F488688

General Info

Members Datasets Scaffolds Average Seq Length
1034 587 824 330

Family's Representative Sequence

Representative Sequence 3300054114|Ga0501084_0009351|Ga0501084_0009351_6938_8020
Length 360
Sequence MVARPPPVGSGTPAKLLNPSRNKQGQPVAASPKPAGRPADGAVASALRTITTERTGLDALAAALAGALAEPFAATVKVIRQARGRVIVSGVGKSGHVARKIASTLASTGTPAFFVHPAEASHGDLGMVTPDDVIVALSWSGESAELRSVVEHSRRFRIPLVAFTSAPDSTLARKSDHVLLLPRADEACPHGLSPTTSALMQLALGDALAIALLEDRGFSAEDFHVLHPGGKLGASLHFVRDVMHQDAAVPLIGPGATLGEAILTIGEKRLGCVGVVDDGGKLIGIITDGDVRRHLTGDDPLAAPVQAVMTRTPKTIAPDALVGTALDLLNKTKITALFVVDAGKPLGVVHMHDLLRIGVA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
3 2506520008 Serratia plymuthica AS12 Isolate Unclassified
4 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
5 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
6 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
7 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
8 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
9 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
10 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
11 2534681786 Brucella suis 92/29 Isolate Unclassified
12 2547132181 Kosakonia sacchari SP1 Isolate Stem
13 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
14 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
15 2561511199 Enterobacter sp. R4-368 Isolate Nodule
16 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
17 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
18 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
19 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
20 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
21 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
22 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
23 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
24 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
25 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
26 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
27 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
28 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
29 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
30 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
31 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
32 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
33 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
34 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
35 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
36 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
37 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
38 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
39 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
40 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
41 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
42 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
43 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
44 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
45 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
46 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
47 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
48 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
49 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
50 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
51 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
52 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
53 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
54 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
55 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
56 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
57 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
58 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
59 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
60 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
61 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
62 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
63 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
64 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
65 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
66 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
67 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
68 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
69 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
70 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
71 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
72 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
73 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
74 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
75 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
76 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
77 2636415599 Klebsiella variicola DX120E Isolate Unclassified
78 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
79 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
80 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
81 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
82 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
83 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
84 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
85 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
86 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
87 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
88 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
89 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
90 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
91 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
92 2738543024 Aminobacter sp. AP02 Isolate Unclassified
93 2751185800 Brucella pituitosa AA2 Isolate Unclassified
94 2751185917 Enterobacter sp. HK169 Isolate Unclassified
95 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
96 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
97 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
98 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
99 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
100 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
101 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
102 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
103 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
104 2775507074 Klebsiella sp. D5A Isolate Unclassified
105 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
106 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
107 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
108 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
109 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
110 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
111 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
112 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
113 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
114 2821118458 Enterobacter asburiae 609 Isolate Unclassified
115 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
116 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
117 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
118 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
119 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
120 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
121 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
122 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
123 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
124 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
125 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
126 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
127 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
128 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
129 2847085930 Erwinia persicina B64 Isolate Bulb
130 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
131 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
132 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
133 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
134 2854911287 Brucella lupini LUP21 Isolate Unclassified
135 2865014394 Pantoea sp. R-71966 Isolate Unclassified
136 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
137 2876601092 Pantoea endophytica 596 Isolate Unclassified
138 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
139 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
140 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
141 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
142 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
143 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
144 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
145 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
146 2904504865 Serratia marcescens 1822 Isolate Unclassified
147 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
148 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
149 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
150 2909042592 Labrys sp. LIt4 Isolate Nodule
151 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
152 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
153 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
154 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
155 2919150387 Rahnella aceris 1817 Isolate Unclassified
156 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
157 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
158 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
159 2927143783 Rahnella sp. 2050 Isolate Unclassified
160 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
161 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
162 2932406140 Serratia sp. 2723 Isolate Rhizosphere
163 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
164 2937539931 Pantoea sp. LS15 Isolate Unclassified
165 2937967321 Serratia sp. YC16 Isolate Unclassified
166 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
167 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
168 2939577877 Serratia sp. 509 Isolate Rhizosphere
169 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
170 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
171 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
172 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
173 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
174 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
175 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
176 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
177 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
178 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
179 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
180 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
181 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
182 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
183 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
184 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
185 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
186 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
187 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
188 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
189 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
190 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
191 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
192 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
193 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
194 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
195 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
196 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
197 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
198 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
199 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
200 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
201 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
202 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
203 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
204 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
205 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
206 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
207 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
208 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
209 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
210 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
211 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
212 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
213 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
214 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
215 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
216 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
217 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
218 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
219 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
220 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
221 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
222 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
223 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
224 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
225 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
226 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
227 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
228 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
229 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
230 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
231 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
232 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
233 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
234 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
235 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
236 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
237 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
238 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
239 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
240 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
241 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
242 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
243 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
244 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
245 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
246 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
247 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
248 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
249 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
250 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
251 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
252 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
253 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
254 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
255 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
256 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
257 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
258 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
259 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
260 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
261 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
262 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
263 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
264 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
265 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
266 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
267 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
268 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
269 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
270 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
271 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
272 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
273 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
274 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
275 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
276 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
277 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
278 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
279 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
280 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
281 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
282 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
283 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
284 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
285 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
286 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
287 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
288 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
289 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
290 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
291 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
292 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
293 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
294 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
295 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
296 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
297 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
298 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
299 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
300 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
301 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
302 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
303 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
304 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
305 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
306 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
307 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
308 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
309 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
310 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
311 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
312 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
313 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
314 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
315 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
316 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
317 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
318 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
319 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
320 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
321 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
322 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
323 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
324 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
325 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
326 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
327 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
328 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
329 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
330 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
331 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
332 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
333 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
334 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
368 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
372 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
374 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
375 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
376 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
377 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
378 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
379 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
380 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
381 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
382 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
383 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
384 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
385 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
386 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
387 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
388 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
389 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
390 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
391 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
392 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
393 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
395 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
396 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
397 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
399 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
400 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
401 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
402 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
403 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
404 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
405 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
406 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
407 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
408 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
409 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
410 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
411 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
412 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
413 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
414 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
415 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
416 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
417 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
418 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
419 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
420 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
421 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
422 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
423 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
424 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
425 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
426 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
427 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
428 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
429 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
430 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
431 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
432 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
433 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
434 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
435 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
436 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
437 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
438 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
439 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
440 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
441 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
442 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
443 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
444 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
445 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
446 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
447 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
448 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
449 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
450 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
451 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
452 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
453 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
454 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
455 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
456 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
457 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
458 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
459 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
460 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
461 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
462 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
463 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
464 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
465 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
466 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
467 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
468 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
469 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
470 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
471 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
472 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
473 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
474 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
475 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
476 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
477 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
478 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
479 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
480 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
481 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
482 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
483 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
484 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
485 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
486 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
487 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
488 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
489 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
490 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
491 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
492 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
493 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
494 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
495 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
496 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
497 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
498 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
499 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
500 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
501 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
502 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
503 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
504 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
505 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
506 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
507 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
508 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
509 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
510 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
511 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
512 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
513 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
514 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
515 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
516 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
517 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
518 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
519 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
520 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
521 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
522 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
523 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
524 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
525 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
526 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
527 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
528 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
529 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
530 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
531 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
532 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
533 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
534 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
535 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
536 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
537 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
538 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
539 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
540 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
541 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
542 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
543 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
544 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
545 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
546 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
547 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
548 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
549 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
550 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
551 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
552 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
553 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
554 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
555 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
556 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
557 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
558 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
559 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
560 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
561 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
562 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
563 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
564 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
565 640753048 Serratia proteamaculans 568 Isolate Endosphere
566 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
567 8004592986 Serratia sp. S119 Isolate Unclassified
568 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
569 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
570 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
571 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
572 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
573 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
574 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
575 8018221730 Enterobacter sp. CM29 Isolate Unclassified
576 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
577 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
578 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
579 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
580 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
581 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
582 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
583 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
584 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
585 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
586 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere
587 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.59
Metatranscriptomes 0.1
Isolates 20.31

