F488695

General Info

Members Datasets Scaffolds Average Seq Length
1035 432 2062 111

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10106143|Ga0075365_101061433
Length 131
Sequence VGGRVPARNGGCVTVTMNEAATTRSLLPPEFADLERYSEWCLGSESQRYAKRLASSMQEMQAFYDAITARAEEAIAYCDKFPLDDLPEDVLNLMHLLYSMIMVSFPVECWKQPKVPDSGATSLNCDSEPRP

Samples

Sample ID Description Type Environment
1 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
8 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
83 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
87 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
88 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
89 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
90 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
91 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
92 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
93 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
94 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
95 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
96 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
99 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
100 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
101 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
102 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
103 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
104 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
105 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
108 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
113 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
116 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
123 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
132 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
133 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
136 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
137 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
138 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
139 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
200 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
205 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
206 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
207 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
208 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
209 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
210 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
211 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
212 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
213 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
214 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
215 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
216 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
217 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
218 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
219 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
220 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
221 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
222 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
223 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
224 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
225 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
226 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
227 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
228 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
229 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
230 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
231 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
232 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
235 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
236 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
237 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
238 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
239 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
240 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
241 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
242 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
243 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
244 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
245 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
246 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
247 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
248 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
249 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
250 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
251 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
252 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
253 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
254 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
255 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
256 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
257 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
258 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
259 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
260 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
261 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
262 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
263 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
264 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
265 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
266 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
267 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
268 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
269 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
270 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
271 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
272 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
273 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
274 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
275 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
276 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
277 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
278 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
279 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
280 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
281 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
282 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
283 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
284 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
285 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
286 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
287 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
288 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
289 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
290 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
291 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
292 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
293 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
294 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
295 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
296 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
297 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
298 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
299 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
300 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
301 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
302 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
303 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
304 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
305 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
306 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
307 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
308 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
309 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
310 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
311 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
312 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
313 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
314 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
315 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
316 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
317 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
318 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
319 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
320 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
321 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
322 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
323 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
324 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
325 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
326 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
327 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
328 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
329 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
330 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
331 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
332 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
333 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
334 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
335 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
336 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
337 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
338 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
339 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
340 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
341 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
342 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
343 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
344 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
345 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
346 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
347 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
348 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
349 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
350 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
351 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
352 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
353 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
354 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
355 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
356 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
357 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
358 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
371 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
372 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
373 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
374 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
375 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
376 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
