ga0207661_10089035
1690 Ga0207661_10965810
1691 Ga0207661_11795626
1692 Ga0207679_10108137
1693 Ga0207679_10567069
1694 Ga0207679_11083787
1695 Ga0207679_11945817
1696 Ga0207651_10063928
1697 Ga0207651_10070442
1698 Ga0207651_10154198
1699 Ga0207651_10247180
1700 Ga0207651_10935455
1701 Ga0207651_10941880
1702 Ga0207712_10315627
1703 Ga0207712_10380179
1704 Ga0207712_10747078
1705 Ga0207712_10951450
1706 Ga0207668_10047267
1707 Ga0207668_10110631
1708 Ga0207640_10067645
1709 Ga0207640_10283257
1710 Ga0207640_10285790
1711 Ga0207658_10054499
1712 Ga0207658_10375258
1713 Ga0207677_10088428
1714 Ga0207677_10109757
1715 Ga0207677_10182354
1716 Ga0207677_10398381
1717 Ga0207677_10425275
1718 Ga0207677_10471038
1719 Ga0207677_11215317
1720 Ga0207677_11645178
1721 Ga0207703_10008225
1722 Ga0207703_10058167
1723 Ga0207703_10080469
1724 Ga0207703_10124942
1725 Ga0207703_10249072
1726 Ga0207703_10321622
1727 Ga0207703_10444585
1728 Ga0207703_11322296
1729 Ga0207703_11673781
1730 Ga0207703_11942156
1731 Ga0207639_10749230
1732 Ga0207708_10009239
1733 Ga0207708_10026867
1734 Ga0207708_10054229
1735 Ga0207708_10369408
1736 Ga0207708_10897707
1737 Ga0207702_10826174
1738 Ga0207641_10756502
1739 Ga0207641_10955912
1740 Ga0207648_10050261
1741 Ga0207648_10073340
1742 Ga0207648_10205744
1743 Ga0207648_10299622
1744 Ga0207648_10317199
1745 Ga0207648_10376404
1746 Ga0207648_10566168
1747 Ga0207676_10105923
1748 Ga0207676_10289644
1749 Ga0207676_10929095
1750 Ga0207676_12090749
1751 Ga0207674_10688973
1752 Ga0207675_100002502
1753 Ga0207675_100052252
1754 Ga0207675_100126025
1755 Ga0207675_100160796
1756 Ga0207675_100176579
1757 Ga0207675_100359154
1758 Ga0207675_100581398
1759 Ga0207675_100711343
1760 Ga0207675_100822501
1761 Ga0207675_101074087
1762 Ga0207683_10086211
1763 Ga0207683_10563352
1764 Ga0207683_11064094
1765 Ga0207698_10139053
1766 Ga0207698_10916983
1767 Ga0207698_10945499
1768 Ga0207698_11039490
1769 Ga0207698_12153439
1770 Ga0207698_12370243
1771 Ga0209998_10014387
1772 Ga0207428_10010977
1773 Ga0207428_10028520
1774 Ga0207428_10100679
1775 Ga0207428_10462738
1776 Ga0268266_10011058
1777 Ga0268266_10034103
1778 Ga0268266_10124591
1779 Ga0268265_10015631
1780 Ga0268265_10018528
1781 Ga0268265_10097260
1782 Ga0268265_10104516
1783 Ga0268265_10219188
1784 Ga0268265_10863086
1785 Ga0268265_10993501
1786 Ga0268265_11568626
1787 Ga0268264_10035635
1788 Ga0268264_10051010
1789 Ga0268264_10102969
1790 Ga0268264_10180716
1791 Ga0268264_10225196
1792 Ga0268264_10389812
1793 Ga0268264_10474019
1794 Ga0268264_10637707
1795 Ga0268264_10702675
1796 Ga0268264_11994121
1797 Ga0268264_12114387
1798 Ga0265318_10071255
1799 Ga0307517_10373570
1800 Ga0265332_10024452
1801 Ga0307513_10365269
1802 Ga0307408_100907340
1803 Ga0307405_11634265
1804 Ga0307412_11061059
1805 Ga0307416_103223965
1806 Ga0307411_10942950
1807 Ga0373930_0003342
1808 Ga0373948_0001613
1809 Ga0373948_0030444
1810 Ga0373950_0002273
1811 Ga0373950_0050115
1812 Ga0373950_0078960
1813 Ga0373959_0001811
1814 Ga0373938_0001023
1815 Ga0373929_0002353
1816 Ga0373934_0093330
