F488682

General Info

Members Datasets Scaffolds Average Seq Length
1034 542 771 233

Family's Representative Sequence

Representative Sequence 3300046491|Ga0495584_0000587|Ga0495584_0000587_21055_21900
Length 281
Sequence MRRQRTWLTQTFDFACGLSHCAVSLTGINFANFTQRPLTVPLELFVSMKPIQLPLGVRLRDDATFINYYPGANAAALGYVERLCEADAGWTESLIYLWGKDGVGRTHLLQAACLRFEQLGEPAVYLPLAELLDRGIEILDNLEQYELVCLDDLQAVAGKADWEEALFHLFNRLRDSGRRLLIAASTSPRELPVKLADLKSRLTLALIFQMRPLSDEDKLRALQLRASRRGLHLTDEVGHFILTRGTRSMSALFELLERLDQASLQAQRKLTIPFLKETLGW

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
3 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
4 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
5 2511231004 Pseudomonas sp. GM102 Isolate Nodule
6 2511231006 Pseudomonas sp. GM17 Isolate Nodule
7 2511231007 Pseudomonas sp. GM18 Isolate Nodule
8 2511231008 Pseudomonas sp. GM21 Isolate Nodule
9 2511231010 Pseudomonas sp. GM25 Isolate Nodule
10 2511231011 Pseudomonas sp. GM30 Isolate Nodule
11 2511231012 Pseudomonas sp. GM33 Isolate Nodule
12 2511231014 Pseudomonas sp. GM48 Isolate Nodule
13 2511231015 Pseudomonas sp. GM49 Isolate Nodule
14 2511231016 Pseudomonas sp. GM50 Isolate Nodule
15 2511231017 Pseudomonas sp. GM55 Isolate Nodule
16 2511231018 Pseudomonas sp. GM60 Isolate Nodule
17 2511231019 Pseudomonas sp. GM67 Isolate Nodule
18 2511231020 Pseudomonas sp. GM74 Isolate Nodule
19 2511231021 Pseudomonas sp. GM78 Isolate Nodule
20 2511231022 Pseudomonas sp. GM79 Isolate Nodule
21 2511231023 Pseudomonas sp. GM80 Isolate Nodule
22 2511231024 Pseudomonas sp. GM84 Isolate Nodule
23 2511231031 Pseudomonas sp. GM16 Isolate Nodule
24 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
25 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
26 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
27 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
28 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
29 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
30 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
31 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
32 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
33 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
34 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
35 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
36 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
37 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
38 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
39 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
40 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
41 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
42 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
43 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
44 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
45 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
46 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
47 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
48 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
49 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
50 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
51 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
52 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
53 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
54 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
55 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
56 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
57 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
58 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
59 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
60 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
61 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
62 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
63 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
64 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
65 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
66 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
67 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
68 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
69 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
70 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
71 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
72 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
73 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
74 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
75 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
76 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
77 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
78 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
79 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
80 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
81 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
82 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
83 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
84 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
85 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
86 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
87 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
88 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
89 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
90 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
91 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
92 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
93 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
94 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
95 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
96 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
97 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
98 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
99 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
100 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
101 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
102 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
103 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
104 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
105 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
106 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
107 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
108 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
109 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
110 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
111 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
112 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
113 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
114 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
115 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
116 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
117 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
118 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
119 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
120 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
121 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
122 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
123 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
124 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
125 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
126 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
127 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
128 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
129 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
130 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
131 2765235841 Pseudomonas putida AA7 Isolate Unclassified
132 2773857670 Pseudomonas sp. 478 Isolate Unclassified
133 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
134 2773857673 Pseudomonas sp. 443 Isolate Unclassified
135 2784132063 Pseudomonas sp. 424 Isolate Unclassified
136 2784132072 Pseudomonas sp. 460 Isolate Unclassified
137 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
138 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
139 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
140 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
141 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
142 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
143 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
144 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
145 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
146 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
147 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
148 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
149 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
150 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
151 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
152 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
153 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
154 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
155 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
156 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
157 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
158 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
159 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
160 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
161 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
162 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
163 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
164 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
165 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
166 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
167 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
168 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
169 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
170 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
171 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
172 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
173 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
174 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
175 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
176 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
177 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
178 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
179 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
180 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
181 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
182 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
183 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
184 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
185 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
186 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
187 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
188 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
189 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
190 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
191 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
192 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
193 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
194 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
195 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
196 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
197 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
198 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
199 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
200 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
201 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
202 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
203 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
204 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
205 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
206 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
207 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
208 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
209 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
210 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
211 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
212 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
213 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
214 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
215 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
216 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
217 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
218 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
219 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
220 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
221 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
222 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
223 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
224 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
225 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
226 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
227 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
228 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
229 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
230 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
231 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
232 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
233 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
234 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
235 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
236 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
237 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
238 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
239 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
240 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
241 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
242 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
243 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
244 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
245 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
246 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
247 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
248 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
249 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
250 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
251 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
252 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
253 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
254 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
255 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
256 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
257 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
258 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
259 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
260 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
261 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
262 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
263 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
264 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
265 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
266 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
267 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
268 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
269 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
270 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
271 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
272 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
273 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
274 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
275 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
276 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
277 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
278 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
279 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
280 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
281 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
282 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
283 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
284 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
285 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
286 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
287 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
288 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
289 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
290 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
291 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
292 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
293 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
294 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
295 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
296 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
297 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
298 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
299 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
300 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
301 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
302 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
303 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
304 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
305 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
306 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
307 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
308 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
309 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
310 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
311 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
312 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
313 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
314 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
315 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
316 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
317 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
318 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
337 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
338 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
339 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
340 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
341 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
342 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
343 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
344 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
345 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
347 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
348 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
349 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
350 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
351 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
352 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
353 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
354 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
355 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
356 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
357 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
358 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
359 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
360 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
361 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
362 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
363 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
364 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
365 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
367 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
368 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
369 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
370 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
371 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
372 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
373 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
374 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
375 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
376 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
377 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
378 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
379 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
380 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
381 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
382 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
383 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
384 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
385 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
386 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
387 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
388 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
389 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
390 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
391 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
392 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
393 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
394 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
395 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
396 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
397 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
398 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
399 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
400 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
401 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
402 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
403 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
404 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
405 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
406 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
407 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
408 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
409 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
410 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
411 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
412 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
413 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
414 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
415 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
416 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
417 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
418 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
419 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
420 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
421 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
422 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
423 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
424 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
425 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
426 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
427 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
428 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
429 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
430 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
431 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
432 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
433 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
434 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
435 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
436 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
437 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
438 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
439 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
440 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
441 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
442 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
443 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
444 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
445 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
446 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
447 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
448 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
449 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
450 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
451 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
452 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
453 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
454 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
455 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
456 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
457 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
458 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
459 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
460 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
461 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
462 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
463 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
464 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
465 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
466 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
467 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
468 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
469 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
470 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
471 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
472 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
473 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
474 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
475 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
476 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
477 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
478 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
479 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
480 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
481 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
482 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
483 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
484 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
485 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
486 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
487 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
488 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
489 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
490 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
491 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
492 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
493 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
494 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
495 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
496 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
497 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
498 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
499 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
500 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
501 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
502 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
503 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
504 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
505 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
506 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
507 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
508 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
509 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
510 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
511 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
512 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
513 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
514 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
515 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
516 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
517 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
518 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
519 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
520 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
521 8052494512 Pseudomonas putida LD6 Isolate Unclassified
522 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
523 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
524 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
525 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
526 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
527 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
528 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
529 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
530 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
531 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
532 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
533 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
534 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
535 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
536 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
537 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
538 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
539 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
540 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
541 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
542 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.47
Metatranscriptomes 0.1
Isolates 25.44