Biome Distribution

Category Percentage (%)
Aerial Root 0.39
Bulb 0.1
Endosphere 5.61
Nodule 3.68
Rhizoplane 7.83
Rhizosphere 63.06
Stem 0.1
Stem Tuber 0.1
Unclassified 19.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2229515 2162886007 Bacteria 1041
2 JGI24740J21852_10000449 3300001979 Bacteria 17614
3 JGI25156J39149_1000215 3300002705 Bacteria 40194
4 JGI25162J39368_1000031 3300002737 Bacteria 210480
5 JGI25162J39368_1000449 3300002737 Bacteria 32568
6 JGI25162J39368_1000471 3300002737 Bacteria 31064
7 JGI25154J39366_1000169 3300002738 Bacteria 50665
8 JGI25157J39369_1000226 3300002741 Bacteria 44207
9 JGI25163J39215_1000261 3300002771 Bacteria 18973
10 JGI25164J39214_1000001 3300002772 Bacteria 477015
11 JGI25152J39213_1000063 3300002773 Bacteria 71659
12 JGI25159J45721_1000718 3300002987 Bacteria 14447
13 JGI25165J46597_1000443 3300003214 Bacteria 41663
14 JGI25165J46597_1001071 3300003214 Bacteria 17571
15 JGI25165J46597_1006237 3300003214 Bacteria 2140
16 rootH2_10324399 3300003320 Bacteria 1632
17 JGI25160J50197_1000114 3300003354 Bacteria 75947
18 JGI26145J50221_1000724 3300003371 Bacteria 2707
19 JGI25161J50226_1000089 3300003374 Bacteria 73775
20 Ga0055538_1000004 3300003751 Bacteria 615646
21 Ga0055539_1000004 3300003752 Bacteria 615646
22 Ga0055533_1000007 3300003756 Bacteria 615646
23 Ga0055525_1000007 3300003759 Bacteria 615646
24 Ga0055531_10013484 3300003794 Bacteria 3762
25 Ga0055541_1000004 3300003841 Bacteria 615646
26 Ga0058692_1001387 3300003856 Bacteria 8962
27 Ga0058692_1002827 3300003856 Bacteria 5690
28 Ga0058692_1008101 3300003856 Bacteria 2726
29 Ga0058692_1009185 3300003856 Bacteria 2506
30 Ga0058692_1016402 3300003856 Bacteria 1646
31 Ga0058692_1028962 3300003856 Bacteria 1064
32 Ga0055543_1000002 3300004625 Bacteria 390020
33 Ga0065165_1000537 3300005262 Bacteria 57544
34 Ga0065703_1018907 3300005272 Bacteria 5240
35 Ga0065704_10001070 3300005289 Bacteria 9761
36 Ga0065704_10001534 3300005289 Bacteria 24742
37 Ga0065704_10001858 3300005289 Bacteria 23782
38 Ga0065704_10002429 3300005289 Bacteria 11867
39 Ga0065704_10006610 3300005289 Bacteria 4362
40 Ga0065704_10013586 3300005289 Bacteria 1491
41 Ga0065704_10093217 3300005289 Bacteria 2610
42 Ga0065707_10108180 3300005295 Bacteria 2521
43 Ga0070676_10027376 3300005328 Bacteria 3232
44 Ga0070676_10140843 3300005328 Bacteria 1535
45 Ga0070683_100027190 3300005329 Bacteria 5159
46 Ga0070690_100000539 3300005330 Bacteria 18931
47 Ga0070690_100010622 3300005330 Bacteria 5362
48 Ga0070670_100017812 3300005331 Bacteria 6095
49 Ga0070677_10014550 3300005333 Bacteria 2771
50 Ga0068869_100044440 3300005334 Bacteria 3195
51 Ga0068869_100347549 3300005334 Bacteria 1208
52 Ga0070666_10027773 3300005335 Bacteria 3708
53 Ga0070666_10155230 3300005335 Bacteria 1598
54 Ga0070680_100040696 3300005336 Bacteria 3765
55 Ga0068868_100016978 3300005338 Bacteria 5416
56 Ga0070660_100019059 3300005339 Bacteria 5024
57 Ga0070689_100016769 3300005340 Bacteria 5366
58 Ga0070689_100021941 3300005340 Bacteria 4761
59 Ga0070689_100031840 3300005340 Bacteria 4008
60 Ga0070687_100000401 3300005343 Bacteria 14719
61 Ga0070687_100042289 3300005343 Bacteria 2308
62 Ga0070661_100012095 3300005344 Bacteria 6032
63 Ga0070668_100022105 3300005347 Bacteria 4808
64 Ga0070671_100004342 3300005355 Bacteria 11219
65 Ga0070674_100001020 3300005356 Bacteria 14599
66 Ga0070673_100002768 3300005364 Bacteria 10780
67 Ga0070673_100036202 3300005364 Bacteria 3749
68 Ga0070673_100067045 3300005364 Bacteria 2869
69 Ga0070688_100108415 3300005365 Bacteria 1843
70 Ga0070688_100129114 3300005365 Bacteria 1703
71 Ga0070659_100011884 3300005366 Bacteria 6445
72 Ga0070714_100023128 3300005435 Bacteria 5102
73 Ga0070713_100066546 3300005436 Bacteria 3031
74 Ga0070713_100156809 3300005436 Bacteria 2029
75 Ga0070701_10083355 3300005438 Bacteria 1736
76 Ga0070711_100009650 3300005439 Bacteria 5948
77 Ga0070705_100005704 3300005440 Bacteria 6080
78 Ga0070700_100007133 3300005441 Bacteria 6015
79 Ga0070694_100024935 3300005444 Bacteria 3864
80 Ga0070678_100015341 3300005456 Bacteria 4867
81 Ga0070678_100015570 3300005456 Bacteria 4836
82 Ga0070678_100020438 3300005456 Bacteria 4344
83 Ga0070662_100002557 3300005457 Bacteria 11203
84 Ga0070662_100004962 3300005457 Bacteria 8453
85 Ga0070681_10009409 3300005458 Bacteria 9616
86 Ga0068867_100002693 3300005459 Bacteria 12530
87 Ga0070679_100021719 3300005530 Bacteria 6269
88 Ga0070672_100006520 3300005543 Bacteria 7846
89 Ga0070672_100056029 3300005543 Bacteria 3090
90 Ga0070686_100002070 3300005544 Bacteria 11080
91 Ga0070695_100056780 3300005545 Bacteria 2527
92 Ga0070693_100070556 3300005547 Bacteria 2056
93 Ga0070665_100002206 3300005548 Bacteria 21732
94 Ga0070665_100010158 3300005548 Bacteria 9520
95 Ga0070665_100031391 3300005548 Bacteria 5348
96 Ga0070665_100048948 3300005548 Bacteria 4242
97 Ga0070665_100178171 3300005548 Bacteria 2126
98 Ga0070664_100001498 3300005564 Bacteria 18609
99 Ga0070664_100017690 3300005564 Bacteria 5854
100 Ga0068857_100000020 3300005577 Bacteria 89305
101 Ga0068857_100030667 3300005577 Bacteria 4749
102 Ga0070702_100053943 3300005615 Bacteria 2311
103 Ga0068852_100014145 3300005616 Bacteria 6129
104 Ga0068852_100049144 3300005616 Bacteria 3607
105 Ga0068851_10000221 3300005834 Bacteria 27516
106 Ga0068870_10005500 3300005840 Bacteria 5534
107 Ga0068858_100033841 3300005842 Bacteria 4740
108 Ga0068862_100180184 3300005844 Bacteria 1896
109 Ga0081455_10030083 3300005937 Bacteria 4939
110 Ga0070717_10181562 3300006028 Bacteria 1835
111 Ga0075363_100106950 3300006048 Bacteria 1552
112 Ga0075364_10021925 3300006051 Bacteria 4029
113 Ga0070712_100004848 3300006175 Bacteria 8318
114 Ga0075367_10151258 3300006178 Bacteria 1440
115 Ga0075366_10002364 3300006195 Bacteria 9662
116 Ga0097621_100022779 3300006237 Bacteria 4867
117 Ga0068871_100306038 3300006358 Bacteria 1396
118 Ga0075428_100323363 3300006844 Bacteria 1657
119 Ga0075430_100123490 3300006846 Bacteria 2158
120 Ga0075431_100041363 3300006847 Bacteria 4751
121 Ga0075431_100070799 3300006847 Bacteria 3598
122 Ga0075431_100198596 3300006847 Bacteria 2053
123 Ga0075433_10014754 3300006852 Bacteria 6395
124 Ga0075429_100005400 3300006880 Bacteria 10997
125 Ga0075429_100014404 3300006880 Bacteria 6853
126 Ga0075429_100444970 3300006880 Bacteria 1135
127 Ga0068865_100002426 3300006881 Bacteria 11015
128 Ga0068865_100154924 3300006881 Bacteria 1742
129 Ga0079104_1000485 3300006946 Bacteria 43922
130 Ga0079104_1000490 3300006946 Bacteria 42967
131 Ga0079104_1000624 3300006946 Bacteria 34658
132 Ga0079104_1000660 3300006946 Bacteria 32875
133 Ga0079104_1001897 3300006946 Bacteria 12619
134 Ga0079104_1002516 3300006946 Bacteria 9735
135 Ga0079104_1002794 3300006946 Bacteria 8797
136 Ga0079104_1006842 3300006946 Bacteria 4227
137 Ga0079104_1014417 3300006946 Bacteria 2384
138 Ga0075435_100162880 3300007076 Bacteria 1879
139 Ga0105251_10001425 3300009011 Bacteria 20604
140 Ga0105251_10002220 3300009011 Bacteria 15494
141 Ga0105251_10002228 3300009011 Bacteria 15467
142 Ga0105251_10002491 3300009011 Bacteria 14415
143 Ga0105251_10002841 3300009011 Bacteria 13080
144 Ga0105251_10005427 3300009011 Bacteria 8332
145 Ga0105251_10008910 3300009011 Bacteria 6001
146 Ga0105251_10011814 3300009011 Bacteria 4970
147 Ga0105251_10015900 3300009011 Bacteria 4092
148 Ga0105251_10088147 3300009011 Bacteria 1428
149 Ga0105251_10101907 3300009011 Bacteria 1312
150 Ga0105244_10000033 3300009036 Bacteria 172219
151 Ga0105244_10000505 3300009036 Bacteria 34917
152 Ga0105244_10000565 3300009036 Bacteria 33084
153 Ga0105244_10000822 3300009036 Bacteria 26216
154 Ga0105244_10001412 3300009036 Bacteria 19445
155 Ga0105244_10002138 3300009036 Bacteria 15170
156 Ga0105244_10002840 3300009036 Bacteria 12855
157 Ga0105244_10004471 3300009036 Bacteria 9606
158 Ga0105244_10005243 3300009036 Bacteria 8658
159 Ga0105244_10018339 3300009036 Bacteria 3928
160 Ga0105244_10076228 3300009036 Bacteria 1665
161 Ga0105244_10099818 3300009036 Bacteria 1421
162 Ga0105244_10156267 3300009036 Bacteria 1091
163 Ga0105250_10000098 3300009092 Bacteria 78269
164 Ga0105250_10000165 3300009092 Bacteria 57113
165 Ga0105250_10000321 3300009092 Bacteria 36864
166 Ga0105250_10000351 3300009092 Bacteria 35223
167 Ga0105250_10001790 3300009092 Bacteria 11256
168 Ga0105250_10004800 3300009092 Bacteria 6158
169 Ga0105250_10006878 3300009092 Bacteria 4932
170 Ga0105250_10015710 3300009092 Bacteria 3099
171 Ga0105240_10000019 3300009093 Bacteria 406211
172 Ga0105245_10007384 3300009098 Bacteria 9623
173 Ga0105247_10000027 3300009101 Bacteria 201966
174 Ga0114129_10063906 3300009147 Bacteria 5136
175 Ga0105243_10001901 3300009148 Bacteria 17803
176 Ga0105243_10003148 3300009148 Bacteria 13544
177 Ga0105243_10003945 3300009148 Bacteria 11845
178 Ga0105243_10157788 3300009148 Bacteria 1953
179 Ga0105243_10267977 3300009148 Bacteria 1532
180 Ga0105241_10000006 3300009174 Bacteria 373608
181 Ga0105241_10017641 3300009174 Bacteria 5248
182 Ga0105242_10003004 3300009176 Bacteria 13183
183 Ga0105248_10444841 3300009177 Bacteria 1460
184 Ga0105237_10002680 3300009545 Bacteria 21825
185 Ga0105239_10002581 3300010375 Bacteria 22935
186 Ga0105246_10004374 3300011119 Bacteria 8595
187 Ga0105246_10122072 3300011119 Bacteria 1932
188 Ga0105246_10172746 3300011119 Bacteria 1657
189 Ga0157373_10000301 3300013100 Bacteria 40059
190 Ga0157373_10002114 3300013100 Bacteria 15036
191 Ga0157373_10014332 3300013100 Bacteria 5810
192 Ga0157373_10016018 3300013100 Bacteria 5472
193 Ga0157371_10000159 3300013102 Bacteria 98984
194 Ga0157371_10000349 3300013102 Bacteria 59337
195 Ga0157371_10001320 3300013102 Bacteria 26053
196 Ga0157371_10001630 3300013102 Bacteria 22978
197 Ga0157371_10020620 3300013102 Bacteria 4850
198 Ga0157371_10022635 3300013102 Bacteria 4600
199 Ga0157371_10110400 3300013102 Bacteria 1952
200 Ga0157370_10001424 3300013104 Bacteria 29698
201 Ga0157370_10003061 3300013104 Bacteria 19833
202 Ga0157369_10024732 3300013105 Bacteria 6674
203 Ga0157374_10010962 3300013296 Bacteria 7827
204 Ga0157378_10016174 3300013297 Bacteria 6532
205 Ga0163162_10008063 3300013306 Bacteria 10277
206 Ga0157372_10000517 3300013307 Bacteria 42523
207 Ga0157372_10008131 3300013307 Bacteria 11154
208 Ga0157372_10165155 3300013307 Bacteria 2560
209 Ga0157372_10183821 3300013307 Bacteria 2420
210 Ga0157372_10207861 3300013307 Bacteria 2268
211 Ga0157372_10273027 3300013307 Bacteria 1965
212 Ga0157372_10275848 3300013307 Bacteria 1954
213 Ga0157372_10472686 3300013307 Bacteria 1461
214 Ga0157375_10211095 3300013308 Bacteria 2099
215 Ga0163163_10041019 3300014325 Bacteria 4524
216 Ga0163163_10165435 3300014325 Bacteria 2258
217 Ga0157380_10099016 3300014326 Bacteria 2424
218 Ga0182008_10021763 3300014497 Bacteria 3292
219 Ga0182008_10025779 3300014497 Bacteria 2985
220 Ga0182008_10058683 3300014497 Bacteria 1899
221 Ga0182006_1000376 3300015261 Bacteria 37065
222 Ga0182006_1000652 3300015261 Bacteria 24669
223 Ga0182007_10032719 3300015262 Bacteria 1765
224 Ga0182005_1002849 3300015265 Bacteria 6017
225 Ga0183366_1002 3300015679 Bacteria 791639
226 Ga0183370_1002 3300015680 Bacteria 791639
227 Ga0183369_1002 3300015685 Bacteria 791621
228 Ga0183368_1005 3300015687 Bacteria 791621
229 Ga0163161_10000036 3300017792 Bacteria 153121
230 Ga0163161_10143786 3300017792 Bacteria 1808
231 Ga0163161_10151804 3300017792 Bacteria 1761
232 Ga0163161_10157119 3300017792 Bacteria 1732
233 Ga0213876_10000013 3300021384 Bacteria 342052
234 Ga0228598_1000779 3300024227 Bacteria 6844
235 Ga0209435_100005 3300025206 Bacteria 573745
236 Ga0209760_100006 3300025207 Bacteria 224535
237 Ga0209784_100001 3300025224 Bacteria 3600592
238 Ga0209566_100001 3300025225 Bacteria 3600765
239 Ga0209674_100002 3300025226 Bacteria 3600592
240 Ga0209563_100008 3300025230 Bacteria 1554545
241 Ga0207427_100002 3300025231 Bacteria 1355321
242 Ga0209437_100078 3300025233 Bacteria 278088
243 Ga0209437_100114 3300025233 Bacteria 210697
244 Ga0209437_100291 3300025233 Bacteria 72764
245 Ga0209646_1000011 3300025246 Bacteria 573745
246 Ga0209026_1000008 3300025250 Bacteria 573745
247 Ga0209677_100004 3300025253 Bacteria 1554545
248 Ga0209677_100524 3300025253 Bacteria 21308
249 Ga0209759_1000004 3300025256 Bacteria 573745
250 Ga0209129_1000010 3300025258 Bacteria 583357
251 Ga0209233_1000157 3300025261 Bacteria 164269
252 Ga0209233_1000192 3300025261 Bacteria 127171
253 Ga0209233_1000194 3300025261 Bacteria 126185
254 Ga0209233_1001399 3300025261 Bacteria 9542
255 Ga0209130_1000083 3300025284 Bacteria 162582
256 Ga0209676_1020610 3300025292 Bacteria 2234
257 Ga0209025_1024737 3300025294 Bacteria 3088
258 Ga0209758_1000657 3300025297 Bacteria 51923
259 Ga0209050_1030485 3300025298 Bacteria 1702
260 Ga0207426_1000173 3300025302 Bacteria 162697
261 Ga0209051_1017207 3300025303 Bacteria 3236
262 Ga0209257_1005500 3300025304 Bacteria 8851
263 Ga0207697_10106612 3300025315 Bacteria 1198
264 Ga0207656_10015155 3300025321 Bacteria 2980
265 Ga0207696_1000014 3300025711 Bacteria 517939
266 Ga0207696_1000027 3300025711 Bacteria 412783
267 Ga0207696_1000137 3300025711 Bacteria 127683
268 Ga0207696_1000188 3300025711 Bacteria 95866
269 Ga0207696_1000272 3300025711 Bacteria 62222
270 Ga0207696_1000356 3300025711 Bacteria 46221
271 Ga0207696_1000466 3300025711 Bacteria 35122
272 Ga0207696_1000800 3300025711 Bacteria 20360
273 Ga0207696_1007349 3300025711 Bacteria 4324
274 Ga0207696_1023980 3300025711 Bacteria 1917
275 Ga0207696_1035017 3300025711 Bacteria 1497
276 Ga0207655_1000024 3300025728 Bacteria 459774
277 Ga0207655_1000028 3300025728 Bacteria 437324
278 Ga0207655_1000065 3300025728 Bacteria 252767
279 Ga0207655_1000072 3300025728 Bacteria 236536
280 Ga0207655_1000186 3300025728 Bacteria 110125
281 Ga0207655_1000397 3300025728 Bacteria 60486
282 Ga0207655_1001028 3300025728 Bacteria 28168
283 Ga0207655_1001295 3300025728 Bacteria 23673
284 Ga0207655_1001763 3300025728 Bacteria 18919
285 Ga0207655_1003209 3300025728 Bacteria 12295
286 Ga0207655_1003378 3300025728 Bacteria 11924
287 Ga0207655_1005165 3300025728 Bacteria 8983
288 Ga0207655_1008316 3300025728 Bacteria 6601
289 Ga0207655_1011918 3300025728 Bacteria 5129
290 Ga0207655_1032714 3300025728 Bacteria 2371
291 Ga0207655_1068907 3300025728 Bacteria 1325
292 Ga0207713_1000019 3300025735 Bacteria 361225
293 Ga0207713_1000157 3300025735 Bacteria 102471
294 Ga0207713_1000181 3300025735 Bacteria 90733
295 Ga0207713_1000272 3300025735 Bacteria 63323
296 Ga0207713_1000300 3300025735 Bacteria 56459
297 Ga0207713_1000672 3300025735 Bacteria 32332
298 Ga0207713_1004072 3300025735 Bacteria 9639
299 Ga0207713_1007104 3300025735 Bacteria 6697
300 Ga0207713_1009166 3300025735 Bacteria 5607
301 Ga0207713_1030551 3300025735 Bacteria 2397
302 Ga0207713_1034504 3300025735 Bacteria 2197
303 Ga0207713_1090723 3300025735 Bacteria 1074
304 Ga0207682_10004305 3300025893 Bacteria 5983
305 Ga0207682_10048308 3300025893 Bacteria 1754
306 Ga0207642_10052739 3300025899 Bacteria 1847
307 Ga0207710_10000007 3300025900 Bacteria 488292
308 Ga0207688_10019282 3300025901 Bacteria 3714
309 Ga0207645_10000491 3300025907 Bacteria 32560
310 Ga0207654_10000008 3300025911 Bacteria 375871
311 Ga0207695_10000049 3300025913 Bacteria 406233
312 Ga0207671_10000860 3300025914 Bacteria 38458
313 Ga0207693_10001110 3300025915 Bacteria 24219
314 Ga0207693_10003425 3300025915 Bacteria 13537
315 Ga0207660_10196631 3300025917 Bacteria 1573
316 Ga0207662_10001193 3300025918 Bacteria 12379
317 Ga0207657_10001426 3300025919 Bacteria 25509
318 Ga0207652_10022607 3300025921 Bacteria 5204
319 Ga0207650_10026935 3300025925 Bacteria 4108
320 Ga0207659_10012807 3300025926 Bacteria 5355
321 Ga0207644_10052478 3300025931 Bacteria 2930
322 Ga0207706_10000793 3300025933 Bacteria 32687
323 Ga0207706_10005929 3300025933 Bacteria 11363
324 Ga0207686_10029851 3300025934 Bacteria 3221
325 Ga0207709_10000726 3300025935 Bacteria 26397
326 Ga0207709_10138551 3300025935 Bacteria 1669
327 Ga0207670_10006332 3300025936 Bacteria 6556
328 Ga0207670_10039355 3300025936 Bacteria 3096
329 Ga0207669_10002032 3300025937 Bacteria 8576
330 Ga0207691_10000089 3300025940 Bacteria 77701
331 Ga0207691_10032395 3300025940 Bacteria 4872
332 Ga0207691_10224603 3300025940 Bacteria 1627
333 Ga0207689_10005053 3300025942 Bacteria 11892
334 Ga0207661_10036398 3300025944 Bacteria 3842
335 Ga0207679_10005736 3300025945 Bacteria 7790
336 Ga0207679_10099840 3300025945 Bacteria 2267
337 Ga0207651_10020956 3300025960 Bacteria 3959
338 Ga0207651_10152589 3300025960 Bacteria 1800
339 Ga0207712_10140188 3300025961 Bacteria 1854
340 Ga0207668_10005034 3300025972 Bacteria 7779
341 Ga0207640_10059442 3300025981 Bacteria 2523
342 Ga0207708_10000969 3300026075 Bacteria 21528
343 Ga0207648_10006014 3300026089 Bacteria 12109
344 Ga0207674_10000119 3300026116 Bacteria 91959
345 Ga0207675_100025761 3300026118 Bacteria 5473
346 Ga0207683_10000118 3300026121 Bacteria 64632
347 Ga0207683_10369831 3300026121 Bacteria 1317
348 Ga0209281_1000025 3300027111 Bacteria 488275
349 Ga0209281_1000096 3300027111 Bacteria 236276
350 Ga0209281_1000279 3300027111 Bacteria 96898
351 Ga0209281_1000281 3300027111 Bacteria 96061
352 Ga0209281_1000328 3300027111 Bacteria 82899
353 Ga0209281_1000369 3300027111 Bacteria 73041
354 Ga0209281_1000558 3300027111 Bacteria 45216
355 Ga0209281_1000723 3300027111 Bacteria 32737
356 Ga0209281_1000953 3300027111 Bacteria 23576
357 Ga0209281_1001042 3300027111 Bacteria 21087
358 Ga0209281_1002724 3300027111 Bacteria 6629
359 Ga0209973_1000528 3300027252 Bacteria 2921
360 Ga0209371_1000013 3300027312 Bacteria 691516
361 Ga0209371_1000019 3300027312 Bacteria 583561
362 Ga0209371_1000069 3300027312 Bacteria 207967
363 Ga0209371_1000083 3300027312 Bacteria 184176
364 Ga0209371_1000149 3300027312 Bacteria 110455
365 Ga0209371_1000346 3300027312 Bacteria 50802
366 Ga0209371_1000351 3300027312 Bacteria 50314
367 Ga0209371_1000509 3300027312 Bacteria 37163
368 Ga0209371_1000663 3300027312 Bacteria 30042
369 Ga0209371_1000759 3300027312 Bacteria 26909
370 Ga0209371_1000804 3300027312 Bacteria 25939
371 Ga0209371_1002463 3300027312 Bacteria 10317
372 Ga0209371_1002564 3300027312 Bacteria 10026
373 Ga0209371_1002905 3300027312 Bacteria 8968
374 Ga0209371_1004479 3300027312 Bacteria 6038
375 Ga0209371_1005492 3300027312 Bacteria 5018
376 Ga0209371_1005938 3300027312 Bacteria 4689
377 Ga0209371_1010862 3300027312 Bacteria 2756
378 Ga0209969_1000081 3300027360 Bacteria 11756
379 Ga0209967_1001071 3300027364 Bacteria 3493
380 Ga0209996_1000001 3300027395 Bacteria 64824
381 Ga0209984_1002511 3300027424 Bacteria 2055
382 Ga0210000_1000003 3300027462 Bacteria 41189
383 Ga0209995_1000345 3300027471 Bacteria 7242
384 Ga0209968_1000643 3300027526 Bacteria 5392
385 Ga0209999_1000262 3300027543 Bacteria 7684
386 Ga0209982_1001101 3300027552 Bacteria 3614
387 Ga0209970_1008147 3300027614 Bacteria 1721
388 Ga0210002_1000075 3300027617 Bacteria 15616
389 Ga0209983_1001181 3300027665 Bacteria 5769
390 Ga0209971_1000339 3300027682 Bacteria 12903
391 Ga0209966_1000425 3300027695 Bacteria 12073
392 Ga0209998_10000165 3300027717 Bacteria 24428
393 Ga0209974_10002753 3300027876 Bacteria 6375
394 Ga0207428_10003400 3300027907 Bacteria 15468
395 Ga0268266_10000142 3300028379 Bacteria 138183
396 Ga0268266_10019945 3300028379 Bacteria 5713
397 Ga0268266_10032511 3300028379 Bacteria 4432
398 Ga0268266_10409747 3300028379 Bacteria 1283
399 Ga0268264_10045271 3300028381 Bacteria 3653
400 Ga0268264_10174290 3300028381 Bacteria 1948
401 Ga0265318_10047325 3300028577 Bacteria 1622
402 Ga0268256_1000014 3300030500 Bacteria 691435
403 Ga0268256_1000024 3300030500 Bacteria 488637
404 Ga0268256_1000066 3300030500 Bacteria 199115
405 Ga0268256_1000074 3300030500 Bacteria 184102
406 Ga0268256_1000293 3300030500 Bacteria 50802
407 Ga0268256_1000294 3300030500 Bacteria 50324