1817 Ga0373934_0273235
1818 Ga0373940_0003660
1819 Ga0373944_0013677
1820 Ga0373949_0001604
1821 Ga0373951_0001636
1822 Ga0373952_0001201
1823 Ga0373923_0190345
1824 Ga0373923_0291579
1825 Ga0373932_0001001
1826 Ga0373932_0249850
1827 Ga0373932_0264196
1828 Ga0373936_0037543
1829 Ga0373936_0637653
1830 Ga0373939_0000747
1831 Ga0373941_0001198
1832 Ga0373945_0382579
1833 Ga0373953_0317651
1834 Ga0373954_0306306
1835 Ga0373956_0132932
1836 Ga0373956_0259975
1837 Ga0373956_0324545
1838 Ga0373960_0008376
1839 Ga0373943_0076339
1840 Ga0373943_0186733
1841 Ga0373943_0532031
1842 Ga0373955_0058623
1843 Ga0373955_0155408
1844 Ga0373955_0232175
1845 Ga0373942_0004032
1846 Ga0373961_0001136
1847 Ga0373962_0000651
1848 Ga0373924_0022675
1849 Ga0373924_0027617
1850 Ga0373924_0101121
1851 Ga0373931_0009113
1852 Ga0373931_0874451
1853 Ga0373931_0922360
1854 Ga0373935_0445927
1855 Ga0373933_0599284
1856 Ga0373947_0045551
1857 Ga0373947_0139903
1858 Ga0373947_0311834
1859 Ga0373947_0806596
1860 Ga0373937_0124685
1861 Ga0373937_0144311
1862 Ga0373937_0364800
1863 Ga0373937_0537059
1864 Ga0373937_0626062
1865 Ga0373925_0008010
1866 Ga0373925_0093282
1867 Ga0395898_0675886
1868 Ga0436365_1418626
1869 Ga0436365_1707679
1870 Ga0436363_0863700
1871 Ga0439439_0033587
1872 Ga0451807_0661252
1873 Ga0451807_1235903
1874 Ga0451807_1277086
1875 Ga0451839_1388944
1876 Ga0451853_0628758
1877 Ga0439441_072835
1878 Ga0450917_026935
1879 Ga0450894_022590
1880 Ga0450896_008585
1881 Ga0450916_004966
1882 Ga0466963_0299266
1883 Ga0466957_0738048
1884 Ga0466960_0615625
1885 Ga0451576_0009854
1886 Ga0451576_0265115
1887 Ga0451576_1533002
1888 Ga0466967_0330676
1889 Ga0495592_0043582
1890 Ga0495603_0314848
1891 Ga0495603_0677610
1892 Ga0495590_0154335
1893 Ga0495629_0112720
1894 Ga0495629_0237693
1895 Ga0495651_0675003
1896 Ga0495653_0347897
1897 Ga0495580_0094881
1898 Ga0495580_0398917
1899 Ga0495580_0478978
1900 Ga0495580_0790056
1901 Ga0495582_0236623
1902 Ga0495582_0720765
1903 Ga0495594_0833360
1904 Ga0495618_0421274
1905 Ga0495628_0162789
1906 Ga0495628_0642912
1907 Ga0495630_0852549
1908 Ga0495630_1147213
1909 Ga0495652_0183350
1910 Ga0495665_0152758
1911 Ga0495640_0680288
1912 Ga0495586_0091873
1913 Ga0495586_0584114
1914 Ga0495587_0197669
1915 Ga0495587_0502414
1916 Ga0495621_0185661
1917 Ga0495621_0346009
1918 Ga0495645_0004640
1919 Ga0495645_0148883
1920 Ga0495633_0322818
1921 Ga0495667_0802577
1922 Ga0495656_0207839
1923 Ga0495656_0492450
1924 Ga0495668_0185133
1925 Ga0495634_0065643
1926 Ga0495634_0403075
1927 Ga0495634_0498394
1928 Ga0495635_0139161
1929 Ga0495635_0269770
1930 Ga0495635_0546251
1931 Ga0495588_0510070
1932 Ga0495599_0522613
1933 Ga0495623_0105471
1934 Ga0495623_0425546
1935 Ga0495647_0069805
1936 Ga0495647_0086452
1937 Ga0495647_0096514
1938 Ga0495647_0191734
1939 Ga0495647_0454527
1940 Ga0495658_0011794
1941 Ga0495658_0024130
1942 Ga0495658_0221124
1943 Ga0495658_0562105
1944 Ga0495669_0208683
1945 Ga0495669_0242280
1946 Ga0495669_0486306
1947 Ga0495613_0000477
1948 Ga0495613_0287410
1949 Ga0495670_0485099
1950 Ga0495671_0188649