Biome Distribution

Category Percentage (%)
Aerial Root 0.19
Bulb 0
Endosphere 7.06
Nodule 2.8
Rhizoplane 7.54
Rhizosphere 69.15
Stem 0
Stem Tuber 0
Unclassified 13.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_22 2124908027 Bacteria 54424
2 MRS2a_Contig_9332 2124908027 Bacteria 3981
3 JGI25162J39368_1000401 3300002737 Bacteria 36292
4 JGI25162J39368_1000412 3300002737 Bacteria 34976
5 JGI25164J39214_1000282 3300002772 Bacteria 36292
6 JGI25164J39214_1000291 3300002772 Bacteria 34976
7 JGI25165J46597_1000520 3300003214 Bacteria 36292
8 JGI25165J46597_1000538 3300003214 Bacteria 34976
9 rootH1_10070704 3300003323 Bacteria 2031
10 rootH1_10317933 3300003323 Bacteria 1934
11 Ga0055538_1000027 3300003751 Bacteria 216576
12 Ga0055539_1000036 3300003752 Bacteria 216576
13 Ga0055533_1000046 3300003756 Bacteria 216576
14 Ga0055532_1000032 3300003758 Bacteria 216568
15 Ga0055525_1000672 3300003759 Bacteria 13111
16 Ga0055525_1003345 3300003759 Bacteria 1449
17 Ga0055535_1004737 3300003761 Bacteria 3200
18 Ga0055536_1000111 3300003781 Bacteria 71634
19 Ga0055536_1035132 3300003781 Bacteria 1257
20 Ga0055530_10000146 3300003791 Bacteria 63397
21 Ga0055530_10000299 3300003791 Bacteria 45066
22 Ga0055530_10000634 3300003791 Bacteria 30257
23 Ga0055540_1000289 3300003792 Bacteria 45066
24 Ga0055540_1000390 3300003792 Bacteria 36134
25 Ga0055540_1003473 3300003792 Bacteria 7607
26 Ga0055531_10000546 3300003794 Bacteria 33355
27 Ga0055531_10000989 3300003794 Bacteria 22593
28 Ga0055531_10025010 3300003794 Bacteria 2183
29 Ga0055541_1000024 3300003841 Bacteria 216576
30 Ga0065714_10000385 3300005288 Bacteria 5464
31 Ga0065714_10003231 3300005288 Bacteria 8635
32 Ga0065714_10005446 3300005288 Bacteria 7235
33 Ga0065714_10074902 3300005288 Bacteria 2975
34 Ga0065714_10082186 3300005288 Bacteria 2323
35 Ga0065714_10095966 3300005288 Bacteria 1772
36 Ga0065704_10014521 3300005289 Bacteria 2088
37 Ga0065704_10072317 3300005289 Bacteria 8746
38 Ga0065704_10132815 3300005289 Bacteria 1608
39 Ga0065712_10067771 3300005290 Bacteria 44643
40 Ga0065712_10073907 3300005290 Bacteria 4245
41 Ga0070676_10460007 3300005328 Bacteria 896
42 Ga0070670_100002076 3300005331 Bacteria 16406
43 Ga0070670_100151425 3300005331 Bacteria 2007
44 Ga0068868_100284927 3300005338 Bacteria 1399
45 Ga0070661_100000008 3300005344 Bacteria 183494
46 Ga0070669_100011983 3300005353 Bacteria 6153
47 Ga0070669_100016636 3300005353 Bacteria 5249
48 Ga0070669_100119695 3300005353 Bacteria 2007
49 Ga0070675_100399340 3300005354 Bacteria 1226
50 Ga0070671_100264932 3300005355 Bacteria 1461
51 Ga0070674_100016977 3300005356 Bacteria 4569
52 Ga0070674_100160566 3300005356 Bacteria 1705
53 Ga0070667_100125540 3300005367 Bacteria 2236
54 Ga0070662_100000966 3300005457 Bacteria 17611
55 Ga0068867_100067897 3300005459 Bacteria 2660
56 Ga0068853_100092045 3300005539 Bacteria 2667
57 Ga0070672_100046923 3300005543 Bacteria 3349
58 Ga0070672_100079711 3300005543 Bacteria 2622
59 Ga0070665_100067353 3300005548 Bacteria 3590
60 Ga0070665_100155909 3300005548 Bacteria 2285
61 Ga0070664_100000075 3300005564 Bacteria 62615
62 Ga0070664_100404603 3300005564 Bacteria 1248
63 Ga0068854_100035560 3300005578 Bacteria 3487
64 Ga0068864_100353634 3300005618 Bacteria 1387
65 Ga0068851_10000090 3300005834 Bacteria 50197
66 Ga0075364_10069825 3300006051 Bacteria 2312
67 Ga0075364_10081757 3300006051 Bacteria 2136
68 Ga0075364_10140765 3300006051 Bacteria 1623
69 Ga0075364_10159829 3300006051 Bacteria 1521
70 Ga0075432_10010964 3300006058 Bacteria 3079
71 Ga0075432_10034024 3300006058 Bacteria 1769
72 Ga0075432_10073634 3300006058 Bacteria 1230
73 Ga0075432_10118770 3300006058 Bacteria 991
74 Ga0075432_10153822 3300006058 Bacteria 885
75 Ga0075362_10155142 3300006177 Bacteria 1100
76 Ga0075362_10185689 3300006177 Bacteria 1008
77 Ga0075369_10011644 3300006186 Bacteria 3462
78 Ga0075369_10052992 3300006186 Bacteria 1759
79 Ga0075436_100582101 3300006914 Bacteria 823
80 Ga0099823_1000246 3300006944 Bacteria 31501
81 Ga0099823_1036538 3300006944 Bacteria 3765
82 Ga0079104_1000433 3300006946 Bacteria 47726
83 Ga0079104_1000766 3300006946 Bacteria 27538
84 Ga0099826_10023740 3300006948 Bacteria 4565
85 Ga0105251_10000035 3300009011 Bacteria 117861
86 Ga0105251_10000092 3300009011 Bacteria 86905
87 Ga0105251_10002567 3300009011 Bacteria 14090
88 Ga0105251_10002666 3300009011 Bacteria 13754
89 Ga0105251_10014207 3300009011 Bacteria 4416
90 Ga0105251_10021031 3300009011 Bacteria 3415
91 Ga0105251_10022506 3300009011 Bacteria 3271
92 Ga0105251_10062640 3300009011 Bacteria 1746
93 Ga0105244_10001613 3300009036 Bacteria 17879
94 Ga0105244_10001867 3300009036 Bacteria 16371
95 Ga0105244_10007007 3300009036 Bacteria 7214
96 Ga0105244_10013839 3300009036 Bacteria 4691
97 Ga0105244_10034710 3300009036 Bacteria 2653
98 Ga0105244_10040447 3300009036 Bacteria 2420
99 Ga0105244_10083576 3300009036 Bacteria 1578
100 Ga0105244_10118600 3300009036 Bacteria 1282
101 Ga0105244_10157423 3300009036 Bacteria 1086
102 Ga0105250_10000261 3300009092 Bacteria 43192
103 Ga0105250_10000495 3300009092 Bacteria 27711
104 Ga0105250_10014884 3300009092 Bacteria 3190
105 Ga0105250_10027737 3300009092 Bacteria 2282
106 Ga0105250_10122912 3300009092 Bacteria 1068
107 Ga0105243_10000582 3300009148 Bacteria 36687
108 Ga0105243_10004457 3300009148 Bacteria 11067
109 Ga0105243_10045999 3300009148 Bacteria 3431
110 Ga0105243_10062778 3300009148 Bacteria 2975
111 Ga0105243_10656453 3300009148 Bacteria 1017
112 Ga0105242_10002684 3300009176 Bacteria 13916
113 Ga0105242_10471402 3300009176 Bacteria 1188
114 Ga0105237_10000856 3300009545 Bacteria 41326
115 Ga0105249_10035526 3300009553 Bacteria 4520
116 Ga0105246_10001063 3300011119 Bacteria 15870
117 Ga0105246_10001690 3300011119 Bacteria 13160
118 Ga0105246_10010360 3300011119 Bacteria 5766
119 Ga0105246_10023990 3300011119 Bacteria 3955
120 Ga0105246_10061949 3300011119 Bacteria 2604
121 Ga0105246_10535276 3300011119 Bacteria 1001
122 Ga0157373_10002237 3300013100 Bacteria 14656
123 Ga0157373_10008169 3300013100 Bacteria 7783
124 Ga0157373_10021495 3300013100 Bacteria 4686
125 Ga0157373_10094782 3300013100 Bacteria 2101
126 Ga0157371_10000301 3300013102 Bacteria 65021
127 Ga0157371_10000923 3300013102 Bacteria 32990
128 Ga0157371_10001330 3300013102 Bacteria 25968
129 Ga0157371_10015893 3300013102 Bacteria 5630
130 Ga0157371_10056663 3300013102 Bacteria 2780
131 Ga0157371_10097294 3300013102 Bacteria 2086
132 Ga0157371_10335232 3300013102 Bacteria 1099
133 Ga0157370_10013075 3300013104 Bacteria 8568
134 Ga0157370_10053960 3300013104 Bacteria 3832
135 Ga0157370_10056165 3300013104 Bacteria 3747
136 Ga0157370_10067552 3300013104 Bacteria 3379
137 Ga0157370_10216011 3300013104 Bacteria 1777
138 Ga0157370_10718564 3300013104 Bacteria 911
139 Ga0157369_10003346 3300013105 Bacteria 19046
140 Ga0157369_10732493 3300013105 Bacteria 1018
141 Ga0163162_10001480 3300013306 Bacteria 21867
142 Ga0163162_10107166 3300013306 Bacteria 2889
143 Ga0163162_10107641 3300013306 Bacteria 2883
144 Ga0157372_10001752 3300013307 Bacteria 23529
145 Ga0157372_10046108 3300013307 Bacteria 4838
146 Ga0157375_10046234 3300013308 Bacteria 4242
147 Ga0157375_10380650 3300013308 Bacteria 1578
148 Ga0182008_10005941 3300014497 Bacteria 6885
149 Ga0182008_10010767 3300014497 Bacteria 4887
150 Ga0182008_10014706 3300014497 Bacteria 4093
151 Ga0182008_10017069 3300014497 Bacteria 3767
152 Ga0182008_10022922 3300014497 Bacteria 3195
153 Ga0182006_1000844 3300015261 Bacteria 20589
154 Ga0182006_1006672 3300015261 Bacteria 5344
155 Ga0182006_1007773 3300015261 Bacteria 4889
156 Ga0182006_1018323 3300015261 Bacteria 2960
157 Ga0182006_1029395 3300015261 Bacteria 2227
158 Ga0182006_1031524 3300015261 Bacteria 2135
159 Ga0182006_1050415 3300015261 Bacteria 1603
160 Ga0182007_10003640 3300015262 Bacteria 7221
161 Ga0182005_1000309 3300015265 Bacteria 29451
162 Ga0182005_1026069 3300015265 Bacteria 1595
163 Ga0163161_10115517 3300017792 Bacteria 2012
164 Ga0163161_10220558 3300017792 Bacteria 1468
165 Ga0209435_101639 3300025206 Bacteria 2748
166 Ga0209760_100028 3300025207 Bacteria 153020
167 Ga0209760_100163 3300025207 Bacteria 39216
168 Ga0209784_100017 3300025224 Bacteria 472003
169 Ga0209566_100014 3300025225 Bacteria 472003
170 Ga0209674_100028 3300025226 Bacteria 472003
171 Ga0209147_100038 3300025229 Bacteria 314497
172 Ga0209563_100032 3300025230 Bacteria 472003
173 Ga0209563_101192 3300025230 Bacteria 7278
174 Ga0207427_100007 3300025231 Bacteria 746220
175 Ga0207427_100008 3300025231 Bacteria 740731
176 Ga0209437_100006 3300025233 Bacteria 1042724
177 Ga0209437_100014 3300025233 Bacteria 740714
178 Ga0209437_107564 3300025233 Bacteria 1762
179 Ga0209258_100197 3300025242 Bacteria 124028
180 Ga0207425_1024826 3300025245 Bacteria 1241
181 Ga0209646_1000171 3300025246 Bacteria 84951
182 Ga0209677_100018 3300025253 Bacteria 472003
183 Ga0209759_1005069 3300025256 Bacteria 4717
184 Ga0209233_1000008 3300025261 Bacteria 1356712
185 Ga0209233_1000086 3300025261 Bacteria 331687
186 Ga0209675_1012545 3300025291 Bacteria 2719
187 Ga0209676_1000006 3300025292 Bacteria 1039588
188 Ga0209676_1000016 3300025292 Bacteria 655561
189 Ga0209676_1000033 3300025292 Bacteria 463236
190 Ga0209676_1000973 3300025292 Bacteria 34485
191 Ga0209676_1002053 3300025292 Bacteria 15749
192 Ga0209676_1008338 3300025292 Bacteria 4637
193 Ga0209050_1000070 3300025298 Bacteria 296366
194 Ga0209050_1000399 3300025298 Bacteria 81236
195 Ga0209050_1000477 3300025298 Bacteria 70798
196 Ga0209051_1000043 3300025303 Bacteria 305473
197 Ga0209051_1000086 3300025303 Bacteria 183550
198 Ga0209051_1000106 3300025303 Bacteria 159222
199 Ga0209051_1005825 3300025303 Bacteria 7092
200 Ga0209257_1000604 3300025304 Bacteria 59301
201 Ga0209257_1000623 3300025304 Bacteria 57092
202 Ga0207656_10000066 3300025321 Bacteria 39833
203 Ga0207696_1000025 3300025711 Bacteria 418650
204 Ga0207696_1000034 3300025711 Bacteria 350426
205 Ga0207696_1000043 3300025711 Bacteria 307112
206 Ga0207696_1000144 3300025711 Bacteria 122345
207 Ga0207696_1001836 3300025711 Bacteria 10916
208 Ga0207696_1005655 3300025711 Bacteria 5152
209 Ga0207655_1000095 3300025728 Bacteria 195899
210 Ga0207655_1000113 3300025728 Bacteria 167376
211 Ga0207655_1000448 3300025728 Bacteria 54335
212 Ga0207655_1000501 3300025728 Bacteria 50226
213 Ga0207655_1000610 3300025728 Bacteria 43238
214 Ga0207655_1001799 3300025728 Bacteria 18594
215 Ga0207655_1005111 3300025728 Bacteria 9044
216 Ga0207655_1005591 3300025728 Bacteria 8509
217 Ga0207655_1008966 3300025728 Bacteria 6273
218 Ga0207655_1026020 3300025728 Bacteria 2821
219 Ga0207655_1068839 3300025728 Bacteria 1326
220 Ga0207655_1074944 3300025728 Bacteria 1243
221 Ga0207655_1081629 3300025728 Bacteria 1165
222 Ga0207713_1000014 3300025735 Bacteria 432450
223 Ga0207713_1000074 3300025735 Bacteria 181376
224 Ga0207713_1000471 3300025735 Bacteria 41932
225 Ga0207713_1000618 3300025735 Bacteria 34875
226 Ga0207713_1000900 3300025735 Bacteria 26916
227 Ga0207713_1003229 3300025735 Bacteria 11252
228 Ga0207713_1003963 3300025735 Bacteria 9819
229 Ga0207713_1008642 3300025735 Bacteria 5831
230 Ga0207713_1011158 3300025735 Bacteria 4912
231 Ga0207713_1014993 3300025735 Bacteria 3996
232 Ga0207713_1016408 3300025735 Bacteria 3758
233 Ga0207713_1017297 3300025735 Bacteria 3624
234 Ga0207713_1017979 3300025735 Bacteria 3517
235 Ga0207713_1019013 3300025735 Bacteria 3379
236 Ga0207671_10000035 3300025914 Bacteria 237603
237 Ga0207649_10000017 3300025920 Bacteria 225193
238 Ga0207681_10000601 3300025923 Bacteria 24426
239 Ga0207681_10007857 3300025923 Bacteria 6529
240 Ga0207681_10048593 3300025923 Bacteria 2864
241 Ga0207650_10000212 3300025925 Bacteria 66326
242 Ga0207650_10006176 3300025925 Bacteria 8166
243 Ga0207650_10116440 3300025925 Bacteria 2075
244 Ga0207659_10164787 3300025926 Bacteria 1744
245 Ga0207706_10000796 3300025933 Bacteria 32646
246 Ga0207686_10011981 3300025934 Bacteria 4760
247 Ga0207709_10000053 3300025935 Bacteria 225514
248 Ga0207709_10011611 3300025935 Bacteria 4856
249 Ga0207709_10066666 3300025935 Bacteria 2269
250 Ga0207691_10009671 3300025940 Bacteria 9248
251 Ga0207679_10000005 3300025945 Bacteria 525011
252 Ga0207712_10128195 3300025961 Bacteria 1929
253 Ga0207639_10086856 3300026041 Bacteria 2492
254 Ga0207648_10090819 3300026089 Bacteria 2669
255 Ga0207676_10588862 3300026095 Bacteria 1067
256 Ga0209281_1000010 3300027111 Bacteria 726106
257 Ga0209281_1000331 3300027111 Bacteria 81645
258 Ga0209281_1010855 3300027111 Bacteria 2061
259 Ga0209389_1000031 3300027296 Bacteria 138036
260 Ga0209371_1001358 3300027312 Bacteria 16941
261 Ga0209371_1005354 3300027312 Bacteria 5135
262 Ga0209371_1009851 3300027312 Bacteria 3000
263 Ga0209984_1000700 3300027424 Bacteria 3571
264 Ga0209999_1008843 3300027543 Bacteria 1822
265 Ga0209999_1025509 3300027543 Bacteria 1092
266 Ga0209983_1002353 3300027665 Bacteria 4148
267 Ga0209971_1000648 3300027682 Bacteria 9081
268 Ga0209974_10020136 3300027876 Bacteria 2212
269 Ga0209974_10033019 3300027876 Bacteria 1716
270 Ga0207428_10049694 3300027907 Bacteria 3359
271 Ga0207428_10065873 3300027907 Bacteria 2856
272 Ga0207428_10579528 3300027907 Bacteria 810
273 Ga0268266_10139563 3300028379 Bacteria 2174
274 Ga0268266_10143672 3300028379 Bacteria 2143
275 Ga0268256_1001168 3300030500 Bacteria 16941
276 Ga0268256_1005256 3300030500 Bacteria 5135
277 Ga0314311_1178492 3300030733 Bacteria 4187
278 Ga0316178_1127053 3300030735 Bacteria 33158
279 Ga0316181_1093196 3300030744 Bacteria 1892
280 Ga0265328_10132599 3300031239 Unclassified 933
281 Ga0265327_10000712 3300031251 Bacteria 52529
282 Ga0265327_10001471 3300031251 Bacteria 29522
283 Ga0265327_10284167 3300031251 Unclassified 731
284 Ga0265316_10000461 3300031344 Bacteria 46248
285 Ga0265316_10458131 3300031344 Bacteria 914
286 Ga0307408_100000042 3300031548 Bacteria 172505
287 Ga0307408_100001335 3300031548 Bacteria 18502
288 Ga0307408_100031564 3300031548 Bacteria 3690
289 Ga0307408_100534977 3300031548 Bacteria 1031
290 Ga0307408_100786731 3300031548 Bacteria 862
291 Ga0316576_10009311 3300031727 Bacteria 6332
292 Ga0316576_10084591 3300031727 Bacteria 2357
293 Ga0316576_10218804 3300031727 Bacteria 1433
294 Ga0316578_10021793 3300031728 Unclassified 3561
295 Ga0316578_10055792 3300031728 Bacteria 2319
296 Ga0316578_10120483 3300031728 Bacteria 1577
297 Ga0316577_10039458 3300031733 Bacteria 2641
298 Ga0316577_10296749 3300031733 Bacteria 915
299 Ga0307413_10018772 3300031824 Bacteria 3636
300 Ga0307413_10137062 3300031824 Bacteria 1685
301 Ga0307406_10024656 3300031901 Bacteria 3594
302 Ga0307412_10026682 3300031911 Bacteria 3593
303 Ga0307412_10026786 3300031911 Bacteria 3587
304 Ga0307412_10149055 3300031911 Bacteria 1723
305 Ga0307412_10412625 3300031911 Bacteria 1102
306 Ga0307409_100117900 3300031995 Bacteria 2241
307 Ga0307414_10018889 3300032004 Bacteria 4258
308 Ga0307414_10396483 3300032004 Bacteria 1197
309 Ga0307411_10031489 3300032005 Bacteria 3264
310 Ga0307411_10061793 3300032005 Bacteria 2495
311 Ga0307411_10123255 3300032005 Bacteria 1879
312 Ga0316585_10012662 3300032137 Bacteria 2502
313 Ga0316580_10018135 3300032139 Bacteria 2166
314 Ga0316593_10088147 3300032168 Unclassified 1090
315 Ga0307510_10025016 3300033180 Bacteria 6893
316 Ga0316574_0001096 3300035398 Bacteria 12390
317 Ga0316574_0011291 3300035398 Bacteria 5073
318 Ga0316574_0017186 3300035398 Bacteria 4228
319 Ga0316574_0195055 3300035398 Unclassified 1302
320 Ga0316582_0010077 3300036647 Bacteria 5162
321 Ga0316582_0043354 3300036647 Bacteria 2822
322 Ga0316582_0048330 3300036647 Bacteria 2690
323 Ga0316582_0119519 3300036647 Unclassified 1762
324 Ga0316582_0146556 3300036647 Bacteria 1594
325 Ga0316582_0286983 3300036647 Bacteria 1130
326 Ga0316582_0428045 3300036647 Unclassified 912
327 Ga0316584_0011224 3300036712 Bacteria 6290
328 Ga0316584_0018008 3300036712 Bacteria 5090
329 Ga0316584_0049469 3300036712 Bacteria 3142
330 Ga0316584_0460790 3300036712 Bacteria 898
331 Ga0237819_02422 3300038705 Bacteria 3773
332 Ga0439436_0000465 3300041404 Bacteria 10411
333 Ga0439438_000136 3300041405 Bacteria 33194
334 Ga0439438_002815 3300041405 Bacteria 7267
335 Ga0439438_005069 3300041405 Bacteria 4911
336 Ga0439438_010637 3300041405 Bacteria 2898
337 Ga0439438_013860 3300041405 Bacteria 2415
338 Ga0439447_001185 3300041407 Bacteria 9504
339 Ga0439447_002289 3300041407 Bacteria 7019
340 Ga0439447_002435 3300041407 Bacteria 6789
341 Ga0439447_018238 3300041407 Bacteria 1896
342 Ga0439466_0000828 3300041411 Bacteria 11773
343 Ga0439466_0001731 3300041411 Bacteria 8525
344 Ga0439466_0005326 3300041411 Bacteria 4919
345 Ga0439466_0005858 3300041411 Bacteria 4680
346 Ga0439466_0007222 3300041411 Bacteria 4204
347 Ga0439466_0007532 3300041411 Bacteria 4116
348 Ga0439466_0023166 3300041411 Bacteria 2186
349 Ga0451807_0563555 3300041486 Bacteria 1183
350 Ga0439437_001430 3300042000 Bacteria 2515
351 Ga0439432_000121 3300042006 Bacteria 25700
352 Ga0439432_004055 3300042006 Bacteria 5370
353 Ga0439432_005544 3300042006 Bacteria 4539
354 Ga0439432_008146 3300042006 Bacteria 3688
355 Ga0439432_030688 3300042006 Bacteria 1742
356 Ga0439432_077276 3300042006 Bacteria 1010
357 Ga0439451_008221 3300042009 Bacteria 2118
358 Ga0439451_018163 3300042009 Bacteria 1418
359 Ga0439452_000244 3300042010 Bacteria 37543
360 Ga0439452_001133 3300042010 Bacteria 11647
361 Ga0439452_002100 3300042010 Bacteria 7549
362 Ga0439452_006702 3300042010 Bacteria 3586
363 Ga0439452_008746 3300042010 Bacteria 3025
364 Ga0439452_011698 3300042010 Bacteria 2513
365 Ga0439452_014917 3300042010 Bacteria 2145
366 Ga0439456_000089 3300042013 Bacteria 31822
367 Ga0439456_005136 3300042013 Bacteria 2657
368 Ga0439456_005403 3300042013 Bacteria 2591
369 Ga0439456_008178 3300042013 Bacteria 2159
370 Ga0439456_019789 3300042013 Bacteria 1417
371 Ga0439463_000778 3300042016 Bacteria 8807
372 Ga0439463_005465 3300042016 Bacteria 3155
373 Ga0450911_000017 3300042115 Bacteria 104823
374 Ga0450911_000237 3300042115 Bacteria 20957
375 Ga0450919_005421 3300042121 Bacteria 1533
376 Ga0450920_022524 3300042122 Bacteria 1220
377 Ga0450922_003536 3300042124 Bacteria 1438
378 Ga0450923_000184 3300042125 Bacteria 5914
379 Ga0450900_000340 3300042136 Bacteria 3454
380 Ga0450902_000757 3300042137 Bacteria 4155
381 Ga0450902_002353 3300042137 Bacteria 2676