408 Ga0268256_1000734 3300030500 Bacteria 24107
409 Ga0268256_1000918 3300030500 Bacteria 20350
410 Ga0268256_1002265 3300030500 Bacteria 10026
411 Ga0268256_1002344 3300030500 Bacteria 9763
412 Ga0268256_1002373 3300030500 Bacteria 9687
413 Ga0268256_1002611 3300030500 Bacteria 8968
414 Ga0268256_1002616 3300030500 Bacteria 8950
415 Ga0268256_1004231 3300030500 Bacteria 6039
416 Ga0268256_1005400 3300030500 Bacteria 5018
417 Ga0268256_1010019 3300030500 Bacteria 3096
418 Ga0268256_1016374 3300030500 Bacteria 2128
419 Ga0265773_1002260 3300031018 Bacteria 1150
420 Ga0265330_10061813 3300031235 Bacteria 1629
421 Ga0265325_10008951 3300031241 Bacteria 5879
422 Ga0265325_10152706 3300031241 Bacteria 1091
423 Ga0265340_10001019 3300031247 Bacteria 15981
424 Ga0265340_10012971 3300031247 Bacteria 4391
425 Ga0265340_10078344 3300031247 Bacteria 1558
426 Ga0265339_10023636 3300031249 Bacteria 3551
427 Ga0307408_100135071 3300031548 Unclassified 1929
428 Ga0265313_10000522 3300031595 Bacteria 40272
429 Ga0265313_10013071 3300031595 Bacteria 5014
430 Ga0265313_10061307 3300031595 Bacteria 1761
431 Ga0307508_10056023 3300031616 Bacteria 3492
432 Ga0265314_10063845 3300031711 Bacteria 2496
433 Ga0265342_10006229 3300031712 Bacteria 8913
434 Ga0265342_10049960 3300031712 Bacteria 2500
435 Ga0307413_10118695 3300031824 Unclassified 1786
436 Ga0307410_10001871 3300031852 Bacteria 9814
437 Ga0307407_10084677 3300031903 Unclassified 1927
438 Ga0307409_100005707 3300031995 Bacteria 7213
439 Ga0307416_100001523 3300032002 Bacteria 12653
440 Ga0307416_100301569 3300032002 Bacteria 1593
441 Ga0307510_10159259 3300033180 Bacteria 1858
442 Ga0373948_0013266 3300034817 Bacteria 1485
443 Ga0373934_0021830 3300035086 Bacteria 2468
444 Ga0373940_0008837 3300035088 Bacteria 2325
445 Ga0373945_0002178 3300035116 Bacteria 6117
446 Ga0373954_0009647 3300035118 Bacteria 4249
447 Ga0373956_0000993 3300035119 Bacteria 11739
448 Ga0373956_0013098 3300035119 Bacteria 3448
449 Ga0373943_0065487 3300035170 Bacteria 1827
450 Ga0373943_0082662 3300035170 Bacteria 1649
451 Ga0373955_0016851 3300035172 Bacteria 3604
452 Ga0373955_0121647 3300035172 Bacteria 1518
453 Ga0373924_0006435 3300035410 Bacteria 4210
454 Ga0373931_0087138 3300035691 Bacteria 1734
455 Ga0373931_0102005 3300035691 Bacteria 1615
456 Ga0373935_0026077 3300035692 Bacteria 3604
457 Ga0373935_0063286 3300035692 Bacteria 2371
458 Ga0373927_0011124 3300035695 Bacteria 5993
459 Ga0373933_0004893 3300035724 Bacteria 7309
460 Ga0373933_0119911 3300035724 Bacteria 1647
461 Ga0373937_0000917 3300036401 Bacteria 24992
462 Ga0373925_0017742 3300037068 Bacteria 5165
463 Ga0373925_0046105 3300037068 Bacteria 3240
464 Ga0373925_0139808 3300037068 Bacteria 1894
465 Ga0400487_22513 3300039110 Bacteria 4494
466 Ga0436365_0471682 3300039437 Bacteria 352256
467 Ga0439438_000003 3300041405 Bacteria 464587
468 Ga0439438_000282 3300041405 Bacteria 22830
469 Ga0439438_000434 3300041405 Bacteria 19009
470 Ga0439447_000460 3300041407 Bacteria 15181
471 Ga0439447_001914 3300041407 Bacteria 7611
472 Ga0439447_002846 3300041407 Bacteria 6215
473 Ga0439466_0000002 3300041411 Bacteria 494198
474 Ga0439432_000566 3300042006 Bacteria 13854
475 Ga0439432_001003 3300042006 Bacteria 10667
476 Ga0439432_001530 3300042006 Bacteria 8686
477 Ga0439432_006918 3300042006 Bacteria 4035
478 Ga0439432_011946 3300042006 Bacteria 2983
479 Ga0439432_050471 3300042006 Bacteria 1298
480 Ga0439452_000004 3300042010 Bacteria 764268
481 Ga0439452_000011 3300042010 Bacteria 428451
482 Ga0439452_000078 3300042010 Bacteria 83572
483 Ga0439452_000079 3300042010 Bacteria 83084
484 Ga0439452_000498 3300042010 Bacteria 21480
485 Ga0439452_001372 3300042010 Bacteria 10056
486 Ga0439452_005027 3300042010 Bacteria 4320
487 Ga0439463_001405 3300042016 Bacteria 6397
488 Ga0450907_000011 3300042146 Bacteria 90100
489 Ga0439464_0000480 3300042439 Bacteria 8070
490 Ga0439464_0000835 3300042439 Bacteria 6808
491 Ga0439464_0002919 3300042439 Bacteria 4258
492 Ga0439464_0037258 3300042439 Bacteria 1379
493 Ga0466981_0000050 3300044669 Bacteria 33071
494 Ga0453683_0002183 3300044673 Bacteria 15564
495 Ga0495627_000017 3300046453 Bacteria 317280
496 Ga0495627_039039 3300046453 Bacteria 1466
497 Ga0495591_000010 3300046458 Bacteria 327794
498 Ga0495591_000090 3300046458 Bacteria 101695
499 Ga0495591_008692 3300046458 Bacteria 4131
500 Ga0495629_0004045 3300046459 Bacteria 11023
501 Ga0495629_0110851 3300046459 Bacteria 1913
502 Ga0495638_0009212 3300046460 Bacteria 6940
503 Ga0495651_0003405 3300046462 Bacteria 12195
504 Ga0495651_0108448 3300046462 Bacteria 2056
505 Ga0495653_0010771 3300046463 Bacteria 7488
506 Ga0495653_0076265 3300046463 Bacteria 2492
507 Ga0495653_0141771 3300046463 Bacteria 1689
508 Ga0495650_0000004 3300046471 Bacteria 779487
509 Ga0495650_0000040 3300046471 Bacteria 366254
510 Ga0495662_0000962 3300046476 Bacteria 14098
511 Ga0495662_0092255 3300046476 Bacteria 1477
512 Ga0495662_0145934 3300046476 Bacteria 1165
513 Ga0495664_0000189 3300046477 Bacteria 30129
514 Ga0495664_0057002 3300046477 Bacteria 2324
515 Ga0495664_0060025 3300046477 Bacteria 2264
516 Ga0495585_0003087 3300046492 Bacteria 11456
517 Ga0495607_0007704 3300046501 Bacteria 7417
518 Ga0495606_0000399 3300046507 Bacteria 73352
519 Ga0495608_0003600 3300046511 Bacteria 11116
520 Ga0495608_0074309 3300046511 Bacteria 2215
521 Ga0495616_0036251 3300046513 Bacteria 2546
522 Ga0495618_0005858 3300046514 Bacteria 7470
523 Ga0495618_0013451 3300046514 Bacteria 4976
524 Ga0495618_0113179 3300046514 Bacteria 1737
525 Ga0495620_0004428 3300046515 Bacteria 7923
526 Ga0495628_0064866 3300046516 Bacteria 2858
527 Ga0495630_0010043 3300046517 Bacteria 6817
528 Ga0495630_0062397 3300046517 Bacteria 2800
529 Ga0495637_0076767 3300046520 Bacteria 1338
530 Ga0495643_0009513 3300046522 Bacteria 6039
531 Ga0495643_0012022 3300046522 Bacteria 5239
532 Ga0495644_0001240 3300046523 Bacteria 10444
533 Ga0495648_0025365 3300046524 Bacteria 4015
534 Ga0495666_0130454 3300046526 Bacteria 1175
535 Ga0495652_0062255 3300046529 Bacteria 3146
536 Ga0495652_0156266 3300046529 Bacteria 1776
537 Ga0495654_0000036 3300046530 Bacteria 191434
538 Ga0495654_0000089 3300046530 Bacteria 102765
539 Ga0495654_0001414 3300046530 Bacteria 16623
540 Ga0495654_0006656 3300046530 Bacteria 6539
541 Ga0495654_0007828 3300046530 Bacteria 5941
542 Ga0495654_0011543 3300046530 Bacteria 4777
543 Ga0495665_0036818 3300046531 Bacteria 2611
544 Ga0495640_0017827 3300046533 Bacteria 5281
545 Ga0495640_0022695 3300046533 Bacteria 4582
546 Ga0495640_0047158 3300046533 Bacteria 2982
547 Ga0495586_0005750 3300046535 Bacteria 6630
548 Ga0495587_0002660 3300046536 Bacteria 11930
549 Ga0495587_0180924 3300046536 Bacteria 1195
550 Ga0495597_0001169 3300046542 Bacteria 19719
551 Ga0495645_0013174 3300046543 Bacteria 5845
552 Ga0495645_0084923 3300046543 Bacteria 2266
553 Ga0495667_0002184 3300046559 Bacteria 13079
554 Ga0495667_0031709 3300046559 Bacteria 3544
555 Ga0495668_0018313 3300046616 Bacteria 4047
556 Ga0495634_0030542 3300046642 Bacteria 3720
557 Ga0495625_0026706 3300046660 Bacteria 4357
558 Ga0495635_0005714 3300046663 Bacteria 8666
559 Ga0495588_0008161 3300046674 Bacteria 4793
560 Ga0495599_0010386 3300046678 Bacteria 5696
561 Ga0495599_0019612 3300046678 Bacteria 4215
562 Ga0495623_0001753 3300046679 Bacteria 14560
563 Ga0495646_0009424 3300046680 Bacteria 6195
564 Ga0495646_0129277 3300046680 Bacteria 1423
565 Ga0495658_0113114 3300046683 Bacteria 1634
566 Ga0495613_0015542 3300046689 Bacteria 5661
567 Ga0495613_0084733 3300046689 Bacteria 2301
568 Ga0495671_0001824 3300046692 Bacteria 13726
569 Ga0495649_0015867 3300046694 Bacteria 4279
570 Ga0495649_0085897 3300046694 Bacteria 1679
571 Ga0495589_0000013 3300046794 Bacteria 248616
572 Ga0495589_0001531 3300046794 Bacteria 13310
573 Ga0495600_0003284 3300046809 Bacteria 9481
574 Ga0495600_0222713 3300046809 Bacteria 1206
575 Ga0495660_0000022 3300046810 Bacteria 284337
576 Ga0495660_0000184 3300046810 Bacteria 67383
577 Ga0495660_0009386 3300046810 Bacteria 5705
578 Ga0495604_0001751 3300047317 Bacteria 17746
579 Ga0495636_0038768 3300047318 Bacteria 1972
580 Ga0495674_0010400 3300047319 Bacteria 8809
581 Ga0495674_0029546 3300047319 Bacteria 4989
582 Ga0495672_0000003 3300047320 Bacteria 728845
583 Ga0495672_0000082 3300047320 Bacteria 159422
584 Ga0495672_0000103 3300047320 Bacteria 136164
585 Ga0495676_0123587 3300047321 Bacteria 1879
586 Ga0495680_0001204 3300047322 Bacteria 28378
587 Ga0495675_0008632 3300047444 Bacteria 6317
588 Ga0495675_0017704 3300047444 Bacteria 4517
589 Ga0495679_000059 3300047446 Bacteria 109922
590 Ga0495679_001176 3300047446 Bacteria 15545
591 Ga0495673_0000011 3300047469 Bacteria 674140
592 Ga0495673_0000117 3300047469 Bacteria 148662
593 Ga0495681_0063598 3300047470 Bacteria 1693
594 Ga0495684_0027627 3300047471 Bacteria 4356
595 Ga0495684_0046434 3300047471 Bacteria 3322
596 Ga0495684_0196146 3300047471 Bacteria 1490
597 Ga0495686_0023082 3300047472 Bacteria 4110
598 Ga0495602_0054974 3300048088 Bacteria 3509
599 Ga0496100_0020046 3300048903 Bacteria 4002
600 Ga0496100_0021063 3300048903 Bacteria 3920
601 Ga0496100_0327114 3300048903 Bacteria 1153
602 Ga0496101_0000144 3300048904 Bacteria 63019
603 Ga0496102_0007586 3300048905 Bacteria 9267
604 Ga0496102_0124521 3300048905 Bacteria 2409
605 Ga0496102_0243430 3300048905 Bacteria 1696
606 Ga0496104_0000153 3300048907 Bacteria 63666
607 Ga0496104_0001602 3300048907 Bacteria 19480
608 Ga0496104_0072416 3300048907 Bacteria 3277
609 Ga0496104_0396721 3300048907 Bacteria 1292
610 Ga0496105_0008262 3300048908 Bacteria 8095
611 Ga0496105_0266126 3300048908 Bacteria 1385
612 Ga0496105_0364291 3300048908 Bacteria 1152
613 Ga0496107_0091072 3300048910 Bacteria 2229
614 Ga0496110_0070201 3300048913 Bacteria 3103
615 Ga0496111_0026200 3300048914 Bacteria 4117
616 Ga0496111_0170038 3300048914 Bacteria 1619
617 Ga0496111_0351684 3300048914 Bacteria 1091
618 Ga0496112_0072822 3300048915 Bacteria 3396
619 Ga0496113_0258725 3300048916 Bacteria 1390
620 Ga0496113_0276204 3300048916 Bacteria 1343
621 Ga0496114_0335312 3300048917 Bacteria 1337
622 Ga0496115_0041888 3300048918 Bacteria 3647
623 Ga0496116_0000009 3300048919 Bacteria 716119
624 Ga0496116_0000016 3300048919 Bacteria 555146
625 Ga0496116_0000148 3300048919 Bacteria 142458
626 Ga0496116_0000777 3300048919 Bacteria 40580
627 Ga0496116_0001014 3300048919 Bacteria 34246
628 Ga0496116_0002172 3300048919 Bacteria 20890
629 Ga0496116_0013724 3300048919 Bacteria 6513
630 Ga0496116_0086262 3300048919 Bacteria 1926
631 Ga0496116_0098066 3300048919 Bacteria 1759
632 Ga0496116_0129522 3300048919 Bacteria 1441
633 Ga0496116_0196610 3300048919 Bacteria 1060
634 Ga0496117_0000116 3300048920 Bacteria 178919
635 Ga0496117_0002487 3300048920 Bacteria 23118
636 Ga0496117_0005006 3300048920 Bacteria 14211
637 Ga0496117_0005369 3300048920 Bacteria 13499
638 Ga0496117_0005435 3300048920 Bacteria 13378
639 Ga0496117_0006918 3300048920 Bacteria 11245
640 Ga0496117_0035041 3300048920 Bacteria 3773
641 Ga0496117_0042050 3300048920 Bacteria 3340
642 Ga0496117_0052762 3300048920 Bacteria 2861
643 Ga0496117_0110532 3300048920 Bacteria 1713
644 Ga0496117_0115120 3300048920 Bacteria 1665
645 Ga0496117_0131419 3300048920 Bacteria 1516
646 Ga0496117_0175935 3300048920 Bacteria 1236
647 Ga0496117_0261191 3300048920 Bacteria 938
648 Ga0496118_0000906 3300048921 Bacteria 46311
649 Ga0496118_0001701 3300048921 Bacteria 32176
650 Ga0496118_0004732 3300048921 Bacteria 15930
651 Ga0496118_0004852 3300048921 Bacteria 15658
652 Ga0496118_0007265 3300048921 Bacteria 11805
653 Ga0496118_0007795 3300048921 Bacteria 11237
654 Ga0496118_0007826 3300048921 Bacteria 11209
655 Ga0496118_0013851 3300048921 Bacteria 7592
656 Ga0496118_0014265 3300048921 Bacteria 7452
657 Ga0496118_0015913 3300048921 Bacteria 6931
658 Ga0496118_0063118 3300048921 Bacteria 2728
659 Ga0496118_0131896 3300048921 Bacteria 1603
660 Ga0496119_0000096 3300048922 Bacteria 129464
661 Ga0496119_0000472 3300048922 Bacteria 54962
662 Ga0496119_0000586 3300048922 Bacteria 49220
663 Ga0496119_0002196 3300048922 Bacteria 21812
664 Ga0496119_0002287 3300048922 Bacteria 21206
665 Ga0496119_0002663 3300048922 Bacteria 19316
666 Ga0496119_0002975 3300048922 Bacteria 18006
667 Ga0496119_0003291 3300048922 Bacteria 16893
668 Ga0496119_0018393 3300048922 Bacteria 5202
669 Ga0496119_0019571 3300048922 Bacteria 4977
670 Ga0496119_0023595 3300048922 Bacteria 4355
671 Ga0496119_0046692 3300048922 Bacteria 2702
672 Ga0496119_0059638 3300048922 Bacteria 2290
673 Ga0496119_0152323 3300048922 Bacteria 1237
674 Ga0496120_0000068 3300048923 Bacteria 166108
675 Ga0496120_0000166 3300048923 Bacteria 111571
676 Ga0496120_0000389 3300048923 Bacteria 70922
677 Ga0496120_0000572 3300048923 Bacteria 56188
678 Ga0496120_0000602 3300048923 Bacteria 54478
679 Ga0496120_0001236 3300048923 Bacteria 32273
680 Ga0496120_0001364 3300048923 Bacteria 29931
681 Ga0496120_0001521 3300048923 Bacteria 27309
682 Ga0496120_0002363 3300048923 Bacteria 19342
683 Ga0496120_0006318 3300048923 Bacteria 9121
684 Ga0496120_0009015 3300048923 Bacteria 7131
685 Ga0496120_0024995 3300048923 Bacteria 3715
686 Ga0496120_0029973 3300048923 Bacteria 3315
687 Ga0496120_0045608 3300048923 Bacteria 2538
688 Ga0496120_0052555 3300048923 Bacteria 2319
689 Ga0496120_0075730 3300048923 Bacteria 1836
690 Ga0496120_0165239 3300048923 Bacteria 1099
691 Ga0496121_0000052 3300048924 Bacteria 313410
692 Ga0496121_0001407 3300048924 Bacteria 40738
693 Ga0496121_0003985 3300048924 Bacteria 20369
694 Ga0496121_0007946 3300048924 Bacteria 12678
695 Ga0496121_0010723 3300048924 Bacteria 10279
696 Ga0496121_0031562 3300048924 Bacteria 4836
697 Ga0496121_0091888 3300048924 Bacteria 2367
698 Ga0496121_0127925 3300048924 Bacteria 1906
699 Ga0496122_0000070 3300048925 Bacteria 223198
700 Ga0496122_0000392 3300048925 Bacteria 93045
701 Ga0496122_0002311 3300048925 Bacteria 27505
702 Ga0496122_0003665 3300048925 Bacteria 19943
703 Ga0496122_0008374 3300048925 Bacteria 11180
704 Ga0496122_0010138 3300048925 Bacteria 9768
705 Ga0496122_0012297 3300048925 Bacteria 8548
706 Ga0496122_0015706 3300048925 Bacteria 7220
707 Ga0496122_0024217 3300048925 Bacteria 5318
708 Ga0496122_0025645 3300048925 Bacteria 5112
709 Ga0496122_0078133 3300048925 Bacteria 2319
710 Ga0496123_0000017 3300048926 Bacteria 415261
711 Ga0496123_0000131 3300048926 Bacteria 153642
712 Ga0496123_0001554 3300048926 Bacteria 31553
713 Ga0496123_0001924 3300048926 Bacteria 27116
714 Ga0496123_0004679 3300048926 Bacteria 14185
715 Ga0496123_0006706 3300048926 Bacteria 11090
716 Ga0496123_0007192 3300048926 Bacteria 10563
717 Ga0496123_0052895 3300048926 Bacteria 2688
718 Ga0496123_0053471 3300048926 Bacteria 2668
719 Ga0496123_0073406 3300048926 Bacteria 2122
720 Ga0496123_0075724 3300048926 Bacteria 2075
721 Ga0496123_0098954 3300048926 Bacteria 1703
722 Ga0496124_0000053 3300048927 Bacteria 252285
723 Ga0496124_0000303 3300048927 Bacteria 91070
724 Ga0496124_0000630 3300048927 Bacteria 58501
725 Ga0496124_0001210 3300048927 Bacteria 39962
726 Ga0496124_0001921 3300048927 Bacteria 28471
727 Ga0496124_0002062 3300048927 Bacteria 27252
728 Ga0496124_0003880 3300048927 Bacteria 17881
729 Ga0496124_0004583 3300048927 Bacteria 16033
730 Ga0496124_0009686 3300048927 Bacteria 9864
731 Ga0496124_0011012 3300048927 Bacteria 9083
732 Ga0496124_0030577 3300048927 Bacteria 4777
733 Ga0496124_0031483 3300048927 Bacteria 4695
734 Ga0496124_0038930 3300048927 Bacteria 4124
735 Ga0496124_0040972 3300048927 Bacteria 4001
736 Ga0496124_0124721 3300048927 Bacteria 2053
737 Ga0496124_0127223 3300048927 Bacteria 2028
738 Ga0496125_0000056 3300048928 Bacteria 271016
739 Ga0496125_0000329 3300048928 Bacteria 91776
740 Ga0496125_0002880 3300048928 Bacteria 21658
741 Ga0496125_0008126 3300048928 Bacteria 11051
742 Ga0496125_0008724 3300048928 Bacteria 10549
743 Ga0496125_0014954 3300048928 Bacteria 7536
744 Ga0496126_0000137 3300048929 Bacteria 167415
745 Ga0496126_0000818 3300048929 Bacteria 55553
746 Ga0496126_0025978 3300048929 Bacteria 5622
747 Ga0496126_0035995 3300048929 Bacteria 4633
748 Ga0496126_0037205 3300048929 Bacteria 4543
749 Ga0496126_0039024 3300048929 Bacteria 4411
750 Ga0496126_0071555 3300048929 Bacteria 3086
751 Ga0495678_000142 3300049459 Bacteria 86788
752 Ga0495678_037537 3300049459 Bacteria 1967
753 Ga0495682_0000034 3300049460 Bacteria 131806
754 Ga0501033_0080497 3300049570 Bacteria 2390
755 Ga0501034_0050830 3300049571 Bacteria 4180
756 Ga0501034_0109009 3300049571 Bacteria 2760
757 Ga0501038_0211111 3300049574 Bacteria 1553
758 Ga0501046_0121964 3300049580 Bacteria 1983
759 Ga0501047_0013360 3300049581 Bacteria 7782
760 Ga0501047_0040203 3300049581 Bacteria 4523
761 Ga0501047_0052523 3300049581 Bacteria 3939
762 Ga0501047_0270655 3300049581 Bacteria 1545
763 Ga0501067_0008176 3300049583 Bacteria 5811
764 Ga0501067_0014574 3300049583 Bacteria 4352
765 Ga0501067_0026561 3300049583 Bacteria 3207
766 Ga0501068_0081154 3300049584 Bacteria 1991
767 Ga0501069_0022611 3300049585 Bacteria 3422
768 Ga0501069_0037274 3300049585 Bacteria 2683
769 Ga0501070_0007890 3300049586 Bacteria 9018
770 Ga0501070_0077636 3300049586 Bacteria 2748
771 Ga0501070_0252744 3300049586 Bacteria 1441
772 Ga0501072_0017632 3300049588 Bacteria 5491
773 Ga0501073_0032601 3300049589 Bacteria 3714
774 Ga0501074_0095267 3300049590 Bacteria 2132
775 Ga0501074_0216356 3300049590 Bacteria 1364
776 Ga0501076_0157277 3300049592 Bacteria 1851
777 Ga0501077_0029901 3300049593 Bacteria 3465
778 Ga0501233_018062 3300049668 Unclassified 1479
779 Ga0501079_0061509 3300049741 Bacteria 2897
780 Ga0501080_0072661 3300049742 Bacteria 3200
781 Ga0501080_0074653 3300049742 Bacteria 3154
782 Ga0501080_0105338 3300049742 Bacteria 2615
783 Ga0501083_0004742 3300049744 Bacteria 9604
784 Ga0501083_0018349 3300049744 Bacteria 4876
785 Ga0501083_0112220 3300049744 Bacteria 1791
786 Ga0501035_0003726 3300049822 Bacteria 14536
787 Ga0501035_0051407 3300049822 Bacteria 3690
788 Ga0501044_0034569 3300049823 Bacteria 5299
789 Ga0501044_0098397 3300049823 Bacteria 2945
790 Ga0501044_0245234 3300049823 Bacteria 1734
791 nmdc:mga00v17_12262_c1 3300050491 Bacteria 4728
792 nmdc:mga00v17_26883_c1 3300050491 Bacteria 3356
793 nmdc:mga00v17_37338_c1 3300050491 Bacteria 2900
794 nmdc:mga0k408_5714_c2 3300050493 Bacteria 4889
795 nmdc:mga05p37_72861_c1 3300050507 Bacteria 4227
796 nmdc:mga09592_14738_c1 3300050508 Bacteria 6378
797 nmdc:mga0qj67_41057_c1 3300050509 Bacteria 3638
798 nmdc:mga06r32_285292_c1 3300050510 Bacteria 1638
799 nmdc:mga0rr50_616455_c1 3300050513 Bacteria 925
800 nmdc:mga08x19_112405_c1 3300050514 Bacteria 1818
801 nmdc:mga08x19_145376_c1 3300050514 Bacteria 1603
802 nmdc:mga0a205_105968_c1 3300050515 Bacteria 2710
803 Ga0495601_0023347 3300053077 Bacteria 3799
804 Ga0495601_0026298 3300053077 Bacteria 3592
805 Ga0495601_0043811 3300053077 Bacteria 2811
806 Ga0495612_0000213 3300053078 Bacteria 24541
807 Ga0495595_0001849 3300053084 Bacteria 8223
808 Ga0495619_0000666 3300053085 Bacteria 22530
809 Ga0495619_0002522 3300053085 Bacteria 11978
810 Ga0500593_037334 3300053117 Bacteria 2176
811 Ga0500618_000706 3300053125 Bacteria 19584
812 Ga0500621_000010 3300053126 Bacteria 169537
813 Ga0500616_0002271 3300053153 Bacteria 16324
814 Ga0500627_0031176 3300053158 Bacteria 2238
815 Ga0501084_0009351 3300054114 Bacteria 8112
816 Ga0501084_0052721 3300054114 Bacteria 3402
817 Ga0501084_0158231 3300054114 Bacteria 1911
818 Ga0501084_0200950 3300054114 Bacteria 1682
819 Ga0501084_0245643 3300054114 Bacteria 1511
820 Ga0501082_0025055 3300060353 Bacteria 5139
821 Ga0501082_0050044 3300060353 Bacteria 3603
822 Ga0501082_0067226 3300060353 Bacteria 3086
823 Ga0501082_0395879 3300060353 Bacteria 1205
824 Ga0501082_0434975 3300060353 Bacteria 1146