1951 Ga0495649_0596856
1952 Ga0495600_0058500
1953 Ga0495581_0405713
1954 Ga0495581_0543980
1955 Ga0495604_0017753
1956 Ga0495674_0092595
1957 Ga0495674_0684191
1958 Ga0495677_0325354
1959 Ga0495684_0000091
1960 Ga0495684_0825006
1961 Ga0495614_0133214
1962 Ga0495614_0226713
1963 Ga0496100_0807360
1964 Ga0496100_1094907
1965 Ga0496101_0070883
1966 Ga0496102_0098595
1967 Ga0496102_0784571
1968 Ga0496103_0790009
1969 Ga0496104_0020319
1970 Ga0496104_0070293
1971 Ga0496104_0154960
1972 Ga0496104_0568476
1973 Ga0496105_0064547
1974 Ga0496105_0077127
1975 Ga0496106_0200879
1976 Ga0496106_0309350
1977 Ga0496106_0542458
1978 Ga0496107_0016684
1979 Ga0496107_0053921
1980 Ga0496107_0278167
1981 Ga0496108_0021997
1982 Ga0496108_0783481
1983 Ga0496109_0167109
1984 Ga0496109_0185147
1985 Ga0496109_0385004
1986 Ga0496109_0442985
1987 Ga0496110_0302101
1988 Ga0496110_0778056
1989 Ga0496111_0659326
1990 Ga0496112_0067520
1991 Ga0496112_0456737
1992 Ga0496112_0643998
1993 Ga0496113_0260596
1994 Ga0496114_0063228
1995 Ga0496114_0094083
1996 Ga0496114_0095041
1997 Ga0496114_0361364
1998 Ga0496114_0498029
1999 Ga0496114_1054095
2000 Ga0496114_1136382
2001 Ga0496115_0055505
2002 Ga0501033_0312825
2003 Ga0501036_0931115
2004 Ga0501038_1212004
2005 Ga0501067_0149511
2006 Ga0501067_0446013
2007 Ga0501067_0704011
2008 Ga0501069_0651084
2009 Ga0501072_0551427
2010 Ga0501075_0615342
2011 Ga0501075_0763190
2012 Ga0501075_1136454
2013 Ga0501077_0566311
2014 Ga0501079_0590083
2015 Ga0501080_0671308
2016 Ga0501081_0267985
2017 Ga0501083_0745993
2018 nmdc:mga05p37_1000_c1
2019 nmdc:mga05p37_102416_c1
2020 nmdc:mga05p37_140839_c1
2021 nmdc:mga05p37_19814_c1
2022 nmdc:mga05p37_239836_c1
2023 nmdc:mga05p37_364859_c1
2024 nmdc:mga05p37_40764_c1
2025 nmdc:mga05p37_6316_c1
2026 nmdc:mga05p37_655616_c1
2027 nmdc:mga09592_1261574_c1
2028 nmdc:mga09592_380155_c1
2029 nmdc:mga06r32_1077734_c1
2030 nmdc:mga06r32_35719_c1
2031 nmdc:mga08y16_11269_c1
2032 nmdc:mga08y16_152898_c1
2033 nmdc:mga08y16_2096917_c1
2034 nmdc:mga08y16_5673_c1
2035 nmdc:mga0n895_11359_c1
2036 nmdc:mga0n895_117152_c1
2037 nmdc:mga0n895_117210_c1
2038 nmdc:mga0n895_11_c1
2039 nmdc:mga0n895_1247572_c1
2040 nmdc:mga0n895_1536449_c1
2041 nmdc:mga0n895_236227_c1
2042 nmdc:mga0n895_290279_c1
2043 nmdc:mga0n895_65163_c1
2044 nmdc:mga0n895_676935_c1
2045 nmdc:mga0rr50_1520_c1
2046 nmdc:mga0rr50_1736800_c1
2047 nmdc:mga0rr50_182435_c1
2048 nmdc:mga0rr50_185445_c1
2049 nmdc:mga0rr50_19872_c1
2050 nmdc:mga0rr50_19_c1
2051 nmdc:mga0rr50_80530_c1
2052 nmdc:mga08x19_129268_c1
2053 nmdc:mga08x19_49827_c1
2054 nmdc:mga08x19_684_c1
2055 nmdc:mga08x19_889653_c1
2056 nmdc:mga0a205_115772_c1
2057 nmdc:mga0a205_1169000_c1
2058 nmdc:mga0a205_1578418_c1
2059 nmdc:mga0a205_18872_c1
2060 nmdc:mga0a205_43710_c1
2061 nmdc:mga0a205_438801_c1
2062 nmdc:mga0a205_734768_c1
2063 nmdc:mga0a205_802481_c1
2064 nmdc:mga0a205_84683_c1
2065 Ga0495601_0001700
2066 Ga0495601_0016644
2067 Ga0495601_0359467
2068 Ga0495612_0341166
2069 Ga0495619_0090727
2070 Ga0495619_0095840
2071 Ga0495619_0553521
2072 Ga0500658_0296893