382 Ga0450902_014286 3300042137 Bacteria 1284
383 Ga0450904_000260 3300042139 Bacteria 11390
384 Ga0450904_002736 3300042139 Bacteria 2022
385 Ga0450905_005405 3300042142 Bacteria 1715
386 Ga0450905_028655 3300042142 Bacteria 850
387 Ga0450905_029684 3300042142 Bacteria 839
388 Ga0450906_002445 3300042145 Bacteria 4059
389 Ga0450907_000076 3300042146 Bacteria 37520
390 Ga0450907_001352 3300042146 Bacteria 5406
391 Ga0450907_010405 3300042146 Bacteria 1544
392 Ga0450910_000679 3300042147 Bacteria 4078
393 Ga0439446_0000604 3300042156 Bacteria 7379
394 Ga0439446_0003340 3300042156 Bacteria 3970
395 Ga0439446_0004459 3300042156 Bacteria 3549
396 Ga0439446_0015788 3300042156 Bacteria 2097
397 Ga0439446_0023590 3300042156 Bacteria 1751
398 Ga0450908_000501 3300042184 Bacteria 7537
399 Ga0450909_000096 3300042185 Bacteria 8526
400 Ga0450909_007833 3300042185 Bacteria 1548
401 Ga0439434_0000804 3300042435 Bacteria 9058
402 Ga0439434_0014404 3300042435 Bacteria 2352
403 Ga0439434_0016910 3300042435 Bacteria 2180
404 Ga0439459_0022850 3300042438 Bacteria 1213
405 Ga0439464_0003363 3300042439 Bacteria 4028
406 Ga0439464_0004738 3300042439 Bacteria 3484
407 Ga0439464_0009195 3300042439 Bacteria 2599
408 Ga0439460_0003586 3300042461 Bacteria 3752
409 Ga0439460_0007704 3300042461 Bacteria 2700
410 Ga0450916_000440 3300042530 Bacteria 3566
411 Ga0450918_011503 3300042531 Bacteria 1542
412 Ga0450901_000007 3300042533 Bacteria 23102
413 Ga0451577_0000105 3300042876 Bacteria 184360
414 Ga0451577_0009916 3300042876 Bacteria 9131
415 Ga0451577_0253980 3300042876 Bacteria 1591
416 Ga0451577_0275370 3300042876 Bacteria 1524
417 Ga0439440_0000185 3300042993 Bacteria 9512
418 Ga0453684_0003537 3300044712 Bacteria 34947
419 Ga0453684_0055976 3300044712 Bacteria 5121
420 Ga0453684_0195291 3300044712 Bacteria 2364
421 Ga0451576_0000217 3300045051 Bacteria 142222
422 Ga0495617_000141 3300046452 Bacteria 47430
423 Ga0495617_029541 3300046452 Bacteria 1843
424 Ga0495617_036883 3300046452 Bacteria 1638
425 Ga0495617_041150 3300046452 Bacteria 1545
426 Ga0495627_000130 3300046453 Bacteria 91090
427 Ga0495627_000888 3300046453 Bacteria 20978
428 Ga0495627_003846 3300046453 Bacteria 6444
429 Ga0495627_004631 3300046453 Bacteria 5703
430 Ga0495627_007148 3300046453 Bacteria 4313
431 Ga0495627_008463 3300046453 Bacteria 3855
432 Ga0495603_0013079 3300046455 Bacteria 5017
433 Ga0495603_0104211 3300046455 Bacteria 1655
434 Ga0495590_0003790 3300046457 Bacteria 6157
435 Ga0495590_0102102 3300046457 Bacteria 1019
436 Ga0495591_000119 3300046458 Bacteria 87324
437 Ga0495591_001004 3300046458 Bacteria 19076
438 Ga0495591_001781 3300046458 Bacteria 12749
439 Ga0495591_002890 3300046458 Bacteria 9214
440 Ga0495591_003252 3300046458 Bacteria 8535
441 Ga0495591_004111 3300046458 Bacteria 7238
442 Ga0495591_007995 3300046458 Bacteria 4396
443 Ga0495629_0073034 3300046459 Bacteria 2395
444 Ga0495638_0014555 3300046460 Bacteria 5311
445 Ga0495638_0022681 3300046460 Bacteria 4118
446 Ga0495638_0033967 3300046460 Bacteria 3258
447 Ga0495638_0113968 3300046460 Bacteria 1603
448 Ga0495653_0009457 3300046463 Bacteria 7975
449 Ga0495653_0016863 3300046463 Bacteria 5944
450 Ga0495653_0020041 3300046463 Bacteria 5419
451 Ga0495650_0003122 3300046471 Bacteria 12416
452 Ga0495650_0005077 3300046471 Bacteria 8710
453 Ga0495650_0016467 3300046471 Bacteria 3743
454 Ga0495582_0002605 3300046473 Bacteria 10035
455 Ga0495605_0000125 3300046474 Bacteria 101414
456 Ga0495605_0000149 3300046474 Bacteria 90748
457 Ga0495605_0000429 3300046474 Bacteria 38029
458 Ga0495605_0000503 3300046474 Bacteria 33522
459 Ga0495605_0001674 3300046474 Bacteria 14250
460 Ga0495605_0004647 3300046474 Bacteria 8028
461 Ga0495605_0009525 3300046474 Bacteria 5454
462 Ga0495605_0018078 3300046474 Bacteria 3785
463 Ga0495639_0000065 3300046475 Bacteria 48194
464 Ga0495639_0003249 3300046475 Bacteria 7058
465 Ga0495584_0000587 3300046491 Bacteria 24562
466 Ga0495584_0003676 3300046491 Bacteria 8351
467 Ga0495584_0004945 3300046491 Bacteria 7106
468 Ga0495584_0020919 3300046491 Bacteria 3321
469 Ga0495584_0030366 3300046491 Bacteria 2737
470 Ga0495584_0055031 3300046491 Bacteria 2002
471 Ga0495585_0001301 3300046492 Bacteria 19906
472 Ga0495585_0001381 3300046492 Bacteria 19179
473 Ga0495585_0310296 3300046492 Bacteria 773
474 Ga0495594_0003413 3300046499 Bacteria 8204
475 Ga0495596_0000636 3300046500 Bacteria 22084
476 Ga0495607_0000312 3300046501 Bacteria 50602
477 Ga0495607_0000379 3300046501 Bacteria 45776
478 Ga0495607_0000455 3300046501 Bacteria 40967
479 Ga0495607_0000464 3300046501 Bacteria 40712
480 Ga0495607_0004399 3300046501 Bacteria 10382
481 Ga0495607_0006401 3300046501 Bacteria 8293
482 Ga0495607_0007164 3300046501 Bacteria 7750
483 Ga0495607_0008736 3300046501 Bacteria 6903
484 Ga0495607_0011380 3300046501 Bacteria 5925
485 Ga0495607_0026447 3300046501 Bacteria 3601
486 Ga0495607_0064900 3300046501 Bacteria 2060
487 Ga0495607_0087953 3300046501 Bacteria 1689
488 Ga0495607_0099717 3300046501 Bacteria 1557
489 Ga0495607_0278997 3300046501 Bacteria 793
490 Ga0495583_0000196 3300046506 Bacteria 101268
491 Ga0495583_0001527 3300046506 Bacteria 22952
492 Ga0495583_0004118 3300046506 Bacteria 10657
493 Ga0495583_0007950 3300046506 Bacteria 6567
494 Ga0495583_0009084 3300046506 Bacteria 5979
495 Ga0495606_0000712 3300046507 Bacteria 51489
496 Ga0495606_0001438 3300046507 Bacteria 31937
497 Ga0495606_0009506 3300046507 Bacteria 8212
498 Ga0495606_0016921 3300046507 Bacteria 5535
499 Ga0495606_0022904 3300046507 Bacteria 4538
500 Ga0495606_0029764 3300046507 Bacteria 3826
501 Ga0495610_0007081 3300046512 Bacteria 7567
502 Ga0495610_0027192 3300046512 Bacteria 3044
503 Ga0495610_0031604 3300046512 Bacteria 2760
504 Ga0495610_0077190 3300046512 Bacteria 1539
505 Ga0495610_0150084 3300046512 Bacteria 995
506 Ga0495616_0019099 3300046513 Bacteria 3745
507 Ga0495616_0028518 3300046513 Bacteria 2955
508 Ga0495616_0038987 3300046513 Bacteria 2436
509 Ga0495620_0000003 3300046515 Bacteria 345923
510 Ga0495620_0000055 3300046515 Bacteria 99544
511 Ga0495620_0000584 3300046515 Bacteria 22805
512 Ga0495620_0001229 3300046515 Bacteria 15659
513 Ga0495620_0004454 3300046515 Bacteria 7894
514 Ga0495620_0010025 3300046515 Bacteria 5011
515 Ga0495630_0027786 3300046517 Bacteria 4201
516 Ga0495630_0131962 3300046517 Bacteria 1897
517 Ga0495631_0002696 3300046518 Bacteria 9861
518 Ga0495631_0006268 3300046518 Bacteria 6158
519 Ga0495632_0000186 3300046519 Bacteria 63352
520 Ga0495632_0000432 3300046519 Bacteria 39892
521 Ga0495632_0000608 3300046519 Bacteria 33143
522 Ga0495632_0003902 3300046519 Bacteria 10361
523 Ga0495632_0005207 3300046519 Bacteria 8669
524 Ga0495632_0006116 3300046519 Bacteria 7803
525 Ga0495632_0006199 3300046519 Bacteria 7741
526 Ga0495632_0008775 3300046519 Bacteria 6159
527 Ga0495632_0014616 3300046519 Bacteria 4434
528 Ga0495632_0019199 3300046519 Bacteria 3730
529 Ga0495632_0063758 3300046519 Bacteria 1783
530 Ga0495637_0000162 3300046520 Bacteria 50983
531 Ga0495637_0000231 3300046520 Bacteria 43247
532 Ga0495637_0002146 3300046520 Bacteria 11045
533 Ga0495637_0003708 3300046520 Bacteria 8071
534 Ga0495637_0005206 3300046520 Bacteria 6661
535 Ga0495637_0005703 3300046520 Bacteria 6314
536 Ga0495637_0007586 3300046520 Bacteria 5367
537 Ga0495637_0008547 3300046520 Bacteria 5026
538 Ga0495637_0013132 3300046520 Bacteria 3938
539 Ga0495637_0014081 3300046520 Bacteria 3780
540 Ga0495637_0060989 3300046520 Bacteria 1547
541 Ga0495643_0000319 3300046522 Bacteria 66471
542 Ga0495643_0001060 3300046522 Bacteria 27491
543 Ga0495643_0008410 3300046522 Bacteria 6536
544 Ga0495643_0037205 3300046522 Bacteria 2671
545 Ga0495643_0047794 3300046522 Bacteria 2315
546 Ga0495643_0201330 3300046522 Bacteria 955
547 Ga0495644_0003627 3300046523 Bacteria 6081
548 Ga0495644_0024090 3300046523 Bacteria 2315
549 Ga0495648_0000676 3300046524 Bacteria 36436
550 Ga0495648_0000755 3300046524 Bacteria 34528
551 Ga0495648_0001144 3300046524 Bacteria 26818
552 Ga0495648_0003719 3300046524 Bacteria 13326
553 Ga0495648_0006841 3300046524 Bacteria 9207
554 Ga0495648_0007126 3300046524 Bacteria 8995
555 Ga0495648_0039231 3300046524 Bacteria 3015
556 Ga0495648_0134382 3300046524 Bacteria 1310
557 Ga0495666_0003285 3300046526 Bacteria 8162
558 Ga0495642_0000172 3300046528 Bacteria 37956
559 Ga0495642_0000431 3300046528 Bacteria 22121
560 Ga0495654_0001418 3300046530 Bacteria 16564
561 Ga0495654_0002234 3300046530 Bacteria 12546
562 Ga0495654_0003745 3300046530 Bacteria 9206
563 Ga0495654_0005234 3300046530 Bacteria 7567
564 Ga0495654_0006557 3300046530 Bacteria 6595
565 Ga0495654_0018618 3300046530 Bacteria 3636
566 Ga0495654_0027116 3300046530 Bacteria 2939
567 Ga0495654_0039060 3300046530 Bacteria 2371
568 Ga0495654_0143301 3300046530 Bacteria 1063
569 Ga0495586_0148424 3300046535 Bacteria 1318
570 Ga0495587_0001431 3300046536 Bacteria 15880
571 Ga0495587_0010525 3300046536 Bacteria 5882
572 Ga0495598_0002453 3300046537 Bacteria 3836
573 Ga0495609_0000087 3300046538 Bacteria 110204
574 Ga0495609_0000174 3300046538 Bacteria 65959
575 Ga0495609_0000213 3300046538 Bacteria 57790
576 Ga0495609_0001854 3300046538 Bacteria 13504
577 Ga0495609_0032377 3300046538 Bacteria 2374
578 Ga0495609_0051850 3300046538 Bacteria 1826
579 Ga0495609_0089699 3300046538 Bacteria 1337
580 Ga0495597_0000097 3300046542 Bacteria 78347
581 Ga0495597_0008719 3300046542 Bacteria 5065
582 Ga0495597_0011290 3300046542 Bacteria 4335
583 Ga0495597_0023634 3300046542 Bacteria 2842
584 Ga0495597_0166931 3300046542 Bacteria 895
585 Ga0495622_0000688 3300046557 Bacteria 19228
586 Ga0495622_0002891 3300046557 Bacteria 8192
587 Ga0495622_0186812 3300046557 Bacteria 927
588 Ga0495633_0000134 3300046558 Bacteria 98658
589 Ga0495633_0007571 3300046558 Bacteria 6230
590 Ga0495656_0006258 3300046615 Bacteria 4167
591 Ga0495668_0017196 3300046616 Bacteria 4199
592 Ga0495668_0246155 3300046616 Bacteria 979
593 Ga0495634_0027922 3300046642 Bacteria 3922
594 Ga0495611_0002038 3300046648 Bacteria 9538
595 Ga0495611_0003476 3300046648 Bacteria 6941
596 Ga0495625_0000145 3300046660 Bacteria 108480
597 Ga0495625_0022895 3300046660 Bacteria 4780
598 Ga0495635_0003568 3300046663 Bacteria 10769
599 Ga0495635_0005207 3300046663 Bacteria 9048
600 Ga0495659_0003223 3300046664 Bacteria 5227
601 Ga0495659_0024669 3300046664 Bacteria 2052
602 Ga0495661_0000150 3300046665 Bacteria 81419
603 Ga0495661_0000193 3300046665 Bacteria 70300
604 Ga0495661_0000306 3300046665 Bacteria 55899
605 Ga0495661_0000332 3300046665 Bacteria 51357
606 Ga0495661_0000644 3300046665 Bacteria 35320
607 Ga0495661_0007217 3300046665 Bacteria 7747
608 Ga0495588_0005283 3300046674 Bacteria 5742
609 Ga0495646_0004182 3300046680 Bacteria 9070
610 Ga0495646_0007936 3300046680 Bacteria 6743
611 Ga0495669_0001041 3300046684 Bacteria 11559
612 Ga0495613_0073554 3300046689 Bacteria 2490
613 Ga0495624_0001547 3300046690 Bacteria 17769
614 Ga0495670_0014020 3300046691 Bacteria 3943
615 Ga0495670_0031504 3300046691 Bacteria 2635
616 Ga0495670_0048498 3300046691 Bacteria 2124
617 Ga0495671_0000813 3300046692 Bacteria 22300
618 Ga0495671_0002178 3300046692 Bacteria 12484
619 Ga0495671_0010354 3300046692 Bacteria 5170
620 Ga0495671_0011743 3300046692 Bacteria 4802
621 Ga0495671_0020192 3300046692 Bacteria 3512
622 Ga0495671_0036459 3300046692 Bacteria 2490
623 Ga0495671_0052705 3300046692 Bacteria 2021
624 Ga0495649_0000362 3300046694 Bacteria 39295
625 Ga0495649_0001373 3300046694 Bacteria 18445
626 Ga0495649_0003896 3300046694 Bacteria 9870
627 Ga0495649_0029860 3300046694 Bacteria 3012
628 Ga0495649_0049052 3300046694 Bacteria 2293
629 Ga0495589_0000228 3300046794 Bacteria 47419
630 Ga0495589_0004887 3300046794 Bacteria 7111
631 Ga0495589_0013783 3300046794 Bacteria 4169
632 Ga0495660_0004242 3300046810 Bacteria 8701
633 Ga0495660_0005442 3300046810 Bacteria 7621
634 Ga0495660_0005476 3300046810 Bacteria 7604
635 Ga0495660_0034816 3300046810 Bacteria 2816
636 Ga0495660_0035397 3300046810 Bacteria 2789
637 Ga0495660_0072027 3300046810 Bacteria 1831
638 Ga0495660_0073341 3300046810 Bacteria 1810
639 Ga0495604_0020674 3300047317 Bacteria 5255
640 Ga0495672_0000961 3300047320 Bacteria 29956
641 Ga0495672_0014074 3300047320 Bacteria 5493
642 Ga0495672_0019259 3300047320 Bacteria 4506
643 Ga0495672_0023652 3300047320 Bacteria 3972
644 Ga0495672_0032335 3300047320 Bacteria 3256
645 Ga0495672_0046547 3300047320 Bacteria 2586
646 Ga0495672_0233142 3300047320 Bacteria 902
647 Ga0495676_0000119 3300047321 Bacteria 60424
648 Ga0495676_0016179 3300047321 Bacteria 6625
649 Ga0495680_0022050 3300047322 Bacteria 5319
650 Ga0495680_0048725 3300047322 Bacteria 3325
651 Ga0495683_0000059 3300047323 Bacteria 116530
652 Ga0495683_0000095 3300047323 Bacteria 89824
653 Ga0495683_0002437 3300047323 Bacteria 11249
654 Ga0495683_0042946 3300047323 Bacteria 2277
655 Ga0495687_003858 3300047443 Bacteria 10544
656 Ga0495687_007887 3300047443 Bacteria 6190
657 Ga0495687_009404 3300047443 Bacteria 5466
658 Ga0495677_0001027 3300047445 Bacteria 11222
659 Ga0495679_000267 3300047446 Bacteria 43569
660 Ga0495679_000554 3300047446 Bacteria 26315
661 Ga0495685_030284 3300047447 Bacteria 1861
662 Ga0495673_0001692 3300047469 Bacteria 16928
663 Ga0495673_0002018 3300047469 Bacteria 14927
664 Ga0495673_0002336 3300047469 Bacteria 13493
665 Ga0495673_0005312 3300047469 Bacteria 7815
666 Ga0495673_0006440 3300047469 Bacteria 6900
667 Ga0495673_0007434 3300047469 Bacteria 6299
668 Ga0495673_0008495 3300047469 Bacteria 5769
669 Ga0495673_0026708 3300047469 Bacteria 2756
670 Ga0495673_0102262 3300047469 Bacteria 1156
671 Ga0495681_0000690 3300047470 Bacteria 25744
672 Ga0495681_0001877 3300047470 Bacteria 15443
673 Ga0495681_0006727 3300047470 Bacteria 7499
674 Ga0495681_0026634 3300047470 Bacteria 3005
675 Ga0495681_0148645 3300047470 Bacteria 984
676 Ga0495686_0123668 3300047472 Bacteria 1539
677 Ga0495626_0000259 3300048091 Bacteria 60592
678 Ga0495626_0000625 3300048091 Bacteria 34456
679 Ga0495626_0003715 3300048091 Bacteria 9641
680 Ga0495626_0004053 3300048091 Bacteria 9130
681 Ga0495626_0008942 3300048091 Bacteria 5435
682 Ga0495626_0010349 3300048091 Bacteria 4981
683 Ga0496102_0009345 3300048905 Bacteria 8423
684 Ga0496103_0002700 3300048906 Bacteria 11067
685 Ga0496110_0022963 3300048913 Bacteria 5302
686 Ga0496112_0453820 3300048915 Bacteria 1219
687 Ga0496114_0004116 3300048917 Bacteria 11251
688 Ga0496114_0007099 3300048917 Bacteria 8836
689 Ga0496115_0014315 3300048918 Bacteria 6005
690 Ga0496115_0035754 3300048918 Bacteria 3932
691 Ga0496116_0000792 3300048919 Bacteria 40176
692 Ga0496116_0009449 3300048919 Bacteria 8306
693 Ga0496116_0037374 3300048919 Bacteria 3387
694 Ga0496116_0045813 3300048919 Bacteria 2957
695 Ga0496117_0001008 3300048920 Bacteria 43122
696 Ga0496117_0002238 3300048920 Bacteria 24976
697 Ga0496117_0002244 3300048920 Bacteria 24928
698 Ga0496117_0002790 3300048920 Bacteria 21334
699 Ga0496117_0008345 3300048920 Bacteria 9848
700 Ga0496117_0106787 3300048920 Bacteria 1756
701 Ga0496117_0153824 3300048920 Bacteria 1357
702 Ga0496118_0003309 3300048921 Bacteria 20446
703 Ga0496118_0010322 3300048921 Bacteria 9261
704 Ga0496118_0035214 3300048921 Bacteria 4070
705 Ga0496118_0035375 3300048921 Bacteria 4056
706 Ga0496118_0109414 3300048921 Bacteria 1839
707 Ga0496118_0180193 3300048921 Bacteria 1277
708 Ga0496119_0000380 3300048922 Bacteria 61208
709 Ga0496120_0002903 3300048923 Bacteria 16379
710 Ga0496121_0000858 3300048924 Bacteria 55007
711 Ga0496121_0001360 3300048924 Bacteria 41696
712 Ga0496121_0002590 3300048924 Bacteria 27310
713 Ga0496121_0044902 3300048924 Bacteria 3804
714 Ga0496121_0066311 3300048924 Bacteria 2932
715 Ga0496121_0136226 3300048924 Bacteria 1829
716 Ga0496122_0001237 3300048925 Bacteria 43156
717 Ga0496122_0002322 3300048925 Bacteria 27452
718 Ga0496122_0004088 3300048925 Bacteria 18485
719 Ga0496122_0036831 3300048925 Bacteria 3948
720 Ga0496122_0042793 3300048925 Bacteria 3557
721 Ga0496123_0000550 3300048926 Bacteria 64267
722 Ga0496123_0006040 3300048926 Bacteria 11894
723 Ga0496123_0008088 3300048926 Bacteria 9726
724 Ga0496123_0035674 3300048926 Bacteria 3540
725 Ga0496123_0054043 3300048926 Bacteria 2648
726 Ga0496123_0142438 3300048926 Bacteria 1308
727 Ga0496124_0000355 3300048927 Bacteria 83748
728 Ga0496124_0001100 3300048927 Bacteria 42478
729 Ga0496124_0002102 3300048927 Bacteria 26896
730 Ga0496124_0007094 3300048927 Bacteria 12006
731 Ga0496124_0010243 3300048927 Bacteria 9520
732 Ga0496124_0010329 3300048927 Bacteria 9471
733 Ga0496124_0030407 3300048927 Bacteria 4794
734 Ga0496124_0092665 3300048927 Bacteria 2461
735 Ga0496124_0174691 3300048927 Bacteria 1659
736 Ga0496124_0334014 3300048927 Bacteria 1079
737 Ga0496125_0002991 3300048928 Bacteria 21184
738 Ga0496125_0037792 3300048928 Bacteria 4192
739 Ga0496125_0049985 3300048928 Bacteria 3467
740 Ga0496126_0029684 3300048929 Bacteria 5191
741 Ga0496126_0128833 3300048929 Bacteria 2188
742 Ga0495678_000108 3300049459 Bacteria 99839
743 Ga0495678_003989 3300049459 Bacteria 8819
744 Ga0495678_005172 3300049459 Bacteria 7306
745 Ga0495678_019211 3300049459 Bacteria 3053
746 Ga0495678_027046 3300049459 Bacteria 2438
747 Ga0495682_0000170 3300049460 Bacteria 55005
748 Ga0495682_0000234 3300049460 Bacteria 43711
749 Ga0495682_0002853 3300049460 Bacteria 7955
750 Ga0495682_0005115 3300049460 Bacteria 5491
751 Ga0495682_0019452 3300049460 Bacteria 2553
752 Ga0495682_0109646 3300049460 Bacteria 989
753 Ga0495682_0126512 3300049460 Bacteria 914
754 Ga0501032_0102910 3300049569 Bacteria 1892
755 Ga0501032_0416826 3300049569 Bacteria 862
756 Ga0501034_0000150 3300049571 Bacteria 131760
757 Ga0501034_0911783 3300049571 Bacteria 766
758 Ga0501037_0097933 3300049573 Bacteria 2119
759 Ga0501039_0106675 3300049575 Bacteria 2188
760 Ga0501070_0036722 3300049586 Bacteria 4092
761 Ga0501072_0465159 3300049588 Bacteria 1001
762 Ga0501080_0473695 3300049742 Bacteria 1121
763 Ga0501241_008863 3300049758 Bacteria 1833
764 Ga0501275_000036 3300049772 Bacteria 13943
765 Ga0501226_000028 3300049853 Bacteria 88553
766 nmdc:mga03683_127151_c1 3300050489 Bacteria 1138
767 nmdc:mga00v17_45138_c1 3300050491 Bacteria 2661
768 nmdc:mga00v17_70159_c1 3300050491 Bacteria 2170
769 nmdc:mga0sz30_7332_c1 3300050516 Bacteria 4130
770 Ga0500618_001241 3300053125 Bacteria 11932
771 Ga0500573_0125367 3300053140 Bacteria 1426