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048919 Ga0496116_0129522 Ga0496116_0129522_38_892 284
2 3300048920 Ga0496117_0261191 Ga0496117_0261191_47_901 284
3 3300048922 Ga0496119_0152323 Ga0496119_0152323_38_892 284
4 3300050513 nmdc:mga0rr50_616455_c1 nmdc:mga0rr50_616455_c1_21_911 292
5 iso_pu_bacteria 2738543024 2739307524 295
6 3300060353 Ga0501082_0395879 Ga0501082_0395879_13_918 297
7 3300025899 Ga0207642_10052739 Ga0207642_100527393 301
8 3300025901 Ga0207688_10019282 Ga0207688_100192822 301
9 3300048921 Ga0496118_0131896 Ga0496118_0131896_151_1179 302
10 3300048929 Ga0496126_0035995 Ga0496126_0035995_1062_2054 305
11 iso_pu_bacteria 2996310559 2996312126 305
12 3300025915 Ga0207693_10001110 Ga0207693_100011106 306
13 3300011119 Ga0105246_10122072 Ga0105246_101220722 307
14 3300015265 Ga0182005_1002849 Ga0182005_10028493 309
15 3300028379 Ga0268266_10409747 Ga0268266_104097472 309
16 3300048905 Ga0496102_0007586 Ga0496102_0007586_5526_6470 309
17 3300048919 Ga0496116_0013724 Ga0496116_0013724_4414_5358 309
18 3300048920 Ga0496117_0002487 Ga0496117_0002487_7419_8363 309
19 3300048921 Ga0496118_0001701 Ga0496118_0001701_26054_26998 309
20 3300048922 Ga0496119_0002975 Ga0496119_0002975_12748_13692 309
21 3300048923 Ga0496120_0006318 Ga0496120_0006318_4651_5595 309
22 3300048924 Ga0496121_0001407 Ga0496121_0001407_32288_33232 309
23 3300048925 Ga0496122_0012297 Ga0496122_0012297_323_1267 309
24 3300048926 Ga0496123_0007192 Ga0496123_0007192_7256_8200 309
25 3300048927 Ga0496124_0011012 Ga0496124_0011012_2364_3308 309
26 3300005937 Ga0081455_10030083 Ga0081455_100300835 310
27 3300006846 Ga0075430_100123490 Ga0075430_1001234902 311
28 3300006847 Ga0075431_100070799 Ga0075431_1000707993 311
29 3300006880 Ga0075429_100005400 Ga0075429_1000054003 311
30 3300009147 Ga0114129_10063906 Ga0114129_100639061 311
31 3300050507 nmdc:mga05p37_72861_c1 nmdc:mga05p37_72861_c1_1540_2553 311
32 3300050509 nmdc:mga0qj67_41057_c1 nmdc:mga0qj67_41057_c1_2393_3406 311
33 3300005436 Ga0070713_100066546 Ga0070713_1000665462 312
34 3300050514 nmdc:mga08x19_145376_c1 nmdc:mga08x19_145376_c1_95_1096 312
35 3300031018 Ga0265773_1002260 Ga0265773_10022601 313
36 3300046459 Ga0495629_0110851 Ga0495629_0110851_861_1844 313
37 3300046477 Ga0495664_0057002 Ga0495664_0057002_1199_2182 313
38 3300046689 Ga0495613_0084733 Ga0495613_0084733_15_968 313
39 3300047471 Ga0495684_0196146 Ga0495684_0196146_47_1030 313
40 iso_pu_bacteria 2909042592 2909044673 313
41 3300046517 Ga0495630_0062397 Ga0495630_0062397_11_997 314
42 3300025315 Ga0207697_10106612 Ga0207697_101066121 315
43 3300060353 Ga0501082_0025055 Ga0501082_0025055_3410_4402 315
44 iso_pu_bacteria 2534681786 2535486069 315
45 iso_pu_bacteria 2510917022 2511136599 316
46 iso_pu_bacteria 2510917026 2511171945 316
47 iso_pu_bacteria 2524023209 2524460110 316
48 iso_pu_bacteria 2582581307 2585274244 316
49 iso_pu_bacteria 2582581308 2585280343 316
50 iso_pu_bacteria 2582581315 2585322621 316
51 iso_pu_bacteria 2582581316 2585330734 316
52 iso_pu_bacteria 2585427527 2585532573 316
53 iso_pu_bacteria 2585427530 2585554411 316
54 iso_pu_bacteria 2585427531 2585560693 316
55 iso_pu_bacteria 2585427608 2585898899 316
56 iso_pu_bacteria 2585427609 2585903509 316
57 iso_pu_bacteria 2585428125 2587981372 316
58 iso_pu_bacteria 2599185236 2599723280 316
59 iso_pu_bacteria 2615840626 2616307356 316
60 iso_pu_bacteria 2615840698 2616554900 316
61 iso_pu_bacteria 2617270742 2617383572 316
62 iso_pu_bacteria 2667528174 2671112149 316
63 iso_pu_bacteria 2738541317 2738944469 316
64 iso_pu_bacteria 2775507266 2778175966 316
65 iso_pu_bacteria 2818991448 2819609645 316
66 iso_pu_bacteria 2818991453 2819639742 316
67 iso_pu_bacteria 2838029111 2838033088 316
68 iso_pu_bacteria 2842298080 2842298664 316
69 iso_pu_bacteria 2842357229 2842359469 316
70 iso_pu_bacteria 2842475841 2842479821 316
71 iso_pu_bacteria 2842482326 2842483433 316
72 iso_pu_bacteria 2842502639 2842506997 316
73 iso_pu_bacteria 2842509118 2842510692 316
74 iso_pu_bacteria 2852387548 2852391149 316
75 iso_pu_bacteria 2899803654 2899806464 316
76 iso_pu_bacteria 2913308742 2913309088 316
77 iso_pu_bacteria 2919171160 2919173348 316
78 iso_pu_bacteria 2919408235 2919410634 316
79 iso_pu_bacteria 3005416602 3005418530 316
80 iso_pu_bacteria 8005314921 8005318578 316
81 iso_pu_bacteria 8005484373 8005488539 316
82 iso_pu_bacteria 8005645114 8005649006 316
83 iso_pu_bacteria 8005658619 8005662486 316
84 iso_pu_bacteria 8005682033 8005682246 316
85 iso_pu_bacteria 8057575449 8057580998 316
86 3300005340 Ga0070689_100021941 Ga0070689_1000219413 317
87 3300005355 Ga0070671_100004342 Ga0070671_1000043426 317
88 3300005364 Ga0070673_100002768 Ga0070673_1000027682 317
89 3300005435 Ga0070714_100023128 Ga0070714_1000231282 317
90 3300005439 Ga0070711_100009650 Ga0070711_1000096505 317
91 3300005456 Ga0070678_100020438 Ga0070678_1000204382 317
92 3300005543 Ga0070672_100056029 Ga0070672_1000560292 317
93 3300005548 Ga0070665_100178171 Ga0070665_1001781713 317
94 3300005842 Ga0068858_100033841 Ga0068858_1000338413 317
95 3300014325 Ga0163163_10041019 Ga0163163_100410193 317
96 3300024227 Ga0228598_1000779 Ga0228598_10007793 317
97 3300025925 Ga0207650_10026935 Ga0207650_100269353 317
98 3300025931 Ga0207644_10052478 Ga0207644_100524783 317
99 3300025936 Ga0207670_10006332 Ga0207670_100063322 317
100 3300025960 Ga0207651_10020956 Ga0207651_100209562 317
101 3300028379 Ga0268266_10032511 Ga0268266_100325113 317
102 3300035116 Ga0373945_0002178 Ga0373945_0002178_4536_5537 317
103 3300035119 Ga0373956_0013098 Ga0373956_0013098_2153_3172 317
104 3300035170 Ga0373943_0082662 Ga0373943_0082662_382_1383 317
105 3300035172 Ga0373955_0016851 Ga0373955_0016851_1102_2121 317
106 3300035691 Ga0373931_0087138 Ga0373931_0087138_274_1275 317
107 3300035692 Ga0373935_0026077 Ga0373935_0026077_451_1452 317
108 3300035695 Ga0373927_0011124 Ga0373927_0011124_4824_5825 317
109 3300037068 Ga0373925_0046105 Ga0373925_0046105_1755_2756 317
110 3300037068 Ga0373925_0139808 Ga0373925_0139808_850_1872 317
111 3300039110 Ga0400487_22513 Ga0400487_22513_2445_3401 317
112 3300046462 Ga0495651_0108448 Ga0495651_0108448_18_1037 317
113 3300046463 Ga0495653_0076265 Ga0495653_0076265_1064_2065 317
114 3300046463 Ga0495653_0141771 Ga0495653_0141771_267_1286 317
115 3300046476 Ga0495662_0000962 Ga0495662_0000962_3352_4353 317
116 3300046476 Ga0495662_0092255 Ga0495662_0092255_70_1089 317
117 3300046477 Ga0495664_0000189 Ga0495664_0000189_2227_3228 317
118 3300046511 Ga0495608_0074309 Ga0495608_0074309_943_1962 317
119 3300046514 Ga0495618_0005858 Ga0495618_0005858_2545_3546 317
120 3300046514 Ga0495618_0113179 Ga0495618_0113179_499_1518 317
121 3300046517 Ga0495630_0010043 Ga0495630_0010043_2912_3913 317
122 3300046526 Ga0495666_0130454 Ga0495666_0130454_31_1053 317
123 3300046529 Ga0495652_0156266 Ga0495652_0156266_705_1706 317
124 3300046531 Ga0495665_0036818 Ga0495665_0036818_1321_2322 317
125 3300046533 Ga0495640_0022695 Ga0495640_0022695_3106_4107 317
126 3300046533 Ga0495640_0047158 Ga0495640_0047158_1455_2474 317
127 3300046535 Ga0495586_0005750 Ga0495586_0005750_2753_3754 317
128 3300046536 Ga0495587_0180924 Ga0495587_0180924_56_1075 317
129 3300046543 Ga0495645_0013174 Ga0495645_0013174_1434_2435 317
130 3300046543 Ga0495645_0084923 Ga0495645_0084923_1123_2142 317
131 3300046559 Ga0495667_0031709 Ga0495667_0031709_2076_3095 317
132 3300046642 Ga0495634_0030542 Ga0495634_0030542_888_1889 317
133 3300046678 Ga0495599_0019612 Ga0495599_0019612_3037_4056 317
134 3300046689 Ga0495613_0015542 Ga0495613_0015542_1967_2986 317
135 3300046809 Ga0495600_0222713 Ga0495600_0222713_27_1046 317
136 3300047319 Ga0495674_0029546 Ga0495674_0029546_2921_3922 317
137 3300047444 Ga0495675_0017704 Ga0495675_0017704_3338_4357 317
138 3300047471 Ga0495684_0027627 Ga0495684_0027627_2895_3896 317
139 3300048907 Ga0496104_0396721 Ga0496104_0396721_72_1073 317
140 3300048915 Ga0496112_0072822 Ga0496112_0072822_2323_3324 317
141 3300048918 Ga0496115_0041888 Ga0496115_0041888_1123_2124 317
142 3300053077 Ga0495601_0026298 Ga0495601_0026298_1832_2833 317
143 3300053078 Ga0495612_0000213 Ga0495612_0000213_18604_19605 317
144 3300053085 Ga0495619_0002522 Ga0495619_0002522_10450_11451 317
145 iso_pu_bacteria 2511231027 2511390338 317
146 iso_pu_bacteria 2767802442 2770198979 317
147 iso_pu_bacteria 2775506902 2776270248 317
148 iso_pu_bacteria 2775506904 2776285023 317
149 iso_pu_bacteria 2839993093 2839998308 317
150 iso_pu_bacteria 2842871566 2842872306 317
151 iso_pu_bacteria 2894652903 2894655577 317
152 iso_pu_bacteria 2904578770 2904582283 317
153 iso_pu_bacteria 2919119836 2919122933 317
154 iso_pu_bacteria 2928521798 2928524227 317
155 iso_pu_bacteria 2954011201 2954013176 317
156 iso_pu_bacteria 3002141150 3002145138 317
157 3300001979 JGI24740J21852_10000449 JGI24740J21852_100004499 318
158 3300002705 JGI25156J39149_1000215 JGI25156J39149_100021530 318
159 3300002737 JGI25162J39368_1000449 JGI25162J39368_100044921 318
160 3300002737 JGI25162J39368_1000471 JGI25162J39368_10004716 318
161 3300002738 JGI25154J39366_1000169 JGI25154J39366_100016939 318
162 3300002741 JGI25157J39369_1000226 JGI25157J39369_100022610 318
163 3300002987 JGI25159J45721_1000718 JGI25159J45721_10007186 318
164 3300003214 JGI25165J46597_1000443 JGI25165J46597_100044322 318
165 3300003214 JGI25165J46597_1001071 JGI25165J46597_100107114 318
166 3300003214 JGI25165J46597_1006237 JGI25165J46597_10062372 318
167 3300003354 JGI25160J50197_1000114 JGI25160J50197_100011448 318
168 3300003374 JGI25161J50226_1000089 JGI25161J50226_100008935 318
169 3300003794 Ga0055531_10013484 Ga0055531_100134843 318
170 3300003856 Ga0058692_1008101 Ga0058692_10081012 318
171 3300004625 Ga0055543_1000002 Ga0055543_1000002365 318
172 3300005262 Ga0065165_1000537 Ga0065165_100053710 318
173 3300005548 Ga0070665_100031391 Ga0070665_1000313912 318
174 3300005616 Ga0068852_100014145 Ga0068852_1000141452 318
175 3300006048 Ga0075363_100106950 Ga0075363_1001069501 318
176 3300006178 Ga0075367_10151258 Ga0075367_101512582 318
177 3300009093 Ga0105240_10000019 Ga0105240_10000019203 318
178 3300009148 Ga0105243_10157788 Ga0105243_101577882 318
179 3300009177 Ga0105248_10444841 Ga0105248_104448412 318
180 3300009545 Ga0105237_10002680 Ga0105237_100026806 318
181 3300010375 Ga0105239_10002581 Ga0105239_100025816 318
182 3300013104 Ga0157370_10003061 Ga0157370_100030619 318
183 3300014497 Ga0182008_10025779 Ga0182008_100257792 318
184 3300015262 Ga0182007_10032719 Ga0182007_100327192 318
185 3300025206 Ga0209435_100005 Ga0209435_100005199 318
186 3300025233 Ga0209437_100078 Ga0209437_100078222 318
187 3300025233 Ga0209437_100291 Ga0209437_10029114 318
188 3300025246 Ga0209646_1000011 Ga0209646_1000011199 318
189 3300025250 Ga0209026_1000008 Ga0209026_1000008199 318
190 3300025253 Ga0209677_100524 Ga0209677_10052418 318
191 3300025256 Ga0209759_1000004 Ga0209759_1000004199 318
192 3300025261 Ga0209233_1000157 Ga0209233_100015746 318
193 3300025261 Ga0209233_1000192 Ga0209233_100019264 318
194 3300025261 Ga0209233_1000194 Ga0209233_100019461 318
195 3300025284 Ga0209130_1000083 Ga0209130_1000083134 318
196 3300025292 Ga0209676_1020610 Ga0209676_10206102 318
197 3300025297 Ga0209758_1000657 Ga0209758_100065726 318
198 3300025298 Ga0209050_1030485 Ga0209050_10304851 318
199 3300025302 Ga0207426_1000173 Ga0207426_1000173134 318
200 3300025303 Ga0209051_1017207 Ga0209051_10172072 318
201 3300025304 Ga0209257_1005500 Ga0209257_10055009 318
202 3300025913 Ga0207695_10000049 Ga0207695_10000049205 318
203 3300025914 Ga0207671_10000860 Ga0207671_1000086022 318
204 3300027312 Ga0209371_1005938 Ga0209371_10059384 318
205 3300030500 Ga0268256_1010019 Ga0268256_10100192 318
206 3300031616 Ga0307508_10056023 Ga0307508_100560234 318
207 3300033180 Ga0307510_10159259 Ga0307510_101592592 318
208 3300046530 Ga0495654_0001414 Ga0495654_0001414_2474_3469 318
209 3300047472 Ga0495686_0023082 Ga0495686_0023082_1302_2297 318
210 3300048914 Ga0496111_0026200 Ga0496111_0026200_844_1839 318
211 3300048920 Ga0496117_0115120 Ga0496117_0115120_319_1314 318
212 3300048922 Ga0496119_0046692 Ga0496119_0046692_84_1079 318
213 3300048923 Ga0496120_0075730 Ga0496120_0075730_188_1183 318
214 3300048925 Ga0496122_0010138 Ga0496122_0010138_2790_3785 318
215 3300048925 Ga0496122_0025645 Ga0496122_0025645_2409_3404 318
216 3300048926 Ga0496123_0075724 Ga0496123_0075724_317_1312 318
217 3300048927 Ga0496124_0031483 Ga0496124_0031483_3506_4501 318
218 3300048927 Ga0496124_0124721 Ga0496124_0124721_431_1426 318
219 3300049571 Ga0501034_0050830 Ga0501034_0050830_874_1881 318
220 3300049583 Ga0501067_0014574 Ga0501067_0014574_74_1081 318
221 3300049585 Ga0501069_0037274 Ga0501069_0037274_682_1689 318
222 3300049588 Ga0501072_0017632 Ga0501072_0017632_222_1229 318
223 3300049590 Ga0501074_0216356 Ga0501074_0216356_94_1101 318
224 3300049744 Ga0501083_0018349 Ga0501083_0018349_3492_4484 318
225 3300049822 Ga0501035_0003726 Ga0501035_0003726_10605_11612 318
226 3300053125 Ga0500618_000706 Ga0500618_000706_12241_13236 318
227 3300053153 Ga0500616_0002271 Ga0500616_0002271_8696_9691 318
228 3300053158 Ga0500627_0031176 Ga0500627_0031176_669_1664 318
229 iso_pu_bacteria 2828305725 2828308496 318
230 iso_pu_bacteria 8002285264 8002291629 318
231 iso_pu_bacteria 8056875544 8056876128 318
232 3300013307 Ga0157372_10472686 Ga0157372_104726862 319
233 3300025294 Ga0209025_1024737 Ga0209025_10247372 319
234 3300032002 Ga0307416_100301569 Ga0307416_1003015692 319
235 3300035086 Ga0373934_0021830 Ga0373934_0021830_694_1707 319
236 3300035118 Ga0373954_0009647 Ga0373954_0009647_2819_3832 319
237 3300035119 Ga0373956_0000993 Ga0373956_0000993_4998_6011 319
238 3300035170 Ga0373943_0065487 Ga0373943_0065487_586_1599 319
239 3300035172 Ga0373955_0121647 Ga0373955_0121647_123_1136 319
240 3300035410 Ga0373924_0006435 Ga0373924_0006435_1649_2662 319
241 3300035692 Ga0373935_0063286 Ga0373935_0063286_61_1074 319
242 3300035724 Ga0373933_0004893 Ga0373933_0004893_1670_2683 319
243 3300036401 Ga0373937_0000917 Ga0373937_0000917_3787_4800 319
244 3300037068 Ga0373925_0017742 Ga0373925_0017742_3601_4614 319
245 3300046459 Ga0495629_0004045 Ga0495629_0004045_769_1782 319
246 3300046462 Ga0495651_0003405 Ga0495651_0003405_7379_8392 319
247 3300046463 Ga0495653_0010771 Ga0495653_0010771_2687_3700 319
248 3300046476 Ga0495662_0145934 Ga0495662_0145934_34_1059 319
249 3300046477 Ga0495664_0060025 Ga0495664_0060025_851_1864 319
250 3300046511 Ga0495608_0003600 Ga0495608_0003600_1611_2624 319
251 3300046514 Ga0495618_0013451 Ga0495618_0013451_218_1231 319
252 3300046516 Ga0495628_0064866 Ga0495628_0064866_522_1535 319
253 3300046529 Ga0495652_0062255 Ga0495652_0062255_1505_2518 319
254 3300046533 Ga0495640_0017827 Ga0495640_0017827_525_1538 319
255 3300046536 Ga0495587_0002660 Ga0495587_0002660_3750_4763 319
256 3300046559 Ga0495667_0002184 Ga0495667_0002184_3768_4781 319
257 3300046663 Ga0495635_0005714 Ga0495635_0005714_6212_7225 319
258 3300046678 Ga0495599_0010386 Ga0495599_0010386_3112_4125 319
