F488642
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1032 | 519 | 2064 | 222 |
Family's Representative Sequence
| Representative Sequence | 3300048927|Ga0496124_0182754|Ga0496124_0182754_653_1405 |
| Length | 245 |
| Sequence | MAGTFGPCPDLVALVQPSTGKQIVTSFLDPVIAFVSAHPWLAYLTLFLAALLEAIPVVGALVPGSTIILALSGELKLWGVLAAAIAGALIGDGSAFWTGHRAQREILGAWPMSRYPAVMAQSEAFFHRWGTLAVFFARFVPPIRAFVPVTAGALGMSPPLFFGVNIPAVLAWASAHVLPGVFAVSALHHYAGLPHHQHVGKHLWILAVFAVAIIALGVWTLRRRRAGKAPSDQARAGLRPGAGPT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 68 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 69 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 70 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 76 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 86 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 87 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 88 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 89 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 119 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 120 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 179 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 182 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 183 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 184 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 185 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 186 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 187 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 188 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 189 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 190 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 191 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 193 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 194 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 196 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 197 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 198 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 199 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 200 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 201 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 202 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 203 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 205 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 206 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 207 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 208 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 210 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 211 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 212 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 213 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 214 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 215 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 216 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 219 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 220 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 221 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 222 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 223 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 224 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 225 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 226 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 230 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 231 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 232 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 233 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 234 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 235 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 236 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 237 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 238 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 239 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 319 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 320 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 321 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 322 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 323 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 324 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 327 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 328 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 329 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 330 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 331 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 332 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 333 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 334 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 335 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 336 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 337 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 338 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 339 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 340 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 370 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 371 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 372 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 373 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 374 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 375 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 376 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 380 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 385 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 386 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 387 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 388 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 389 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 390 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 391 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 392 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 393 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 394 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 395 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 396 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 397 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 398 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 399 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 400 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 401 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 402 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 403 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 404 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 405 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 406 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 407 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 408 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 409 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 410 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 