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036712 Ga0316584_0018008 Ga0316584_0018008_23_586 187
2 3300042122 Ga0450920_022524 Ga0450920_022524_84_878 220
3 3300042876 Ga0451577_0009916 Ga0451577_0009916_4407_5102 223
4 3300005338 Ga0068868_100284927 Ga0068868_1002849272 224
5 3300005543 Ga0070672_100079711 Ga0070672_1000797112 224
6 3300005618 Ga0068864_100353634 Ga0068864_1003536342 224
7 3300026095 Ga0207676_10588862 Ga0207676_105888622 224
8 3300049772 Ga0501275_000036 Ga0501275_000036_4880_5590 224
9 iso_pu_bacteria 2894510363 2894515149 224
10 3300032168 Ga0316593_10088147 Ga0316593_100881471 225
11 3300046474 Ga0495605_0000429 Ga0495605_0000429_15_692 225
12 3300046474 Ga0495605_0009525 Ga0495605_0009525_4765_5442 225
13 3300046474 Ga0495605_0018078 Ga0495605_0018078_3093_3770 225
14 3300046491 Ga0495584_0020919 Ga0495584_0020919_10_687 225
15 3300046501 Ga0495607_0000379 Ga0495607_0000379_45089_45766 225
16 3300046501 Ga0495607_0007164 Ga0495607_0007164_19_696 225
17 3300046501 Ga0495607_0026447 Ga0495607_0026447_2899_3576 225
18 3300046519 Ga0495632_0000608 Ga0495632_0000608_32443_33120 225
19 3300046520 Ga0495637_0005206 Ga0495637_0005206_11_688 225
20 3300046524 Ga0495648_0134382 Ga0495648_0134382_17_694 225
21 3300046538 Ga0495609_0089699 Ga0495609_0089699_639_1316 225
22 3300046542 Ga0495597_0023634 Ga0495597_0023634_1050_1727 225
23 3300047323 Ga0495683_0002437 Ga0495683_0002437_21_698 225
24 3300049571 Ga0501034_0911783 Ga0501034_0911783_65_742 225
25 3300049588 Ga0501072_0465159 Ga0501072_0465159_249_944 225
26 3300049742 Ga0501080_0473695 Ga0501080_0473695_299_994 225
27 3300050489 nmdc:mga03683_127151_c1 nmdc:mga03683_127151_c1_10_687 225
28 3300031727 Ga0316576_10084591 Ga0316576_100845913 226
29 3300035398 Ga0316574_0011291 Ga0316574_0011291_3639_4331 226
30 3300031727 Ga0316576_10009311 Ga0316576_100093113 227
31 3300031728 Ga0316578_10021793 Ga0316578_100217934 227
32 iso_pu_bacteria 8011350971 8011356408 227
33 3300003794 Ga0055531_10025010 Ga0055531_100250102 228
34 3300005331 Ga0070670_100151425 Ga0070670_1001514252 228
35 3300005353 Ga0070669_100016636 Ga0070669_1000166365 228
36 3300005354 Ga0070675_100399340 Ga0070675_1003993402 228
37 3300005355 Ga0070671_100264932 Ga0070671_1002649322 228
38 3300005356 Ga0070674_100016977 Ga0070674_1000169773 228
39 3300005367 Ga0070667_100125540 Ga0070667_1001255402 228
40 3300005459 Ga0068867_100067897 Ga0068867_1000678972 228
41 3300005543 Ga0070672_100046923 Ga0070672_1000469234 228
42 3300009176 Ga0105242_10471402 Ga0105242_104714021 228
43 3300013308 Ga0157375_10380650 Ga0157375_103806502 228
44 3300025304 Ga0209257_1000623 Ga0209257_100062358 228
45 3300025923 Ga0207681_10048593 Ga0207681_100485933 228
46 3300025925 Ga0207650_10116440 Ga0207650_101164402 228
47 3300025926 Ga0207659_10164787 Ga0207659_101647872 228
48 3300025940 Ga0207691_10009671 Ga0207691_100096717 228
49 3300026089 Ga0207648_10090819 Ga0207648_100908192 228
50 3300036647 Ga0316582_0146556 Ga0316582_0146556_744_1433 228
51 3300036647 Ga0316582_0428045 Ga0316582_0428045_52_765 228
52 3300042876 Ga0451577_0000105 Ga0451577_0000105_5902_6594 228
53 3300044712 Ga0453684_0003537 Ga0453684_0003537_28331_29023 228
54 3300044712 Ga0453684_0055976 Ga0453684_0055976_3799_4491 228
55 3300044712 Ga0453684_0195291 Ga0453684_0195291_511_1203 228
56 3300046537 Ga0495598_0002453 Ga0495598_0002453_1466_2164 228
57 iso_pu_bacteria 8001522603 8001523344 228
58 3300035398 Ga0316574_0017186 Ga0316574_0017186_775_1512 229
59 3300035398 Ga0316574_0195055 Ga0316574_0195055_471_1199 229
60 3300036647 Ga0316582_0043354 Ga0316582_0043354_1528_2265 229
61 3300045051 Ga0451576_0000217 Ga0451576_0000217_60843_61532 229
62 iso_pu_bacteria 2894414249 2894417246 229
63 3300013102 Ga0157371_10097294 Ga0157371_100972942 230
64 3300031239 Ga0265328_10132599 Ga0265328_101325992 230
65 3300031251 Ga0265327_10000712 Ga0265327_1000071217 230
66 3300031251 Ga0265327_10001471 Ga0265327_1000147113 230
67 3300031251 Ga0265327_10284167 Ga0265327_102841671 230
68 3300031344 Ga0265316_10000461 Ga0265316_100004618 230
69 3300031727 Ga0316576_10218804 Ga0316576_102188042 230
70 3300031728 Ga0316578_10055792 Ga0316578_100557924 230
71 3300031728 Ga0316578_10120483 Ga0316578_101204832 230
72 3300031733 Ga0316577_10039458 Ga0316577_100394583 230
73 3300031733 Ga0316577_10296749 Ga0316577_102967491 230
74 3300032137 Ga0316585_10012662 Ga0316585_100126623 230
75 3300032139 Ga0316580_10018135 Ga0316580_100181353 230
76 3300035398 Ga0316574_0001096 Ga0316574_0001096_5321_6013 230
77 3300036647 Ga0316582_0048330 Ga0316582_0048330_30_722 230
78 3300036647 Ga0316582_0119519 Ga0316582_0119519_530_1222 230
79 3300036712 Ga0316584_0011224 Ga0316584_0011224_5257_5949 230
80 3300036712 Ga0316584_0460790 Ga0316584_0460790_175_867 230
81 3300042876 Ga0451577_0253980 Ga0451577_0253980_142_834 230
82 3300049569 Ga0501032_0102910 Ga0501032_0102910_672_1379 230
83 3300049586 Ga0501070_0036722 Ga0501070_0036722_831_1538 230
84 iso_pu_bacteria 2510065053 2510283551 230
85 iso_pu_bacteria 2510065055 2510292621 230
86 iso_pu_bacteria 2510065058 2510311713 230
87 iso_pu_bacteria 2511231004 2511254626 230
88 iso_pu_bacteria 2511231006 2511266576 230
89 iso_pu_bacteria 2511231007 2511270707 230
90 iso_pu_bacteria 2511231008 2511277288 230
91 iso_pu_bacteria 2511231010 2511287314 230
92 iso_pu_bacteria 2511231011 2511294727 230
93 iso_pu_bacteria 2511231012 2511303398 230
94 iso_pu_bacteria 2511231014 2511312798 230
95 iso_pu_bacteria 2511231015 2511320269 230
96 iso_pu_bacteria 2511231016 2511328767 230
97 iso_pu_bacteria 2511231017 2511331717 230
98 iso_pu_bacteria 2511231018 2511340701 230
99 iso_pu_bacteria 2511231019 2511343871 230
100 iso_pu_bacteria 2511231020 2511350216 230
101 iso_pu_bacteria 2511231021 2511358543 230
102 iso_pu_bacteria 2511231022 2511362853 230
103 iso_pu_bacteria 2511231023 2511369823 230
104 iso_pu_bacteria 2511231031 2511416239 230
105 iso_pu_bacteria 2512047018 2512328473 230
106 iso_pu_bacteria 2554235132 2554816809 230
107 iso_pu_bacteria 2554235231 2555249255 230
108 iso_pu_bacteria 2554235341 2555671454 230
109 iso_pu_bacteria 2582580891 2583793916 230
110 iso_pu_bacteria 2597489887 2597859538 230
111 iso_pu_bacteria 2597489888 2597865185 230
112 iso_pu_bacteria 2597489889 2597871048 230
113 iso_pu_bacteria 2599185160 2599354389 230
114 iso_pu_bacteria 2599185161 2599359897 230
115 iso_pu_bacteria 2599185162 2599366219 230
116 iso_pu_bacteria 2599185163 2599373009 230
117 iso_pu_bacteria 2599185164 2599379497 230
118 iso_pu_bacteria 2599185165 2599385525 230
119 iso_pu_bacteria 2599185166 2599391868 230
120 iso_pu_bacteria 2599185167 2599400316 230
121 iso_pu_bacteria 2599185168 2599403634 230
122 iso_pu_bacteria 2599185179 2599451353 230
123 iso_pu_bacteria 2599185181 2599461223 230
124 iso_pu_bacteria 2599185182 2599469765 230
125 iso_pu_bacteria 2599185185 2599482368 230
126 iso_pu_bacteria 2599185186 2599490243 230
127 iso_pu_bacteria 2599185188 2599503361 230
128 iso_pu_bacteria 2599185189 2599508667 230
129 iso_pu_bacteria 2599185190 2599512527 230
130 iso_pu_bacteria 2599185191 2599519876 230
131 iso_pu_bacteria 2599185212 2599614988 230
132 iso_pu_bacteria 2599185248 2599771160 230
133 iso_pu_bacteria 2599185257 2599803912 230
134 iso_pu_bacteria 2599185288 2599878527 230
135 iso_pu_bacteria 2599185289 2599886309 230
136 iso_pu_bacteria 2599185290 2599891203 230
137 iso_pu_bacteria 2599185291 2599898023 230
138 iso_pu_bacteria 2599185300 2599934756 230
139 iso_pu_bacteria 2599185302 2599943915 230
140 iso_pu_bacteria 2599185303 2599947730 230
141 iso_pu_bacteria 2599185304 2599955871 230
142 iso_pu_bacteria 2599185305 2599960336 230
143 iso_pu_bacteria 2599185306 2599967896 230
144 iso_pu_bacteria 2599185307 2599972861 230
145 iso_pu_bacteria 2599185308 2599979102 230
146 iso_pu_bacteria 2599185309 2599986588 230
147 iso_pu_bacteria 2599185310 2599989597 230
148 iso_pu_bacteria 2599185311 2599997629 230
149 iso_pu_bacteria 2599185312 2600000056 230
150 iso_pu_bacteria 2599185313 2600005009 230
151 iso_pu_bacteria 2599185314 2600013061 230
152 iso_pu_bacteria 2599185315 2600017837 230
153 iso_pu_bacteria 2599185316 2600024728 230
154 iso_pu_bacteria 2599185317 2600030562 230
155 iso_pu_bacteria 2599185318 2600038175 230
156 iso_pu_bacteria 2599185319 2600044489 230
157 iso_pu_bacteria 2599185320 2600048312 230
158 iso_pu_bacteria 2599185321 2600055399 230
159 iso_pu_bacteria 2599185322 2600061517 230
160 iso_pu_bacteria 2599185323 2600066191 230
161 iso_pu_bacteria 2599185324 2600070080 230
162 iso_pu_bacteria 2599185325 2600077971 230
163 iso_pu_bacteria 2599185356 2600213838 230
164 iso_pu_bacteria 2600254930 2600360006 230
165 iso_pu_bacteria 2600254931 2600364442 230
166 iso_pu_bacteria 2600254954 2600446444 230
167 iso_pu_bacteria 2600255296 2601689558 230
168 iso_pu_bacteria 2600255313 2601774006 230
169 iso_pu_bacteria 2600255318 2601795547 230
170 iso_pu_bacteria 2600255389 2602010493 230
171 iso_pu_bacteria 2603880185 2606075617 230
172 iso_pu_bacteria 2603880199 2606128472 230
173 iso_pu_bacteria 2606217733 2608379893 230
174 iso_pu_bacteria 2619619299 2621298257 230
175 iso_pu_bacteria 2623620443 2624479484 230
176 iso_pu_bacteria 2623620446 2624493520 230
177 iso_pu_bacteria 2643221565 2643841709 230
178 iso_pu_bacteria 2643221571 2643869302 230
179 iso_pu_bacteria 2643221589 2643952617 230
180 iso_pu_bacteria 2643221602 2644022379 230
181 iso_pu_bacteria 2643221633 2644188585 230
182 iso_pu_bacteria 2643221650 2644281879 230
183 iso_pu_bacteria 2643221713 2644622018 230
184 iso_pu_bacteria 2651869719 2652544079 230
185 iso_pu_bacteria 2667528170 2671090117 230
186 iso_pu_bacteria 2667528171 2671096970 230
187 iso_pu_bacteria 2667528176 2671125243 230
188 iso_pu_bacteria 2671180172 2671770519 230
189 iso_pu_bacteria 2675903420 2677899968 230
190 iso_pu_bacteria 2675903515 2678264747 230
191 iso_pu_bacteria 2713897148 2715753877 230
192 iso_pu_bacteria 2713897149 2715757751 230
193 iso_pu_bacteria 2718217725 2718633332 230
194 iso_pu_bacteria 2721755607 2723249938 230
195 iso_pu_bacteria 2728369097 2729146926 230
196 iso_pu_bacteria 2738541265 2738671358 230
197 iso_pu_bacteria 2738541271 2738689151 230
198 iso_pu_bacteria 2738541282 2738749752 230
199 iso_pu_bacteria 2738541294 2738808388 230
200 iso_pu_bacteria 2738541303 2738858792 230
201 iso_pu_bacteria 2738541309 2738895748 230
202 iso_pu_bacteria 2738543004 2739201281 230
203 iso_pu_bacteria 2738543015 2739261155 230
204 iso_pu_bacteria 2738543016 2739264538 230
205 iso_pu_bacteria 2738543020 2739286348 230
206 iso_pu_bacteria 2738543021 2739291661 230
207 iso_pu_bacteria 2738543025 2739316714 230
208 iso_pu_bacteria 2740892503 2743739069 230
209 iso_pu_bacteria 2744054620 2745005201 230
210 iso_pu_bacteria 2773857670 2774121295 230
211 iso_pu_bacteria 2773857672 2774128677 230
212 iso_pu_bacteria 2773857673 2774137641 230
213 iso_pu_bacteria 2784132063 2784265606 230
214 iso_pu_bacteria 2784132072 2784317411 230
215 iso_pu_bacteria 2791355520 2794594982 230
216 iso_pu_bacteria 2806310737 2807407091 230
217 iso_pu_bacteria 2806310745 2807455422 230
218 iso_pu_bacteria 2808606361 2808858406 230
219 iso_pu_bacteria 2808606373 2808907135 230
220 iso_pu_bacteria 2808606376 2808926264 230
221 iso_pu_bacteria 2808606377 2808927413 230
222 iso_pu_bacteria 2808606378 2808938539 230
223 iso_pu_bacteria 2808606379 2808940797 230
224 iso_pu_bacteria 2808606380 2808948363 230
225 iso_pu_bacteria 2808606381 2808950048 230
226 iso_pu_bacteria 2808606382 2808961547 230
227 iso_pu_bacteria 2808606383 2808966891 230
228 iso_pu_bacteria 2808606385 2808977894 230
229 iso_pu_bacteria 2808606388 2808993374 230
230 iso_pu_bacteria 2808606389 2809001721 230
231 iso_pu_bacteria 2808606445 2809216419 230
232 iso_pu_bacteria 2811994881 2812371105 230
233 iso_pu_bacteria 2816332298 2817492598 230
234 iso_pu_bacteria 2818991456 2819654748 230
235 iso_pu_bacteria 2818991464 2819702063 230
236 iso_pu_bacteria 2823421272 2823423035 230
237 iso_pu_bacteria 2825651385 2825656364 230
238 iso_pu_bacteria 2826581358 2826585967 230
239 iso_pu_bacteria 2834028612 2834031810 230
240 iso_pu_bacteria 2842805378 2842805479 230
241 iso_pu_bacteria 2842815866 2842818998 230
242 iso_pu_bacteria 2842826826 2842827589 230
243 iso_pu_bacteria 2842832357 2842832645 230
244 iso_pu_bacteria 2842837860 2842841303 230
245 iso_pu_bacteria 2842843487 2842848269 230
246 iso_pu_bacteria 2842849001 2842853845 230
247 iso_pu_bacteria 2842854478 2842856751 230
248 iso_pu_bacteria 2844665904 2844671977 230
249 iso_pu_bacteria 2852612431 2852613034 230
250 iso_pu_bacteria 2852657418 2852658967 230
251 iso_pu_bacteria 2852667396 2852669231 230
252 iso_pu_bacteria 2860339153 2860339972 230
253 iso_pu_bacteria 2860867994 2860871688 230
254 iso_pu_bacteria 2878029506 2878031487 230
255 iso_pu_bacteria 2880230671 2880232357 230
256 iso_pu_bacteria 2904518522 2904521752 230
257 iso_pu_bacteria 2904550169 2904553150 230
258 iso_pu_bacteria 2908446538 2908451097 230
259 iso_pu_bacteria 2912963787 2912967760 230
260 iso_pu_bacteria 2913036834 2913041356 230
261 iso_pu_bacteria 2917070673 2917075322 230
262 iso_pu_bacteria 2917832318 2917837286 230
263 iso_pu_bacteria 2919063839 2919064042 230
264 iso_pu_bacteria 2919125081 2919126713 230
265 iso_pu_bacteria 2919385768 2919386451 230
266 iso_pu_bacteria 2919456309 2919457066 230
267 iso_pu_bacteria 2919481497 2919484277 230
268 iso_pu_bacteria 2919487758 2919491267 230
269 iso_pu_bacteria 2919501602 2919505573 230
270 iso_pu_bacteria 2919697872 2919702822 230
271 iso_pu_bacteria 2923153595 2923158150 230
272 iso_pu_bacteria 2923519811 2923525213 230
273 iso_pu_bacteria 2923586266 2923590215 230
274 iso_pu_bacteria 2926063275 2926067250 230
275 iso_pu_bacteria 2929144301 2929148681 230
276 iso_pu_bacteria 2929189879 2929193727 230
277 iso_pu_bacteria 2931369376 2931373887 230
278 iso_pu_bacteria 2931390751 2931395050 230
279 iso_pu_bacteria 2931396565 2931400136 230
280 iso_pu_bacteria 2935353572 2935356309 230
281 iso_pu_bacteria 2939636861 2939639693 230
282 iso_pu_bacteria 2939651529 2939655786 230
283 iso_pu_bacteria 2945928738 2945932253 230
284 iso_pu_bacteria 2945961074 2945961875 230
285 iso_pu_bacteria 2946006987 2946008446 230
286 iso_pu_bacteria 2946027586 2946032193 230
287 iso_pu_bacteria 2947233263 2947239027 230
288 iso_pu_bacteria 2969304461 2969306270 230
289 iso_pu_bacteria 2974298342 2974299194 230
290 iso_pu_bacteria 2984286254 2984288027 230
291 iso_pu_bacteria 2984499530 2984501513 230
292 iso_pu_bacteria 2984504281 2984505088 230
293 iso_pu_bacteria 2988728565 2988730264 230
294 iso_pu_bacteria 2990196909 2990199962 230
295 iso_pu_bacteria 2998139840 2998141665 230
296 iso_pu_bacteria 3007252601 3007256340 230
297 iso_pu_bacteria 3007315729 3007319444 230
298 iso_pu_bacteria 3007395558 3007397451 230
299 iso_pu_bacteria 3007419365 3007424617 230