259 3300046679 Ga0495623_0001753 Ga0495623_0001753_9485_10498 319
260 3300046680 Ga0495646_0009424 Ga0495646_0009424_280_1293 319
261 3300046683 Ga0495658_0113114 Ga0495658_0113114_201_1214 319
262 3300046809 Ga0495600_0003284 Ga0495600_0003284_7167_8180 319
263 3300047317 Ga0495604_0001751 Ga0495604_0001751_3702_4715 319
264 3300047319 Ga0495674_0010400 Ga0495674_0010400_3766_4779 319
265 3300047322 Ga0495680_0001204 Ga0495680_0001204_27196_28209 319
266 3300047444 Ga0495675_0008632 Ga0495675_0008632_3694_4707 319
267 3300047471 Ga0495684_0046434 Ga0495684_0046434_1327_2340 319
268 3300048088 Ga0495602_0054974 Ga0495602_0054974_399_1412 319
269 3300049570 Ga0501033_0080497 Ga0501033_0080497_1001_1984 319
270 3300049571 Ga0501034_0109009 Ga0501034_0109009_88_1071 319
271 3300049574 Ga0501038_0211111 Ga0501038_0211111_76_1059 319
272 3300049580 Ga0501046_0121964 Ga0501046_0121964_452_1549 319
273 3300049581 Ga0501047_0013360 Ga0501047_0013360_4547_5644 319
274 3300049581 Ga0501047_0052523 Ga0501047_0052523_2446_3429 319
275 3300049581 Ga0501047_0270655 Ga0501047_0270655_118_1137 319
276 3300049585 Ga0501069_0022611 Ga0501069_0022611_2267_3250 319
277 3300049586 Ga0501070_0007890 Ga0501070_0007890_148_1245 319
278 3300049586 Ga0501070_0252744 Ga0501070_0252744_187_1284 319
279 3300049822 Ga0501035_0051407 Ga0501035_0051407_2453_3472 319
280 3300049823 Ga0501044_0034569 Ga0501044_0034569_3028_4125 319
281 3300049823 Ga0501044_0098397 Ga0501044_0098397_1810_2829 319
282 3300053077 Ga0495601_0023347 Ga0495601_0023347_2756_3781 319
283 3300053084 Ga0495595_0001849 Ga0495595_0001849_2584_3597 319
284 3300053085 Ga0495619_0000666 Ga0495619_0000666_1325_2338 319
285 3300060353 Ga0501082_0434975 Ga0501082_0434975_73_1056 319
286 iso_pu_bacteria 2757320392 2757571324 319
287 iso_pu_bacteria 2765235802 2765466346 319
288 iso_pu_bacteria 2840764183 2840769141 319
289 3300005334 Ga0068869_100347549 Ga0068869_1003475491 320
290 3300006852 Ga0075433_10014754 Ga0075433_100147542 320
291 3300028577 Ga0265318_10047325 Ga0265318_100473252 320
292 3300031235 Ga0265330_10061813 Ga0265330_100618132 320
293 3300031241 Ga0265325_10008951 Ga0265325_100089514 320
294 3300031241 Ga0265325_10152706 Ga0265325_101527061 320
295 3300031247 Ga0265340_10001019 Ga0265340_1000101910 320
296 3300031247 Ga0265340_10012971 Ga0265340_100129713 320
297 3300031247 Ga0265340_10078344 Ga0265340_100783442 320
298 3300031249 Ga0265339_10023636 Ga0265339_100236363 320
299 3300031595 Ga0265313_10000522 Ga0265313_1000052215 320
300 3300031595 Ga0265313_10013071 Ga0265313_100130714 320
301 3300031595 Ga0265313_10061307 Ga0265313_100613071 320
302 3300031711 Ga0265314_10063845 Ga0265314_100638452 320
303 3300031712 Ga0265342_10006229 Ga0265342_100062297 320
304 3300031712 Ga0265342_10049960 Ga0265342_100499602 320
305 3300035724 Ga0373933_0119911 Ga0373933_0119911_396_1367 320
306 3300046680 Ga0495646_0129277 Ga0495646_0129277_189_1160 320
307 3300048922 Ga0496119_0002287 Ga0496119_0002287_1314_2357 320
308 3300048926 Ga0496123_0053471 Ga0496123_0053471_1228_2229 320
309 3300049581 Ga0501047_0040203 Ga0501047_0040203_2338_3339 320
310 3300049583 Ga0501067_0008176 Ga0501067_0008176_462_1463 320
311 3300049583 Ga0501067_0026561 Ga0501067_0026561_1966_2970 320
312 3300049584 Ga0501068_0081154 Ga0501068_0081154_948_1958 320
313 3300049586 Ga0501070_0077636 Ga0501070_0077636_366_1376 320
314 3300049589 Ga0501073_0032601 Ga0501073_0032601_628_1629 320
315 3300049590 Ga0501074_0095267 Ga0501074_0095267_867_1868 320
316 3300049592 Ga0501076_0157277 Ga0501076_0157277_471_1478 320
317 3300049593 Ga0501077_0029901 Ga0501077_0029901_51_1052 320
318 3300049741 Ga0501079_0061509 Ga0501079_0061509_1825_2826 320
319 3300049742 Ga0501080_0072661 Ga0501080_0072661_872_1873 320
320 3300049742 Ga0501080_0074653 Ga0501080_0074653_830_1834 320
321 3300049742 Ga0501080_0105338 Ga0501080_0105338_1142_2152 320
322 3300049744 Ga0501083_0004742 Ga0501083_0004742_6465_7463 320
323 3300049744 Ga0501083_0112220 Ga0501083_0112220_685_1686 320
324 3300049823 Ga0501044_0245234 Ga0501044_0245234_44_1054 320
325 3300053117 Ga0500593_037334 Ga0500593_037334_1029_2135 320
326 3300054114 Ga0501084_0009351 Ga0501084_0009351_6938_8020 320
327 3300054114 Ga0501084_0052721 Ga0501084_0052721_2307_3308 320
328 3300054114 Ga0501084_0158231 Ga0501084_0158231_623_1627 320
329 3300054114 Ga0501084_0200950 Ga0501084_0200950_168_1169 320
330 3300054114 Ga0501084_0245643 Ga0501084_0245643_320_1318 320
331 3300060353 Ga0501082_0050044 Ga0501082_0050044_1070_2071 320
332 3300060353 Ga0501082_0067226 Ga0501082_0067226_1200_2198 320
333 iso_pu_bacteria 2751185800 2753357266 320
334 iso_pu_bacteria 2758568016 2758639672 320
335 iso_pu_bacteria 2854911287 2854916733 320
336 iso_pu_bacteria 2915650412 2915652011 320
337 3300003371 JGI26145J50221_1000724 JGI26145J50221_10007242 321
338 3300005289 Ga0065704_10013586 Ga0065704_100135861 321
339 3300005295 Ga0065707_10108180 Ga0065707_101081803 321
340 3300005328 Ga0070676_10027376 Ga0070676_100273763 321
341 3300005329 Ga0070683_100027190 Ga0070683_1000271904 321
342 3300005330 Ga0070690_100010622 Ga0070690_1000106223 321
343 3300005331 Ga0070670_100017812 Ga0070670_1000178123 321
344 3300005333 Ga0070677_10014550 Ga0070677_100145502 321
345 3300005334 Ga0068869_100044440 Ga0068869_1000444402 321
346 3300005335 Ga0070666_10027773 Ga0070666_100277733 321
347 3300005336 Ga0070680_100040696 Ga0070680_1000406963 321
348 3300005338 Ga0068868_100016978 Ga0068868_1000169783 321
349 3300005339 Ga0070660_100019059 Ga0070660_1000190595 321
350 3300005340 Ga0070689_100031840 Ga0070689_1000318402 321
351 3300005344 Ga0070661_100012095 Ga0070661_1000120954 321
352 3300005356 Ga0070674_100001020 Ga0070674_1000010207 321
353 3300005364 Ga0070673_100036202 Ga0070673_1000362021 321
354 3300005365 Ga0070688_100108415 Ga0070688_1001084151 321
355 3300005366 Ga0070659_100011884 Ga0070659_1000118843 321
356 3300005436 Ga0070713_100156809 Ga0070713_1001568092 321
357 3300005438 Ga0070701_10083355 Ga0070701_100833551 321
358 3300005440 Ga0070705_100005704 Ga0070705_1000057042 321
359 3300005441 Ga0070700_100007133 Ga0070700_1000071334 321
360 3300005444 Ga0070694_100024935 Ga0070694_1000249352 321
361 3300005456 Ga0070678_100015570 Ga0070678_1000155703 321
362 3300005457 Ga0070662_100002557 Ga0070662_1000025575 321
363 3300005458 Ga0070681_10009409 Ga0070681_100094098 321
364 3300005459 Ga0068867_100002693 Ga0068867_1000026934 321
365 3300005530 Ga0070679_100021719 Ga0070679_1000217194 321
366 3300005543 Ga0070672_100006520 Ga0070672_1000065203 321
367 3300005545 Ga0070695_100056780 Ga0070695_1000567802 321
368 3300005547 Ga0070693_100070556 Ga0070693_1000705562 321
369 3300005564 Ga0070664_100017690 Ga0070664_1000176906 321
370 3300005577 Ga0068857_100030667 Ga0068857_1000306674 321
371 3300005615 Ga0070702_100053943 Ga0070702_1000539432 321
372 3300005616 Ga0068852_100049144 Ga0068852_1000491443 321
373 3300005840 Ga0068870_10005500 Ga0068870_100055003 321
374 3300005844 Ga0068862_100180184 Ga0068862_1001801842 321
375 3300006175 Ga0070712_100004848 Ga0070712_1000048486 321
376 3300006358 Ga0068871_100306038 Ga0068871_1003060382 321
377 3300006844 Ga0075428_100323363 Ga0075428_1003233632 321
378 3300006847 Ga0075431_100041363 Ga0075431_1000413633 321
379 3300006880 Ga0075429_100444970 Ga0075429_1004449701 321
380 3300006881 Ga0068865_100002426 Ga0068865_1000024268 321
381 3300007076 Ga0075435_100162880 Ga0075435_1001628801 321
382 3300009098 Ga0105245_10007384 Ga0105245_100073844 321
383 3300009148 Ga0105243_10003945 Ga0105243_100039456 321
384 3300009174 Ga0105241_10017641 Ga0105241_100176413 321
385 3300009176 Ga0105242_10003004 Ga0105242_100030049 321
386 3300011119 Ga0105246_10004374 Ga0105246_100043748 321
387 3300013297 Ga0157378_10016174 Ga0157378_100161743 321
388 3300013308 Ga0157375_10211095 Ga0157375_102110953 321
389 3300014326 Ga0157380_10099016 Ga0157380_100990163 321
390 3300025893 Ga0207682_10004305 Ga0207682_100043056 321
391 3300025907 Ga0207645_10000491 Ga0207645_1000049111 321
392 3300025915 Ga0207693_10003425 Ga0207693_100034259 321
393 3300025917 Ga0207660_10196631 Ga0207660_101966312 321
394 3300025919 Ga0207657_10001426 Ga0207657_1000142621 321
395 3300025921 Ga0207652_10022607 Ga0207652_100226073 321
396 3300025926 Ga0207659_10012807 Ga0207659_100128076 321
397 3300025933 Ga0207706_10000793 Ga0207706_1000079323 321
398 3300025934 Ga0207686_10029851 Ga0207686_100298512 321
399 3300025937 Ga0207669_10002032 Ga0207669_100020324 321
400 3300025940 Ga0207691_10000089 Ga0207691_1000008945 321
401 3300025942 Ga0207689_10005053 Ga0207689_100050534 321
402 3300025944 Ga0207661_10036398 Ga0207661_100363985 321
403 3300025945 Ga0207679_10099840 Ga0207679_100998402 321
404 3300025960 Ga0207651_10152589 Ga0207651_101525891 321
405 3300025961 Ga0207712_10140188 Ga0207712_101401882 321
406 3300025981 Ga0207640_10059442 Ga0207640_100594423 321
407 3300026075 Ga0207708_10000969 Ga0207708_100009694 321
408 3300026089 Ga0207648_10006014 Ga0207648_100060147 321
409 3300026121 Ga0207683_10000118 Ga0207683_1000011810 321
410 3300027252 Ga0209973_1000528 Ga0209973_10005283 321
411 3300027360 Ga0209969_1000081 Ga0209969_10000818 321
412 3300027364 Ga0209967_1001071 Ga0209967_10010713 321
413 3300027395 Ga0209996_1000001 Ga0209996_100000122 321
414 3300027424 Ga0209984_1002511 Ga0209984_10025112 321
415 3300027462 Ga0210000_1000003 Ga0210000_10000033 321
416 3300027471 Ga0209995_1000345 Ga0209995_10003455 321
417 3300027526 Ga0209968_1000643 Ga0209968_10006436 321
418 3300027543 Ga0209999_1000262 Ga0209999_10002622 321
419 3300027552 Ga0209982_1001101 Ga0209982_10011014 321
420 3300027614 Ga0209970_1008147 Ga0209970_10081472 321
421 3300027617 Ga0210002_1000075 Ga0210002_100007511 321
422 3300027665 Ga0209983_1001181 Ga0209983_10011816 321
423 3300027682 Ga0209971_1000339 Ga0209971_10003397 321
424 3300027695 Ga0209966_1000425 Ga0209966_10004256 321
425 3300027717 Ga0209998_10000165 Ga0209998_100001653 321
426 3300027907 Ga0207428_10003400 Ga0207428_1000340012 321
427 3300028381 Ga0268264_10045271 Ga0268264_100452712 321
428 3300031548 Ga0307408_100135071 Ga0307408_1001350711 321
429 3300031824 Ga0307413_10118695 Ga0307413_101186952 321
430 3300031852 Ga0307410_10001871 Ga0307410_100018716 321
431 3300031903 Ga0307407_10084677 Ga0307407_100846772 321
432 3300031995 Ga0307409_100005707 Ga0307409_1000057079 321
433 3300032002 Ga0307416_100001523 Ga0307416_1000015237 321
434 3300034817 Ga0373948_0013266 Ga0373948_0013266_448_1473 321
435 3300035088 Ga0373940_0008837 Ga0373940_0008837_1057_2082 321
436 3300035691 Ga0373931_0102005 Ga0373931_0102005_484_1509 321
437 3300042439 Ga0439464_0037258 Ga0439464_0037258_81_1106 321
438 3300047318 Ga0495636_0038768 Ga0495636_0038768_840_1865 321
439 3300048905 Ga0496102_0243430 Ga0496102_0243430_108_1115 321
440 3300048907 Ga0496104_0072416 Ga0496104_0072416_1333_2340 321
441 3300048908 Ga0496105_0266126 Ga0496105_0266126_90_1097 321
442 3300048910 Ga0496107_0091072 Ga0496107_0091072_689_1696 321
443 3300048913 Ga0496110_0070201 Ga0496110_0070201_393_1400 321
444 3300048914 Ga0496111_0170038 Ga0496111_0170038_188_1195 321
445 3300048916 Ga0496113_0258725 Ga0496113_0258725_19_1026 321
446 3300049668 Ga0501233_018062 Ga0501233_018062_133_1101 321
447 3300050510 nmdc:mga06r32_285292_c1 nmdc:mga06r32_285292_c1_311_1336 321
448 3300050515 nmdc:mga0a205_105968_c1 nmdc:mga0a205_105968_c1_1497_2522 321
449 3300053077 Ga0495601_0043811 Ga0495601_0043811_1481_2482 321
450 3300005328 Ga0070676_10140843 Ga0070676_101408431 322
451 3300005330 Ga0070690_100000539 Ga0070690_1000005396 322
452 3300005335 Ga0070666_10155230 Ga0070666_101552302 322
453 3300005340 Ga0070689_100016769 Ga0070689_1000167692 322
454 3300005343 Ga0070687_100000401 Ga0070687_1000004019 322
455 3300005343 Ga0070687_100042289 Ga0070687_1000422892 322
456 3300005364 Ga0070673_100067045 Ga0070673_1000670452 322
457 3300005365 Ga0070688_100129114 Ga0070688_1001291142 322
458 3300005456 Ga0070678_100015341 Ga0070678_1000153413 322
459 3300005544 Ga0070686_100002070 Ga0070686_1000020707 322
460 3300005564 Ga0070664_100001498 Ga0070664_1000014984 322
461 3300006028 Ga0070717_10181562 Ga0070717_101815622 322
462 3300006237 Ga0097621_100022779 Ga0097621_1000227793 322
463 3300006847 Ga0075431_100198596 Ga0075431_1001985961 322
464 3300006880 Ga0075429_100014404 Ga0075429_1000144042 322
465 3300006881 Ga0068865_100154924 Ga0068865_1001549242 322
466 3300009148 Ga0105243_10267977 Ga0105243_102679771 322
467 3300014325 Ga0163163_10165435 Ga0163163_101654352 322
468 3300025893 Ga0207682_10048308 Ga0207682_100483081 322
469 3300025918 Ga0207662_10001193 Ga0207662_100011937 322
470 3300025935 Ga0207709_10138551 Ga0207709_101385512 322
471 3300025936 Ga0207670_10039355 Ga0207670_100393552 322
472 3300025940 Ga0207691_10032395 Ga0207691_100323955 322
473 3300025940 Ga0207691_10224603 Ga0207691_102246033 322
474 3300025945 Ga0207679_10005736 Ga0207679_100057364 322
475 3300026121 Ga0207683_10369831 Ga0207683_103698311 322
476 3300027876 Ga0209974_10002753 Ga0209974_100027536 322
477 3300028381 Ga0268264_10174290 Ga0268264_101742902 322
478 3300044673 Ga0453683_0002183 Ga0453683_0002183_7138_8112 322
479 3300048903 Ga0496100_0327114 Ga0496100_0327114_75_1097 322
480 3300048917 Ga0496114_0335312 Ga0496114_0335312_40_1062 322
481 3300050508 nmdc:mga09592_14738_c1 nmdc:mga09592_14738_c1_929_1954 322
482 3300050514 nmdc:mga08x19_112405_c1 nmdc:mga08x19_112405_c1_653_1681 322
483 iso_pu_bacteria 2511231025 2511379640 322
484 iso_pu_bacteria 2511231035 2511433686 322
485 iso_pu_bacteria 2876601092 2876605890 322
486 iso_pu_bacteria 2939602548 2939605876 322
487 iso_pu_bacteria 8016733728 8016737432 322
488 iso_pu_bacteria 8019499862 8019502658 322
489 3300026118 Ga0207675_100025761 Ga0207675_1000257615 323
490 iso_pu_bacteria 2608642108 2608670723 323
491 iso_pu_bacteria 2844528606 2844531327 323
492 iso_pu_bacteria 2865014394 2865016085 323
493 iso_pu_bacteria 2881609920 2881611337 323
494 iso_pu_bacteria 2904504865 2904507199 323
495 iso_pu_bacteria 2945951305 2945954543 323
496 iso_pu_bacteria 2978975091 2978977016 323
497 3300009092 Ga0105250_10000098 Ga0105250_1000009826 324
498 3300013296 Ga0157374_10010962 Ga0157374_100109627 324
499 3300025711 Ga0207696_1000027 Ga0207696_1000027310 324
500 iso_pu_bacteria 2506520007 2506580567 324
501 iso_pu_bacteria 2506520008 2506585706 324
502 iso_pu_bacteria 2508501071 2508854364 324
503 iso_pu_bacteria 2547132181 2547695979 324
504 iso_pu_bacteria 2547132416 2548649439 324
505 iso_pu_bacteria 2561511199 2562464635 324
506 iso_pu_bacteria 2585427591 2585826374 324
507 iso_pu_bacteria 2585427592 2585830592 324
508 iso_pu_bacteria 2599185169 2599410304 324
509 iso_pu_bacteria 2600255254 2601523516 324
510 iso_pu_bacteria 2600255255 2601528675 324
511 iso_pu_bacteria 2600255256 2601534441 324
512 iso_pu_bacteria 2600255257 2601538780 324
513 iso_pu_bacteria 2600255280 2601615508 324
514 iso_pu_bacteria 2600255281 2601619566 324
515 iso_pu_bacteria 2600255287 2601644019 324