411 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 412 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 413 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 414 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 415 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 416 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 417 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 418 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 419 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 420 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 421 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 422 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 423 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 424 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 425 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 426 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 427 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 429 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 431 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 432 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 433 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 434 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 435 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 436 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 437 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 438 | 2791355199 | |||
| 439 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 440 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 441 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 442 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 443 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 444 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 445 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 446 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 447 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 448 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 449 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 450 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 451 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 452 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 453 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 454 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 455 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 456 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 457 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 458 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 459 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 460 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 461 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 462 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 463 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 464 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 465 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 466 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 467 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 468 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 469 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 470 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 471 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 472 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 473 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 474 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 475 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 476 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 477 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 478 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 479 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 480 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 481 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 482 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 483 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 484 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 485 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 486 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 487 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 488 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 489 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 490 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 491 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 492 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 493 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 494 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 495 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 496 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 497 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 498 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 499 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 500 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 501 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 502 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 503 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 504 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 505 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 506 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 507 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 508 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 509 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 510 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 511 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 512 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 513 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 514 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 515 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 516 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 517 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 518 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 519 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.27 |
| Metatranscriptomes | 0.1 |
| Isolates | 8.63 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.47 |
| Nodule | 7.27 |
| Rhizoplane | 7.95 |
| Rhizosphere | 67.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496124_0182754 | 3300048927 | Bacteria | 1612 |
| 2 | JGI25153J46596_10022904 | 3300003215 | Bacteria | 2291 |
| 3 | rootL2_10161206 | 3300003322 | Bacteria | 1167 |
| 4 | rootL2_10205455 | 3300003322 | Bacteria | 1002 |
| 5 | rootH1_10066983 | 3300003323 | Bacteria | 1264 |
| 6 | rootH1_10114185 | 3300003323 | Bacteria | 1166 |
| 7 | JGI25404J52841_10020122 | 3300003659 | Bacteria | 1446 |
| 8 | Ga0055543_1004157 | 3300004625 | Bacteria | 4019 |
| 9 | Ga0065165_1001154 | 3300005262 | Bacteria | 30829 |
| 10 | Ga0065165_1009552 | 3300005262 | Bacteria | 4331 |
| 11 | Ga0070658_10251334 | 3300005327 | Bacteria | 1500 |
| 12 | Ga0070676_10213956 | 3300005328 | Bacteria | 1270 |
| 13 | Ga0070683_100038284 | 3300005329 | Bacteria | 4395 |