300 iso_pu_bacteria 3007511990 3007513060 230
301 iso_pu_bacteria 3007614139 3007615879 230
302 iso_pu_bacteria 3007619802 3007621914 230
303 iso_pu_bacteria 3007718800 3007722466 230
304 iso_pu_bacteria 3007861166 3007863096 230
305 iso_pu_bacteria 3007866637 3007870604 230
306 iso_pu_bacteria 3007872151 3007874118 230
307 iso_pu_bacteria 637000220 637321774 230
308 iso_pu_bacteria 8015687852 8015692246 230
309 iso_pu_bacteria 8016728285 8016733056 230
310 iso_pu_bacteria 8019769354 8019772969 230
311 iso_pu_bacteria 8019775933 8019780297 230
312 iso_pu_bacteria 8029995093 8029999091 230
313 iso_pu_bacteria 8034962539 8034964036 230
314 iso_pu_bacteria 8054285046 8054285782 230
315 iso_pu_bacteria 8054347763 8054350689 230
316 iso_pu_bacteria 8054503363 8054507559 230
317 iso_pu_bacteria 8055770955 8055775456 230
318 iso_pu_bacteria 8055817908 8055822501 230
319 iso_pu_bacteria 8055878733 8055881306 230
320 iso_pu_bacteria 8056115690 8056117602 230
321 iso_pu_bacteria 8056120720 8056122135 230
322 iso_pu_bacteria 8056125926 8056130138 230
323 iso_pu_bacteria 8056131705 8056135954 230
324 iso_pu_bacteria 8056137416 8056138756 230
325 iso_pu_bacteria 8056143049 8056144708 230
326 iso_pu_bacteria 8056148874 8056153284 230
327 iso_pu_bacteria 8056155041 8056156183 230
328 iso_pu_bacteria 8056161164 8056162168 230
329 iso_pu_bacteria 8056166840 8056169326 230
330 iso_pu_bacteria 8056172158 8056175512 230
331 iso_pu_bacteria 8056177738 8056181191 230
332 iso_pu_bacteria 8056569372 8056573179 230
333 iso_pu_bacteria 8057798959 8057804271 230
334 3300005328 Ga0070676_10460007 Ga0070676_104600071 231
335 3300036647 Ga0316582_0010077 Ga0316582_0010077_1235_1939 231
336 3300036647 Ga0316582_0286983 Ga0316582_0286983_173_877 231
337 3300036712 Ga0316584_0049469 Ga0316584_0049469_2302_3006 231
338 3300042185 Ga0450909_007833 Ga0450909_007833_792_1493 231
339 3300047322 Ga0495680_0022050 Ga0495680_0022050_2735_3451 231
340 3300048918 Ga0496115_0014315 Ga0496115_0014315_3071_3781 231
341 3300048921 Ga0496118_0109414 Ga0496118_0109414_725_1420 231
342 3300048927 Ga0496124_0092665 Ga0496124_0092665_965_1660 231
343 3300049569 Ga0501032_0416826 Ga0501032_0416826_75_770 231
344 iso_pu_bacteria 2511231024 2511374185 231
345 iso_pu_bacteria 2765235841 2765585520 231
346 iso_pu_bacteria 2919155634 2919158738 231
347 iso_pu_bacteria 3007803356 3007803795 231
348 iso_pu_bacteria 8052494512 8052495849 231
349 iso_pu_bacteria 8054929484 8054929919 231
350 2124908027 MRS2a_Contig_22 MRS2a_00122070 234
351 2124908027 MRS2a_Contig_9332 MRS2a_00231020 234
352 3300002737 JGI25162J39368_1000401 JGI25162J39368_10004014 234
353 3300002737 JGI25162J39368_1000412 JGI25162J39368_100041234 234
354 3300002772 JGI25164J39214_1000282 JGI25164J39214_10002824 234
355 3300002772 JGI25164J39214_1000291 JGI25164J39214_10002914 234
356 3300003214 JGI25165J46597_1000520 JGI25165J46597_10005204 234
357 3300003214 JGI25165J46597_1000538 JGI25165J46597_10005384 234
358 3300003323 rootH1_10070704 rootH1_100707042 234
359 3300003323 rootH1_10317933 rootH1_103179332 234
360 3300003751 Ga0055538_1000027 Ga0055538_1000027195 234
361 3300003752 Ga0055539_1000036 Ga0055539_1000036195 234
362 3300003756 Ga0055533_1000046 Ga0055533_1000046195 234
363 3300003758 Ga0055532_1000032 Ga0055532_1000032195 234
364 3300003759 Ga0055525_1000672 Ga0055525_10006724 234
365 3300003759 Ga0055525_1003345 Ga0055525_10033452 234
366 3300003761 Ga0055535_1004737 Ga0055535_10047372 234
367 3300003781 Ga0055536_1000111 Ga0055536_100011112 234
368 3300003781 Ga0055536_1035132 Ga0055536_10351321 234
369 3300003791 Ga0055530_10000146 Ga0055530_1000014663 234
370 3300003791 Ga0055530_10000299 Ga0055530_1000029946 234
371 3300003791 Ga0055530_10000634 Ga0055530_100006344 234
372 3300003792 Ga0055540_1000289 Ga0055540_100028946 234
373 3300003792 Ga0055540_1000390 Ga0055540_10003904 234
374 3300003792 Ga0055540_1003473 Ga0055540_10034736 234
375 3300003794 Ga0055531_10000546 Ga0055531_1000054636 234
376 3300003794 Ga0055531_10000989 Ga0055531_1000098917 234
377 3300003841 Ga0055541_1000024 Ga0055541_1000024195 234
378 3300005288 Ga0065714_10000385 Ga0065714_100003854 234
379 3300005288 Ga0065714_10003231 Ga0065714_100032312 234
380 3300005288 Ga0065714_10005446 Ga0065714_100054465 234
381 3300005288 Ga0065714_10074902 Ga0065714_100749023 234
382 3300005288 Ga0065714_10082186 Ga0065714_100821861 234
383 3300005288 Ga0065714_10095966 Ga0065714_100959661 234
384 3300005289 Ga0065704_10014521 Ga0065704_100145212 234
385 3300005289 Ga0065704_10072317 Ga0065704_100723172 234
386 3300005289 Ga0065704_10132815 Ga0065704_101328151 234
387 3300005290 Ga0065712_10067771 Ga0065712_1006777143 234
388 3300005290 Ga0065712_10073907 Ga0065712_100739074 234
389 3300005331 Ga0070670_100002076 Ga0070670_1000020763 234
390 3300005344 Ga0070661_100000008 Ga0070661_10000000880 234
391 3300005353 Ga0070669_100011983 Ga0070669_1000119833 234
392 3300005353 Ga0070669_100119695 Ga0070669_1001196952 234
393 3300005356 Ga0070674_100160566 Ga0070674_1001605661 234
394 3300005457 Ga0070662_100000966 Ga0070662_10000096620 234
395 3300005539 Ga0068853_100092045 Ga0068853_1000920453 234
396 3300005548 Ga0070665_100067353 Ga0070665_1000673532 234
397 3300005548 Ga0070665_100155909 Ga0070665_1001559092 234
398 3300005564 Ga0070664_100000075 Ga0070664_10000007513 234
399 3300005564 Ga0070664_100404603 Ga0070664_1004046031 234
400 3300005578 Ga0068854_100035560 Ga0068854_1000355605 234
401 3300005834 Ga0068851_10000090 Ga0068851_1000009020 234
402 3300006051 Ga0075364_10069825 Ga0075364_100698252 234
403 3300006051 Ga0075364_10081757 Ga0075364_100817572 234
404 3300006051 Ga0075364_10140765 Ga0075364_101407652 234
405 3300006051 Ga0075364_10159829 Ga0075364_101598292 234
406 3300006058 Ga0075432_10010964 Ga0075432_100109644 234
407 3300006058 Ga0075432_10034024 Ga0075432_100340242 234
408 3300006058 Ga0075432_10073634 Ga0075432_100736342 234
409 3300006058 Ga0075432_10118770 Ga0075432_101187702 234
410 3300006058 Ga0075432_10153822 Ga0075432_101538221 234
411 3300006177 Ga0075362_10155142 Ga0075362_101551421 234
412 3300006177 Ga0075362_10185689 Ga0075362_101856891 234
413 3300006186 Ga0075369_10011644 Ga0075369_100116443 234
414 3300006186 Ga0075369_10052992 Ga0075369_100529922 234
415 3300006914 Ga0075436_100582101 Ga0075436_1005821011 234
416 3300006944 Ga0099823_1000246 Ga0099823_100024626 234
417 3300006944 Ga0099823_1036538 Ga0099823_10365382 234
418 3300006946 Ga0079104_1000433 Ga0079104_100043349 234
419 3300006946 Ga0079104_1000766 Ga0079104_100076619 234
420 3300006948 Ga0099826_10023740 Ga0099826_100237405 234
421 3300009011 Ga0105251_10000035 Ga0105251_1000003572 234
422 3300009011 Ga0105251_10000092 Ga0105251_1000009245 234
423 3300009011 Ga0105251_10002567 Ga0105251_1000256713 234
424 3300009011 Ga0105251_10002666 Ga0105251_1000266613 234
425 3300009011 Ga0105251_10014207 Ga0105251_100142072 234
426 3300009011 Ga0105251_10021031 Ga0105251_100210314 234
427 3300009011 Ga0105251_10022506 Ga0105251_100225064 234
428 3300009011 Ga0105251_10062640 Ga0105251_100626402 234
429 3300009036 Ga0105244_10001613 Ga0105244_100016134 234
430 3300009036 Ga0105244_10001867 Ga0105244_1000186711 234
431 3300009036 Ga0105244_10007007 Ga0105244_100070075 234
432 3300009036 Ga0105244_10013839 Ga0105244_100138395 234
433 3300009036 Ga0105244_10034710 Ga0105244_100347104 234
434 3300009036 Ga0105244_10040447 Ga0105244_100404472 234
435 3300009036 Ga0105244_10083576 Ga0105244_100835762 234
436 3300009036 Ga0105244_10118600 Ga0105244_101186002 234
437 3300009036 Ga0105244_10157423 Ga0105244_101574231 234
438 3300009092 Ga0105250_10000261 Ga0105250_100002614 234
439 3300009092 Ga0105250_10000495 Ga0105250_100004957 234
440 3300009092 Ga0105250_10014884 Ga0105250_100148841 234
441 3300009092 Ga0105250_10027737 Ga0105250_100277371 234
442 3300009092 Ga0105250_10122912 Ga0105250_101229121 234
443 3300009148 Ga0105243_10000582 Ga0105243_100005824 234
444 3300009148 Ga0105243_10004457 Ga0105243_100044579 234
445 3300009148 Ga0105243_10045999 Ga0105243_100459994 234
446 3300009148 Ga0105243_10062778 Ga0105243_100627782 234
447 3300009148 Ga0105243_10656453 Ga0105243_106564531 234
448 3300009176 Ga0105242_10002684 Ga0105242_100026844 234
449 3300009545 Ga0105237_10000856 Ga0105237_100008563 234
450 3300009553 Ga0105249_10035526 Ga0105249_100355265 234
451 3300011119 Ga0105246_10001063 Ga0105246_1000106314 234
452 3300011119 Ga0105246_10001690 Ga0105246_100016904 234
453 3300011119 Ga0105246_10010360 Ga0105246_100103604 234
454 3300011119 Ga0105246_10023990 Ga0105246_100239905 234
455 3300011119 Ga0105246_10061949 Ga0105246_100619493 234
456 3300011119 Ga0105246_10535276 Ga0105246_105352761 234
457 3300013100 Ga0157373_10002237 Ga0157373_1000223712 234
458 3300013100 Ga0157373_10008169 Ga0157373_100081692 234
459 3300013100 Ga0157373_10021495 Ga0157373_100214953 234
460 3300013100 Ga0157373_10094782 Ga0157373_100947822 234
461 3300013102 Ga0157371_10000301 Ga0157371_1000030110 234
462 3300013102 Ga0157371_10000923 Ga0157371_1000092333 234
463 3300013102 Ga0157371_10001330 Ga0157371_100013301 234
464 3300013102 Ga0157371_10015893 Ga0157371_100158936 234
465 3300013102 Ga0157371_10056663 Ga0157371_100566633 234
466 3300013102 Ga0157371_10335232 Ga0157371_103352321 234
467 3300013104 Ga0157370_10013075 Ga0157370_100130754 234
468 3300013104 Ga0157370_10053960 Ga0157370_100539604 234
469 3300013104 Ga0157370_10056165 Ga0157370_100561654 234
470 3300013104 Ga0157370_10067552 Ga0157370_100675525 234
471 3300013104 Ga0157370_10216011 Ga0157370_102160112 234
472 3300013104 Ga0157370_10718564 Ga0157370_107185641 234
473 3300013105 Ga0157369_10003346 Ga0157369_1000334611 234
474 3300013105 Ga0157369_10732493 Ga0157369_107324931 234
475 3300013306 Ga0163162_10001480 Ga0163162_1000148022 234
476 3300013306 Ga0163162_10107166 Ga0163162_101071661 234
477 3300013306 Ga0163162_10107641 Ga0163162_101076412 234
478 3300013307 Ga0157372_10001752 Ga0157372_1000175210 234
479 3300013307 Ga0157372_10046108 Ga0157372_100461085 234
480 3300013308 Ga0157375_10046234 Ga0157375_100462342 234
481 3300014497 Ga0182008_10005941 Ga0182008_100059414 234
482 3300014497 Ga0182008_10010767 Ga0182008_100107674 234
483 3300014497 Ga0182008_10014706 Ga0182008_100147064 234
484 3300014497 Ga0182008_10017069 Ga0182008_100170691 234
485 3300014497 Ga0182008_10022922 Ga0182008_100229222 234
486 3300015261 Ga0182006_1000844 Ga0182006_100084422 234
487 3300015261 Ga0182006_1006672 Ga0182006_10066724 234
488 3300015261 Ga0182006_1007773 Ga0182006_10077732 234
489 3300015261 Ga0182006_1018323 Ga0182006_10183233 234
490 3300015261 Ga0182006_1029395 Ga0182006_10293951 234
491 3300015261 Ga0182006_1031524 Ga0182006_10315243 234
492 3300015261 Ga0182006_1050415 Ga0182006_10504151 234
493 3300015262 Ga0182007_10003640 Ga0182007_100036405 234
494 3300015265 Ga0182005_1000309 Ga0182005_10003094 234
495 3300015265 Ga0182005_1026069 Ga0182005_10260692 234
496 3300017792 Ga0163161_10115517 Ga0163161_101155171 234
497 3300017792 Ga0163161_10220558 Ga0163161_102205583 234
498 3300025206 Ga0209435_101639 Ga0209435_1016392 234
499 3300025207 Ga0209760_100028 Ga0209760_10002836 234
500 3300025207 Ga0209760_100163 Ga0209760_10016334 234
501 3300025224 Ga0209784_100017 Ga0209784_100017254 234
502 3300025225 Ga0209566_100014 Ga0209566_100014254 234
503 3300025226 Ga0209674_100028 Ga0209674_100028254 234
504 3300025229 Ga0209147_100038 Ga0209147_100038109 234
505 3300025230 Ga0209563_100032 Ga0209563_100032254 234
506 3300025230 Ga0209563_101192 Ga0209563_1011922 234
507 3300025231 Ga0207427_100007 Ga0207427_10000734 234
508 3300025231 Ga0207427_100008 Ga0207427_100008136 234
509 3300025233 Ga0209437_100006 Ga0209437_100006300 234
510 3300025233 Ga0209437_100014 Ga0209437_100014575 234
511 3300025233 Ga0209437_107564 Ga0209437_1075641 234
512 3300025242 Ga0209258_100197 Ga0209258_10019734 234
513 3300025245 Ga0207425_1024826 Ga0207425_10248261 234
514 3300025246 Ga0209646_1000171 Ga0209646_100017145 234
515 3300025253 Ga0209677_100018 Ga0209677_100018254 234
516 3300025256 Ga0209759_1005069 Ga0209759_10050694 234
517 3300025261 Ga0209233_1000008 Ga0209233_1000008575 234
518 3300025261 Ga0209233_1000086 Ga0209233_100008634 234
519 3300025291 Ga0209675_1012545 Ga0209675_10125452 234
520 3300025292 Ga0209676_1000006 Ga0209676_1000006282 234
521 3300025292 Ga0209676_1000016 Ga0209676_1000016584 234
522 3300025292 Ga0209676_1000033 Ga0209676_1000033402 234
523 3300025292 Ga0209676_1000973 Ga0209676_10009734 234
524 3300025292 Ga0209676_1002053 Ga0209676_10020532 234
525 3300025292 Ga0209676_1008338 Ga0209676_10083385 234
526 3300025298 Ga0209050_1000070 Ga0209050_1000070237 234
527 3300025298 Ga0209050_1000399 Ga0209050_100039935 234
528 3300025298 Ga0209050_1000477 Ga0209050_100047727 234
529 3300025303 Ga0209051_1000043 Ga0209051_100004346 234
530 3300025303 Ga0209051_1000086 Ga0209051_100008670 234
531 3300025303 Ga0209051_1000106 Ga0209051_1000106108 234
532 3300025303 Ga0209051_1005825 Ga0209051_10058254 234
533 3300025304 Ga0209257_1000604 Ga0209257_100060446 234
534 3300025321 Ga0207656_10000066 Ga0207656_1000006628 234
535 3300025711 Ga0207696_1000025 Ga0207696_1000025343 234
536 3300025711 Ga0207696_1000034 Ga0207696_100003494 234
537 3300025711 Ga0207696_1000043 Ga0207696_1000043191 234
538 3300025711 Ga0207696_1000144 Ga0207696_100014434 234
539 3300025711 Ga0207696_1001836 Ga0207696_10018363 234
540 3300025711 Ga0207696_1005655 Ga0207696_10056552 234
541 3300025728 Ga0207655_1000095 Ga0207655_100009597 234
542 3300025728 Ga0207655_1000113 Ga0207655_1000113136 234
543 3300025728 Ga0207655_1000448 Ga0207655_100044810 234
544 3300025728 Ga0207655_1000501 Ga0207655_100050146 234
545 3300025728 Ga0207655_1000610 Ga0207655_100061037 234
546 3300025728 Ga0207655_1001799 Ga0207655_100179912 234
547 3300025728 Ga0207655_1005111 Ga0207655_10051119 234
548 3300025728 Ga0207655_1005591 Ga0207655_10055917 234
549 3300025728 Ga0207655_1008966 Ga0207655_10089665 234
550 3300025728 Ga0207655_1026020 Ga0207655_10260203 234
551 3300025728 Ga0207655_1068839 Ga0207655_10688391 234
552 3300025728 Ga0207655_1074944 Ga0207655_10749442 234
553 3300025728 Ga0207655_1081629 Ga0207655_10816291 234
554 3300025735 Ga0207713_1000014 Ga0207713_1000014337 234
555 3300025735 Ga0207713_1000074 Ga0207713_100007448 234
556 3300025735 Ga0207713_1000471 Ga0207713_100047110 234
557 3300025735 Ga0207713_1000618 Ga0207713_100061821 234
558 3300025735 Ga0207713_1000900 Ga0207713_10009005 234
559 3300025735 Ga0207713_1003229 Ga0207713_10032299 234
560 3300025735 Ga0207713_1003963 Ga0207713_10039635 234
561 3300025735 Ga0207713_1008642 Ga0207713_10086424 234
562 3300025735 Ga0207713_1011158 Ga0207713_10111581 234
563 3300025735 Ga0207713_1014993 Ga0207713_10149935 234
564 3300025735 Ga0207713_1016408 Ga0207713_10164081 234
565 3300025735 Ga0207713_1017297 Ga0207713_10172973 234