516 iso_pu_bacteria 2600255288 2601647971 324
517 iso_pu_bacteria 2600255289 2601653560 324
518 iso_pu_bacteria 2600255290 2601658319 324
519 iso_pu_bacteria 2600255298 2601696275 324
520 iso_pu_bacteria 2600255300 2601706215 324
521 iso_pu_bacteria 2600255301 2601711800 324
522 iso_pu_bacteria 2600255302 2601716818 324
523 iso_pu_bacteria 2600255303 2601721299 324
524 iso_pu_bacteria 2600255304 2601727224 324
525 iso_pu_bacteria 2600255305 2601731764 324
526 iso_pu_bacteria 2600255306 2601736776 324
527 iso_pu_bacteria 2600255307 2601740258 324
528 iso_pu_bacteria 2600255309 2601751195 324
529 iso_pu_bacteria 2600255310 2601757129 324
530 iso_pu_bacteria 2600255311 2601762270 324
531 iso_pu_bacteria 2600255392 2602018945 324
532 iso_pu_bacteria 2602042046 2603639478 324
533 iso_pu_bacteria 2602042047 2603644345 324
534 iso_pu_bacteria 2602042052 2603661232 324
535 iso_pu_bacteria 2602042053 2603666507 324
536 iso_pu_bacteria 2602042066 2603701130 324
537 iso_pu_bacteria 2602042067 2603704952 324
538 iso_pu_bacteria 2602042103 2603839161 324
539 iso_pu_bacteria 2602042104 2603843579 324
540 iso_pu_bacteria 2602042105 2603849318 324
541 iso_pu_bacteria 2602042106 2603854388 324
542 iso_pu_bacteria 2602042110 2603872443 324
543 iso_pu_bacteria 2602042111 2603877319 324
544 iso_pu_bacteria 2603880178 2606049624 324
545 iso_pu_bacteria 2603880184 2606070939 324
546 iso_pu_bacteria 2603880202 2606147308 324
547 iso_pu_bacteria 2603880211 2606177033 324
548 iso_pu_bacteria 2609459761 2609911397 324
549 iso_pu_bacteria 2636415599 2637223134 324
550 iso_pu_bacteria 2648501693 2650897363 324
551 iso_pu_bacteria 2654587920 2656276360 324
552 iso_pu_bacteria 2667528172 2671104529 324
553 iso_pu_bacteria 2667528173 2671106668 324
554 iso_pu_bacteria 2671180115 2671586135 324
555 iso_pu_bacteria 2675903046 2676408675 324
556 iso_pu_bacteria 2681812866 2681998109 324
557 iso_pu_bacteria 2681812869 2682008229 324
558 iso_pu_bacteria 2684622997 2686354666 324
559 iso_pu_bacteria 2687453601 2689447121 324
560 iso_pu_bacteria 2706794495 2707101139 324
561 iso_pu_bacteria 2711768156 2712471306 324
562 iso_pu_bacteria 2751185917 2753857741 324
563 iso_pu_bacteria 2765235842 2765590856 324
564 iso_pu_bacteria 2772190666 2772440923 324
565 iso_pu_bacteria 2775506706 2775540423 324
566 iso_pu_bacteria 2775507074 2777019458 324
567 iso_pu_bacteria 2791355010 2792312562 324
568 iso_pu_bacteria 2791355275 2793403862 324
569 iso_pu_bacteria 2808606414 2809124013 324
570 iso_pu_bacteria 2811995292 2813726765 324
571 iso_pu_bacteria 2814123068 2814694138 324
572 iso_pu_bacteria 2821118458 2821120739 324
573 iso_pu_bacteria 2823373977 2823376617 324
574 iso_pu_bacteria 2844425489 2844429230 324
575 iso_pu_bacteria 2847085930 2847090311 324
576 iso_pu_bacteria 2847797336 2847801538 324
577 iso_pu_bacteria 2852103415 2852106051 324
578 iso_pu_bacteria 2854601825 2854604941 324
579 iso_pu_bacteria 2869551831 2869556529 324
580 iso_pu_bacteria 2884086401 2884087012 324
581 iso_pu_bacteria 2888366609 2888371028 324
582 iso_pu_bacteria 2888373701 2888376270 324
583 iso_pu_bacteria 2891670763 2891675504 324
584 iso_pu_bacteria 2904474040 2904474184 324
585 iso_pu_bacteria 2904513164 2904517048 324
586 iso_pu_bacteria 2908669403 2908672870 324
587 iso_pu_bacteria 2919108558 2919113496 324
588 iso_pu_bacteria 2919150387 2919150531 324
589 iso_pu_bacteria 2923634449 2923636747 324
590 iso_pu_bacteria 2927143783 2927145404 324
591 iso_pu_bacteria 2927833300 2927836792 324
592 iso_pu_bacteria 2932406140 2932407119 324
593 iso_pu_bacteria 2935625433 2935629514 324
594 iso_pu_bacteria 2937539931 2937544128 324
595 iso_pu_bacteria 2937967321 2937971236 324
596 iso_pu_bacteria 2939568625 2939572431 324
597 iso_pu_bacteria 2939573065 2939576605 324
598 iso_pu_bacteria 2939577877 2939582359 324
599 iso_pu_bacteria 2939607340 2939610573 324
600 iso_pu_bacteria 2939617950 2939620577 324
601 iso_pu_bacteria 2939642701 2939645642 324
602 iso_pu_bacteria 2945874760 2945875828 324
603 iso_pu_bacteria 2969079654 2969080165 324
604 iso_pu_bacteria 2971820967 2971821513 324
605 iso_pu_bacteria 2974310843 2974314915 324
606 iso_pu_bacteria 2974435778 2974440310 324
607 iso_pu_bacteria 2984494565 2984498378 324
608 iso_pu_bacteria 2984559226 2984562620 324
609 iso_pu_bacteria 2984595703 2984600680 324
610 iso_pu_bacteria 2990261002 2990263480 324
611 iso_pu_bacteria 3000376612 3000377475 324
612 iso_pu_bacteria 640753048 640939924 324
613 iso_pu_bacteria 8004592986 8004593829 324
614 iso_pu_bacteria 8015394850 8015397106 324
615 iso_pu_bacteria 8018221730 8018226387 324
616 iso_pu_bacteria 8018405270 8018407095 324
617 iso_pu_bacteria 8019504834 8019507466 324
618 iso_pu_bacteria 8054844752 8054848501 324
619 iso_pu_bacteria 8054849141 8054849760 324
620 iso_pu_bacteria 8055087960 8055089523 324
621 iso_pu_bacteria 8055092621 8055095992 324
622 iso_pu_bacteria 8055097453 8055101736 324
623 iso_pu_bacteria 8055693939 8055697674 324
624 iso_pu_bacteria 8057304971 8057308474 324
625 3300009036 Ga0105244_10002138 Ga0105244_100021385 326
626 3300009092 Ga0105250_10006878 Ga0105250_100068783 326
627 3300013100 Ga0157373_10000301 Ga0157373_1000030112 326
628 3300013102 Ga0157371_10000349 Ga0157371_1000034925 326
629 3300013307 Ga0157372_10183821 Ga0157372_101838213 326
630 3300013307 Ga0157372_10275848 Ga0157372_102758482 326
631 3300025711 Ga0207696_1000272 Ga0207696_100027247 326
632 3300025728 Ga0207655_1000024 Ga0207655_1000024273 326
633 3300025728 Ga0207655_1008316 Ga0207655_10083168 326
634 3300025735 Ga0207713_1004072 Ga0207713_100407213 326
635 3300027312 Ga0209371_1000346 Ga0209371_100034634 326
636 3300027312 Ga0209371_1000351 Ga0209371_100035123 326
637 3300030500 Ga0268256_1000293 Ga0268256_100029334 326
638 3300030500 Ga0268256_1000294 Ga0268256_100029430 326
639 3300046458 Ga0495591_000010 Ga0495591_000010_241662_242642 326
640 3300046530 Ga0495654_0000036 Ga0495654_0000036_9987_10967 326
641 3300046616 Ga0495668_0018313 Ga0495668_0018313_607_1587 326
642 3300048904 Ga0496101_0000144 Ga0496101_0000144_16653_17633 326
643 3300048919 Ga0496116_0001014 Ga0496116_0001014_15258_16238 326
644 3300048921 Ga0496118_0063118 Ga0496118_0063118_405_1385 326
645 3300048923 Ga0496120_0000068 Ga0496120_0000068_62985_63965 326
646 3300048923 Ga0496120_0001236 Ga0496120_0001236_8119_9099 326
647 3300048927 Ga0496124_0001210 Ga0496124_0001210_23592_24572 326
648 3300048927 Ga0496124_0038930 Ga0496124_0038930_1074_2054 326
649 3300048927 Ga0496124_0127223 Ga0496124_0127223_622_1602 326
650 iso_pu_bacteria 2806310673 2807177024 326
651 3300003856 Ga0058692_1001387 Ga0058692_10013872 327
652 3300005347 Ga0070668_100022105 Ga0070668_1000221053 327
653 3300005457 Ga0070662_100004962 Ga0070662_1000049627 327
654 3300005548 Ga0070665_100010158 Ga0070665_10001015811 327
655 3300009011 Ga0105251_10088147 Ga0105251_100881472 327
656 3300009036 Ga0105244_10076228 Ga0105244_100762282 327
657 3300011119 Ga0105246_10172746 Ga0105246_101727462 327
658 3300013306 Ga0163162_10008063 Ga0163162_1000806311 327
659 3300013307 Ga0157372_10207861 Ga0157372_102078611 327
660 3300014497 Ga0182008_10021763 Ga0182008_100217635 327
661 3300015261 Ga0182006_1000652 Ga0182006_100065220 327
662 3300017792 Ga0163161_10151804 Ga0163161_101518042 327
663 3300025711 Ga0207696_1000466 Ga0207696_100046621 327
664 3300025728 Ga0207655_1001028 Ga0207655_100102825 327
665 3300025735 Ga0207713_1030551 Ga0207713_10305512 327
666 3300025735 Ga0207713_1090723 Ga0207713_10907231 327
667 3300025933 Ga0207706_10005929 Ga0207706_1000592912 327
668 3300025972 Ga0207668_10005034 Ga0207668_100050344 327
669 3300027312 Ga0209371_1000083 Ga0209371_100008319 327
670 3300027312 Ga0209371_1002463 Ga0209371_100246315 327
671 3300027312 Ga0209371_1010862 Ga0209371_10108623 327
672 3300030500 Ga0268256_1000074 Ga0268256_1000074155 327
673 3300030500 Ga0268256_1002616 Ga0268256_10026162 327
674 3300030500 Ga0268256_1016374 Ga0268256_10163741 327
675 3300041407 Ga0439447_001914 Ga0439447_001914_5496_6479 327
676 3300041411 Ga0439466_0000002 Ga0439466_0000002_169220_170203 327
677 3300042006 Ga0439432_011946 Ga0439432_011946_681_1664 327
678 3300042010 Ga0439452_005027 Ga0439452_005027_2034_3017 327
679 3300042016 Ga0439463_001405 Ga0439463_001405_916_1899 327
680 3300042146 Ga0450907_000011 Ga0450907_000011_3610_4593 327
681 3300042439 Ga0439464_0002919 Ga0439464_0002919_833_1816 327
682 3300046492 Ga0495585_0003087 Ga0495585_0003087_6833_7816 327
683 3300046522 Ga0495643_0009513 Ga0495643_0009513_1833_2816 327
684 3300046524 Ga0495648_0025365 Ga0495648_0025365_1774_2757 327
685 3300046810 Ga0495660_0009386 Ga0495660_0009386_4308_5291 327
686 3300047320 Ga0495672_0000103 Ga0495672_0000103_86185_87168 327
687 3300048903 Ga0496100_0021063 Ga0496100_0021063_708_1691 327
688 3300048908 Ga0496105_0008262 Ga0496105_0008262_1904_2887 327
689 3300048914 Ga0496111_0351684 Ga0496111_0351684_95_1078 327
690 3300048920 Ga0496117_0000116 Ga0496117_0000116_7388_8371 327
691 3300048921 Ga0496118_0000906 Ga0496118_0000906_5798_6781 327
692 3300048922 Ga0496119_0000472 Ga0496119_0000472_24010_24993 327
693 3300048923 Ga0496120_0000166 Ga0496120_0000166_84945_85928 327
694 3300048924 Ga0496121_0000052 Ga0496121_0000052_172520_173503 327
695 3300048926 Ga0496123_0098954 Ga0496123_0098954_375_1358 327
696 3300048927 Ga0496124_0001921 Ga0496124_0001921_10575_11558 327
697 3300048927 Ga0496124_0030577 Ga0496124_0030577_2052_3035 327
698 3300048928 Ga0496125_0008724 Ga0496125_0008724_9168_10151 327
699 3300048929 Ga0496126_0039024 Ga0496126_0039024_1719_2702 327
700 3300049459 Ga0495678_037537 Ga0495678_037537_867_1850 327
701 3300050491 nmdc:mga00v17_37338_c1 nmdc:mga00v17_37338_c1_26_1009 327
702 2162886007 SwRhRL2b_contig_2229515 SwRhRL2b_0313.00001100 328
703 3300002737 JGI25162J39368_1000031 JGI25162J39368_1000031145 328
704 3300002771 JGI25163J39215_1000261 JGI25163J39215_10002617 328
705 3300002772 JGI25164J39214_1000001 JGI25164J39214_100000114 328
706 3300002773 JGI25152J39213_1000063 JGI25152J39213_100006364 328
707 3300003320 rootH2_10324399 rootH2_103243992 328
708 3300003751 Ga0055538_1000004 Ga0055538_1000004144 328
709 3300003752 Ga0055539_1000004 Ga0055539_1000004414 328
710 3300003756 Ga0055533_1000007 Ga0055533_1000007144 328
711 3300003759 Ga0055525_1000007 Ga0055525_1000007144 328
712 3300003841 Ga0055541_1000004 Ga0055541_1000004144 328
713 3300003856 Ga0058692_1002827 Ga0058692_10028272 328
714 3300003856 Ga0058692_1009185 Ga0058692_10091853 328
715 3300003856 Ga0058692_1016402 Ga0058692_10164022 328
716 3300003856 Ga0058692_1028962 Ga0058692_10289621 328
717 3300005272 Ga0065703_1018907 Ga0065703_10189072 328
718 3300005289 Ga0065704_10001070 Ga0065704_1000107011 328
719 3300005289 Ga0065704_10001534 Ga0065704_1000153411 328
720 3300005289 Ga0065704_10001858 Ga0065704_1000185812 328
721 3300005289 Ga0065704_10002429 Ga0065704_100024296 328
722 3300005289 Ga0065704_10006610 Ga0065704_100066103 328
723 3300005289 Ga0065704_10093217 Ga0065704_100932172 328
724 3300005548 Ga0070665_100002206 Ga0070665_10000220616 328
725 3300005548 Ga0070665_100048948 Ga0070665_1000489482 328
726 3300005577 Ga0068857_100000020 Ga0068857_10000002079 328
727 3300005834 Ga0068851_10000221 Ga0068851_1000022124 328
728 3300006051 Ga0075364_10021925 Ga0075364_100219251 328
729 3300006195 Ga0075366_10002364 Ga0075366_1000236411 328
730 3300006946 Ga0079104_1000485 Ga0079104_100048519 328
731 3300006946 Ga0079104_1000490 Ga0079104_100049019 328
732 3300006946 Ga0079104_1000624 Ga0079104_100062426 328
733 3300006946 Ga0079104_1000660 Ga0079104_100066028 328
734 3300006946 Ga0079104_1001897 Ga0079104_10018976 328
735 3300006946 Ga0079104_1002516 Ga0079104_10025167 328
736 3300006946 Ga0079104_1002794 Ga0079104_100279411 328
737 3300006946 Ga0079104_1006842 Ga0079104_10068423 328
738 3300006946 Ga0079104_1014417 Ga0079104_10144171 328
739 3300009011 Ga0105251_10001425 Ga0105251_1000142514 328
740 3300009011 Ga0105251_10002220 Ga0105251_1000222013 328
741 3300009011 Ga0105251_10002228 Ga0105251_1000222812 328
742 3300009011 Ga0105251_10002491 Ga0105251_100024919 328
743 3300009011 Ga0105251_10002841 Ga0105251_1000284112 328
744 3300009011 Ga0105251_10005427 Ga0105251_100054273 328
745 3300009011 Ga0105251_10008910 Ga0105251_100089102 328
746 3300009011 Ga0105251_10011814 Ga0105251_100118143 328
747 3300009011 Ga0105251_10015900 Ga0105251_100159003 328
748 3300009011 Ga0105251_10101907 Ga0105251_101019072 328
749 3300009036 Ga0105244_10000033 Ga0105244_10000033173 328
750 3300009036 Ga0105244_10000505 Ga0105244_1000050529 328
751 3300009036 Ga0105244_10000565 Ga0105244_1000056525 328
752 3300009036 Ga0105244_10000822 Ga0105244_1000082219 328
753 3300009036 Ga0105244_10001412 Ga0105244_1000141212 328
754 3300009036 Ga0105244_10002840 Ga0105244_1000284011 328
755 3300009036 Ga0105244_10004471 Ga0105244_100044713 328
756 3300009036 Ga0105244_10005243 Ga0105244_100052433 328
757 3300009036 Ga0105244_10018339 Ga0105244_100183391 328
758 3300009036 Ga0105244_10099818 Ga0105244_100998182 328
759 3300009036 Ga0105244_10156267 Ga0105244_101562671 328
760 3300009092 Ga0105250_10000165 Ga0105250_1000016547 328
761 3300009092 Ga0105250_10000321 Ga0105250_1000032131 328
762 3300009092 Ga0105250_10000351 Ga0105250_1000035113 328
763 3300009092 Ga0105250_10001790 Ga0105250_100017907 328
764 3300009092 Ga0105250_10004800 Ga0105250_100048006 328
765 3300009092 Ga0105250_10015710 Ga0105250_100157101 328
766 3300009101 Ga0105247_10000027 Ga0105247_1000002768 328
767 3300009148 Ga0105243_10001901 Ga0105243_100019019 328
768 3300009148 Ga0105243_10003148 Ga0105243_100031489 328
769 3300009174 Ga0105241_10000006 Ga0105241_1000000638 328
770 3300013100 Ga0157373_10002114 Ga0157373_1000211411 328
771 3300013100 Ga0157373_10014332 Ga0157373_100143322 328
772 3300013100 Ga0157373_10016018 Ga0157373_100160185 328
773 3300013102 Ga0157371_10000159 Ga0157371_1000015979 328
774 3300013102 Ga0157371_10001320 Ga0157371_1000132014 328
775 3300013102 Ga0157371_10001630 Ga0157371_1000163013 328
776 3300013102 Ga0157371_10020620 Ga0157371_100206205 328
777 3300013102 Ga0157371_10022635 Ga0157371_100226354 328
778 3300013102 Ga0157371_10110400 Ga0157371_101104002 328
779 3300013104 Ga0157370_10001424 Ga0157370_1000142418 328
780 3300013105 Ga0157369_10024732 Ga0157369_100247322 328
781 3300013307 Ga0157372_10000517 Ga0157372_1000051714 328
782 3300013307 Ga0157372_10008131 Ga0157372_100081314 328
783 3300013307 Ga0157372_10165155 Ga0157372_101651552 328
784 3300013307 Ga0157372_10273027 Ga0157372_102730272 328
785 3300014497 Ga0182008_10058683 Ga0182008_100586832 328
786 3300015261 Ga0182006_1000376 Ga0182006_100037635 328
787 3300015679 Ga0183366_1002 Ga0183366_1002694 328
788 3300015680 Ga0183370_1002 Ga0183370_1002694 328
789 3300015685 Ga0183369_1002 Ga0183369_1002694 328
790 3300015687 Ga0183368_1005 Ga0183368_1005694 328
791 3300017792 Ga0163161_10000036 Ga0163161_10000036109 328
792 3300017792 Ga0163161_10143786 Ga0163161_101437862 328