377 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
378 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
379 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
380 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
381 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
383 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
384 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
385 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
386 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
387 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
388 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
389 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
390 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
391 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
392 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
393 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
394 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
395 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
396 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
397 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
398 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
399 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
400 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
401 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
402 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
403 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
404 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
405 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
406 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
407 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
408 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
409 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
410 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
411 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
412 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
413 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
414 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
415 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
416 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
417 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
418 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
419 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
420 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
421 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
422 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
423 2508501039 Frankia saprophytica CN3 Isolate Nodule
424 2687453737 Frankia sp. BMG5.36 Isolate Nodule
425 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
426 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
427 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
428 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
429 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
430 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
431 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
432 8002784119 Frankia sp. AgB1.9 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.84
Metatranscriptomes 0
Isolates 1.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.23
Nodule 0.48
Rhizoplane 6.18
Rhizosphere 71.79
Stem 0
Stem Tuber 0
Unclassified 0.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_10106143 3300006038 Bacteria 1927
2 CNXas_1005693 3300000545 Bacteria 881
3 JGI24747J21853_1041118 3300001978 Bacteria 548
4 JGI24739J22299_10014705 3300001989 Bacteria 2845
5 JGI24739J22299_10076295 3300001989 Bacteria 1035
6 JGI24737J22298_10189378 3300001990 Bacteria 607
7 JGI24750J21931_1019857 3300002070 Bacteria 934
8 JGI24748J21848_1011471 3300002074 Bacteria 1044
9 JGI24749J21850_1002582 3300002076 Bacteria 2539
10 JGI24744J21845_10005891 3300002077 Bacteria 2542
11 JGI24034J26672_10002221 3300002239 Bacteria 2646
12 JGI24034J26672_10019259 3300002239 Bacteria 1064
13 JGI24742J22300_10003432 3300002244 Bacteria 2570
14 JGI25406J46586_10203423 3300003203 Unclassified 578
15 Ga0070676_10088804 3300005328 Bacteria 1889
16 Ga0070683_100031150 3300005329 Bacteria 4847
17 Ga0070683_100302955 3300005329 Bacteria 1520
18 Ga0070683_100313813 3300005329 Bacteria 1492
19 Ga0070683_101842703 3300005329 Bacteria 581
20 Ga0070683_102298297 3300005329 Bacteria 517
21 Ga0070690_100005233 3300005330 Bacteria 7270
22 Ga0070690_100763677 3300005330 Bacteria 747
23 Ga0070670_100138005 3300005331 Bacteria 2108
24 Ga0070670_100301499 3300005331 Bacteria 1402
25 Ga0070670_101811197 3300005331 Bacteria 562
26 Ga0068869_100009993 3300005334 Bacteria 6170
27 Ga0070666_10561773 3300005335 Bacteria 830
28 Ga0070666_10576769 3300005335 Bacteria 820
29 Ga0070680_100001473 3300005336 Bacteria 17100
30 Ga0070680_100089024 3300005336 Bacteria 2554
31 Ga0070682_100019637 3300005337 Bacteria 3967
32 Ga0070682_100399514 3300005337 Bacteria 1039
33 Ga0068868_100006261 3300005338 Bacteria 8418
34 Ga0068868_100879949 3300005338 Bacteria 813
35 Ga0070660_101076971 3300005339 Bacteria 680
36 Ga0070689_100043104 3300005340 Bacteria 3466
37 Ga0070691_10008644 3300005341 Bacteria 4662
38 Ga0070687_100315200 3300005343 Bacteria 997
39 Ga0070687_100807295 3300005343 Bacteria 665
40 Ga0070668_100020194 3300005347 Bacteria 5024
41 Ga0070668_100208708 3300005347 Bacteria 1606
42 Ga0070668_100278217 3300005347 Bacteria 1397
43 Ga0070668_100286746 3300005347 Bacteria 1377
44 Ga0070668_100329803 3300005347 Bacteria 1287
45 Ga0070668_100685234 3300005347 Bacteria 903
46 Ga0070668_100917007 3300005347 Bacteria 784
47 Ga0070669_100062270 3300005353 Bacteria 2743
48 Ga0070669_101363634 3300005353 Bacteria 615
49 Ga0070675_100048326 3300005354 Bacteria 3488
50 Ga0070675_100076120 3300005354 Bacteria 2790
51 Ga0070675_100749289 3300005354 Bacteria 891
52 Ga0070671_100448401 3300005355 Bacteria 1107
53 Ga0070674_100034016 3300005356 Bacteria 3399
54 Ga0070674_100072577 3300005356 Bacteria 2438
55 Ga0070673_100335243 3300005364 Bacteria 1339
56 Ga0070673_100590666 3300005364 Bacteria 1012
57 Ga0070673_100612510 3300005364 Bacteria 994
58 Ga0070673_100953797 3300005364 Bacteria 797
59 Ga0070673_101945227 3300005364 Bacteria 558
60 Ga0070688_100139893 3300005365 Bacteria 1643
61 Ga0070659_100064787 3300005366 Bacteria 2893
62 Ga0070667_100000073 3300005367 Bacteria 122757
63 Ga0070667_100050177 3300005367 Bacteria 3516
64 Ga0070667_100057241 3300005367 Bacteria 3294
65 Ga0070667_100100180 3300005367 Bacteria 2502
66 Ga0070667_100284849 3300005367 Bacteria 1485
67 Ga0070709_10526979 3300005434 Bacteria 901
68 Ga0070714_100004993 3300005435 Bacteria 10085
69 Ga0070714_100385059 3300005435 Bacteria 1323
70 Ga0070714_100599981 3300005435 Bacteria 1057
71 Ga0070714_100781107 3300005435 Bacteria 924
72 Ga0070714_101051641 3300005435 Bacteria 793
73 Ga0070714_101299291 3300005435 Bacteria 710
74 Ga0070713_100030219 3300005436 Bacteria 4301
75 Ga0070713_100048888 3300005436 Bacteria 3486
76 Ga0070713_101606775 3300005436 Bacteria 631
77 Ga0070713_102480342 3300005436 Bacteria 501
78 Ga0070710_10003422 3300005437 Bacteria 7513
79 Ga0070701_10013157 3300005438 Bacteria 3756
80 Ga0070711_100003825 3300005439 Bacteria 8842
81 Ga0070705_100003436 3300005440 Bacteria 7766
82 Ga0070705_100860673 3300005440 Bacteria 726
83 Ga0070700_100001480 3300005441 Bacteria 11692
84 Ga0070700_100334678 3300005441 Bacteria 1117
85 Ga0070700_100833844 3300005441 Bacteria 745
86 Ga0070694_100007844 3300005444 Bacteria 6516
87 Ga0070708_100193542 3300005445 Bacteria 1902
88 Ga0070663_100005263 3300005455 Bacteria 7669
89 Ga0070663_100712622 3300005455 Bacteria 854
90 Ga0070678_100028448 3300005456 Bacteria 3812
91 Ga0070678_100306901 3300005456 Bacteria 1350
92 Ga0070678_100308568 3300005456 Unclassified 1347
93 Ga0070678_100834215 3300005456 Bacteria 839
94 Ga0070678_101069767 3300005456 Bacteria 744
95 Ga0070662_100036411 3300005457 Bacteria 3481
96 Ga0070681_10000016 3300005458 Bacteria 126919
97 Ga0070681_10132679 3300005458 Bacteria 2422
98 Ga0070681_10365077 3300005458 Bacteria 1354
99 Ga0070681_11117033 3300005458 Bacteria 709
100 Ga0070681_11988397 3300005458 Bacteria 509
101 Ga0068867_100000117 3300005459 Bacteria 50416
102 Ga0070685_10002511 3300005466 Bacteria 9411
103 Ga0070685_10163900 3300005466 Bacteria 1419
104 Ga0070707_100048260 3300005468 Bacteria 4079
105 Ga0070707_101678018 3300005468 Bacteria 602
106 Ga0070698_100022542 3300005471 Bacteria 6586
107 Ga0070698_100564182 3300005471 Bacteria 1078
108 Ga0070699_100143148 3300005518 Bacteria 2112
109 Ga0070699_100242625 3300005518 Bacteria 1609
110 Ga0070679_100007597 3300005530 Bacteria 10144
111 Ga0070679_100137709 3300005530 Bacteria 2422
112 Ga0070679_100587491 3300005530 Bacteria 1057
113 Ga0070684_100050120 3300005535 Bacteria 3626
114 Ga0070684_100086188 3300005535 Bacteria 2787
115 Ga0070684_100383962 3300005535 Bacteria 1294
116 Ga0070684_100406080 3300005535 Bacteria 1256
117 Ga0070684_100440972 3300005535 Bacteria 1203
118 Ga0070697_100153856 3300005536 Bacteria 1940
119 Ga0068853_100001776 3300005539 Bacteria 15846
120 Ga0068853_100692150 3300005539 Bacteria 972
121 Ga0068853_102157694 3300005539 Bacteria 540
122 Ga0070672_100229505 3300005543 Bacteria 1559
123 Ga0070672_100251687 3300005543 Bacteria 1488
124 Ga0070672_100422673 3300005543 Bacteria 1145
125 Ga0070686_100465054 3300005544 Bacteria 975
126 Ga0070686_100478172 3300005544 Bacteria 963
127 Ga0070695_100006447 3300005545 Bacteria 6939
128 Ga0070695_100249158 3300005545 Bacteria 1292
129 Ga0070696_100008033 3300005546 Bacteria 7050
130 Ga0070696_100354089 3300005546 Bacteria 1138
131 Ga0070693_100003341 3300005547 Bacteria 7458
132 Ga0070665_100004592 3300005548 Bacteria 14452
133 Ga0070665_100006811 3300005548 Bacteria 11619
134 Ga0070665_100026007 3300005548 Bacteria 5895
135 Ga0070704_100011707 3300005549 Bacteria 5390
136 Ga0070704_100116932 3300005549 Bacteria 2040
137 Ga0068855_100043819 3300005563 Bacteria 5297
138 Ga0070664_100181811 3300005564 Bacteria 1869
139 Ga0070664_100336782 3300005564 Bacteria 1370
140 Ga0070664_102344574 3300005564 Bacteria 506
141 Ga0068857_102210157 3300005577 Bacteria 540
142 Ga0068857_102501829 3300005577 Bacteria 507
143 Ga0068854_100000583 3300005578 Bacteria 21768
144 Ga0068854_100033035 3300005578 Bacteria 3605
145 Ga0068854_100391908 3300005578 Bacteria 1147
146 Ga0068856_101967912 3300005614 Bacteria 595
147 Ga0068856_102194576 3300005614 Bacteria 561
148 Ga0070702_100390540 3300005615 Bacteria 992
149 Ga0068852_100099781 3300005616 Bacteria 2618
150 Ga0068852_100528065 3300005616 Bacteria 1178
151 Ga0068852_100943005 3300005616 Bacteria 881
152 Ga0068859_100003452 3300005617 Bacteria 16065
153 Ga0068859_100005109 3300005617 Bacteria 13333
154 Ga0068859_100508538 3300005617 Bacteria 1300
155 Ga0068859_101317724 3300005617 Bacteria 796
156 Ga0068864_100187181 3300005618 Bacteria 1896
157 Ga0068866_10002207 3300005718 Bacteria 8097
158 Ga0068866_10486387 3300005718 Bacteria 814
159 Ga0068866_10772726 3300005718 Bacteria 665
160 Ga0068861_100023118 3300005719 Bacteria 4481
161 Ga0068861_100182200 3300005719 Bacteria 1749
162 Ga0068861_100951417 3300005719 Bacteria 817
163 Ga0068851_10057861 3300005834 Bacteria 1980
164 Ga0068863_100000587 3300005841 Bacteria 37032