566 3300025735 Ga0207713_1017979 Ga0207713_10179793 234
567 3300025735 Ga0207713_1019013 Ga0207713_10190134 234
568 3300025914 Ga0207671_10000035 Ga0207671_1000003598 234
569 3300025920 Ga0207649_10000017 Ga0207649_1000001780 234
570 3300025923 Ga0207681_10000601 Ga0207681_1000060110 234
571 3300025923 Ga0207681_10007857 Ga0207681_100078572 234
572 3300025925 Ga0207650_10000212 Ga0207650_1000021260 234
573 3300025925 Ga0207650_10006176 Ga0207650_100061763 234
574 3300025933 Ga0207706_10000796 Ga0207706_100007965 234
575 3300025934 Ga0207686_10011981 Ga0207686_100119814 234
576 3300025935 Ga0207709_10000053 Ga0207709_10000053180 234
577 3300025935 Ga0207709_10011611 Ga0207709_100116113 234
578 3300025935 Ga0207709_10066666 Ga0207709_100666662 234
579 3300025945 Ga0207679_10000005 Ga0207679_10000005175 234
580 3300025961 Ga0207712_10128195 Ga0207712_101281953 234
581 3300026041 Ga0207639_10086856 Ga0207639_100868563 234
582 3300027111 Ga0209281_1000010 Ga0209281_1000010500 234
583 3300027111 Ga0209281_1000331 Ga0209281_100033118 234
584 3300027111 Ga0209281_1010855 Ga0209281_10108552 234
585 3300027296 Ga0209389_1000031 Ga0209389_1000031106 234
586 3300027312 Ga0209371_1001358 Ga0209371_100135812 234
587 3300027312 Ga0209371_1005354 Ga0209371_10053546 234
588 3300027312 Ga0209371_1009851 Ga0209371_10098513 234
589 3300027424 Ga0209984_1000700 Ga0209984_10007004 234
590 3300027543 Ga0209999_1008843 Ga0209999_10088433 234
591 3300027543 Ga0209999_1025509 Ga0209999_10255091 234
592 3300027665 Ga0209983_1002353 Ga0209983_10023533 234
593 3300027682 Ga0209971_1000648 Ga0209971_100064810 234
594 3300027876 Ga0209974_10020136 Ga0209974_100201364 234
595 3300027876 Ga0209974_10033019 Ga0209974_100330192 234
596 3300027907 Ga0207428_10049694 Ga0207428_100496944 234
597 3300027907 Ga0207428_10065873 Ga0207428_100658732 234
598 3300027907 Ga0207428_10579528 Ga0207428_105795281 234
599 3300028379 Ga0268266_10139563 Ga0268266_101395633 234
600 3300028379 Ga0268266_10143672 Ga0268266_101436722 234
601 3300030500 Ga0268256_1001168 Ga0268256_100116812 234
602 3300030500 Ga0268256_1005256 Ga0268256_10052566 234
603 3300030733 Ga0314311_1178492 Ga0314311_11784923 234
604 3300030735 Ga0316178_1127053 Ga0316178_112705330 234
605 3300030744 Ga0316181_1093196 Ga0316181_10931961 234
606 3300031344 Ga0265316_10458131 Ga0265316_104581311 234
607 3300031548 Ga0307408_100000042 Ga0307408_10000004268 234
608 3300031548 Ga0307408_100001335 Ga0307408_1000013354 234
609 3300031548 Ga0307408_100031564 Ga0307408_1000315641 234
610 3300031548 Ga0307408_100534977 Ga0307408_1005349771 234
611 3300031548 Ga0307408_100786731 Ga0307408_1007867311 234
612 3300031824 Ga0307413_10018772 Ga0307413_100187724 234
613 3300031824 Ga0307413_10137062 Ga0307413_101370622 234
614 3300031901 Ga0307406_10024656 Ga0307406_100246561 234
615 3300031911 Ga0307412_10026682 Ga0307412_100266821 234
616 3300031911 Ga0307412_10026786 Ga0307412_100267861 234
617 3300031911 Ga0307412_10149055 Ga0307412_101490551 234
618 3300031911 Ga0307412_10412625 Ga0307412_104126251 234
619 3300031995 Ga0307409_100117900 Ga0307409_1001179002 234
620 3300032004 Ga0307414_10018889 Ga0307414_100188892 234
621 3300032004 Ga0307414_10396483 Ga0307414_103964831 234
622 3300032005 Ga0307411_10031489 Ga0307411_100314891 234
623 3300032005 Ga0307411_10061793 Ga0307411_100617933 234
624 3300032005 Ga0307411_10123255 Ga0307411_101232552 234
625 3300033180 Ga0307510_10025016 Ga0307510_100250163 234
626 3300038705 Ga0237819_02422 Ga0237819_02422_1065_1769 234
627 3300041404 Ga0439436_0000465 Ga0439436_0000465_6749_7453 234
628 3300041405 Ga0439438_000136 Ga0439438_000136_32373_33077 234
629 3300041405 Ga0439438_002815 Ga0439438_002815_4718_5422 234
630 3300041405 Ga0439438_005069 Ga0439438_005069_3906_4610 234
631 3300041405 Ga0439438_010637 Ga0439438_010637_816_1520 234
632 3300041405 Ga0439438_013860 Ga0439438_013860_1639_2343 234
633 3300041407 Ga0439447_001185 Ga0439447_001185_5936_6640 234
634 3300041407 Ga0439447_002289 Ga0439447_002289_1833_2537 234
635 3300041407 Ga0439447_002435 Ga0439447_002435_2826_3530 234
636 3300041407 Ga0439447_018238 Ga0439447_018238_1007_1711 234
637 3300041411 Ga0439466_0000828 Ga0439466_0000828_3327_4031 234
638 3300041411 Ga0439466_0001731 Ga0439466_0001731_2861_3565 234
639 3300041411 Ga0439466_0005326 Ga0439466_0005326_2508_3212 234
640 3300041411 Ga0439466_0005858 Ga0439466_0005858_251_955 234
641 3300041411 Ga0439466_0007222 Ga0439466_0007222_2855_3559 234
642 3300041411 Ga0439466_0007532 Ga0439466_0007532_536_1240 234
643 3300041411 Ga0439466_0023166 Ga0439466_0023166_1282_1986 234
644 3300041486 Ga0451807_0563555 Ga0451807_0563555_166_870 234
645 3300042000 Ga0439437_001430 Ga0439437_001430_1692_2396 234
646 3300042006 Ga0439432_000121 Ga0439432_000121_2776_3480 234
647 3300042006 Ga0439432_004055 Ga0439432_004055_1763_2467 234
648 3300042006 Ga0439432_005544 Ga0439432_005544_2632_3339 234
649 3300042006 Ga0439432_008146 Ga0439432_008146_178_882 234
650 3300042006 Ga0439432_030688 Ga0439432_030688_877_1581 234
651 3300042006 Ga0439432_077276 Ga0439432_077276_185_889 234
652 3300042009 Ga0439451_008221 Ga0439451_008221_418_1122 234
653 3300042009 Ga0439451_018163 Ga0439451_018163_76_780 234
654 3300042010 Ga0439452_000244 Ga0439452_000244_3894_4598 234
655 3300042010 Ga0439452_001133 Ga0439452_001133_8161_8865 234
656 3300042010 Ga0439452_002100 Ga0439452_002100_2870_3574 234
657 3300042010 Ga0439452_006702 Ga0439452_006702_2769_3473 234
658 3300042010 Ga0439452_008746 Ga0439452_008746_2249_2953 234
659 3300042010 Ga0439452_011698 Ga0439452_011698_177_881 234
660 3300042010 Ga0439452_014917 Ga0439452_014917_20_724 234
661 3300042013 Ga0439456_000089 Ga0439456_000089_28208_28912 234
662 3300042013 Ga0439456_005136 Ga0439456_005136_1919_2623 234
663 3300042013 Ga0439456_005403 Ga0439456_005403_1504_2208 234
664 3300042013 Ga0439456_008178 Ga0439456_008178_532_1236 234
665 3300042013 Ga0439456_019789 Ga0439456_019789_655_1359 234
666 3300042016 Ga0439463_000778 Ga0439463_000778_2859_3563 234
667 3300042016 Ga0439463_005465 Ga0439463_005465_1207_1911 234
668 3300042115 Ga0450911_000017 Ga0450911_000017_23439_24143 234
669 3300042115 Ga0450911_000237 Ga0450911_000237_2855_3559 234
670 3300042121 Ga0450919_005421 Ga0450919_005421_495_1199 234
671 3300042124 Ga0450922_003536 Ga0450922_003536_654_1358 234
672 3300042125 Ga0450923_000184 Ga0450923_000184_1715_2419 234
673 3300042136 Ga0450900_000340 Ga0450900_000340_2057_2764 234
674 3300042137 Ga0450902_000757 Ga0450902_000757_3188_3892 234
675 3300042137 Ga0450902_002353 Ga0450902_002353_766_1470 234
676 3300042137 Ga0450902_014286 Ga0450902_014286_143_847 234
677 3300042139 Ga0450904_000260 Ga0450904_000260_7989_8693 234
678 3300042139 Ga0450904_002736 Ga0450904_002736_122_826 234
679 3300042142 Ga0450905_005405 Ga0450905_005405_921_1625 234
680 3300042142 Ga0450905_028655 Ga0450905_028655_107_814 234
681 3300042142 Ga0450905_029684 Ga0450905_029684_61_765 234
682 3300042145 Ga0450906_002445 Ga0450906_002445_2845_3549 234
683 3300042146 Ga0450907_000076 Ga0450907_000076_2888_3592 234
684 3300042146 Ga0450907_001352 Ga0450907_001352_2702_3406 234
685 3300042146 Ga0450907_010405 Ga0450907_010405_578_1282 234
686 3300042147 Ga0450910_000679 Ga0450910_000679_1800_2504 234
687 3300042156 Ga0439446_0000604 Ga0439446_0000604_3884_4588 234
688 3300042156 Ga0439446_0003340 Ga0439446_0003340_3187_3891 234
689 3300042156 Ga0439446_0004459 Ga0439446_0004459_774_1478 234
690 3300042156 Ga0439446_0015788 Ga0439446_0015788_255_959 234
691 3300042156 Ga0439446_0023590 Ga0439446_0023590_205_909 234
692 3300042184 Ga0450908_000501 Ga0450908_000501_3953_4657 234
693 3300042185 Ga0450909_000096 Ga0450909_000096_4942_5646 234
694 3300042435 Ga0439434_0000804 Ga0439434_0000804_5486_6190 234
695 3300042435 Ga0439434_0014404 Ga0439434_0014404_1614_2318 234
696 3300042435 Ga0439434_0016910 Ga0439434_0016910_702_1406 234
697 3300042438 Ga0439459_0022850 Ga0439459_0022850_312_1016 234
698 3300042439 Ga0439464_0003363 Ga0439464_0003363_1819_2523 234
699 3300042439 Ga0439464_0004738 Ga0439464_0004738_1295_1999 234
700 3300042439 Ga0439464_0009195 Ga0439464_0009195_130_834 234
701 3300042461 Ga0439460_0003586 Ga0439460_0003586_63_767 234
702 3300042461 Ga0439460_0007704 Ga0439460_0007704_1727_2431 234
703 3300042530 Ga0450916_000440 Ga0450916_000440_1731_2435 234
704 3300042531 Ga0450918_011503 Ga0450918_011503_701_1405 234
705 3300042533 Ga0450901_000007 Ga0450901_000007_4107_4811 234
706 3300042876 Ga0451577_0275370 Ga0451577_0275370_747_1451 234
707 3300042993 Ga0439440_0000185 Ga0439440_0000185_5960_6664 234
708 3300046452 Ga0495617_000141 Ga0495617_000141_43726_44430 234
709 3300046452 Ga0495617_029541 Ga0495617_029541_588_1292 234
710 3300046452 Ga0495617_036883 Ga0495617_036883_608_1312 234
711 3300046452 Ga0495617_041150 Ga0495617_041150_460_1164 234
712 3300046453 Ga0495627_000130 Ga0495627_000130_37514_38218 234
713 3300046453 Ga0495627_000888 Ga0495627_000888_5370_6074 234
714 3300046453 Ga0495627_003846 Ga0495627_003846_2638_3342 234
715 3300046453 Ga0495627_004631 Ga0495627_004631_1739_2443 234
716 3300046453 Ga0495627_007148 Ga0495627_007148_777_1481 234
717 3300046453 Ga0495627_008463 Ga0495627_008463_2165_2869 234
718 3300046455 Ga0495603_0013079 Ga0495603_0013079_4115_4819 234
719 3300046455 Ga0495603_0104211 Ga0495603_0104211_922_1626 234
720 3300046457 Ga0495590_0003790 Ga0495590_0003790_2819_3523 234
721 3300046457 Ga0495590_0102102 Ga0495590_0102102_200_904 234
722 3300046458 Ga0495591_000119 Ga0495591_000119_32897_33601 234
723 3300046458 Ga0495591_001004 Ga0495591_001004_2918_3622 234
724 3300046458 Ga0495591_001781 Ga0495591_001781_9190_9894 234
725 3300046458 Ga0495591_002890 Ga0495591_002890_5851_6555 234
726 3300046458 Ga0495591_003252 Ga0495591_003252_4745_5449 234
727 3300046458 Ga0495591_004111 Ga0495591_004111_3729_4433 234
728 3300046458 Ga0495591_007995 Ga0495591_007995_1540_2244 234
729 3300046459 Ga0495629_0073034 Ga0495629_0073034_443_1147 234
730 3300046460 Ga0495638_0014555 Ga0495638_0014555_3234_3938 234
731 3300046460 Ga0495638_0022681 Ga0495638_0022681_69_773 234
732 3300046460 Ga0495638_0033967 Ga0495638_0033967_322_1026 234
733 3300046460 Ga0495638_0113968 Ga0495638_0113968_455_1159 234
734 3300046463 Ga0495653_0009457 Ga0495653_0009457_3009_3713 234
735 3300046463 Ga0495653_0016863 Ga0495653_0016863_2375_3079 234
736 3300046463 Ga0495653_0020041 Ga0495653_0020041_3628_4332 234
737 3300046471 Ga0495650_0003122 Ga0495650_0003122_8730_9434 234
738 3300046471 Ga0495650_0005077 Ga0495650_0005077_6170_6874 234
739 3300046471 Ga0495650_0016467 Ga0495650_0016467_2615_3319 234
740 3300046473 Ga0495582_0002605 Ga0495582_0002605_5549_6253 234
741 3300046474 Ga0495605_0000125 Ga0495605_0000125_49155_49859 234
742 3300046474 Ga0495605_0000149 Ga0495605_0000149_34912_35616 234
743 3300046474 Ga0495605_0000503 Ga0495605_0000503_32618_33322 234
744 3300046474 Ga0495605_0001674 Ga0495605_0001674_9188_9892 234
745 3300046474 Ga0495605_0004647 Ga0495605_0004647_382_1086 234
746 3300046475 Ga0495639_0000065 Ga0495639_0000065_44633_45337 234
747 3300046475 Ga0495639_0003249 Ga0495639_0003249_2887_3591 234
748 3300046491 Ga0495584_0000587 Ga0495584_0000587_21055_21900 234
749 3300046491 Ga0495584_0003676 Ga0495584_0003676_4785_5489 234
750 3300046491 Ga0495584_0004945 Ga0495584_0004945_1892_2596 234
751 3300046491 Ga0495584_0030366 Ga0495584_0030366_1815_2519 234
752 3300046491 Ga0495584_0055031 Ga0495584_0055031_70_774 234
753 3300046492 Ga0495585_0001301 Ga0495585_0001301_2870_3574 234
754 3300046492 Ga0495585_0001381 Ga0495585_0001381_15274_15978 234
755 3300046492 Ga0495585_0310296 Ga0495585_0310296_35_739 234
756 3300046499 Ga0495594_0003413 Ga0495594_0003413_2863_3567 234
757 3300046500 Ga0495596_0000636 Ga0495596_0000636_2809_3513 234
758 3300046501 Ga0495607_0000312 Ga0495607_0000312_44355_45059 234
759 3300046501 Ga0495607_0000455 Ga0495607_0000455_5154_5858 234
760 3300046501 Ga0495607_0000464 Ga0495607_0000464_8304_9026 234
761 3300046501 Ga0495607_0004399 Ga0495607_0004399_9618_10322 234
762 3300046501 Ga0495607_0006401 Ga0495607_0006401_2841_3545 234
763 3300046501 Ga0495607_0008736 Ga0495607_0008736_6161_6865 234
764 3300046501 Ga0495607_0011380 Ga0495607_0011380_2399_3103 234
765 3300046501 Ga0495607_0064900 Ga0495607_0064900_337_1041 234
766 3300046501 Ga0495607_0087953 Ga0495607_0087953_811_1515 234
767 3300046501 Ga0495607_0099717 Ga0495607_0099717_100_804 234
768 3300046501 Ga0495607_0278997 Ga0495607_0278997_42_746 234
769 3300046506 Ga0495583_0000196 Ga0495583_0000196_49111_49815 234
770 3300046506 Ga0495583_0001527 Ga0495583_0001527_7840_8544 234
771 3300046506 Ga0495583_0004118 Ga0495583_0004118_7018_7722 234
772 3300046506 Ga0495583_0007950 Ga0495583_0007950_4555_5259 234
773 3300046506 Ga0495583_0009084 Ga0495583_0009084_2824_3528 234
774 3300046507 Ga0495606_0000712 Ga0495606_0000712_5466_6170 234
775 3300046507 Ga0495606_0001438 Ga0495606_0001438_24845_25549 234
776 3300046507 Ga0495606_0009506 Ga0495606_0009506_4083_4787 234
777 3300046507 Ga0495606_0016921 Ga0495606_0016921_1687_2391 234
778 3300046507 Ga0495606_0022904 Ga0495606_0022904_726_1430 234
779 3300046507 Ga0495606_0029764 Ga0495606_0029764_2840_3544 234
780 3300046512 Ga0495610_0007081 Ga0495610_0007081_4138_4842 234
781 3300046512 Ga0495610_0027192 Ga0495610_0027192_2142_2846 234
782 3300046512 Ga0495610_0031604 Ga0495610_0031604_573_1277 234
783 3300046512 Ga0495610_0077190 Ga0495610_0077190_449_1153 234
784 3300046512 Ga0495610_0150084 Ga0495610_0150084_230_934 234
785 3300046513 Ga0495616_0019099 Ga0495616_0019099_201_905 234
786 3300046513 Ga0495616_0028518 Ga0495616_0028518_1798_2502 234
787 3300046513 Ga0495616_0038987 Ga0495616_0038987_337_1041 234
788 3300046515 Ga0495620_0000003 Ga0495620_0000003_227003_227710 234
789 3300046515 Ga0495620_0000055 Ga0495620_0000055_49746_50450 234
790 3300046515 Ga0495620_0000584 Ga0495620_0000584_21601_22305 234
791 3300046515 Ga0495620_0001229 Ga0495620_0001229_7623_8345 234
792 3300046515 Ga0495620_0004454 Ga0495620_0004454_1656_2360 234
793 3300046515 Ga0495620_0010025 Ga0495620_0010025_2873_3577 234
794 3300046517 Ga0495630_0027786 Ga0495630_0027786_2216_2920 234
795 3300046517 Ga0495630_0131962 Ga0495630_0131962_946_1650 234
796 3300046518 Ga0495631_0002696 Ga0495631_0002696_505_1209 234
797 3300046518 Ga0495631_0006268 Ga0495631_0006268_4154_4858 234
798 3300046519 Ga0495632_0000186 Ga0495632_0000186_59625_60332 234
799 3300046519 Ga0495632_0000432 Ga0495632_0000432_37553_38257 234
800 3300046519 Ga0495632_0003902 Ga0495632_0003902_3091_3795 234
801 3300046519 Ga0495632_0005207 Ga0495632_0005207_2184_2888 234
802 3300046519 Ga0495632_0006116 Ga0495632_0006116_3082_3786 234
803 3300046519 Ga0495632_0006199 Ga0495632_0006199_1962_2666 234
804 3300046519 Ga0495632_0008775 Ga0495632_0008775_3459_4163 234