793 3300017792 Ga0163161_10157119 Ga0163161_101571191 328
794 3300021384 Ga0213876_10000013 Ga0213876_10000013265 328
795 3300025207 Ga0209760_100006 Ga0209760_100006140 328
796 3300025224 Ga0209784_100001 Ga0209784_100001142 328
797 3300025225 Ga0209566_100001 Ga0209566_100001142 328
798 3300025226 Ga0209674_100002 Ga0209674_100002142 328
799 3300025230 Ga0209563_100008 Ga0209563_100008143 328
800 3300025231 Ga0207427_100002 Ga0207427_1000021137 328
801 3300025233 Ga0209437_100114 Ga0209437_10011457 328
802 3300025253 Ga0209677_100004 Ga0209677_100004143 328
803 3300025258 Ga0209129_1000010 Ga0209129_100001065 328
804 3300025261 Ga0209233_1001399 Ga0209233_10013992 328
805 3300025321 Ga0207656_10015155 Ga0207656_100151552 328
806 3300025711 Ga0207696_1000014 Ga0207696_1000014313 328
807 3300025711 Ga0207696_1000137 Ga0207696_100013770 328
808 3300025711 Ga0207696_1000188 Ga0207696_100018834 328
809 3300025711 Ga0207696_1000356 Ga0207696_100035614 328
810 3300025711 Ga0207696_1000800 Ga0207696_100080018 328
811 3300025711 Ga0207696_1007349 Ga0207696_10073493 328
812 3300025711 Ga0207696_1023980 Ga0207696_10239801 328
813 3300025711 Ga0207696_1035017 Ga0207696_10350172 328
814 3300025728 Ga0207655_1000028 Ga0207655_1000028139 328
815 3300025728 Ga0207655_1000065 Ga0207655_100006585 328
816 3300025728 Ga0207655_1000072 Ga0207655_100007270 328
817 3300025728 Ga0207655_1000186 Ga0207655_100018638 328
818 3300025728 Ga0207655_1000397 Ga0207655_100039716 328
819 3300025728 Ga0207655_1001295 Ga0207655_100129518 328
820 3300025728 Ga0207655_1001763 Ga0207655_10017634 328
821 3300025728 Ga0207655_1003209 Ga0207655_100320910 328
822 3300025728 Ga0207655_1003378 Ga0207655_10033786 328
823 3300025728 Ga0207655_1005165 Ga0207655_10051651 328
824 3300025728 Ga0207655_1011918 Ga0207655_10119186 328
825 3300025728 Ga0207655_1032714 Ga0207655_10327143 328
826 3300025728 Ga0207655_1068907 Ga0207655_10689072 328
827 3300025735 Ga0207713_1000019 Ga0207713_100001976 328
828 3300025735 Ga0207713_1000157 Ga0207713_100015738 328
829 3300025735 Ga0207713_1000181 Ga0207713_100018128 328
830 3300025735 Ga0207713_1000272 Ga0207713_100027239 328
831 3300025735 Ga0207713_1000300 Ga0207713_100030033 328
832 3300025735 Ga0207713_1000672 Ga0207713_100067212 328
833 3300025735 Ga0207713_1007104 Ga0207713_10071049 328
834 3300025735 Ga0207713_1009166 Ga0207713_10091662 328
835 3300025735 Ga0207713_1034504 Ga0207713_10345042 328
836 3300025900 Ga0207710_10000007 Ga0207710_10000007139 328
837 3300025911 Ga0207654_10000008 Ga0207654_1000000841 328
838 3300025935 Ga0207709_10000726 Ga0207709_1000072621 328
839 3300026116 Ga0207674_10000119 Ga0207674_1000011975 328
840 3300027111 Ga0209281_1000025 Ga0209281_100002579 328
841 3300027111 Ga0209281_1000096 Ga0209281_1000096141 328
842 3300027111 Ga0209281_1000279 Ga0209281_100027935 328
843 3300027111 Ga0209281_1000281 Ga0209281_100028181 328
844 3300027111 Ga0209281_1000328 Ga0209281_100032872 328
845 3300027111 Ga0209281_1000369 Ga0209281_100036926 328
846 3300027111 Ga0209281_1000558 Ga0209281_100055836 328
847 3300027111 Ga0209281_1000723 Ga0209281_100072324 328
848 3300027111 Ga0209281_1000953 Ga0209281_100095317 328
849 3300027111 Ga0209281_1001042 Ga0209281_100104211 328
850 3300027111 Ga0209281_1002724 Ga0209281_10027244 328
851 3300027312 Ga0209371_1000013 Ga0209371_1000013597 328
852 3300027312 Ga0209371_1000019 Ga0209371_1000019478 328
853 3300027312 Ga0209371_1000069 Ga0209371_1000069156 328
854 3300027312 Ga0209371_1000149 Ga0209371_100014965 328
855 3300027312 Ga0209371_1000509 Ga0209371_100050928 328
856 3300027312 Ga0209371_1000663 Ga0209371_100066312 328
857 3300027312 Ga0209371_1000759 Ga0209371_100075916 328
858 3300027312 Ga0209371_1000804 Ga0209371_100080424 328
859 3300027312 Ga0209371_1002564 Ga0209371_100256413 328
860 3300027312 Ga0209371_1002905 Ga0209371_10029058 328
861 3300027312 Ga0209371_1004479 Ga0209371_10044794 328
862 3300027312 Ga0209371_1005492 Ga0209371_10054926 328
863 3300028379 Ga0268266_10000142 Ga0268266_1000014268 328
864 3300028379 Ga0268266_10019945 Ga0268266_100199456 328
865 3300030500 Ga0268256_1000014 Ga0268256_100001481 328
866 3300030500 Ga0268256_1000024 Ga0268256_100002447 328
867 3300030500 Ga0268256_1000066 Ga0268256_100006634 328
868 3300030500 Ga0268256_1000734 Ga0268256_100073416 328
869 3300030500 Ga0268256_1000918 Ga0268256_100091815 328
870 3300030500 Ga0268256_1002265 Ga0268256_10022652 328
871 3300030500 Ga0268256_1002344 Ga0268256_10023442 328
872 3300030500 Ga0268256_1002373 Ga0268256_100237311 328
873 3300030500 Ga0268256_1002611 Ga0268256_10026118 328
874 3300030500 Ga0268256_1004231 Ga0268256_10042315 328
875 3300030500 Ga0268256_1005400 Ga0268256_10054006 328
876 3300039437 Ga0436365_0471682 Ga0436365_0471682_70340_71326 328
877 3300041405 Ga0439438_000003 Ga0439438_000003_402591_403577 328
878 3300041405 Ga0439438_000282 Ga0439438_000282_9708_10694 328
879 3300041405 Ga0439438_000434 Ga0439438_000434_11924_12910 328
880 3300041407 Ga0439447_000460 Ga0439447_000460_7164_8150 328
881 3300041407 Ga0439447_002846 Ga0439447_002846_2264_3250 328
882 3300042006 Ga0439432_000566 Ga0439432_000566_7753_8739 328
883 3300042006 Ga0439432_001003 Ga0439432_001003_1984_2982 328
884 3300042006 Ga0439432_001530 Ga0439432_001530_7383_8369 328
885 3300042006 Ga0439432_006918 Ga0439432_006918_1816_2802 328
886 3300042006 Ga0439432_050471 Ga0439432_050471_229_1215 328
887 3300042010 Ga0439452_000004 Ga0439452_000004_316036_317022 328
888 3300042010 Ga0439452_000011 Ga0439452_000011_79801_80787 328
889 3300042010 Ga0439452_000078 Ga0439452_000078_68213_69199 328
890 3300042010 Ga0439452_000079 Ga0439452_000079_7919_8905 328
891 3300042010 Ga0439452_000498 Ga0439452_000498_12333_13319 328
892 3300042010 Ga0439452_001372 Ga0439452_001372_1155_2141 328
893 3300042439 Ga0439464_0000480 Ga0439464_0000480_5441_6427 328
894 3300042439 Ga0439464_0000835 Ga0439464_0000835_2838_3824 328
895 3300044669 Ga0466981_0000050 Ga0466981_0000050_26623_27609 328
896 3300046453 Ga0495627_000017 Ga0495627_000017_61152_62144 328
897 3300046453 Ga0495627_039039 Ga0495627_039039_45_1031 328
898 3300046458 Ga0495591_000090 Ga0495591_000090_73765_74751 328
899 3300046458 Ga0495591_008692 Ga0495591_008692_1199_2185 328
900 3300046460 Ga0495638_0009212 Ga0495638_0009212_2339_3325 328
901 3300046471 Ga0495650_0000004 Ga0495650_0000004_150787_151773 328
902 3300046471 Ga0495650_0000040 Ga0495650_0000040_88219_89205 328
903 3300046501 Ga0495607_0007704 Ga0495607_0007704_6302_7297 328
904 3300046507 Ga0495606_0000399 Ga0495606_0000399_61959_62954 328
905 3300046513 Ga0495616_0036251 Ga0495616_0036251_838_1833 328
906 3300046515 Ga0495620_0004428 Ga0495620_0004428_5428_6414 328
907 3300046520 Ga0495637_0076767 Ga0495637_0076767_65_1051 328
908 3300046522 Ga0495643_0012022 Ga0495643_0012022_1406_2401 328
909 3300046523 Ga0495644_0001240 Ga0495644_0001240_7202_8197 328
910 3300046530 Ga0495654_0000089 Ga0495654_0000089_39656_40651 328
911 3300046530 Ga0495654_0006656 Ga0495654_0006656_3129_4115 328
912 3300046530 Ga0495654_0007828 Ga0495654_0007828_1363_2349 328
913 3300046530 Ga0495654_0011543 Ga0495654_0011543_1642_2688 328
914 3300046542 Ga0495597_0001169 Ga0495597_0001169_8990_9976 328
915 3300046660 Ga0495625_0026706 Ga0495625_0026706_1018_2064 328
916 3300046674 Ga0495588_0008161 Ga0495588_0008161_2995_3981 328
917 3300046692 Ga0495671_0001824 Ga0495671_0001824_11864_12859 328
918 3300046694 Ga0495649_0015867 Ga0495649_0015867_3219_4205 328
919 3300046694 Ga0495649_0085897 Ga0495649_0085897_619_1605 328
920 3300046794 Ga0495589_0000013 Ga0495589_0000013_31162_32148 328
921 3300046794 Ga0495589_0001531 Ga0495589_0001531_8415_9410 328
922 3300046810 Ga0495660_0000022 Ga0495660_0000022_150180_151166 328
923 3300046810 Ga0495660_0000184 Ga0495660_0000184_32586_33581 328
924 3300047320 Ga0495672_0000003 Ga0495672_0000003_665709_666704 328
925 3300047320 Ga0495672_0000082 Ga0495672_0000082_66268_67254 328
926 3300047321 Ga0495676_0123587 Ga0495676_0123587_815_1810 328
927 3300047446 Ga0495679_000059 Ga0495679_000059_67571_68617 328
928 3300047446 Ga0495679_001176 Ga0495679_001176_12486_13472 328
929 3300047469 Ga0495673_0000011 Ga0495673_0000011_62330_63325 328
930 3300047469 Ga0495673_0000117 Ga0495673_0000117_88611_89597 328
931 3300047470 Ga0495681_0063598 Ga0495681_0063598_188_1174 328
932 3300048903 Ga0496100_0020046 Ga0496100_0020046_792_1778 328
933 3300048905 Ga0496102_0124521 Ga0496102_0124521_1035_2021 328
934 3300048907 Ga0496104_0000153 Ga0496104_0000153_1104_2090 328
935 3300048907 Ga0496104_0001602 Ga0496104_0001602_11802_12788 328
936 3300048908 Ga0496105_0364291 Ga0496105_0364291_105_1091 328
937 3300048916 Ga0496113_0276204 Ga0496113_0276204_214_1200 328
938 3300048919 Ga0496116_0000009 Ga0496116_0000009_565725_566723 328
939 3300048919 Ga0496116_0000016 Ga0496116_0000016_26983_27969 328
940 3300048919 Ga0496116_0000148 Ga0496116_0000148_121624_122610 328
941 3300048919 Ga0496116_0000777 Ga0496116_0000777_8185_9171 328
942 3300048919 Ga0496116_0002172 Ga0496116_0002172_7611_8597 328
943 3300048919 Ga0496116_0086262 Ga0496116_0086262_730_1716 328
944 3300048919 Ga0496116_0098066 Ga0496116_0098066_733_1719 328
945 3300048919 Ga0496116_0196610 Ga0496116_0196610_41_1027 328
946 3300048920 Ga0496117_0005006 Ga0496117_0005006_7815_8801 328
947 3300048920 Ga0496117_0005369 Ga0496117_0005369_8896_9882 328
948 3300048920 Ga0496117_0005435 Ga0496117_0005435_2071_3069 328
949 3300048920 Ga0496117_0006918 Ga0496117_0006918_9098_10084 328
950 3300048920 Ga0496117_0035041 Ga0496117_0035041_58_1044 328
951 3300048920 Ga0496117_0042050 Ga0496117_0042050_2219_3223 328
952 3300048920 Ga0496117_0052762 Ga0496117_0052762_304_1290 328
953 3300048920 Ga0496117_0110532 Ga0496117_0110532_623_1609 328
954 3300048920 Ga0496117_0131419 Ga0496117_0131419_484_1470 328
955 3300048920 Ga0496117_0175935 Ga0496117_0175935_30_1022 328
956 3300048921 Ga0496118_0004732 Ga0496118_0004732_6796_7782 328
957 3300048921 Ga0496118_0004852 Ga0496118_0004852_11935_12921 328
958 3300048921 Ga0496118_0007265 Ga0496118_0007265_8143_9129 328
959 3300048921 Ga0496118_0007795 Ga0496118_0007795_4013_4999 328
960 3300048921 Ga0496118_0007826 Ga0496118_0007826_4897_5883 328
961 3300048921 Ga0496118_0013851 Ga0496118_0013851_4572_5558 328
962 3300048921 Ga0496118_0014265 Ga0496118_0014265_2204_3190 328
963 3300048921 Ga0496118_0015913 Ga0496118_0015913_1823_2821 328
964 3300048922 Ga0496119_0000096 Ga0496119_0000096_67686_68672 328
965 3300048922 Ga0496119_0000586 Ga0496119_0000586_27604_28593 328
966 3300048922 Ga0496119_0002196 Ga0496119_0002196_7810_8796 328
967 3300048922 Ga0496119_0002663 Ga0496119_0002663_9325_10311 328
968 3300048922 Ga0496119_0003291 Ga0496119_0003291_13452_14456 328
969 3300048922 Ga0496119_0018393 Ga0496119_0018393_3724_4710 328
970 3300048922 Ga0496119_0019571 Ga0496119_0019571_3573_4559 328
971 3300048922 Ga0496119_0023595 Ga0496119_0023595_149_1147 328
972 3300048922 Ga0496119_0059638 Ga0496119_0059638_320_1306 328
973 3300048923 Ga0496120_0000389 Ga0496120_0000389_59588_60574 328
974 3300048923 Ga0496120_0000572 Ga0496120_0000572_44856_45842 328
975 3300048923 Ga0496120_0000602 Ga0496120_0000602_27604_28593 328
976 3300048923 Ga0496120_0001364 Ga0496120_0001364_7724_8710 328
977 3300048923 Ga0496120_0001521 Ga0496120_0001521_13583_14569 328
978 3300048923 Ga0496120_0002363 Ga0496120_0002363_14495_15481 328
979 3300048923 Ga0496120_0009015 Ga0496120_0009015_1671_2657 328
980 3300048923 Ga0496120_0024995 Ga0496120_0024995_1004_2008 328
981 3300048923 Ga0496120_0029973 Ga0496120_0029973_2290_3288 328
982 3300048923 Ga0496120_0045608 Ga0496120_0045608_751_1737 328
983 3300048923 Ga0496120_0052555 Ga0496120_0052555_167_1153 328
984 3300048923 Ga0496120_0165239 Ga0496120_0165239_74_1060 328
985 3300048924 Ga0496121_0003985 Ga0496121_0003985_8104_9090 328
986 3300048924 Ga0496121_0007946 Ga0496121_0007946_7817_8803 328
987 3300048924 Ga0496121_0010723 Ga0496121_0010723_1538_2524 328
988 3300048924 Ga0496121_0031562 Ga0496121_0031562_2927_3913 328
989 3300048924 Ga0496121_0091888 Ga0496121_0091888_751_1737 328
990 3300048924 Ga0496121_0127925 Ga0496121_0127925_170_1156 328
991 3300048925 Ga0496122_0000070 Ga0496122_0000070_96560_97546 328
992 3300048925 Ga0496122_0000392 Ga0496122_0000392_67771_68757 328
993 3300048925 Ga0496122_0002311 Ga0496122_0002311_14148_15134 328
994 3300048925 Ga0496122_0003665 Ga0496122_0003665_15082_16068 328
995 3300048925 Ga0496122_0008374 Ga0496122_0008374_7816_8802 328
996 3300048925 Ga0496122_0015706 Ga0496122_0015706_5387_6373 328
997 3300048925 Ga0496122_0024217 Ga0496122_0024217_3831_4817 328
998 3300048925 Ga0496122_0078133 Ga0496122_0078133_253_1239 328
999 3300048926 Ga0496123_0000017 Ga0496123_0000017_12575_13561 328
1000 3300048926 Ga0496123_0000131 Ga0496123_0000131_27004_27990 328
1001 3300048926 Ga0496123_0001554 Ga0496123_0001554_7919_8905 328
1002 3300048926 Ga0496123_0001924 Ga0496123_0001924_11977_12963 328
1003 3300048926 Ga0496123_0004679 Ga0496123_0004679_3755_4741 328
1004 3300048926 Ga0496123_0006706 Ga0496123_0006706_2511_3497 328
1005 3300048926 Ga0496123_0052895 Ga0496123_0052895_1072_2058 328
1006 3300048926 Ga0496123_0073406 Ga0496123_0073406_1081_2067 328
1007 3300048927 Ga0496124_0000053 Ga0496124_0000053_65233_66219 328
1008 3300048927 Ga0496124_0000303 Ga0496124_0000303_62676_63662 328
1009 3300048927 Ga0496124_0000630 Ga0496124_0000630_15319_16305 328
1010 3300048927 Ga0496124_0002062 Ga0496124_0002062_11660_12646 328
1011 3300048927 Ga0496124_0003880 Ga0496124_0003880_1491_2477 328
1012 3300048927 Ga0496124_0004583 Ga0496124_0004583_3907_4893 328
1013 3300048927 Ga0496124_0009686 Ga0496124_0009686_7732_8718 328
1014 3300048927 Ga0496124_0040972 Ga0496124_0040972_826_1812 328
1015 3300048928 Ga0496125_0000056 Ga0496125_0000056_119854_120840 328
1016 3300048928 Ga0496125_0000329 Ga0496125_0000329_13827_14834 328
1017 3300048928 Ga0496125_0002880 Ga0496125_0002880_8116_9102 328
1018 3300048928 Ga0496125_0008126 Ga0496125_0008126_6514_7500 328
1019 3300048928 Ga0496125_0014954 Ga0496125_0014954_3538_4524 328
1020 3300048929 Ga0496126_0000137 Ga0496126_0000137_111460_112446 328
1021 3300048929 Ga0496126_0000818 Ga0496126_0000818_52092_53078 328
1022 3300048929 Ga0496126_0025978 Ga0496126_0025978_3631_4617 328
1023 3300048929 Ga0496126_0037205 Ga0496126_0037205_854_1840 328
1024 3300048929 Ga0496126_0071555 Ga0496126_0071555_1350_2336 328
1025 3300049459 Ga0495678_000142 Ga0495678_000142_34451_35446 328
1026 3300049460 Ga0495682_0000034 Ga0495682_0000034_68715_69710 328
1027 3300050491 nmdc:mga00v17_12262_c1 nmdc:mga00v17_12262_c1_2218_3204 328
1028 3300050491 nmdc:mga00v17_26883_c1 nmdc:mga00v17_26883_c1_1731_2717 328
1029 3300050493 nmdc:mga0k408_5714_c2 nmdc:mga0k408_5714_c2_1811_2797 328
1030 3300053126 Ga0500621_000010 Ga0500621_000010_106546_107541 328
1031 iso_pu_bacteria 2554235234 2555258926 328
1032 iso_pu_bacteria 2600255291 2601663844 328
1033 iso_pu_bacteria 2600255299 2601701476 328
1034 iso_pu_bacteria 2602042109 2603865727 328