165 Ga0068863_100005790 3300005841 Bacteria 12117
166 Ga0068863_100274958 3300005841 Bacteria 1631
167 Ga0068863_101877022 3300005841 Bacteria 609
168 Ga0068858_100002382 3300005842 Bacteria 19005
169 Ga0068858_100023382 3300005842 Bacteria 5757
170 Ga0068858_100196005 3300005842 Bacteria 1909
171 Ga0068858_101611154 3300005842 Bacteria 641
172 Ga0068860_100000127 3300005843 Bacteria 122766
173 Ga0068860_100013220 3300005843 Bacteria 8099
174 Ga0068860_100686690 3300005843 Bacteria 1033
175 Ga0068860_100889859 3300005843 Bacteria 906
176 Ga0068860_101059775 3300005843 Bacteria 829
177 Ga0068860_101284564 3300005843 Bacteria 753
178 Ga0068862_100000052 3300005844 Bacteria 144622
179 Ga0068862_100051689 3300005844 Bacteria 3515
180 Ga0068862_100081114 3300005844 Bacteria 2814
181 Ga0068862_101008391 3300005844 Bacteria 824
182 Ga0068862_102274687 3300005844 Bacteria 554
183 Ga0081455_10083171 3300005937 Bacteria 2616
184 Ga0081455_10146201 3300005937 Bacteria 1828
185 Ga0081538_10243648 3300005981 Bacteria 691
186 Ga0081540_1067006 3300005983 Bacteria 1679
187 Ga0081539_10013736 3300005985 Bacteria 6074
188 Ga0070717_10506350 3300006028 Bacteria 1091
189 Ga0070717_11074194 3300006028 Bacteria 733
190 Ga0075365_10000843 3300006038 Bacteria 12710
191 Ga0075365_10028705 3300006038 Bacteria 3550
192 Ga0075365_10059674 3300006038 Bacteria 2543
193 Ga0075365_10071618 3300006038 Bacteria 2334
194 Ga0075365_10348937 3300006038 Bacteria 1043
195 Ga0075365_10777140 3300006038 Bacteria 676
196 Ga0075368_10075572 3300006042 Bacteria 1366
197 Ga0075368_10129542 3300006042 Bacteria 1048
198 Ga0075363_100000535 3300006048 Bacteria 12269
199 Ga0075363_100000785 3300006048 Bacteria 10936
200 Ga0075363_100003343 3300006048 Bacteria 6809
201 Ga0075363_100008384 3300006048 Bacteria 4810
202 Ga0075363_100022489 3300006048 Bacteria 3187
203 Ga0075363_100023644 3300006048 Bacteria 3117
204 Ga0075363_100054952 3300006048 Bacteria 2131
205 Ga0075363_100076138 3300006048 Bacteria 1829
206 Ga0075363_100149202 3300006048 Bacteria 1319
207 Ga0075363_100210346 3300006048 Bacteria 1113
208 Ga0075363_100288359 3300006048 Bacteria 951
209 Ga0075363_100324560 3300006048 Bacteria 896
210 Ga0075363_100411214 3300006048 Bacteria 796
211 Ga0075363_100528703 3300006048 Bacteria 702
212 Ga0075364_10000965 3300006051 Bacteria 15156
213 Ga0075364_10003153 3300006051 Bacteria 9328
214 Ga0075364_10009265 3300006051 Bacteria 5902
215 Ga0075364_10022032 3300006051 Bacteria 4020
216 Ga0075364_10023732 3300006051 Bacteria 3886
217 Ga0075364_10045531 3300006051 Bacteria 2855
218 Ga0075364_10074288 3300006051 Bacteria 2242
219 Ga0075364_10102998 3300006051 Bacteria 1901
220 Ga0075364_10107659 3300006051 Bacteria 1858
221 Ga0075364_10112111 3300006051 Bacteria 1821
222 Ga0075364_10122701 3300006051 Bacteria 1740
223 Ga0075364_10283139 3300006051 Bacteria 1128
224 Ga0075364_10309832 3300006051 Bacteria 1075
225 Ga0075364_10856652 3300006051 Bacteria 619
226 Ga0070715_10003363 3300006163 Bacteria 5069
227 Ga0070715_10526314 3300006163 Bacteria 681
228 Ga0070716_100002843 3300006173 Bacteria 8063
229 Ga0070716_100660355 3300006173 Bacteria 794
230 Ga0070716_100893967 3300006173 Bacteria 695
231 Ga0070712_100001350 3300006175 Bacteria 14893
232 Ga0075362_10003867 3300006177 Bacteria 5318
233 Ga0075362_10008968 3300006177 Bacteria 3847
234 Ga0075362_10037050 3300006177 Bacteria 2137
235 Ga0075362_10290858 3300006177 Bacteria 809
236 Ga0075362_10404195 3300006177 Bacteria 689
237 Ga0075362_10411639 3300006177 Bacteria 683
238 Ga0075367_10002329 3300006178 Bacteria 8638
239 Ga0075367_10028683 3300006178 Bacteria 3177
240 Ga0075367_10048104 3300006178 Bacteria 2511
241 Ga0075367_10089814 3300006178 Bacteria 1868
242 Ga0075367_10158925 3300006178 Bacteria 1405
243 Ga0075367_10220930 3300006178 Bacteria 1186
244 Ga0075367_10482364 3300006178 Bacteria 786
245 Ga0075367_10660456 3300006178 Bacteria 665
246 Ga0075369_10003288 3300006186 Bacteria 5872
247 Ga0075369_10023078 3300006186 Bacteria 2570
248 Ga0075369_10039829 3300006186 Bacteria 2008
249 Ga0075369_10063171 3300006186 Bacteria 1619
250 Ga0075369_10064006 3300006186 Bacteria 1610
251 Ga0075369_10069309 3300006186 Bacteria 1551
252 Ga0075369_10155193 3300006186 Bacteria 1048
253 Ga0075369_10160946 3300006186 Bacteria 1029
254 Ga0075369_10231800 3300006186 Bacteria 856
255 Ga0075369_10233682 3300006186 Bacteria 852
256 Ga0075369_10436964 3300006186 Bacteria 619
257 Ga0075427_10069176 3300006194 Bacteria 627
258 Ga0075366_10081931 3300006195 Bacteria 1928
259 Ga0075366_10849595 3300006195 Bacteria 568
260 Ga0097621_100010921 3300006237 Bacteria 6667
261 Ga0097621_101124111 3300006237 Bacteria 738
262 Ga0075370_10000648 3300006353 Bacteria 13492
263 Ga0075370_10023860 3300006353 Bacteria 3373
264 Ga0075370_10029510 3300006353 Bacteria 3055
265 Ga0075370_10076350 3300006353 Bacteria 1921
266 Ga0075370_10105715 3300006353 Bacteria 1632
267 Ga0075370_10336813 3300006353 Bacteria 900
268 Ga0075370_10893715 3300006353 Bacteria 543
269 Ga0068871_100492804 3300006358 Bacteria 1104
270 Ga0075428_100000149 3300006844 Bacteria 63444
271 Ga0075428_100031764 3300006844 Bacteria 5833
272 Ga0075428_100185245 3300006844 Bacteria 2253
273 Ga0075428_101058774 3300006844 Bacteria 857
274 Ga0075430_100009262 3300006846 Bacteria 8321
275 Ga0075430_100365873 3300006846 Bacteria 1191
276 Ga0075430_100605345 3300006846 Bacteria 904
277 Ga0075431_100005842 3300006847 Bacteria 12176
278 Ga0075431_100018645 3300006847 Bacteria 7070
279 Ga0075431_100019173 3300006847 Bacteria 6972
280 Ga0075431_100028256 3300006847 Bacteria 5760
281 Ga0075431_100294654 3300006847 Bacteria 1640
282 Ga0075431_100936080 3300006847 Bacteria 835
283 Ga0075429_100007149 3300006880 Bacteria 9688
284 Ga0075429_101170758 3300006880 Bacteria 671
285 Ga0068865_100002335 3300006881 Bacteria 11195
286 Ga0068865_100212835 3300006881 Bacteria 1507
287 Ga0068865_100389288 3300006881 Bacteria 1139
288 Ga0068865_100653494 3300006881 Bacteria 894
289 Ga0068865_100794587 3300006881 Bacteria 816
290 Ga0075436_100437516 3300006914 Bacteria 951
291 Ga0097620_100003452 3300006931 Bacteria 16065
292 Ga0097620_100005109 3300006931 Bacteria 13333
293 Ga0097620_100508554 3300006931 Bacteria 1300
294 Ga0097620_101317736 3300006931 Bacteria 796
295 Ga0099795_10625780 3300007788 Bacteria 514
296 Ga0105250_10032933 3300009092 Bacteria 2080
297 Ga0105250_10101106 3300009092 Bacteria 1176
298 Ga0105250_10142565 3300009092 Bacteria 994
299 Ga0105250_10219287 3300009092 Bacteria 806
300 Ga0105240_11816418 3300009093 Bacteria 635
301 Ga0111539_10192125 3300009094 Bacteria 2382
302 Ga0111539_10222259 3300009094 Bacteria 2199
303 Ga0111539_10288376 3300009094 Bacteria 1910
304 Ga0111539_10966603 3300009094 Bacteria 990
305 Ga0111539_13251387 3300009094 Bacteria 524
306 Ga0105245_10011950 3300009098 Bacteria 7547
307 Ga0105245_10171540 3300009098 Bacteria 2066
308 Ga0105245_10182325 3300009098 Bacteria 2007
309 Ga0105245_10269204 3300009098 Bacteria 1661
310 Ga0105245_11961964 3300009098 Bacteria 639
311 Ga0105247_10006449 3300009101 Bacteria 7267
312 Ga0105247_10083726 3300009101 Bacteria 2015
313 Ga0105247_10590465 3300009101 Bacteria 822
314 Ga0114129_10015094 3300009147 Bacteria 10993
315 Ga0114129_10617842 3300009147 Bacteria 1402
316 Ga0114129_10759982 3300009147 Bacteria 1240
317 Ga0114129_12387134 3300009147 Bacteria 634
318 Ga0105243_10001073 3300009148 Bacteria 25026
319 Ga0105241_10013166 3300009174 Bacteria 6066
320 Ga0105241_12429982 3300009174 Bacteria 524
321 Ga0105241_12476927 3300009174 Bacteria 519
322 Ga0105242_10004109 3300009176 Bacteria 11322
323 Ga0105242_10125221 3300009176 Bacteria 2211
324 Ga0105242_10684066 3300009176 Bacteria 1002
325 Ga0105242_10801938 3300009176 Bacteria 932
326 Ga0105242_11470547 3300009176 Bacteria 711
327 Ga0105242_12328303 3300009176 Bacteria 582
328 Ga0105242_12645339 3300009176 Bacteria 551
329 Ga0105248_10000613 3300009177 Bacteria 40714
330 Ga0105248_10005533 3300009177 Bacteria 13875
331 Ga0105248_10007314 3300009177 Bacteria 12115
332 Ga0105248_11598551 3300009177 Bacteria 738
333 Ga0105237_10006996 3300009545 Bacteria 12430
334 Ga0105237_10188982 3300009545 Bacteria 2060
335 Ga0105237_10282487 3300009545 Bacteria 1662
336 Ga0105249_10000093 3300009553 Bacteria 122840
337 Ga0105249_10004135 3300009553 Bacteria 12537
338 Ga0105249_10027420 3300009553 Bacteria 5139
339 Ga0105249_10628648 3300009553 Bacteria 1130
340 Ga0105249_10714710 3300009553 Bacteria 1063
341 Ga0105249_12439618 3300009553 Bacteria 595
342 Ga0105239_10010185 3300010375 Bacteria 10531
343 Ga0105239_10095545 3300010375 Bacteria 3283
344 Ga0105239_10313117 3300010375 Bacteria 1769
345 Ga0105239_11030700 3300010375 Bacteria 946
346 Ga0105239_11119698 3300010375 Bacteria 906
347 Ga0105239_12694418 3300010375 Bacteria 580
348 Ga0105246_10101506 3300011119 Bacteria 2096
349 Ga0157371_10136635 3300013102 Bacteria 1746
350 Ga0157370_10082786 3300013104 Bacteria 3018
351 Ga0157370_10600735 3300013104 Bacteria 1007
352 Ga0157370_11321869 3300013104 Bacteria 649
353 Ga0157370_11490480 3300013104 Bacteria 608
354 Ga0157369_10138082 3300013105 Bacteria 2580
355 Ga0157369_10293035 3300013105 Bacteria 1694
356 Ga0157369_11025353 3300013105 Bacteria 844
357 Ga0157378_10000743 3300013297 Bacteria 30508
358 Ga0157378_10328550 3300013297 Bacteria 1488
359 Ga0157378_10349793 3300013297 Bacteria 1443
360 Ga0157378_12862289 3300013297 Bacteria 535
361 Ga0163162_10061938 3300013306 Bacteria 3780
362 Ga0163162_10142826 3300013306 Bacteria 2508
363 Ga0163162_11036167 3300013306 Bacteria 928
364 Ga0163162_11059403 3300013306 Bacteria 918
365 Ga0163162_11171122 3300013306 Bacteria 872
366 Ga0163162_11391936 3300013306 Bacteria 798
367 Ga0157372_10004762 3300013307 Bacteria 14406
368 Ga0157372_10171276 3300013307 Bacteria 2512
369 Ga0157372_11355637 3300013307 Bacteria 820
370 Ga0157375_10000151 3300013308 Bacteria 68008
371 Ga0157375_10396734 3300013308 Bacteria 1546
372 Ga0157375_11721510 3300013308 Bacteria 742
373 Ga0157375_12749082 3300013308 Bacteria 588
374 Ga0163163_10006842 3300014325 Bacteria 10008
375 Ga0157380_10000291 3300014326 Bacteria 30141
376 Ga0157380_10770812 3300014326 Bacteria 976
377 Ga0157380_13363251 3300014326 Bacteria 512
378 Ga0182008_10143223 3300014497 Bacteria 1196
379 Ga0157377_10021290 3300014745 Bacteria 3409
380 Ga0157379_10001953 3300014968 Bacteria 17056
381 Ga0157379_10052940 3300014968 Bacteria 3626
382 Ga0157379_10110944 3300014968 Bacteria 2463
383 Ga0157376_10037925 3300014969 Bacteria 3918
384 Ga0157376_10528048 3300014969 Bacteria 1164
385 Ga0157376_12336975 3300014969 Bacteria 574
386 Ga0163161_10000573 3300017792 Bacteria 29547
387 Ga0213874_10081093 3300021377 Bacteria 1051
388 Ga0213876_10011394 3300021384 Bacteria 4747
389 Ga0213876_10033559 3300021384 Bacteria 2706
390 Ga0213876_10379840 3300021384 Bacteria 751
391 Ga0213876_10551244 3300021384 Bacteria 613
392 Ga0213875_10010183 3300021388 Bacteria 4722
393 Ga0213875_10015500 3300021388 Bacteria 3707
394 Ga0209673_1043123 3300025273 Bacteria 1263
395 Ga0209051_1000011 3300025303 Bacteria 610828
396 Ga0209051_1038816 3300025303 Bacteria 1729
397 Ga0209051_1050309 3300025303 Bacteria 1396
398 Ga0207656_10563694 3300025321 Bacteria 581
399 Ga0207696_1036307 3300025711 Bacteria 1463