805 3300046519 Ga0495632_0014616 Ga0495632_0014616_1933_2637 234
806 3300046519 Ga0495632_0019199 Ga0495632_0019199_2850_3554 234
807 3300046519 Ga0495632_0063758 Ga0495632_0063758_874_1578 234
808 3300046520 Ga0495637_0000162 Ga0495637_0000162_5880_6584 234
809 3300046520 Ga0495637_0000231 Ga0495637_0000231_5583_6287 234
810 3300046520 Ga0495637_0002146 Ga0495637_0002146_9021_9725 234
811 3300046520 Ga0495637_0003708 Ga0495637_0003708_2845_3549 234
812 3300046520 Ga0495637_0005703 Ga0495637_0005703_1423_2127 234
813 3300046520 Ga0495637_0007586 Ga0495637_0007586_528_1232 234
814 3300046520 Ga0495637_0008547 Ga0495637_0008547_1799_2503 234
815 3300046520 Ga0495637_0013132 Ga0495637_0013132_820_1524 234
816 3300046520 Ga0495637_0014081 Ga0495637_0014081_2803_3507 234
817 3300046520 Ga0495637_0060989 Ga0495637_0060989_230_934 234
818 3300046522 Ga0495643_0000319 Ga0495643_0000319_21889_22596 234
819 3300046522 Ga0495643_0001060 Ga0495643_0001060_5421_6125 234
820 3300046522 Ga0495643_0008410 Ga0495643_0008410_3094_3801 234
821 3300046522 Ga0495643_0037205 Ga0495643_0037205_1528_2232 234
822 3300046522 Ga0495643_0047794 Ga0495643_0047794_70_774 234
823 3300046522 Ga0495643_0201330 Ga0495643_0201330_217_921 234
824 3300046523 Ga0495644_0003627 Ga0495644_0003627_2007_2711 234
825 3300046523 Ga0495644_0024090 Ga0495644_0024090_74_778 234
826 3300046524 Ga0495648_0000676 Ga0495648_0000676_7912_8619 234
827 3300046524 Ga0495648_0000755 Ga0495648_0000755_29534_30238 234
828 3300046524 Ga0495648_0001144 Ga0495648_0001144_23251_23955 234
829 3300046524 Ga0495648_0003719 Ga0495648_0003719_9751_10455 234
830 3300046524 Ga0495648_0006841 Ga0495648_0006841_5661_6365 234
831 3300046524 Ga0495648_0007126 Ga0495648_0007126_7946_8650 234
832 3300046524 Ga0495648_0039231 Ga0495648_0039231_1763_2608 234
833 3300046526 Ga0495666_0003285 Ga0495666_0003285_4598_5302 234
834 3300046528 Ga0495642_0000172 Ga0495642_0000172_34367_35071 234
835 3300046528 Ga0495642_0000431 Ga0495642_0000431_18655_19359 234
836 3300046530 Ga0495654_0001418 Ga0495654_0001418_2931_3635 234
837 3300046530 Ga0495654_0002234 Ga0495654_0002234_1017_1721 234
838 3300046530 Ga0495654_0003745 Ga0495654_0003745_3160_3864 234
839 3300046530 Ga0495654_0005234 Ga0495654_0005234_2726_3430 234
840 3300046530 Ga0495654_0006557 Ga0495654_0006557_3879_4583 234
841 3300046530 Ga0495654_0018618 Ga0495654_0018618_1796_2500 234
842 3300046530 Ga0495654_0027116 Ga0495654_0027116_1969_2673 234
843 3300046530 Ga0495654_0039060 Ga0495654_0039060_1548_2252 234
844 3300046530 Ga0495654_0143301 Ga0495654_0143301_312_1016 234
845 3300046535 Ga0495586_0148424 Ga0495586_0148424_308_1012 234
846 3300046536 Ga0495587_0001431 Ga0495587_0001431_2893_3597 234
847 3300046536 Ga0495587_0010525 Ga0495587_0010525_2820_3524 234
848 3300046538 Ga0495609_0000087 Ga0495609_0000087_89020_89724 234
849 3300046538 Ga0495609_0000174 Ga0495609_0000174_49442_50146 234
850 3300046538 Ga0495609_0000213 Ga0495609_0000213_3058_3762 234
851 3300046538 Ga0495609_0001854 Ga0495609_0001854_12739_13443 234
852 3300046538 Ga0495609_0032377 Ga0495609_0032377_70_774 234
853 3300046538 Ga0495609_0051850 Ga0495609_0051850_528_1232 234
854 3300046542 Ga0495597_0000097 Ga0495597_0000097_33595_34299 234
855 3300046542 Ga0495597_0008719 Ga0495597_0008719_458_1162 234
856 3300046542 Ga0495597_0011290 Ga0495597_0011290_1944_2648 234
857 3300046542 Ga0495597_0166931 Ga0495597_0166931_118_822 234
858 3300046557 Ga0495622_0000688 Ga0495622_0000688_13386_14090 234
859 3300046557 Ga0495622_0002891 Ga0495622_0002891_4631_5335 234
860 3300046557 Ga0495622_0186812 Ga0495622_0186812_154_858 234
861 3300046558 Ga0495633_0000134 Ga0495633_0000134_49137_49841 234
862 3300046558 Ga0495633_0007571 Ga0495633_0007571_2642_3346 234
863 3300046615 Ga0495656_0006258 Ga0495656_0006258_1636_2340 234
864 3300046616 Ga0495668_0017196 Ga0495668_0017196_664_1368 234
865 3300046616 Ga0495668_0246155 Ga0495668_0246155_99_803 234
866 3300046642 Ga0495634_0027922 Ga0495634_0027922_2857_3561 234
867 3300046648 Ga0495611_0002038 Ga0495611_0002038_4916_5620 234
868 3300046648 Ga0495611_0003476 Ga0495611_0003476_3084_3788 234
869 3300046660 Ga0495625_0000145 Ga0495625_0000145_53703_54407 234
870 3300046660 Ga0495625_0022895 Ga0495625_0022895_3621_4325 234
871 3300046663 Ga0495635_0003568 Ga0495635_0003568_2888_3592 234
872 3300046663 Ga0495635_0005207 Ga0495635_0005207_5489_6193 234
873 3300046664 Ga0495659_0003223 Ga0495659_0003223_4505_5209 234
874 3300046664 Ga0495659_0024669 Ga0495659_0024669_500_1204 234
875 3300046665 Ga0495661_0000150 Ga0495661_0000150_34946_35650 234
876 3300046665 Ga0495661_0000193 Ga0495661_0000193_23338_24042 234
877 3300046665 Ga0495661_0000306 Ga0495661_0000306_5827_6531 234
878 3300046665 Ga0495661_0000332 Ga0495661_0000332_17702_18406 234
879 3300046665 Ga0495661_0000644 Ga0495661_0000644_2833_3537 234
880 3300046665 Ga0495661_0007217 Ga0495661_0007217_78_782 234
881 3300046674 Ga0495588_0005283 Ga0495588_0005283_4521_5225 234
882 3300046680 Ga0495646_0004182 Ga0495646_0004182_2866_3570 234
883 3300046680 Ga0495646_0007936 Ga0495646_0007936_921_1625 234
884 3300046684 Ga0495669_0001041 Ga0495669_0001041_8289_8993 234
885 3300046689 Ga0495613_0073554 Ga0495613_0073554_684_1388 234
886 3300046690 Ga0495624_0001547 Ga0495624_0001547_2859_3563 234
887 3300046691 Ga0495670_0014020 Ga0495670_0014020_2877_3581 234
888 3300046691 Ga0495670_0031504 Ga0495670_0031504_1351_2055 234
889 3300046691 Ga0495670_0048498 Ga0495670_0048498_1309_2013 234
890 3300046692 Ga0495671_0000813 Ga0495671_0000813_2700_3545 234
891 3300046692 Ga0495671_0002178 Ga0495671_0002178_355_1059 234
892 3300046692 Ga0495671_0010354 Ga0495671_0010354_2752_3456 234
893 3300046692 Ga0495671_0011743 Ga0495671_0011743_3729_4433 234
894 3300046692 Ga0495671_0020192 Ga0495671_0020192_1231_1935 234
895 3300046692 Ga0495671_0036459 Ga0495671_0036459_814_1518 234
896 3300046692 Ga0495671_0052705 Ga0495671_0052705_934_1638 234
897 3300046694 Ga0495649_0000362 Ga0495649_0000362_33043_33747 234
898 3300046694 Ga0495649_0001373 Ga0495649_0001373_16889_17593 234
899 3300046694 Ga0495649_0003896 Ga0495649_0003896_2869_3573 234
900 3300046694 Ga0495649_0029860 Ga0495649_0029860_231_935 234
901 3300046694 Ga0495649_0049052 Ga0495649_0049052_69_773 234
902 3300046794 Ga0495589_0000228 Ga0495589_0000228_2846_3550 234
903 3300046794 Ga0495589_0004887 Ga0495589_0004887_4772_5476 234
904 3300046794 Ga0495589_0013783 Ga0495589_0013783_1503_2207 234
905 3300046810 Ga0495660_0004242 Ga0495660_0004242_2833_3537 234
906 3300046810 Ga0495660_0005442 Ga0495660_0005442_3015_3719 234
907 3300046810 Ga0495660_0005476 Ga0495660_0005476_5079_5783 234
908 3300046810 Ga0495660_0034816 Ga0495660_0034816_1189_1893 234
909 3300046810 Ga0495660_0035397 Ga0495660_0035397_1844_2548 234
910 3300046810 Ga0495660_0072027 Ga0495660_0072027_1056_1760 234
911 3300046810 Ga0495660_0073341 Ga0495660_0073341_120_824 234
912 3300047317 Ga0495604_0020674 Ga0495604_0020674_834_1538 234
913 3300047320 Ga0495672_0000961 Ga0495672_0000961_29190_29894 234
914 3300047320 Ga0495672_0014074 Ga0495672_0014074_1949_2653 234
915 3300047320 Ga0495672_0019259 Ga0495672_0019259_3128_3832 234
916 3300047320 Ga0495672_0023652 Ga0495672_0023652_2829_3533 234
917 3300047320 Ga0495672_0032335 Ga0495672_0032335_73_777 234
918 3300047320 Ga0495672_0046547 Ga0495672_0046547_1564_2268 234
919 3300047320 Ga0495672_0233142 Ga0495672_0233142_76_780 234
920 3300047321 Ga0495676_0000119 Ga0495676_0000119_5682_6386 234
921 3300047321 Ga0495676_0016179 Ga0495676_0016179_5241_5945 234
922 3300047322 Ga0495680_0048725 Ga0495680_0048725_372_1076 234
923 3300047323 Ga0495683_0000059 Ga0495683_0000059_86501_87205 234
924 3300047323 Ga0495683_0000095 Ga0495683_0000095_49370_50074 234
925 3300047323 Ga0495683_0042946 Ga0495683_0042946_1529_2233 234
926 3300047443 Ga0495687_003858 Ga0495687_003858_3753_4457 234
927 3300047443 Ga0495687_007887 Ga0495687_007887_3868_4572 234
928 3300047443 Ga0495687_009404 Ga0495687_009404_148_852 234
929 3300047445 Ga0495677_0001027 Ga0495677_0001027_7597_8301 234
930 3300047446 Ga0495679_000267 Ga0495679_000267_39483_40187 234
931 3300047446 Ga0495679_000554 Ga0495679_000554_5776_6480 234
932 3300047447 Ga0495685_030284 Ga0495685_030284_460_1164 234
933 3300047469 Ga0495673_0001692 Ga0495673_0001692_13353_14057 234
934 3300047469 Ga0495673_0002018 Ga0495673_0002018_11357_12061 234
935 3300047469 Ga0495673_0002336 Ga0495673_0002336_2543_3247 234
936 3300047469 Ga0495673_0005312 Ga0495673_0005312_4607_5311 234
937 3300047469 Ga0495673_0006440 Ga0495673_0006440_991_1695 234
938 3300047469 Ga0495673_0007434 Ga0495673_0007434_2790_3494 234
939 3300047469 Ga0495673_0008495 Ga0495673_0008495_2287_2991 234
940 3300047469 Ga0495673_0026708 Ga0495673_0026708_144_848 234
941 3300047469 Ga0495673_0102262 Ga0495673_0102262_201_905 234
942 3300047470 Ga0495681_0000690 Ga0495681_0000690_2891_3595 234
943 3300047470 Ga0495681_0001877 Ga0495681_0001877_14091_14795 234
944 3300047470 Ga0495681_0006727 Ga0495681_0006727_3923_4627 234
945 3300047470 Ga0495681_0026634 Ga0495681_0026634_55_759 234
946 3300047470 Ga0495681_0148645 Ga0495681_0148645_62_766 234
947 3300047472 Ga0495686_0123668 Ga0495686_0123668_747_1451 234
948 3300048091 Ga0495626_0000259 Ga0495626_0000259_5842_6546 234
949 3300048091 Ga0495626_0000625 Ga0495626_0000625_2869_3573 234
950 3300048091 Ga0495626_0003715 Ga0495626_0003715_2869_3573 234
951 3300048091 Ga0495626_0004053 Ga0495626_0004053_2867_3571 234
952 3300048091 Ga0495626_0008942 Ga0495626_0008942_4605_5309 234
953 3300048091 Ga0495626_0010349 Ga0495626_0010349_1405_2109 234
954 3300048905 Ga0496102_0009345 Ga0496102_0009345_2887_3591 234
955 3300048906 Ga0496103_0002700 Ga0496103_0002700_2886_3590 234
956 3300048913 Ga0496110_0022963 Ga0496110_0022963_4026_4733 234
957 3300048915 Ga0496112_0453820 Ga0496112_0453820_388_1092 234
958 3300048917 Ga0496114_0004116 Ga0496114_0004116_10386_11093 234
959 3300048917 Ga0496114_0007099 Ga0496114_0007099_2746_3453 234
960 3300048918 Ga0496115_0035754 Ga0496115_0035754_1596_2300 234
961 3300048919 Ga0496116_0000792 Ga0496116_0000792_36633_37337 234
962 3300048919 Ga0496116_0009449 Ga0496116_0009449_2866_3570 234
963 3300048919 Ga0496116_0037374 Ga0496116_0037374_1308_2015 234
964 3300048919 Ga0496116_0045813 Ga0496116_0045813_1442_2146 234
965 3300048920 Ga0496117_0001008 Ga0496117_0001008_39651_40358 234
966 3300048920 Ga0496117_0002238 Ga0496117_0002238_2841_3545 234
967 3300048920 Ga0496117_0002244 Ga0496117_0002244_2893_3600 234
968 3300048920 Ga0496117_0002790 Ga0496117_0002790_17791_18495 234
969 3300048920 Ga0496117_0008345 Ga0496117_0008345_6198_6905 234
970 3300048920 Ga0496117_0106787 Ga0496117_0106787_841_1545 234
971 3300048920 Ga0496117_0153824 Ga0496117_0153824_493_1197 234
972 3300048921 Ga0496118_0003309 Ga0496118_0003309_17310_18017 234
973 3300048921 Ga0496118_0010322 Ga0496118_0010322_5712_6419 234
974 3300048921 Ga0496118_0035214 Ga0496118_0035214_2503_3207 234
975 3300048921 Ga0496118_0035375 Ga0496118_0035375_1870_2574 234
976 3300048921 Ga0496118_0180193 Ga0496118_0180193_282_986 234
977 3300048922 Ga0496119_0000380 Ga0496119_0000380_45567_46274 234
978 3300048923 Ga0496120_0002903 Ga0496120_0002903_1851_2558 234
979 3300048924 Ga0496121_0000858 Ga0496121_0000858_45257_45961 234
980 3300048924 Ga0496121_0001360 Ga0496121_0001360_38164_38868 234
981 3300048924 Ga0496121_0002590 Ga0496121_0002590_3077_3781 234
982 3300048924 Ga0496121_0044902 Ga0496121_0044902_3081_3785 234
983 3300048924 Ga0496121_0066311 Ga0496121_0066311_414_1121 234
984 3300048924 Ga0496121_0136226 Ga0496121_0136226_948_1655 234
985 3300048925 Ga0496122_0001237 Ga0496122_0001237_17525_18229 234
986 3300048925 Ga0496122_0002322 Ga0496122_0002322_23908_24612 234
987 3300048925 Ga0496122_0004088 Ga0496122_0004088_11946_12653 234
988 3300048925 Ga0496122_0036831 Ga0496122_0036831_722_1429 234
989 3300048925 Ga0496122_0042793 Ga0496122_0042793_1540_2244 234
990 3300048926 Ga0496123_0000550 Ga0496123_0000550_17523_18227 234
991 3300048926 Ga0496123_0006040 Ga0496123_0006040_9486_10190 234
992 3300048926 Ga0496123_0008088 Ga0496123_0008088_8627_9334 234
993 3300048926 Ga0496123_0035674 Ga0496123_0035674_16_723 234
994 3300048926 Ga0496123_0054043 Ga0496123_0054043_262_966 234
995 3300048926 Ga0496123_0142438 Ga0496123_0142438_137_841 234
996 3300048927 Ga0496124_0000355 Ga0496124_0000355_39962_40666 234
997 3300048927 Ga0496124_0001100 Ga0496124_0001100_39110_39817 234
998 3300048927 Ga0496124_0002102 Ga0496124_0002102_23685_24389 234
999 3300048927 Ga0496124_0007094 Ga0496124_0007094_10473_11177 234
1000 3300048927 Ga0496124_0010243 Ga0496124_0010243_5957_6664 234
1001 3300048927 Ga0496124_0010329 Ga0496124_0010329_175_879 234
1002 3300048927 Ga0496124_0030407 Ga0496124_0030407_1313_2017 234
1003 3300048927 Ga0496124_0174691 Ga0496124_0174691_598_1305 234
1004 3300048927 Ga0496124_0334014 Ga0496124_0334014_293_997 234
1005 3300048928 Ga0496125_0002991 Ga0496125_0002991_3071_3778 234
1006 3300048928 Ga0496125_0037792 Ga0496125_0037792_2748_3455 234
1007 3300048928 Ga0496125_0049985 Ga0496125_0049985_2469_3176 234
1008 3300048929 Ga0496126_0029684 Ga0496126_0029684_482_1189 234
1009 3300048929 Ga0496126_0128833 Ga0496126_0128833_1392_2096 234
1010 3300049459 Ga0495678_000108 Ga0495678_000108_49960_50664 234
1011 3300049459 Ga0495678_003989 Ga0495678_003989_7348_8052 234
1012 3300049459 Ga0495678_005172 Ga0495678_005172_20_724 234
1013 3300049459 Ga0495678_019211 Ga0495678_019211_771_1475 234
1014 3300049459 Ga0495678_027046 Ga0495678_027046_1636_2340 234
1015 3300049460 Ga0495682_0000170 Ga0495682_0000170_5818_6522 234
1016 3300049460 Ga0495682_0000234 Ga0495682_0000234_7415_8119 234
1017 3300049460 Ga0495682_0002853 Ga0495682_0002853_4416_5120 234
1018 3300049460 Ga0495682_0005115 Ga0495682_0005115_23_727 234
1019 3300049460 Ga0495682_0019452 Ga0495682_0019452_346_1050 234
1020 3300049460 Ga0495682_0109646 Ga0495682_0109646_102_806 234
1021 3300049460 Ga0495682_0126512 Ga0495682_0126512_53_757 234
1022 3300049571 Ga0501034_0000150 Ga0501034_0000150_16394_17101 234
1023 3300049573 Ga0501037_0097933 Ga0501037_0097933_638_1342 234
1024 3300049575 Ga0501039_0106675 Ga0501039_0106675_857_1561 234
1025 3300049758 Ga0501241_008863 Ga0501241_008863_451_1155 234
1026 3300049853 Ga0501226_000028 Ga0501226_000028_61714_62418 234
1027 3300050491 nmdc:mga00v17_45138_c1 nmdc:mga00v17_45138_c1_1872_2576 234
1028 3300050491 nmdc:mga00v17_70159_c1 nmdc:mga00v17_70159_c1_144_848 234
1029 3300050516 nmdc:mga0sz30_7332_c1 nmdc:mga0sz30_7332_c1_2862_3566 234
1030 3300053125 Ga0500618_001241 Ga0500618_001241_7935_8639 234
1031 3300053140 Ga0500573_0125367 Ga0500573_0125367_207_911 234
1032 iso_pu_bacteria 2599185155 2599326979 234
1033 iso_pu_bacteria 2600255283 2601625505 234
1034 iso_pu_bacteria 3007855910 3007856255 234