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01380

SIS

SIS domain

78

211

0.97

PF00571

CBS

CBS domain

305

360

0.94

PF00571

CBS

CBS domain

239

297

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xhz-assembly1.cif.gz_B probing the active site of the sugar isomerase domain from e. coli arabinose-5-phosphate isomerase via x-ray crystallography 0.9864 10 183
2xhz-assembly1.cif.gz_B probing the active site of the sugar isomerase domain from e. coli arabinose-5-phosphate isomerase via x-ray crystallography 0.9808 10 183
3fna-assembly3.cif.gz_A crystal structure of the cbs pair of possible d-arabinose 5-phosphate isomerase yrbh from escherichia coli cft073 0.9744 198 322
3fna-assembly3.cif.gz_B-2 crystal structure of the cbs pair of possible d-arabinose 5-phosphate isomerase yrbh from escherichia coli cft073 0.9705 199 324
3k2v-assembly1.cif.gz_B structure of the cbs pair of a putative d-arabinose 5-phosphate isomerase from klebsiella pneumoniae subsp. pneumoniae. 0.9698 198 324
ID Description Score Start End Superfamily
af_P45395_202_325_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 1.001 202 324 3.10.580.10
af_P45395_202_325_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9846 202 324 3.10.580.10
3fnaA00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9677 198 322 3.10.580.10
3fnaA00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9509 198 322 3.10.580.10
af_P45395_11_201_3.40.50.10490 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.95 11 200 3.40.50.10490
ID Description Score Start End GO Terms
AF-A0A656SJ60-F1-model_v4 deleted 0.9975 45 126
AF-A0A4V2AMI0-F1-model_v4 SIS domain-containing protein 0.9783 23 168 GO:0097367
GO:1901135
AF-A0A832J690-F1-model_v4 CBS domain-containing protein 0.9632 229 328
AF-A0A656SJ60-F1-model_v4 deleted 0.9624 45 126
AF-A0A382IFM7-F1-model_v4 SIS domain-containing protein 0.9594 10 131 GO:0097367
GO:1901135

Feature Viewer

pLDDT pTM Quality
89.02 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map