400 Ga0207692_10023120 3300025898 Bacteria 2870
401 Ga0207642_10008512 3300025899 Bacteria 3524
402 Ga0207642_10472514 3300025899 Bacteria 763
403 Ga0207710_10000090 3300025900 Bacteria 121405
404 Ga0207710_10007626 3300025900 Bacteria 4578
405 Ga0207710_10129888 3300025900 Bacteria 1209
406 Ga0207688_10000025 3300025901 Bacteria 48564
407 Ga0207680_10066701 3300025903 Bacteria 2214
408 Ga0207647_10284401 3300025904 Bacteria 943
409 Ga0207685_10078795 3300025905 Bacteria 1357
410 Ga0207699_11174990 3300025906 Bacteria 568
411 Ga0207645_10028129 3300025907 Bacteria 3630
412 Ga0207645_10276614 3300025907 Bacteria 1114
413 Ga0207645_10787265 3300025907 Unclassified 647
414 Ga0207684_10070998 3300025910 Bacteria 2959
415 Ga0207654_10267540 3300025911 Bacteria 1152
416 Ga0207707_10000402 3300025912 Bacteria 45224
417 Ga0207707_10101648 3300025912 Bacteria 2513
418 Ga0207707_11669802 3300025912 Bacteria 500
419 Ga0207671_10038555 3300025914 Bacteria 3541
420 Ga0207671_10084152 3300025914 Bacteria 2389
421 Ga0207671_10329934 3300025914 Bacteria 1208
422 Ga0207693_10000123 3300025915 Bacteria 69311
423 Ga0207663_10516986 3300025916 Bacteria 929
424 Ga0207660_10000506 3300025917 Bacteria 26042
425 Ga0207660_10007569 3300025917 Bacteria 7029
426 Ga0207662_10112348 3300025918 Bacteria 1700
427 Ga0207662_10388206 3300025918 Bacteria 944
428 Ga0207652_10000217 3300025921 Bacteria 60702
429 Ga0207652_10001296 3300025921 Bacteria 22239
430 Ga0207646_11076725 3300025922 Bacteria 708
431 Ga0207681_10006119 3300025923 Bacteria 7382
432 Ga0207681_10050343 3300025923 Bacteria 2818
433 Ga0207681_10510180 3300025923 Bacteria 986
434 Ga0207694_10218994 3300025924 Bacteria 1552
435 Ga0207650_10307495 3300025925 Bacteria 1296
436 Ga0207650_10784076 3300025925 Unclassified 807
437 Ga0207659_10087453 3300025926 Bacteria 2320
438 Ga0207659_10144638 3300025926 Bacteria 1850
439 Ga0207659_10154930 3300025926 Bacteria 1793
440 Ga0207687_10003568 3300025927 Bacteria 10469
441 Ga0207687_10263461 3300025927 Bacteria 1375
442 Ga0207687_10886541 3300025927 Bacteria 763
443 Ga0207700_10010231 3300025928 Bacteria 5904
444 Ga0207700_10044908 3300025928 Bacteria 3256
445 Ga0207700_11207177 3300025928 Bacteria 675
446 Ga0207664_10003405 3300025929 Bacteria 10594
447 Ga0207664_10129362 3300025929 Bacteria 2124
448 Ga0207664_10344078 3300025929 Bacteria 1319
449 Ga0207664_10453688 3300025929 Bacteria 1144
450 Ga0207664_10717640 3300025929 Bacteria 899
451 Ga0207664_10964224 3300025929 Bacteria 765
452 Ga0207690_10045749 3300025932 Bacteria 2893
453 Ga0207706_10007184 3300025933 Bacteria 10303
454 Ga0207706_10155804 3300025933 Bacteria 2009
455 Ga0207706_10307900 3300025933 Bacteria 1380
456 Ga0207706_10474696 3300025933 Bacteria 1081
457 Ga0207686_10038333 3300025934 Bacteria 2899
458 Ga0207686_10274046 3300025934 Bacteria 1243
459 Ga0207709_10020867 3300025935 Bacteria 3701
460 Ga0207709_10269791 3300025935 Bacteria 1252
461 Ga0207709_10405595 3300025935 Bacteria 1043
462 Ga0207709_10543260 3300025935 Bacteria 913
463 Ga0207670_10061860 3300025936 Bacteria 2556
464 Ga0207669_10018729 3300025937 Bacteria 3587
465 Ga0207669_10141807 3300025937 Bacteria 1669
466 Ga0207669_10311392 3300025937 Bacteria 1201
467 Ga0207704_10003808 3300025938 Bacteria 6865
468 Ga0207704_10591262 3300025938 Unclassified 907
469 Ga0207665_10002883 3300025939 Bacteria 11537
470 Ga0207665_10338155 3300025939 Bacteria 1134
471 Ga0207665_10643357 3300025939 Bacteria 831
472 Ga0207691_10221043 3300025940 Bacteria 1642
473 Ga0207691_10264201 3300025940 Bacteria 1483
474 Ga0207691_10323111 3300025940 Bacteria 1323
475 Ga0207691_11541314 3300025940 Bacteria 542
476 Ga0207711_10000183 3300025941 Bacteria 67270
477 Ga0207711_10038685 3300025941 Bacteria 4057
478 Ga0207711_10067663 3300025941 Bacteria 3092
479 Ga0207689_10006918 3300025942 Bacteria 9977
480 Ga0207661_10021412 3300025944 Bacteria 4844
481 Ga0207661_10337513 3300025944 Bacteria 1357
482 Ga0207661_11372461 3300025944 Bacteria 649
483 Ga0207661_11579440 3300025944 Bacteria 600
484 Ga0207679_10454472 3300025945 Bacteria 1136
485 Ga0207667_10150511 3300025949 Bacteria 2395
486 Ga0207651_10173787 3300025960 Bacteria 1702
487 Ga0207651_11247274 3300025960 Bacteria 668
488 Ga0207651_11504309 3300025960 Bacteria 606
489 Ga0207712_10000073 3300025961 Bacteria 123046
490 Ga0207712_10005837 3300025961 Bacteria 7759
491 Ga0207712_10061158 3300025961 Bacteria 2672
492 Ga0207712_10869045 3300025961 Bacteria 796
493 Ga0207668_10034633 3300025972 Bacteria 3355
494 Ga0207668_10631751 3300025972 Bacteria 935
495 Ga0207668_10860760 3300025972 Bacteria 805
496 Ga0207668_10914258 3300025972 Bacteria 781
497 Ga0207668_10968686 3300025972 Bacteria 759
498 Ga0207668_11348726 3300025972 Bacteria 643
499 Ga0207668_11535255 3300025972 Bacteria 601
500 Ga0207668_11743738 3300025972 Bacteria 562
501 Ga0207640_10028509 3300025981 Bacteria 3415
502 Ga0207640_10079030 3300025981 Bacteria 2241
503 Ga0207658_10000975 3300025986 Bacteria 23607
504 Ga0207658_10036659 3300025986 Bacteria 3517
505 Ga0207658_10044863 3300025986 Bacteria 3220
506 Ga0207658_10079661 3300025986 Bacteria 2506
507 Ga0207658_10610708 3300025986 Bacteria 980
508 Ga0207703_10012758 3300026035 Bacteria 6551
509 Ga0207703_10111945 3300026035 Bacteria 2331
510 Ga0207703_11755741 3300026035 Bacteria 596
511 Ga0207639_10075588 3300026041 Bacteria 2649
512 Ga0207639_12202466 3300026041 Bacteria 512
513 Ga0207678_10010947 3300026067 Bacteria 7971
514 Ga0207678_10219477 3300026067 Bacteria 1627
515 Ga0207678_10290868 3300026067 Bacteria 1403
516 Ga0207708_10000452 3300026075 Bacteria 31890
517 Ga0207708_10597714 3300026075 Bacteria 934
518 Ga0207708_11109041 3300026075 Bacteria 690
519 Ga0207702_10300591 3300026078 Bacteria 1523
520 Ga0207641_10003420 3300026088 Bacteria 14062
521 Ga0207641_10020200 3300026088 Bacteria 5468
522 Ga0207641_10276373 3300026088 Bacteria 1578
523 Ga0207648_10000381 3300026089 Bacteria 48976
524 Ga0207648_10259340 3300026089 Bacteria 1551
525 Ga0207676_10196779 3300026095 Bacteria 1778
526 Ga0207675_100000406 3300026118 Bacteria 41422
527 Ga0207675_100753480 3300026118 Bacteria 985
528 Ga0207675_101715997 3300026118 Bacteria 648
529 Ga0207675_102545958 3300026118 Bacteria 522
530 Ga0207683_10000310 3300026121 Bacteria 44091
531 Ga0207683_10025548 3300026121 Bacteria 5096
532 Ga0207683_10054614 3300026121 Bacteria 3502
533 Ga0207698_10034664 3300026142 Bacteria 3682
534 Ga0209813_10025528 3300027866 Bacteria 1700
535 Ga0209813_10056684 3300027866 Bacteria 1240
536 Ga0207428_10362872 3300027907 Bacteria 1065
537 Ga0207428_11206825 3300027907 Bacteria 526
538 Ga0268266_10032217 3300028379 Bacteria 4454
539 Ga0268266_10126407 3300028379 Bacteria 2282
540 Ga0268266_10392572 3300028379 Bacteria 1311
541 Ga0268265_10000063 3300028380 Bacteria 144643
542 Ga0268265_10191063 3300028380 Bacteria 1768
543 Ga0268265_10295223 3300028380 Bacteria 1457
544 Ga0268265_12652593 3300028380 Bacteria 507
545 Ga0268264_10000007 3300028381 Bacteria 815790
546 Ga0268264_10034118 3300028381 Bacteria 4184
547 Ga0268264_10468416 3300028381 Bacteria 1223
548 Ga0268264_10947069 3300028381 Bacteria 866
549 Ga0265334_10052936 3300028573 Bacteria 1552
550 Ga0265322_10159889 3300028654 Bacteria 644
551 Ga0307517_10005164 3300028786 Bacteria 19809
552 Ga0307517_10329930 3300028786 Bacteria 839
553 Ga0265338_10000221 3300028800 Bacteria 105982
554 Ga0265338_10124224 3300028800 Bacteria 2051
555 Ga0265325_10001860 3300031241 Bacteria 14575
556 Ga0265339_10021949 3300031249 Bacteria 3704
557 Ga0265327_10002277 3300031251 Bacteria 20626
558 Ga0265327_10004299 3300031251 Bacteria 12720
559 Ga0265316_10067864 3300031344 Bacteria 2757
560 Ga0307509_10214281 3300031507 Bacteria 1747
561 Ga0307509_10358374 3300031507 Bacteria 1179
562 Ga0307408_100970249 3300031548 Bacteria 782
563 Ga0265313_10001360 3300031595 Bacteria 23016
564 Ga0307508_10063781 3300031616 Bacteria 3250
565 Ga0307508_10166743 3300031616 Bacteria 1806
566 Ga0265314_10122744 3300031711 Bacteria 1632
567 Ga0265342_10261441 3300031712 Bacteria 921
568 Ga0307516_10000001 3300031730 Bacteria 510338
569 Ga0307516_10082483 3300031730 Bacteria 3057
570 Ga0307413_10035991 3300031824 Bacteria 2846
571 Ga0307413_10049067 3300031824 Bacteria 2528
572 Ga0307410_10021678 3300031852 Bacteria 3955
573 Ga0307410_11564827 3300031852 Bacteria 582
574 Ga0307409_100238718 3300031995 Bacteria 1653
575 Ga0307409_100489179 3300031995 Bacteria 1195
576 Ga0307416_100144956 3300032002 Bacteria 2166
577 Ga0307416_101117758 3300032002 Bacteria 893
578 Ga0307416_102004055 3300032002 Bacteria 682
579 Ga0307416_102613699 3300032002 Bacteria 602
580 Ga0307411_10033435 3300032005 Bacteria 3190
581 Ga0307415_100028762 3300032126 Bacteria 3542
582 Ga0307415_100393402 3300032126 Bacteria 1181
583 Ga0307415_101206034 3300032126 Bacteria 713
584 Ga0307507_10000003 3300033179 Bacteria 371707
585 Ga0307510_10035941 3300033180 Bacteria 5522
586 Ga0307510_10324088 3300033180 Bacteria 997
587 Ga0373936_0135331 3300035113 Bacteria 1061
588 Ga0373941_0176247 3300035115 Bacteria 800
589 Ga0373943_0260508 3300035170 Bacteria 976
590 Ga0373946_0661367 3300035171 Bacteria 544
591 Ga0373931_1251428 3300035691 Bacteria 509
592 Ga0373937_0912799 3300036401 Bacteria 827
593 Ga0373925_1117495 3300037068 Bacteria 648
594 Ga0436364_0645816 3300037853 Bacteria 2519
595 Ga0436364_0932842 3300037853 Bacteria 11199
596 Ga0436364_0943073 3300037853 Bacteria 18642
597 Ga0436365_0124560 3300039437 Bacteria 70307
598 Ga0436365_0431983 3300039437 Bacteria 5993
599 Ga0436365_0775305 3300039437 Bacteria 25601
600 Ga0436365_0811759 3300039437 Bacteria 3584
601 Ga0436365_0929971 3300039437 Bacteria 2501
602 Ga0436365_1129713 3300039437 Bacteria 683
603 Ga0436365_1722545 3300039437 Bacteria 16488
604 Ga0436360_1146012 3300039438 Bacteria 619
605 Ga0436360_1275343 3300039438 Bacteria 725
606 Ga0436361_0032023 3300039447 Bacteria 525
607 Ga0436361_0782782 3300039447 Bacteria 1188
608 Ga0436361_0844996 3300039447 Bacteria 716
609 Ga0436363_0798419 3300039450 Bacteria 2918
610 Ga0436363_0971284 3300039450 Bacteria 633
611 Ga0436363_0996389 3300039450 Bacteria 511
612 Ga0436363_1196451 3300039450 Bacteria 1119
613 Ga0439461_0053233 3300041410 Bacteria 903
614 Ga0439465_0002031 3300041413 Bacteria 6636
615 Ga0439465_0017976 3300041413 Bacteria 2209
616 Ga0451789_0755581 3300041443 Bacteria 536
617 Ga0451791_1293266 3300041451 Bacteria 1257
618 Ga0451793_0493536 3300041452 Bacteria 726
619 Ga0451795_1661774 3300041456 Bacteria 613
620 Ga0451802_0625630 3300041460 Bacteria 579
621 Ga0451804_0159783 3300041463 Unclassified 722
622 Ga0451851_0772599 3300041507 Bacteria 554
623 Ga0451853_1445305 3300041512 Bacteria 771
624 Ga0451853_3576008 3300041512 Bacteria 1055
625 Ga0439431_0059774 3300041997 Bacteria 1001
626 Ga0439442_012761 3300042002 Bacteria 1719
627 Ga0439445_0046199 3300042004 Bacteria 1167
628 Ga0439448_0016952 3300042005 Bacteria 2220
629 Ga0439448_0199083 3300042005 Bacteria 702
630 Ga0439434_0074531 3300042435 Bacteria 1071
631 Ga0466969_0100727 3300044656 Bacteria 1360
632 Ga0466972_0061126 3300044658 Bacteria 1807
633 Ga0466972_0065620 3300044658 Bacteria 1736
634 Ga0466965_0038429 3300044683 Bacteria 2351
635 Ga0466965_0163461 3300044683 Bacteria 1168
636 Ga0466965_0203611 3300044683 Bacteria 1050