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22688

Hda_lid

Hda, lid domain

215

279

0.99

PF00308

Bac_DnaA

Bacterial DnaA ATPAse domain

59

209

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x06-assembly1.cif.gz_E dna replication regulation protein 0.9122 5 229
5x06-assembly1.cif.gz_F dna replication regulation protein 0.9047 3 230
5x06-assembly1.cif.gz_F dna replication regulation protein 0.8971 3 230
5x06-assembly1.cif.gz_H dna replication regulation protein 0.8964 5 207
5x06-assembly1.cif.gz_E dna replication regulation protein 0.8963 5 229
ID Description Score Start End Superfamily
af_P69931_1_164_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9013 1 164 3.40.50.300
3sc3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8927 23 164 3.40.50.300
af_P69931_1_164_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8907 1 164 3.40.50.300
3bosA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8829 4 164 3.40.50.300
3sc3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8813 23 164 3.40.50.300
ID Description Score Start End GO Terms
AF-F3FTU9-F1-model_v4 DNA replication initiation factor 0.9912 29 233 GO:0003743
GO:0006270
GO:0032297
AF-A0A0P9J3K0-F1-model_v4 deleted 0.9872 1 233
AF-A4NXM4-F1-model_v4 Chromosomal replication initiator protein DnaA ATPAse domain-containing protein 0.9831 52 160 GO:0006270
GO:0032297
AF-A0A0P9J3K0-F1-model_v4 deleted 0.983 1 233
AF-A0A3M4R106-F1-model_v4 deleted 0.9776 1 233

Feature Viewer

pLDDT pTM Quality
92.14 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map