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01740

STAS

STAS domain

2

107

0.93

PF13466

STAS_2

STAS domain

19

95

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hyl-assembly1.cif.gz_A the crystal structure of an anti-sigma-factor antagonist from haliangium ochraceum dsm 14365 0.9166 3 113
1th8-assembly1.cif.gz_B crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form ii 0.9159 3 112
4xs5-assembly2.cif.gz_B crystal structure of sulfate transporter/antisigma-factor antagonist stas from dyadobacter fermentans dsm 18053 0.9128 4 112
6m36-assembly1.cif.gz_H the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9125 2 102
4qtp-assembly3.cif.gz_C crystal structure of an anti-sigma factor antagonist from mycobacterium paratuberculosis 0.9125 3 113
ID Description Score Start End Superfamily
af_A0A0N7KGR6_2_88_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.966 45 110 3.30.750.24
af_A0A0R0KL09_2_75_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.947 52 110 3.30.750.24
af_Q10QI4_508_648_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9151 6 110 3.30.750.24
1tidD00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9116 3 112 3.30.750.24
4xs5B00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9101 4 111 3.30.750.24
ID Description Score Start End GO Terms
AF-A0A2V7XAJ0-F1-model_v4 Anti-sigma factor antagonist 0.9871 3 112 GO:0043856
AF-A0A1F2TGN8-F1-model_v4 STAS domain-containing protein 0.9857 1 111 GO:0043856
AF-A0A7Y8LKM0-F1-model_v4 STAS domain-containing protein 0.9785 2 111 GO:0043856
AF-A0A2V7XFS2-F1-model_v4 STAS domain-containing protein 0.9781 1 111 GO:0043856
AF-A0A2V7XEN0-F1-model_v4 Anti-sigma factor antagonist 0.9772 3 112 GO:0043856

Map