637 Ga0466965_0390310 3300044683 Bacteria 768
638 Ga0466965_0785734 3300044683 Bacteria 550
639 Ga0466966_0008881 3300044684 Bacteria 6655
640 Ga0466966_0018926 3300044684 Bacteria 4537
641 Ga0466966_0035446 3300044684 Bacteria 3222
642 Ga0466966_0040777 3300044684 Bacteria 2987
643 Ga0466961_0012470 3300044693 Bacteria 5439
644 Ga0466961_0031971 3300044693 Bacteria 3381
645 Ga0466961_0073736 3300044693 Bacteria 2164
646 Ga0466963_0020412 3300044694 Bacteria 4166
647 Ga0466963_0067268 3300044694 Bacteria 2404
648 Ga0466963_0082463 3300044694 Bacteria 2180
649 Ga0466963_0087302 3300044694 Bacteria 2121
650 Ga0466963_0106318 3300044694 Bacteria 1924
651 Ga0466963_0168372 3300044694 Bacteria 1527
652 Ga0466963_0839633 3300044694 Bacteria 648
653 Ga0466963_0932628 3300044694 Bacteria 612
654 Ga0466964_0105968 3300044706 Bacteria 1247
655 Ga0466971_0009847 3300044719 Bacteria 4174
656 Ga0466971_0029934 3300044719 Bacteria 2436
657 Ga0466971_0073873 3300044719 Bacteria 1550
658 Ga0466968_0005412 3300044735 Bacteria 4783
659 Ga0466968_0235306 3300044735 Bacteria 866
660 Ga0466970_0016759 3300044765 Bacteria 3781
661 Ga0466970_0037488 3300044765 Bacteria 2569
662 Ga0466970_0161924 3300044765 Bacteria 1238
663 Ga0466957_0007139 3300044842 Bacteria 6317
664 Ga0466957_0064280 3300044842 Bacteria 2257
665 Ga0466957_0224006 3300044842 Bacteria 1243
666 Ga0466957_0269565 3300044842 Bacteria 1136
667 Ga0466960_0000194 3300044901 Bacteria 20982
668 Ga0466960_0003452 3300044901 Bacteria 6080
669 Ga0466960_0254894 3300044901 Bacteria 976
670 Ga0466959_0002618 3300045049 Bacteria 11549
671 Ga0466959_0011944 3300045049 Bacteria 6261
672 Ga0466959_0131781 3300045049 Bacteria 1771
673 Ga0466959_0683834 3300045049 Bacteria 688
674 Ga0451576_1285707 3300045051 Bacteria 763
675 Ga0451576_1751290 3300045051 Bacteria 643
676 Ga0466958_0000674 3300045836 Bacteria 14797
677 Ga0466958_0036494 3300045836 Bacteria 2942
678 Ga0466958_0052217 3300045836 Bacteria 2477
679 Ga0466958_0563218 3300045836 Bacteria 741
680 Ga0466967_0005060 3300045976 Bacteria 9043
681 Ga0466967_0007373 3300045976 Bacteria 7926
682 Ga0466967_0014658 3300045976 Bacteria 6117
683 Ga0466967_0028027 3300045976 Bacteria 4695
684 Ga0466967_0092395 3300045976 Bacteria 2751
685 Ga0466967_0139301 3300045976 Bacteria 2259
686 Ga0466967_0183923 3300045976 Bacteria 1972
687 Ga0466967_0217630 3300045976 Bacteria 1814
688 Ga0466967_0326906 3300045976 Bacteria 1480
689 Ga0466967_0359398 3300045976 Bacteria 1411
690 Ga0466967_0761862 3300045976 Bacteria 960
691 Ga0466967_0827006 3300045976 Bacteria 920
692 Ga0466967_1759639 3300045976 Bacteria 617
693 Ga0466967_1933990 3300045976 Bacteria 587
694 Ga0495603_0003651 3300046455 Bacteria 9156
695 Ga0495603_0252830 3300046455 Bacteria 1014
696 Ga0495590_0192315 3300046457 Bacteria 748
697 Ga0495629_0244507 3300046459 Bacteria 1235
698 Ga0495638_0222091 3300046460 Bacteria 1055
699 Ga0495638_0257159 3300046460 Bacteria 960
700 Ga0495638_0409749 3300046460 Bacteria 701
701 Ga0495638_0551577 3300046460 Bacteria 573
702 Ga0495641_0197531 3300046461 Bacteria 901
703 Ga0495651_0070329 3300046462 Bacteria 2663
704 Ga0495582_0028970 3300046473 Bacteria 3040
705 Ga0495582_0731158 3300046473 Bacteria 573
706 Ga0495582_0780710 3300046473 Bacteria 553
707 Ga0495605_0007783 3300046474 Bacteria 6070
708 Ga0495662_0242291 3300046476 Bacteria 888
709 Ga0495584_0432888 3300046491 Bacteria 669
710 Ga0495585_0070742 3300046492 Bacteria 1902
711 Ga0495585_0130002 3300046492 Bacteria 1326
712 Ga0495594_0123051 3300046499 Bacteria 1467
713 Ga0495594_0261522 3300046499 Bacteria 985
714 Ga0495594_0617237 3300046499 Bacteria 614
715 Ga0495594_0877230 3300046499 Bacteria 504
716 Ga0495607_0080852 3300046501 Bacteria 1785
717 Ga0495607_0141171 3300046501 Bacteria 1242
718 Ga0495583_0108409 3300046506 Bacteria 1178
719 Ga0495606_0006829 3300046507 Bacteria 10419
720 Ga0495608_0511536 3300046511 Bacteria 726
721 Ga0495616_0004697 3300046513 Bacteria 8564
722 Ga0495618_0286371 3300046514 Bacteria 1026
723 Ga0495620_0002171 3300046515 Bacteria 11400
724 Ga0495620_0190978 3300046515 Bacteria 790
725 Ga0495628_0035763 3300046516 Bacteria 3990
726 Ga0495632_0091654 3300046519 Bacteria 1440
727 Ga0495643_0064704 3300046522 Bacteria 1931
728 Ga0495644_0157337 3300046523 Bacteria 871
729 Ga0495648_0046653 3300046524 Bacteria 2683
730 Ga0495666_0142003 3300046526 Bacteria 1119
731 Ga0495666_0201599 3300046526 Bacteria 914
732 Ga0495640_0088801 3300046533 Bacteria 2042
733 Ga0495609_0026688 3300046538 Bacteria 2643
734 Ga0495622_0026457 3300046557 Bacteria 2708
735 Ga0495622_0034397 3300046557 Bacteria 2364
736 Ga0495633_0013663 3300046558 Bacteria 4270
737 Ga0495633_0046775 3300046558 Bacteria 2046
738 Ga0495668_0020805 3300046616 Bacteria 3768
739 Ga0495668_0421615 3300046616 Bacteria 734
740 Ga0495668_0435009 3300046616 Bacteria 722
741 Ga0495634_0057516 3300046642 Bacteria 2595
742 Ga0495634_0271931 3300046642 Bacteria 1031
743 Ga0495611_0202091 3300046648 Bacteria 926
744 Ga0495625_0100778 3300046660 Bacteria 1984
745 Ga0495635_0177393 3300046663 Bacteria 1448
746 Ga0495635_0960329 3300046663 Unclassified 545
747 Ga0495635_1088194 3300046663 Bacteria 506
748 Ga0495661_0040957 3300046665 Bacteria 2869
749 Ga0495588_0758252 3300046674 Bacteria 507
750 Ga0495657_0112827 3300046675 Bacteria 1720
751 Ga0495657_0609342 3300046675 Bacteria 631
752 Ga0495647_0325113 3300046681 Bacteria 697
753 Ga0495658_0061248 3300046683 Bacteria 2160
754 Ga0495613_0173248 3300046689 Bacteria 1530
755 Ga0495613_0618091 3300046689 Bacteria 719
756 Ga0495613_0666537 3300046689 Bacteria 687
757 Ga0495613_0975488 3300046689 Bacteria 545
758 Ga0495624_0231763 3300046690 Bacteria 1118
759 Ga0495670_0006912 3300046691 Bacteria 5588
760 Ga0495671_0111047 3300046692 Bacteria 1339
761 Ga0495649_0078661 3300046694 Bacteria 1764
762 Ga0495589_0042163 3300046794 Bacteria 2274
763 Ga0495589_0060671 3300046794 Bacteria 1857
764 Ga0495600_0061704 3300046809 Bacteria 2449
765 Ga0495660_0061085 3300046810 Bacteria 2022
766 Ga0495581_0059362 3300047315 Bacteria 2210
767 Ga0495604_0209906 3300047317 Bacteria 1346
768 Ga0495604_0285507 3300047317 Bacteria 1113
769 Ga0495636_0010553 3300047318 Bacteria 3649
770 Ga0495674_0032073 3300047319 Bacteria 4769
771 Ga0495674_0162530 3300047319 Bacteria 1868
772 Ga0495674_0692201 3300047319 Bacteria 801
773 Ga0495672_0495686 3300047320 Bacteria 544
774 Ga0495676_0096899 3300047321 Bacteria 2191
775 Ga0495676_0128039 3300047321 Bacteria 1837
776 Ga0495676_0259521 3300047321 Bacteria 1182
777 Ga0495680_0534145 3300047322 Bacteria 792
778 Ga0495680_1085768 3300047322 Unclassified 506
779 Ga0495683_0053204 3300047323 Bacteria 2019
780 Ga0495687_011000 3300047443 Bacteria 4904
781 Ga0495687_167764 3300047443 Bacteria 730
782 Ga0495679_065689 3300047446 Bacteria 1055
783 Ga0495685_008124 3300047447 Bacteria 3476
784 Ga0495685_026967 3300047447 Bacteria 1976
785 Ga0495681_0025141 3300047470 Bacteria 3120
786 Ga0495681_0051664 3300047470 Bacteria 1932
787 Ga0495686_0031599 3300047472 Bacteria 3432
788 Ga0495686_0070052 3300047472 Bacteria 2161
789 Ga0495686_0235508 3300047472 Bacteria 1035
790 Ga0495593_0018948 3300047673 Bacteria 3862
791 Ga0495626_0028939 3300048091 Bacteria 2683
792 Ga0496100_0001669 3300048903 Bacteria 11013
793 Ga0496100_0013741 3300048903 Bacteria 4682
794 Ga0496100_0684805 3300048903 Bacteria 800
795 Ga0496101_0001611 3300048904 Bacteria 13577
796 Ga0496101_0002434 3300048904 Bacteria 11438
797 Ga0496101_0120636 3300048904 Bacteria 1982
798 Ga0496101_0215292 3300048904 Bacteria 1489
799 Ga0496102_0000168 3300048905 Bacteria 88511
800 Ga0496102_0001601 3300048905 Bacteria 19957
801 Ga0496102_0490060 3300048905 Bacteria 1151
802 Ga0496102_0548226 3300048905 Bacteria 1079
803 Ga0496102_0750573 3300048905 Bacteria 899
804 Ga0496102_0865368 3300048905 Bacteria 826
805 Ga0496103_0002680 3300048906 Bacteria 11131
806 Ga0496103_0004047 3300048906 Bacteria 8911
807 Ga0496103_0956389 3300048906 Bacteria 535
808 Ga0496104_0022846 3300048907 Bacteria 5747
809 Ga0496104_0277954 3300048907 Bacteria 1587
810 Ga0496104_0381144 3300048907 Bacteria 1323
811 Ga0496104_1338204 3300048907 Bacteria 619
812 Ga0496105_0036262 3300048908 Bacteria 4062
813 Ga0496105_1392669 3300048908 Bacteria 508
814 Ga0496106_0033141 3300048909 Bacteria 3853
815 Ga0496106_0044941 3300048909 Bacteria 3316
816 Ga0496107_0005374 3300048910 Bacteria 8764
817 Ga0496107_0032901 3300048910 Bacteria 3707
818 Ga0496107_1230920 3300048910 Bacteria 537
819 Ga0496108_0037725 3300048911 Bacteria 4026
820 Ga0496108_0538871 3300048911 Bacteria 1019
821 Ga0496108_0626033 3300048911 Bacteria 937
822 Ga0496108_0867832 3300048911 Bacteria 776
823 Ga0496109_0024357 3300048912 Bacteria 5380
824 Ga0496109_0108847 3300048912 Bacteria 2576
825 Ga0496109_0121952 3300048912 Bacteria 2429
826 Ga0496109_0318339 3300048912 Bacteria 1468
827 Ga0496109_0494179 3300048912 Bacteria 1155
828 Ga0496109_1146898 3300048912 Bacteria 714
829 Ga0496110_0085304 3300048913 Bacteria 2819
830 Ga0496110_0754378 3300048913 Bacteria 876
831 Ga0496111_0603871 3300048914 Bacteria 803
832 Ga0496112_0006249 3300048915 Bacteria 10439
833 Ga0496112_0011898 3300048915 Bacteria 7971
834 Ga0496112_0040884 3300048915 Bacteria 4534
835 Ga0496112_0113635 3300048915 Bacteria 2679
836 Ga0496112_0157021 3300048915 Bacteria 2242
837 Ga0496112_0490138 3300048915 Bacteria 1165
838 Ga0496112_0605513 3300048915 Bacteria 1027
839 Ga0496112_0752338 3300048915 Bacteria 901
840 Ga0496113_0087851 3300048916 Bacteria 2391
841 Ga0496113_0240100 3300048916 Bacteria 1446
842 Ga0496113_1109105 3300048916 Bacteria 620
843 Ga0496114_0000419 3300048917 Bacteria 31425
844 Ga0496114_0012385 3300048917 Bacteria 6826
845 Ga0496114_0994954 3300048917 Bacteria 722
846 Ga0496115_0000875 3300048918 Bacteria 21881
847 Ga0496115_0074275 3300048918 Bacteria 2760
848 Ga0496115_0229278 3300048918 Bacteria 1532
849 Ga0496115_0245913 3300048918 Bacteria 1474
850 Ga0496116_0126181 3300048919 Bacteria 1469
851 Ga0496117_0001651 3300048920 Bacteria 31339
852 Ga0496118_0005957 3300048921 Bacteria 13610
853 Ga0496119_0012379 3300048922 Bacteria 6936
854 Ga0496120_0014792 3300048923 Bacteria 5177
855 Ga0496121_0015881 3300048924 Bacteria 7823
856 Ga0496121_0670080 3300048924 Bacteria 629
857 Ga0496125_0078976 3300048928 Bacteria 2526
858 Ga0496125_0135199 3300048928 Bacteria 1726
859 Ga0496126_0000750 3300048929 Bacteria 58851
860 Ga0496126_0014023 3300048929 Bacteria 8122
861 Ga0496126_0025811 3300048929 Bacteria 5645
862 Ga0496126_0235398 3300048929 Bacteria 1532
863 Ga0495678_024313 3300049459 Bacteria 2617
864 Ga0495682_0021736 3300049460 Bacteria 2403
865 Ga0501032_0028158 3300049569 Bacteria 3861
866 Ga0501033_0023718 3300049570 Bacteria 4627
867 Ga0501033_0067390 3300049570 Bacteria 2632
868 Ga0501033_0934959 3300049570 Bacteria 582
869 Ga0501034_0042343 3300049571 Bacteria 4609
870 Ga0501034_0368436 3300049571 Bacteria 1363
871 Ga0501036_0268729 3300049572 Bacteria 1428
872 Ga0501036_0725686 3300049572 Bacteria 820
873 Ga0501037_0126643 3300049573 Bacteria 1833
874 Ga0501038_0996468 3300049574 Bacteria 615
875 Ga0501039_0505547 3300049575 Bacteria 949
876 Ga0501041_0362119 3300049577 Bacteria 917
877 Ga0501043_0188579 3300049579 Bacteria 1604
878 Ga0501046_0009507 3300049580 Bacteria 8402
879 Ga0501047_0046399 3300049581 Bacteria 4199
880 Ga0501047_0076262 3300049581 Bacteria 3226
881 Ga0501047_0088540 3300049581 Bacteria 2973
882 Ga0501047_0699554 3300049581 Bacteria 831
883 Ga0501048_0028626 3300049582 Bacteria 4044
884 Ga0501048_0891210 3300049582 Bacteria 640
885 Ga0501068_0206660 3300049584 Bacteria 1246
886 Ga0501069_0195600 3300049585 Bacteria 1171
887 Ga0501070_0008468 3300049586 Bacteria 8689
888 Ga0501070_0386661 3300049586 Bacteria 1133
889 Ga0501073_0160801 3300049589 Bacteria 1556
890 Ga0501073_0177304 3300049589 Bacteria 1475
891 Ga0501074_0758444 3300049590 Bacteria 684
892 Ga0501075_0686835 3300049591 Bacteria 780
893 Ga0501076_1598614 3300049592 Bacteria 535
894 Ga0501077_1103227 3300049593 Bacteria 511
895 Ga0501079_0228171 3300049741 Bacteria 1455
896 Ga0501079_1196575 3300049741 Bacteria 599
897 Ga0501080_0363369 3300049742 Bacteria 1306
898 Ga0501080_1441077 3300049742 Bacteria 587
899 Ga0501081_1138899 3300049743 Bacteria 591
900 Ga0501035_0033426 3300049822 Bacteria 4677
901 Ga0501044_0026363 3300049823 Bacteria 6153
902 Ga0501044_1117964 3300049823 Bacteria 657
903 nmdc:mga03683_102347_c1 3300050489 Bacteria 1260
904 nmdc:mga03683_38315_c1 3300050489 Bacteria 1957
905 nmdc:mga03683_508292_c1 3300050489 Bacteria 584
906 nmdc:mga03683_93599_c1 3300050489 Bacteria 1313
907 nmdc:mga03n38_1269_c1 3300050490 Bacteria 7098
908 nmdc:mga03n38_13838_c1 3300050490 Bacteria 3076
909 nmdc:mga03n38_19369_c1 3300050490 Bacteria 2704
910 nmdc:mga03n38_199940_c1 3300050490 Bacteria 1034
911 nmdc:mga03n38_242851_c1 3300050490 Bacteria 948
912 nmdc:mga03n38_268410_c1 3300050490 Bacteria 907
913 nmdc:mga03n38_297196_c1 3300050490 Bacteria 866
914 nmdc:mga03n38_342426_c1 3300050490 Bacteria 812
915 nmdc:mga03n38_39871_c1 3300050490 Bacteria 2038
916 nmdc:mga03n38_51456_c1 3300050490 Bacteria 1840
917 nmdc:mga03n38_69370_c1 3300050490 Bacteria 1627
918 nmdc:mga03n38_721_c1 3300050490 Bacteria 8696
919 nmdc:mga03n38_75787_c1 3300050490 Bacteria 1568
920 nmdc:mga03n38_810_c1 3300050490 Bacteria 8350
921 nmdc:mga00v17_1030539_c1 3300050491 Bacteria 517
922 nmdc:mga00v17_118410_c1 3300050491 Bacteria 1685
923 nmdc:mga00v17_15447_c1 3300050491 Bacteria 4286
924 nmdc:mga00v17_24485_c1 3300050491 Bacteria 3503
925 nmdc:mga00v17_301496_c1 3300050491 Bacteria 1041
926 nmdc:mga00v17_39864_c1 3300050491 Bacteria 2815
927 nmdc:mga00v17_4529_c1 3300050491 Bacteria 7239
928 nmdc:mga00v17_55120_c1 3300050491 Bacteria 2427
929 nmdc:mga00v17_7619_c1 3300050491 Bacteria 4598
930 nmdc:mga00v17_82102_c1 3300050491 Bacteria 2014
931 nmdc:mga00v17_897293_c1 3300050491 Bacteria 561
932 nmdc:mga0yw44_119096_c1 3300050492 Bacteria 1699
933 nmdc:mga0yw44_1470_c1 3300050492 Bacteria 9381
934 nmdc:mga0yw44_157737_c1 3300050492 Bacteria 1484
935 nmdc:mga0yw44_15825_c1 3300050492 Bacteria 4054
936 nmdc:mga0yw44_15926_c1 3300050492 Bacteria 4045
937 nmdc:mga0yw44_256551_c1 3300050492 Bacteria 1164
938 nmdc:mga0yw44_274123_c1 3300050492 Bacteria 1126
939 nmdc:mga0yw44_528082_c1 3300050492 Bacteria 801
940 nmdc:mga0yw44_6767_c2 3300050492 Bacteria 3220
941 nmdc:mga0yw44_759406_c1 3300050492 Bacteria 658
942 nmdc:mga0yw44_881136_c1 3300050492 Bacteria 607
943 nmdc:mga0k408_19089_c1 3300050493 Bacteria 3828
944 nmdc:mga0k408_301199_c1 3300050493 Bacteria 957
945 nmdc:mga0k408_655782_c1 3300050493 Bacteria 617
946 nmdc:mga06z11_126641_c1 3300050494 Bacteria 1430
947 nmdc:mga06z11_185625_c1 3300050494 Bacteria 1201
948 nmdc:mga06z11_18816_c1 3300050494 Bacteria 3163
949 nmdc:mga06z11_19932_c1 3300050494 Bacteria 3092
950 nmdc:mga06z11_354932_c1 3300050494 Bacteria 878
951 nmdc:mga06z11_558743_c1 3300050494 Bacteria 695
952 nmdc:mga06z11_58731_c1 3300050494 Bacteria 1996
953 nmdc:mga04h51_104144_c1 3300050495 Bacteria 1038
954 nmdc:mga04h51_170562_c1 3300050495 Bacteria 842
955 nmdc:mga04h51_409830_c1 3300050495 Bacteria 569
956 nmdc:mga07m45_106999_c1 3300050496 Bacteria 1609
957 nmdc:mga07m45_236129_c1 3300050496 Bacteria 1064
958 nmdc:mga07m45_39850_c1 3300050496 Bacteria 2627
959 nmdc:mga07m45_48663_c1 3300050496 Bacteria 2385
960 nmdc:mga07m45_70302_c1 3300050496 Bacteria 1991
961 nmdc:mga07m45_8837_c1 3300050496 Bacteria 5197
962 nmdc:mga05p37_16778_c1 3300050507 Bacteria 8828
963 nmdc:mga05p37_217211_c1 3300050507 Bacteria 2309
964 nmdc:mga05p37_582326_c1 3300050507 Bacteria 1267
965 nmdc:mga05p37_976245_c1 3300050507 Bacteria 903
966 nmdc:mga09592_124161_c1 3300050508 Bacteria 2219
967 nmdc:mga09592_124884_c1 3300050508 Bacteria 2212
968 nmdc:mga0qj67_110358_c1 3300050509 Bacteria 2220
969 nmdc:mga0qj67_13043_c1 3300050509 Bacteria 6275
970 nmdc:mga0qj67_360353_c1 3300050509 Bacteria 1175
971 nmdc:mga0qj67_55584_c1 3300050509 Bacteria 3136
972 nmdc:mga0qj67_5897_c1 3300050509 Bacteria 8975
973 nmdc:mga06r32_148206_c2 3300050510 Bacteria 1203
974 nmdc:mga06r32_15073_c1 3300050510 Bacteria 7020
975 nmdc:mga06r32_18748_c1 3300050510 Bacteria 6341
976 nmdc:mga06r32_274600_c1 3300050510 Bacteria 1673
977 nmdc:mga06r32_47833_c1 3300050510 Bacteria 4087
978 nmdc:mga08y16_2010030_c1 3300050511 Bacteria 527
979 nmdc:mga08y16_234662_c1 3300050511 Bacteria 1897
980 nmdc:mga08y16_238043_c1 3300050511 Bacteria 1882
981 nmdc:mga0sz30_121305_c1 3300050516 Bacteria 1149
982 nmdc:mga0sz30_128160_c1 3300050516 Bacteria 1117
983 nmdc:mga0sz30_18655_c3 3300050516 Bacteria 1104
984 nmdc:mga0sz30_25299_c1 3300050516 Bacteria 1513
985 nmdc:mga0sz30_29869_c1 3300050516 Bacteria 2249
986 nmdc:mga0sz30_38899_c1 3300050516 Bacteria 1994
987 nmdc:mga0sz30_58856_c1 3300050516 Bacteria 1639
988 nmdc:mga0sz30_71931_c1 3300050516 Bacteria 1489
989 nmdc:mga0sz30_7628_c1 3300050516 Bacteria 4063
990 nmdc:mga0sz30_79417_c1 3300050516 Bacteria 1419
991 Ga0500635_0017052 3300053080 Bacteria 2169
992 Ga0495619_0589153 3300053085 Bacteria 761
993 Ga0500578_0038473 3300053086 Bacteria 3072
994 Ga0500643_015545 3300053087 Bacteria 2606
995 Ga0500646_0178000 3300053090 Bacteria 719
996 Ga0500660_066782 3300053100 Bacteria 1705
997 Ga0500558_145231 3300053106 Bacteria 888
998 Ga0500560_219438 3300053107 Bacteria 607
999 Ga0500569_005158 3300053109 Bacteria 2795
1000 Ga0500594_0244617 3300053118 Bacteria 596
1001 Ga0500628_018732 3300053129 Bacteria 1369
1002 Ga0500652_001268 3300053131 Bacteria 8017
1003 Ga0500652_040195 3300053131 Bacteria 1878
1004 Ga0500561_0009146 3300053137 Bacteria 2000
1005 Ga0500573_0346939 3300053140 Bacteria 722
1006 Ga0500579_128238 3300053143 Bacteria 1198
1007 Ga0500616_0030957 3300053153 Bacteria 2935
1008 Ga0500627_0082504 3300053158 Bacteria 1434
1009 Ga0500633_0010331 3300053160 Bacteria 2491
1010 Ga0500634_0023973 3300053161 Bacteria 3317
1011 Ga0500645_000063 3300053730 Bacteria 85018
1012 Ga0500656_028837 3300053732 Bacteria 728
1013 Ga0500587_002606 3300053739 Bacteria 2559
1014 Ga0501084_0000240 3300054114 Bacteria 41460
1015 Ga0501084_0360896 3300054114 Bacteria 1228
1016 Ga0501082_0545713 3300060353 Bacteria 1014
1017 Ga0466962_0028193 3300061719 Bacteria 2690
1018 Ga0466962_0445667 3300061719 Bacteria 652
1019 Ga0530510_0193045 3300061734 Bacteria 1512
1020 2508676442 2508501039 Bacteria 9978592
1021 2689955741 2687453737 Bacteria 11203906
1022 2689956864 2687453737 Bacteria 11203906
1023 2738706167 2738541274 Bacteria 6909446
1024 2738890801 2738541308 Bacteria 7020677
1025 2738890809 2738541308 Bacteria 7020677
1026 2739332933 2738543028 Bacteria 6917070
1027 2809193523 2808606439 Bacteria 5952208
1028 2842140136 2842134933 Bacteria 5847019
1029 2895881684 2895880812 Bacteria 11255272
1030 2929216771 2929212328 Bacteria 7708288
1031 8002789107 8002784119 Bacteria 9788632
1032 Ga0075365_10106143
1033 CNXas_1005693
1034 JGI24747J21853_1041118
1035 JGI24739J22299_10014705
1036 JGI24739J22299_10076295
1037 JGI24737J22298_10189378
1038 JGI24750J21931_1019857
1039 JGI24748J21848_1011471
1040 JGI24749J21850_1002582
1041 JGI24744J21845_10005891
1042 JGI24034J26672_10002221
1043 JGI24034J26672_10019259
1044 JGI24742J22300_10003432
1045 JGI25406J46586_10203423
1046 Ga0070676_10088804
1047 Ga0070683_100031150
1048 Ga0070683_100302955
1049 Ga0070683_100313813
1050 Ga0070683_101842703
1051 Ga0070683_102298297
1052 Ga0070690_100005233
1053 Ga0070690_100763677
1054 Ga0070670_100138005
1055 Ga0070670_100301499
1056 Ga0070670_101811197
1057 Ga0068869_100009993
1058 Ga0070666_10561773
1059 Ga0070666_10576769
1060 Ga0070680_100001473
1061 Ga0070680_100089024
1062 Ga0070682_100019637
1063 Ga0070682_100399514
1064 Ga0068868_100006261
1065 Ga0068868_100879949
1066 Ga0070660_101076971
1067 Ga0070689_100043104
1068 Ga0070691_10008644
1069 Ga0070687_100315200
1070 Ga0070687_100807295
1071 Ga0070668_100020194
1072 Ga0070668_100208708
1073 Ga0070668_100278217
1074 Ga0070668_100286746
1075 Ga0070668_100329803
1076 Ga0070668_100685234
1077 Ga0070668_100917007
1078 Ga0070669_100062270
1079 Ga0070669_101363634
1080 Ga0070675_100048326
1081 Ga0070675_100076120
1082 Ga0070675_100749289
1083 Ga0070671_100448401
1084 Ga0070674_100034016
1085 Ga0070674_100072577
1086 Ga0070673_100335243
1087 Ga0070673_100590666
1088 Ga0070673_100612510
1089 Ga0070673_100953797
1090 Ga0070673_101945227
1091 Ga0070688_100139893
1092 Ga0070659_100064787
1093 Ga0070667_100000073
1094 Ga0070667_100050177
1095 Ga0070667_100057241
1096 Ga0070667_100100180
1097 Ga0070667_100284849
1098 Ga0070709_10526979
1099 Ga0070714_100004993
1100 Ga0070714_100385059
1101 Ga0070714_100599981
1102 Ga0070714_100781107
1103 Ga0070714_101051641
1104 Ga0070714_101299291
1105 Ga0070713_100030219
1106 Ga0070713_100048888
1107 Ga0070713_101606775
1108 Ga0070713_102480342
1109 Ga0070710_10003422
1110 Ga0070701_10013157
1111 Ga0070711_100003825
1112 Ga0070705_100003436
1113 Ga0070705_100860673
1114 Ga0070700_100001480
1115 Ga0070700_100334678
1116 Ga0070700_100833844
1117 Ga0070694_100007844
1118 Ga0070708_100193542
1119 Ga0070663_100005263
1120 Ga0070663_100712622
1121 Ga0070678_100028448
1122 Ga0070678_100306901
1123 Ga0070678_100308568
1124 Ga0070678_100834215
1125 Ga0070678_101069767
1126 Ga0070662_100036411
1127 Ga0070681_10000016
1128 Ga0070681_10132679
1129 Ga0070681_10365077
1130 Ga0070681_11117033
1131 Ga0070681_11988397
1132 Ga0068867_100000117
1133 Ga0070685_10002511
1134 Ga0070685_10163900
1135 Ga0070707_100048260
1136 Ga0070707_101678018
1137 Ga0070698_100022542
1138 Ga0070698_100564182
1139 Ga0070699_100143148
1140 Ga0070699_100242625
1141 Ga0070679_100007597
1142 Ga0070679_100137709
1143 Ga0070679_100587491
1144 Ga0070684_100050120
1145 Ga0070684_100086188
1146 Ga0070684_100383962
1147 Ga0070684_100406080
1148 Ga0070684_100440972
1149 Ga0070697_100153856
1150 Ga0068853_100001776
1151 Ga0068853_100692150
1152 Ga0068853_102157694
1153 Ga0070672_100229505
1154 Ga0070672_100251687
1155 Ga0070672_100422673
1156 Ga0070686_100465054
1157 Ga0070686_100478172
1158 Ga0070695_100006447
1159 Ga0070695_100249158
1160 Ga0070696_100008033
1161 Ga0070696_100354089
1162 Ga0070693_100003341
1163 Ga0070665_100004592
1164 Ga0070665_100006811
1165 Ga0070665_100026007
1166 Ga0070704_100011707
1167 Ga0070704_100116932
1168 Ga0068855_100043819
1169 Ga0070664_100181811
1170 Ga0070664_100336782
1171 Ga0070664_102344574
1172 Ga0068857_102210157
1173 Ga0068857_102501829
1174 Ga0068854_100000583
1175 Ga0068854_100033035
1176 Ga0068854_100391908
1177 Ga0068856_101967912
1178 Ga0068856_102194576
1179 Ga0070702_100390540
1180 Ga0068852_100099781
1181 Ga0068852_100528065
1182 Ga0068852_100943005
1183 Ga0068859_100003452
1184 Ga0068859_100005109
1185 Ga0068859_100508538
1186 Ga0068859_101317724
1187 Ga0068864_100187181
1188 Ga0068866_10002207
1189 Ga0068866_10486387
1190 Ga0068866_10772726
1191 Ga0068861_100023118
1192 Ga0068861_100182200
1193 Ga0068861_100951417
1194 Ga0068851_10057861
1195 Ga0068863_100000587
1196 Ga0068863_100005790
1197 Ga0068863_100274958
1198 Ga0068863_101877022
1199 Ga0068858_100002382
1200 Ga0068858_100023382
1201 Ga0068858_100196005
1202 Ga0068858_101611154
1203 Ga0068860_100000127
1204 Ga0068860_100013220
1205 Ga0068860_100686690
1206 Ga0068860_100889859
1207 Ga0068860_101059775
1208 Ga0068860_101284564
1209 Ga0068862_100000052
1210 Ga0068862_100051689
1211 Ga0068862_100081114
1212 Ga0068862_101008391
1213 Ga0068862_102274687
1214 Ga0081455_10083171
1215 Ga0081455_10146201
1216 Ga0081538_10243648
1217 Ga0081540_1067006
1218 Ga0081539_10013736
1219 Ga0070717_10506350
1220 Ga0070717_11074194
1221 Ga0075365_10000843
1222 Ga0075365_10028705
1223 Ga0075365_10059674
1224 Ga0075365_10071618
1225 Ga0075365_10348937
1226 Ga0075365_10777140
1227 Ga0075368_10075572
1228 Ga0075368_10129542
1229 Ga0075363_100000535
1230 Ga0075363_100000785
1231 Ga0075363_100003343
1232 Ga0075363_100008384
1233 Ga0075363_100022489
1234 Ga0075363_100023644
1235 Ga0075363_100054952
1236 Ga0075363_100076138
1237 Ga0075363_100149202
1238 Ga0075363_100210346
1239 Ga0075363_100288359
1240 Ga0075363_100324560
1241 Ga0075363_100411214
1242 Ga0075363_100528703
1243 Ga0075364_10000965
1244 Ga0075364_10003153
1245 Ga0075364_10009265
1246 Ga0075364_10022032
1247 Ga0075364_10023732
1248 Ga0075364_10045531
1249 Ga0075364_10074288
1250 Ga0075364_10102998
1251 Ga0075364_10107659
1252 Ga0075364_10112111
1253 Ga0075364_10122701
1254 Ga0075364_10283139
1255 Ga0075364_10309832
1256 Ga0075364_10856652
1257 Ga0070715_10003363
1258 Ga0070715_10526314
1259 Ga0070716_100002843
1260 Ga0070716_100660355
1261 Ga0070716_100893967
1262 Ga0070712_100001350
1263 Ga0075362_10003867
1264 Ga0075362_10008968
1265 Ga0075362_10037050
1266 Ga0075362_10290858
1267 Ga0075362_10404195
1268 Ga0075362_10411639
1269 Ga0075367_10002329
1270 Ga0075367_10028683
1271 Ga0075367_10048104
1272 Ga0075367_10089814
1273 Ga0075367_10158925
1274 Ga0075367_10220930
1275 Ga0075367_10482364
1276 Ga0075367_10660456
1277 Ga0075369_10003288
1278 Ga0075369_10023078
1279 Ga0075369_10039829
1280 Ga0075369_10063171
1281 Ga0075369_10064006
1282 Ga0075369_10069309
1283 Ga0075369_10155193
1284 Ga0075369_10160946
1285 Ga0075369_10231800
1286 Ga0075369_10233682
1287 Ga0075369_10436964
1288 Ga0075427_10069176
1289 Ga0075366_10081931
1290 Ga0075366_10849595
1291 Ga0097621_100010921
1292 Ga0097621_101124111
1293 Ga0075370_10000648
1294 Ga0075370_10023860
1295 Ga0075370_10029510
1296 Ga0075370_10076350
1297 Ga0075370_10105715
1298 Ga0075370_10336813
1299 Ga0075370_10893715
1300 Ga0068871_100492804
1301 Ga0075428_100000149
1302 Ga0075428_100031764
1303 Ga0075428_100185245
1304 Ga0075428_101058774
1305 Ga0075430_100009262
1306 Ga0075430_100365873
1307 Ga0075430_100605345
1308 Ga0075431_100005842
1309 Ga0075431_100018645
1310 Ga0075431_100019173
1311 Ga0075431_100028256
1312 Ga0075431_100294654
1313 Ga0075431_100936080
1314 Ga0075429_100007149
1315 Ga0075429_101170758
1316 Ga0068865_100002335
1317 Ga0068865_100212835
1318 Ga0068865_100389288
1319 Ga0068865_100653494
1320 Ga0068865_100794587
1321 Ga0075436_100437516
1322 Ga0097620_100003452
1323 Ga0097620_100005109
1324 Ga0097620_100508554
1325 Ga0097620_101317736
1326 Ga0099795_10625780
1327 Ga0105250_10032933
1328 Ga0105250_10101106
1329 Ga0105250_10142565
1330 Ga0105250_10219287
1331 Ga0105240_11816418
1332 Ga0111539_10192125
1333 Ga0111539_10222259
1334 Ga0111539_10288376
1335 Ga0111539_10966603
1336 Ga0111539_13251387
1337 Ga0105245_10011950
1338 Ga0105245_10171540
1339 Ga0105245_10182325
1340 Ga0105245_10269204
1341 Ga0105245_11961964
1342 Ga0105247_10006449
1343 Ga0105247_10083726
1344 Ga0105247_10590465
1345 Ga0114129_10015094
1346 Ga0114129_10617842
1347 Ga0114129_10759982
1348 Ga0114129_12387134
1349 Ga0105243_10001073
1350 Ga0105241_10013166
1351 Ga0105241_12429982
1352 Ga0105241_12476927
1353 Ga0105242_10004109
1354 Ga0105242_10125221
1355 Ga0105242_10684066
1356 Ga0105242_10801938
1357 Ga0105242_11470547
1358 Ga0105242_12328303
1359 Ga0105242_12645339
1360 Ga0105248_10000613
1361 Ga0105248_10005533
1362 Ga0105248_10007314
1363 Ga0105248_11598551
1364 Ga0105237_10006996
1365 Ga0105237_10188982
1366 Ga0105237_10282487
1367 Ga0105249_10000093
1368 Ga0105249_10004135
1369 Ga0105249_10027420
1370 Ga0105249_10628648
1371 Ga0105249_10714710
1372 Ga0105249_12439618
1373 Ga0105239_10010185
1374 Ga0105239_10095545
1375 Ga0105239_10313117
1376 Ga0105239_11030700
1377 Ga0105239_11119698
1378 Ga0105239_12694418
1379 Ga0105246_10101506
1380 Ga0157371_10136635
1381 Ga0157370_10082786
1382 Ga0157370_10600735
1383 Ga0157370_11321869
1384 Ga0157370_11490480
1385 Ga0157369_10138082
1386 Ga0157369_10293035
1387 Ga0157369_11025353
1388 Ga0157378_10000743
1389 Ga0157378_10328550
1390 Ga0157378_10349793
1391 Ga0157378_12862289
1392 Ga0163162_10061938
1393 Ga0163162_10142826
1394 Ga0163162_11036167
1395 Ga0163162_11059403
1396 Ga0163162_11171122
1397 Ga0163162_11391936
1398 Ga0157372_10004762
1399 Ga0157372_10171276
1400 Ga0157372_11355637
1401 Ga0157375_10000151
1402 Ga0157375_10396734
1403 Ga0157375_11721510
1404 Ga0157375_12749082
1405 Ga0163163_10006842
1406 Ga0157380_10000291
1407 Ga0157380_10770812
1408 Ga0157380_13363251
1409 Ga0182008_10143223
1410 Ga0157377_10021290
1411 Ga0157379_10001953
1412 Ga0157379_10052940
1413 Ga0157379_10110944
1414 Ga0157376_10037925
1415 Ga0157376_10528048
1416 Ga0157376_12336975
1417 Ga0163161_10000573
1418 Ga0213874_10081093
1419 Ga0213876_10011394
1420 Ga0213876_10033559
1421 Ga0213876_10379840
1422 Ga0213876_10551244
1423 Ga0213875_10010183
1424 Ga0213875_10015500
1425 Ga0209673_1043123
1426 Ga0209051_1000011
1427 Ga0209051_1038816
1428 Ga0209051_1050309
1429 Ga0207656_10563694
1430 Ga0207696_1036307
1431 Ga0207692_10023120
1432 Ga0207642_10008512
1433 Ga0207642_10472514
1434 Ga0207710_10000090
1435 Ga0207710_10007626
1436 Ga0207710_10129888
1437 Ga0207688_10000025
1438 Ga0207680_10066701
1439 Ga0207647_10284401
1440 Ga0207685_10078795
1441 Ga0207699_11174990
1442 Ga0207645_10028129
1443 Ga0207645_10276614
1444 Ga0207645_10787265
1445 Ga0207684_10070998
1446 Ga0207654_10267540
1447 Ga0207707_10000402
1448 Ga0207707_10101648
1449 Ga0207707_11669802
1450 Ga0207671_10038555
1451 Ga0207671_10084152
1452 Ga0207671_10329934
1453 Ga0207693_10000123
1454 Ga0207663_10516986
1455 Ga0207660_10000506
1456 Ga0207660_10007569
1457 Ga0207662_10112348
1458 Ga0207662_10388206
1459 Ga0207652_10000217
1460 Ga0207652_10001296
1461 Ga0207646_11076725
1462 Ga0207681_10006119
1463 Ga0207681_10050343
1464 Ga0207681_10510180
1465 Ga0207694_10218994
1466 Ga0207650_10307495
1467 Ga0207650_10784076
1468 Ga0207659_10087453
1469 Ga0207659_10144638
1470 Ga0207659_10154930
1471 Ga0207687_10003568
1472 Ga0207687_10263461
1473 Ga0207687_10886541
1474 Ga0207700_10010231
1475 Ga0207700_10044908
1476 Ga0207700_11207177
1477 Ga0207664_10003405
1478 Ga0207664_10129362
1479 Ga0207664_10344078
1480 Ga0207664_10453688
1481 Ga0207664_10717640
1482 Ga0207664_10964224
1483 Ga0207690_10045749
1484 Ga0207706_10007184
1485 Ga0207706_10155804
1486 Ga0207706_10307900
1487 Ga0207706_10474696
1488 Ga0207686_10038333
1489 Ga0207686_10274046
1490 Ga0207709_10020867
1491 Ga0207709_10269791
1492 Ga0207709_10405595
1493 Ga0207709_10543260
1494 Ga0207670_10061860
1495 Ga0207669_10018729
1496 Ga0207669_10141807
1497 Ga0207669_10311392
1498 Ga0207704_10003808
1499 Ga0207704_10591262
1500 Ga0207665_10002883
1501 Ga0207665_10338155
1502 Ga0207665_10643357
1503 Ga0207691_10221043
1504 Ga0207691_10264201
1505 Ga0207691_10323111
1506 Ga0207691_11541314
1507 Ga0207711_10000183
1508 Ga0207711_10038685
1509 Ga0207711_10067663
1510 Ga0207689_10006918
1511 Ga0207661_10021412
1512 Ga0207661_10337513
1513 Ga0207661_11372461
1514 Ga0207661_11579440
1515 Ga0207679_10454472
1516 Ga0207667_10150511
1517 Ga0207651_10173787
1518 Ga0207651_11247274
1519 Ga0207651_11504309
1520 Ga0207712_10000073
1521 Ga0207712_10005837
1522 Ga0207712_10061158
1523 Ga0207712_10869045
1524 Ga0207668_10034633
1525 Ga0207668_10631751
1526 Ga0207668_10860760
1527 Ga0207668_10914258
1528 Ga0207668_10968686
1529 Ga0207668_11348726
1530 Ga0207668_11535255
1531 Ga0207668_11743738
1532 Ga0207640_10028509
1533 Ga0207640_10079030
1534 Ga0207658_10000975
1535 Ga0207658_10036659
1536 Ga0207658_10044863
1537 Ga0207658_10079661
1538 Ga0207658_10610708
1539 Ga0207703_10012758
1540 Ga0207703_10111945
1541 Ga0207703_11755741
1542 Ga0207639_10075588
1543 Ga0207639_12202466
1544 Ga0207678_10010947
1545 Ga0207678_10219477
1546 Ga0207678_10290868
1547 Ga0207708_10000452
1548 Ga0207708_10597714
1549 Ga0207708_11109041
1550 Ga0207702_10300591
1551 Ga0207641_10003420
1552 Ga0207641_10020200
1553 Ga0207641_10276373
1554 Ga0207648_10000381
1555 Ga0207648_10259340
1556 Ga0207676_10196779
1557 Ga0207675_100000406
1558 Ga0207675_100753480
1559 Ga0207675_101715997
1560 Ga0207675_102545958
1561 Ga0207683_10000310
1562 Ga0207683_10025548
1563 Ga0207683_10054614
1564 Ga0207698_10034664
1565 Ga0209813_10025528
1566 Ga0209813_10056684
1567 Ga0207428_10362872
1568 Ga0207428_11206825
1569 Ga0268266_10032217
1570 Ga0268266_10126407
1571 Ga0268266_10392572
1572 Ga0268265_10000063
1573 Ga0268265_10191063
1574 Ga0268265_10295223
1575 Ga0268265_12652593
1576 Ga0268264_10000007
1577 Ga0268264_10034118
1578 Ga0268264_10468416
1579 Ga0268264_10947069
1580 Ga0265334_10052936
1581 Ga0265322_10159889
1582 Ga0307517_10005164
1583 Ga0307517_10329930
1584 Ga0265338_10000221
1585 Ga0265338_10124224
1586 Ga0265325_10001860
1587 Ga0265339_10021949
1588 Ga0265327_10002277
1589 Ga0265327_10004299
1590 Ga0265316_10067864
1591 Ga0307509_10214281
1592 Ga0307509_10358374
1593 Ga0307408_100970249
1594 Ga0265313_10001360
1595 Ga0307508_10063781
1596 Ga0307508_10166743
1597 Ga0265314_10122744
1598 Ga0265342_10261441
1599 Ga0307516_10000001
1600 Ga0307516_10082483
1601 Ga0307413_10035991
1602 Ga0307413_10049067
1603 Ga0307410_10021678
1604 Ga0307410_11564827
1605 Ga0307409_100238718
1606 Ga0307409_100489179
1607 Ga0307416_100144956
1608 Ga0307416_101117758
1609 Ga0307416_102004055
1610 Ga0307416_102613699
1611 Ga0307411_10033435
1612 Ga0307415_100028762
1613 Ga0307415_100393402
1614 Ga0307415_101206034
1615 Ga0307507_10000003
1616 Ga0307510_10035941
1617 Ga0307510_10324088
1618 Ga0373936_0135331
1619 Ga0373941_0176247
1620 Ga0373943_0260508
1621 Ga0373946_0661367
1622 Ga0373931_1251428
1623 Ga0373937_0912799
1624 Ga0373925_1117495
1625 Ga0436364_0645816
1626 Ga0436364_0932842
1627 Ga0436364_0943073
1628 Ga0436365_0124560
1629 Ga0436365_0431983
1630 Ga0436365_0775305
1631 Ga0436365_0811759
1632 Ga0436365_0929971
1633 Ga0436365_1129713
1634 Ga0436365_1722545
1635 Ga0436360_1146012
1636 Ga0436360_1275343
1637 Ga0436361_0032023
1638 Ga0436361_0782782
1639 Ga0436361_0844996
1640 Ga0436363_0798419
1641 Ga0436363_0971284
1642 Ga0436363_0996389
1643 Ga0436363_1196451
1644 Ga0439461_0053233
1645 Ga0439465_0002031
1646 Ga0439465_0017976
1647 Ga0451789_0755581
1648 Ga0451791_1293266
1649 Ga0451793_0493536
1650 Ga0451795_1661774
1651 Ga0451802_0625630
1652 Ga0451804_0159783
1653 Ga0451851_0772599
1654 Ga0451853_1445305
1655 Ga0451853_3576008
1656 Ga0439431_0059774
1657 Ga0439442_012761
1658 Ga0439445_0046199
1659 Ga0439448_0016952
1660 Ga0439448_0199083
1661 Ga0439434_0074531
1662 Ga0466969_0100727
1663 Ga0466972_0061126
1664 Ga0466972_0065620
1665 Ga0466965_0038429
1666 Ga0466965_0163461
1667 Ga0466965_0203611
1668 Ga0466965_0390310
1669 Ga0466965_0785734
1670 Ga0466966_0008881
1671 Ga0466966_0018926
1672 Ga0466966_0035446
1673 Ga0466966_0040777
1674 Ga0466961_0012470
1675 Ga0466961_0031971
1676 Ga0466961_0073736
1677 Ga0466963_0020412
1678 Ga0466963_0067268
1679 Ga0466963_0082463
1680 Ga0466963_0087302
1681 Ga0466963_0106318
1682 Ga0466963_0168372
1683 Ga0466963_0839633
1684 Ga0466963_0932628
1685 Ga0466964_0105968
1686 Ga0466971_0009847
1687 Ga0466971_0029934
1688 Ga0466971_0073873
1689 Ga0466968_0005412
1690 Ga0466968_0235306
1691 Ga0466970_0016759
1692 Ga0466970_0037488
1693 Ga0466970_0161924
1694 Ga0466957_0007139
1695 Ga0466957_0064280
1696 Ga0466957_0224006
1697 Ga0466957_0269565
1698 Ga0466960_0000194
1699 Ga0466960_0003452
1700 Ga0466960_0254894
1701 Ga0466959_0002618
1702 Ga0466959_0011944
1703 Ga0466959_0131781
1704 Ga0466959_0683834
1705 Ga0451576_1285707
1706 Ga0451576_1751290
1707 Ga0466958_0000674
1708 Ga0466958_0036494
1709 Ga0466958_0052217
1710 Ga0466958_0563218
1711 Ga0466967_0005060
1712 Ga0466967_0007373
1713 Ga0466967_0014658
1714 Ga0466967_0028027
1715 Ga0466967_0092395
1716 Ga0466967_0139301
1717 Ga0466967_0183923
1718 Ga0466967_0217630
1719 Ga0466967_0326906
1720 Ga0466967_0359398
1721 Ga0466967_0761862
1722 Ga0466967_0827006
1723 Ga0466967_1759639
1724 Ga0466967_1933990
1725 Ga0495603_0003651
1726 Ga0495603_0252830
1727 Ga0495590_0192315
1728 Ga0495629_0244507
1729 Ga0495638_0222091
1730 Ga0495638_0257159
1731 Ga0495638_0409749
1732 Ga0495638_0551577
1733 Ga0495641_0197531
1734 Ga0495651_0070329
1735 Ga0495582_0028970
1736 Ga0495582_0731158
1737 Ga0495582_0780710
1738 Ga0495605_0007783
1739 Ga0495662_0242291
1740 Ga0495584_0432888
1741 Ga0495585_0070742
1742 Ga0495585_0130002
1743 Ga0495594_0123051
1744 Ga0495594_0261522
1745 Ga0495594_0617237
1746 Ga0495594_0877230
1747 Ga0495607_0080852
1748 Ga0495607_0141171
1749 Ga0495583_0108409
1750 Ga0495606_0006829
1751 Ga0495608_0511536
1752 Ga0495616_0004697
1753 Ga0495618_0286371
1754 Ga0495620_0002171
1755 Ga0495620_0190978
1756 Ga0495628_0035763
1757 Ga0495632_0091654
1758 Ga0495643_0064704
1759 Ga0495644_0157337
1760 Ga0495648_0046653
1761 Ga0495666_0142003
1762 Ga0495666_0201599
1763 Ga0495640_0088801
1764 Ga0495609_0026688
1765 Ga0495622_0026457
1766 Ga0495622_0034397
1767 Ga0495633_0013663
1768 Ga0495633_0046775
1769 Ga0495668_0020805
1770 Ga0495668_0421615
1771 Ga0495668_0435009
1772 Ga0495634_0057516
1773 Ga0495634_0271931
1774 Ga0495611_0202091
1775 Ga0495625_0100778
1776 Ga0495635_0177393
1777 Ga0495635_0960329
1778 Ga0495635_1088194
1779 Ga0495661_0040957
1780 Ga0495588_0758252
1781 Ga0495657_0112827
1782 Ga0495657_0609342
1783 Ga0495647_0325113
1784 Ga0495658_0061248
1785 Ga0495613_0173248
1786 Ga0495613_0618091
1787 Ga0495613_0666537
1788 Ga0495613_0975488
1789 Ga0495624_0231763
1790 Ga0495670_0006912
1791 Ga0495671_0111047
1792 Ga0495649_0078661
1793 Ga0495589_0042163
1794 Ga0495589_0060671
1795 Ga0495600_0061704
1796 Ga0495660_0061085
1797 Ga0495581_0059362
1798 Ga0495604_0209906
1799 Ga0495604_0285507
1800 Ga0495636_0010553
1801 Ga0495674_0032073
1802 Ga0495674_0162530
1803 Ga0495674_0692201
1804 Ga0495672_0495686
1805 Ga0495676_0096899
1806 Ga0495676_0128039
1807 Ga0495676_0259521
1808 Ga0495680_0534145
1809 Ga0495680_1085768
1810 Ga0495683_0053204
1811 Ga0495687_011000
1812 Ga0495687_167764
1813 Ga0495679_065689
1814 Ga0495685_008124
1815 Ga0495685_026967
1816 Ga0495681_0025141
1817 Ga0495681_0051664
1818 Ga0495686_0031599
1819 Ga0495686_0070052
1820 Ga0495686_0235508
1821 Ga0495593_0018948
1822 Ga0495626_0028939
1823 Ga0496100_0001669
1824 Ga0496100_0013741
1825 Ga0496100_0684805
1826 Ga0496101_0001611
1827 Ga0496101_0002434
1828 Ga0496101_0120636
1829 Ga0496101_0215292
1830 Ga0496102_0000168
1831 Ga0496102_0001601
1832 Ga0496102_0490060
1833 Ga0496102_0548226
1834 Ga0496102_0750573
1835 Ga0496102_0865368
1836 Ga0496103_0002680
1837 Ga0496103_0004047
1838 Ga0496103_0956389
1839 Ga0496104_0022846
1840 Ga0496104_0277954
1841 Ga0496104_0381144
1842 Ga0496104_1338204
1843 Ga0496105_0036262
1844 Ga0496105_1392669
1845 Ga0496106_0033141
1846 Ga0496106_0044941
1847 Ga0496107_0005374
1848 Ga0496107_0032901
1849 Ga0496107_1230920
1850 Ga0496108_0037725
1851 Ga0496108_0538871
1852 Ga0496108_0626033
1853 Ga0496108_0867832
1854 Ga0496109_0024357
1855 Ga0496109_0108847
1856 Ga0496109_0121952
1857 Ga0496109_0318339
1858 Ga0496109_0494179
1859 Ga0496109_1146898
1860 Ga0496110_0085304
1861 Ga0496110_0754378
1862 Ga0496111_0603871
1863 Ga0496112_0006249
1864 Ga0496112_0011898
1865 Ga0496112_0040884
1866 Ga0496112_0113635
1867 Ga0496112_0157021
1868 Ga0496112_0490138
1869 Ga0496112_0605513
1870 Ga0496112_0752338
1871 Ga0496113_0087851
1872 Ga0496113_0240100
1873 Ga0496113_1109105
1874 Ga0496114_0000419
1875 Ga0496114_0012385
1876 Ga0496114_0994954
1877 Ga0496115_0000875
1878 Ga0496115_0074275
1879 Ga0496115_0229278
1880 Ga0496115_0245913
1881 Ga0496116_0126181
1882 Ga0496117_0001651
1883 Ga0496118_0005957
1884 Ga0496119_0012379
1885 Ga0496120_0014792
1886 Ga0496121_0015881
1887 Ga0496121_0670080
1888 Ga0496125_0078976
1889 Ga0496125_0135199
1890 Ga0496126_0000750
1891 Ga0496126_0014023
1892 Ga0496126_0025811
1893 Ga0496126_0235398
1894 Ga0495678_024313
1895 Ga0495682_0021736
1896 Ga0501032_0028158
1897 Ga0501033_0023718
1898 Ga0501033_0067390
1899 Ga0501033_0934959
1900 Ga0501034_0042343
1901 Ga0501034_0368436
1902 Ga0501036_0268729
1903 Ga0501036_0725686
1904 Ga0501037_0126643
1905 Ga0501038_0996468
1906 Ga0501039_0505547
1907 Ga0501041_0362119
1908 Ga0501043_0188579
1909 Ga0501046_0009507
1910 Ga0501047_0046399
1911 Ga0501047_0076262
1912 Ga0501047_0088540
1913 Ga0501047_0699554
1914 Ga0501048_0028626
1915 Ga0501048_0891210
1916 Ga0501068_0206660
1917 Ga0501069_0195600
1918 Ga0501070_0008468
1919 Ga0501070_0386661
1920 Ga0501073_0160801
1921 Ga0501073_0177304
1922 Ga0501074_0758444
1923 Ga0501075_0686835
1924 Ga0501076_1598614
1925 Ga0501077_1103227
1926 Ga0501079_0228171
1927 Ga0501079_1196575
1928 Ga0501080_0363369
1929 Ga0501080_1441077
1930 Ga0501081_1138899
1931 Ga0501035_0033426
1932 Ga0501044_0026363
1933 Ga0501044_1117964
1934 nmdc:mga03683_102347_c1
1935 nmdc:mga03683_38315_c1
1936 nmdc:mga03683_508292_c1
1937 nmdc:mga03683_93599_c1
1938 nmdc:mga03n38_1269_c1
1939 nmdc:mga03n38_13838_c1
1940 nmdc:mga03n38_19369_c1
1941 nmdc:mga03n38_199940_c1
1942 nmdc:mga03n38_242851_c1
1943 nmdc:mga03n38_268410_c1
1944 nmdc:mga03n38_297196_c1
1945 nmdc:mga03n38_342426_c1
1946 nmdc:mga03n38_39871_c1
1947 nmdc:mga03n38_51456_c1
1948 nmdc:mga03n38_69370_c1
1949 nmdc:mga03n38_721_c1
1950 nmdc:mga03n38_75787_c1
1951 nmdc:mga03n38_810_c1
1952 nmdc:mga00v17_1030539_c1
1953 nmdc:mga00v17_118410_c1
1954 nmdc:mga00v17_15447_c1
1955 nmdc:mga00v17_24485_c1
1956 nmdc:mga00v17_301496_c1
1957 nmdc:mga00v17_39864_c1
1958 nmdc:mga00v17_4529_c1
1959 nmdc:mga00v17_55120_c1
1960 nmdc:mga00v17_7619_c1
1961 nmdc:mga00v17_82102_c1
1962 nmdc:mga00v17_897293_c1
1963 nmdc:mga0yw44_119096_c1
1964 nmdc:mga0yw44_1470_c1
1965 nmdc:mga0yw44_157737_c1
1966 nmdc:mga0yw44_15825_c1
1967 nmdc:mga0yw44_15926_c1
1968 nmdc:mga0yw44_256551_c1
1969 nmdc:mga0yw44_274123_c1
1970 nmdc:mga0yw44_528082_c1
1971 nmdc:mga0yw44_6767_c2
1972 nmdc:mga0yw44_759406_c1
1973 nmdc:mga0yw44_881136_c1
1974 nmdc:mga0k408_19089_c1
1975 nmdc:mga0k408_301199_c1
1976 nmdc:mga0k408_655782_c1
1977 nmdc:mga06z11_126641_c1
1978 nmdc:mga06z11_185625_c1
1979 nmdc:mga06z11_18816_c1
1980 nmdc:mga06z11_19932_c1
1981 nmdc:mga06z11_354932_c1
1982 nmdc:mga06z11_558743_c1
1983 nmdc:mga06z11_58731_c1
1984 nmdc:mga04h51_104144_c1
1985 nmdc:mga04h51_170562_c1
1986 nmdc:mga04h51_409830_c1
1987 nmdc:mga07m45_106999_c1
1988 nmdc:mga07m45_236129_c1
1989 nmdc:mga07m45_39850_c1
1990 nmdc:mga07m45_48663_c1
1991 nmdc:mga07m45_70302_c1
1992 nmdc:mga07m45_8837_c1
1993 nmdc:mga05p37_16778_c1
1994 nmdc:mga05p37_217211_c1
1995 nmdc:mga05p37_582326_c1
1996 nmdc:mga05p37_976245_c1
1997 nmdc:mga09592_124161_c1
1998 nmdc:mga09592_124884_c1
1999 nmdc:mga0qj67_110358_c1
2000 nmdc:mga0qj67_13043_c1
2001 nmdc:mga0qj67_360353_c1
2002 nmdc:mga0qj67_55584_c1
2003 nmdc:mga0qj67_5897_c1
2004 nmdc:mga06r32_148206_c2
2005 nmdc:mga06r32_15073_c1
2006 nmdc:mga06r32_18748_c1
2007 nmdc:mga06r32_274600_c1
2008 nmdc:mga06r32_47833_c1
2009 nmdc:mga08y16_2010030_c1
2010 nmdc:mga08y16_234662_c1
2011 nmdc:mga08y16_238043_c1
2012 nmdc:mga0sz30_121305_c1
2013 nmdc:mga0sz30_128160_c1
2014 nmdc:mga0sz30_18655_c3
2015 nmdc:mga0sz30_25299_c1
2016 nmdc:mga0sz30_29869_c1
2017 nmdc:mga0sz30_38899_c1
2018 nmdc:mga0sz30_58856_c1
2019 nmdc:mga0sz30_71931_c1
2020 nmdc:mga0sz30_7628_c1
2021 nmdc:mga0sz30_79417_c1
2022 Ga0500635_0017052
2023 Ga0495619_0589153
2024 Ga0500578_0038473
2025 Ga0500643_015545
2026 Ga0500646_0178000
2027 Ga0500660_066782
2028 Ga0500558_145231
2029 Ga0500560_219438
2030 Ga0500569_005158
2031 Ga0500594_0244617
2032 Ga0500628_018732
2033 Ga0500652_001268
2034 Ga0500652_040195
2035 Ga0500561_0009146
2036 Ga0500573_0346939
2037 Ga0500579_128238
2038 Ga0500616_0030957
2039 Ga0500627_0082504
2040 Ga0500633_0010331
2041 Ga0500634_0023973
2042 Ga0500645_000063
2043 Ga0500656_028837
2044 Ga0500587_002606
2045 Ga0501084_0000240
2046 Ga0501084_0360896
2047 Ga0501082_0545713
2048 Ga0466962_0028193
2049 Ga0466962_0445667
2050 Ga0530510_0193045
2051 2508676442
2052 2689955741
2053 2689956864
2054 2738706167
2055 2738890801
2056 2738890809
2057 2739332933
2058 2809193523
2059 2842140136
2060 2895881684
2061 2929216771
2062 8002789107

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7r7a-assembly1.cif.gz_8 state e1 nucleolar 60s ribosome biogenesis intermediate - composite model 0.5797 12 85
8iqh-assembly1.cif.gz_C structure of full-length asfvprimpol in apo-form 0.5486 35 90
7vrc-assembly1.cif.gz_A structure of the yeast snf11/snf2 complex 0.4337 20 90
6j42-assembly1.cif.gz_A crystal structure of wild type katb, a manganese catalase from anabaena 0.3837 35 101
4r42-assembly1.cif.gz_C-2 crystal structure of katb, a manganese catalase from anabaena pcc7120 0.3825 35 101
ID Description Score Start End Superfamily
af_O76407_94_199_1.25.40.90 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; 0.5741 14 83 1.25.40.90
af_Q15061_473_577_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.5376 13 81 1.25.10.10
af_A0A0R0HUX5_898_1051_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.5 8 86 1.25.10.10
af_Q6ZQL4_471_575_1.25.40.90 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; 0.4955 9 94 1.25.40.90
af_Q13535_1_529_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.4823 42 106 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A3D5DEC4-F1-model_v4 Uncharacterized protein 0.9837 5 86
AF-A0A2E2U233-F1-model_v4 deleted 0.9771 2 94
AF-A0A2N4X260-F1-model_v4 Uncharacterized protein 0.9701 2 86
AF-A0A1B3N219-F1-model_v4 Uncharacterized protein 0.9695 4 85
AF-A0A1I4H3E2-F1-model_v4 Uncharacterized protein 0.9678 5 94

Map