| 14 | Ga0070683_100082292 | 3300005329 | Bacteria | 3014 |
| 15 | Ga0068869_100019987 | 3300005334 | Bacteria | 4586 |
| 16 | Ga0068869_100028909 | 3300005334 | Bacteria | 3878 |
| 17 | Ga0070666_10414414 | 3300005335 | Bacteria | 970 |
| 18 | Ga0070680_100090173 | 3300005336 | Bacteria | 2537 |
| 19 | Ga0070680_100296001 | 3300005336 | Bacteria | 1372 |
| 20 | Ga0070682_100217035 | 3300005337 | Bacteria | 1359 |
| 21 | Ga0068868_100022836 | 3300005338 | Bacteria | 4728 |
| 22 | Ga0068868_100095676 | 3300005338 | Bacteria | 2398 |
| 23 | Ga0070660_100163307 | 3300005339 | Bacteria | 1796 |
| 24 | Ga0070660_100182193 | 3300005339 | Bacteria | 1700 |
| 25 | Ga0070660_100274881 | 3300005339 | Bacteria | 1378 |
| 26 | Ga0070689_100929188 | 3300005340 | Bacteria | 771 |
| 27 | Ga0070691_10067403 | 3300005341 | Bacteria | 1731 |
| 28 | Ga0070691_10236206 | 3300005341 | Bacteria | 975 |
| 29 | Ga0070661_100188622 | 3300005344 | Bacteria | 1572 |
| 30 | Ga0070661_100328453 | 3300005344 | Bacteria | 1196 |
| 31 | Ga0070692_10226670 | 3300005345 | Bacteria | 1107 |
| 32 | Ga0070668_100046579 | 3300005347 | Bacteria | 3330 |
| 33 | Ga0070668_100063000 | 3300005347 | Bacteria | 2874 |
| 34 | Ga0070668_100265259 | 3300005347 | Bacteria | 1429 |
| 35 | Ga0070668_100286836 | 3300005347 | Bacteria | 1376 |
| 36 | Ga0070668_100390981 | 3300005347 | Bacteria | 1186 |
| 37 | Ga0070669_100167442 | 3300005353 | Bacteria | 1711 |
| 38 | Ga0070671_100013134 | 3300005355 | Bacteria | 6672 |
| 39 | Ga0070667_100105278 | 3300005367 | Bacteria | 2441 |
| 40 | Ga0070667_101162959 | 3300005367 | Bacteria | 722 |
| 41 | Ga0070709_10001027 | 3300005434 | Bacteria | 15441 |
| 42 | Ga0070709_10005403 | 3300005434 | Bacteria | 6921 |
| 43 | Ga0070709_10017504 | 3300005434 | Bacteria | 4112 |
| 44 | Ga0070709_10056309 | 3300005434 | Bacteria | 2485 |
| 45 | Ga0070714_100002014 | 3300005435 | Bacteria | 14871 |
| 46 | Ga0070714_100038190 | 3300005435 | Bacteria | 4038 |
| 47 | Ga0070714_100113883 | 3300005435 | Bacteria | 2399 |
| 48 | Ga0070713_100004390 | 3300005436 | Bacteria | 9476 |
| 49 | Ga0070713_100016677 | 3300005436 | Bacteria | 5527 |
| 50 | Ga0070713_100052787 | 3300005436 | Bacteria | 3367 |
| 51 | Ga0070713_100178132 | 3300005436 | Bacteria | 1909 |
| 52 | Ga0070713_100281925 | 3300005436 | Bacteria | 1525 |
| 53 | Ga0070713_100412001 | 3300005436 | Bacteria | 1264 |
| 54 | Ga0070710_10001042 | 3300005437 | Bacteria | 13175 |
| 55 | Ga0070710_10001742 | 3300005437 | Bacteria | 10288 |
| 56 | Ga0070710_10506972 | 3300005437 | Bacteria | 827 |
| 57 | Ga0070711_100003508 | 3300005439 | Bacteria | 9148 |
| 58 | Ga0070711_100010129 | 3300005439 | Bacteria | 5825 |
| 59 | Ga0070711_100046349 | 3300005439 | Bacteria | 2961 |
| 60 | Ga0070700_100114854 | 3300005441 | Bacteria | 1796 |
| 61 | Ga0070700_100348808 | 3300005441 | Bacteria | 1097 |
| 62 | Ga0070663_100018623 | 3300005455 | Bacteria | 4556 |
| 63 | Ga0070663_100065498 | 3300005455 | Bacteria | 2630 |
| 64 | Ga0070663_100080448 | 3300005455 | Bacteria | 2393 |
| 65 | Ga0070663_100106570 | 3300005455 | Bacteria | 2099 |
| 66 | Ga0070663_100230832 | 3300005455 | Bacteria | 1457 |
| 67 | Ga0070663_100286360 | 3300005455 | Bacteria | 1315 |
| 68 | Ga0070678_100043057 | 3300005456 | Bacteria | 3213 |
| 69 | Ga0070678_100052680 | 3300005456 | Bacteria | 2956 |
| 70 | Ga0070678_100455505 | 3300005456 | Bacteria | 1121 |
| 71 | Ga0070662_100111438 | 3300005457 | Bacteria | 2085 |
| 72 | Ga0070681_10009040 | 3300005458 | Bacteria | 9791 |
| 73 | Ga0070681_10055005 | 3300005458 | Bacteria | 3964 |
| 74 | Ga0070681_10070515 | 3300005458 | Bacteria | 3460 |
| 75 | Ga0070681_10188680 | 3300005458 | Bacteria | 1981 |
| 76 | Ga0070681_10249267 | 3300005458 | Bacteria | 1689 |
| 77 | Ga0070681_10354528 | 3300005458 | Bacteria | 1377 |
| 78 | Ga0068867_100051402 | 3300005459 | Bacteria | 3039 |
| 79 | Ga0070706_100123166 | 3300005467 | Bacteria | 2417 |
| 80 | Ga0070698_100649991 | 3300005471 | Bacteria | 996 |
| 81 | Ga0070699_100146075 | 3300005518 | Bacteria | 2090 |
| 82 | Ga0070679_100004286 | 3300005530 | Bacteria | 13161 |
| 83 | Ga0070679_100038414 | 3300005530 | Bacteria | 4760 |
| 84 | Ga0070679_100232580 | 3300005530 | Bacteria | 1802 |
| 85 | Ga0070679_100516842 | 3300005530 | Bacteria | 1138 |
| 86 | Ga0070684_100031374 | 3300005535 | Bacteria | 4523 |
| 87 | Ga0070684_100059917 | 3300005535 | Bacteria | 3328 |
| 88 | Ga0070684_100212710 | 3300005535 | Bacteria | 1762 |
| 89 | Ga0068853_100039035 | 3300005539 | Bacteria | 4048 |
| 90 | Ga0068853_100082805 | 3300005539 | Bacteria | 2811 |
| 91 | Ga0068853_100092600 | 3300005539 | Bacteria | 2659 |
| 92 | Ga0068853_100107686 | 3300005539 | Bacteria | 2471 |
| 93 | Ga0068853_100171372 | 3300005539 | Bacteria | 1964 |
| 94 | Ga0068853_100194351 | 3300005539 | Bacteria | 1844 |
| 95 | Ga0068853_100243463 | 3300005539 | Bacteria | 1649 |
| 96 | Ga0068853_100488351 | 3300005539 | Bacteria | 1161 |
| 97 | Ga0068853_100621675 | 3300005539 | Bacteria | 1027 |
| 98 | Ga0070672_100126254 | 3300005543 | Bacteria | 2099 |
| 99 | Ga0070686_100176013 | 3300005544 | Bacteria | 1517 |
| 100 | Ga0070665_100062716 | 3300005548 | Bacteria | 3726 |
| 101 | Ga0070665_100063938 | 3300005548 | Bacteria | 3689 |
| 102 | Ga0070665_100105554 | 3300005548 | Bacteria | 2819 |
| 103 | Ga0070665_100186295 | 3300005548 | Bacteria | 2076 |
| 104 | Ga0070665_100867548 | 3300005548 | Bacteria | 915 |
| 105 | Ga0070704_100271395 | 3300005549 | Bacteria | 1402 |
| 106 | Ga0068855_100020446 | 3300005563 | Bacteria | 7938 |
| 107 | Ga0068855_100056006 | 3300005563 | Bacteria | 4628 |
| 108 | Ga0068855_100099741 | 3300005563 | Bacteria | 3344 |
| 109 | Ga0068855_100202696 | 3300005563 | Bacteria | 2233 |
| 110 | Ga0068855_100264388 | 3300005563 | Bacteria | 1915 |
| 111 | Ga0070664_100049361 | 3300005564 | Bacteria | 3559 |
| 112 | Ga0070664_100059412 | 3300005564 | Bacteria | 3253 |
| 113 | Ga0070664_100109514 | 3300005564 | Bacteria | 2409 |
| 114 | Ga0068857_100056048 | 3300005577 | Bacteria | 3497 |
| 115 | Ga0068857_100091695 | 3300005577 | Bacteria | 2720 |
| 116 | Ga0068857_100179874 | 3300005577 | Bacteria | 1925 |
| 117 | Ga0068857_100179886 | 3300005577 | Bacteria | 1924 |
| 118 | Ga0068857_100213788 | 3300005577 | Bacteria | 1760 |
| 119 | Ga0068854_100346291 | 3300005578 | Bacteria | 1215 |
| 120 | Ga0068856_100042399 | 3300005614 | Bacteria | 4476 |
| 121 | Ga0068856_100252474 | 3300005614 | Bacteria | 1779 |
| 122 | Ga0070702_100131886 | 3300005615 | Bacteria | 1579 |
| 123 | Ga0070702_100247313 | 3300005615 | Bacteria | 1207 |
| 124 | Ga0068852_100116648 | 3300005616 | Bacteria | 2436 |
| 125 | Ga0068852_100117092 | 3300005616 | Bacteria | 2432 |
| 126 | Ga0068852_100390953 | 3300005616 | Bacteria | 1366 |
| 127 | Ga0068852_100930884 | 3300005616 | Bacteria | 887 |
| 128 | Ga0068859_100220206 | 3300005617 | Bacteria | 1985 |
| 129 | Ga0068864_100079049 | 3300005618 | Bacteria | 2879 |
| 130 | Ga0068864_100401546 | 3300005618 | Bacteria | 1302 |
| 131 | Ga0068864_100501471 | 3300005618 | Bacteria | 1168 |
| 132 | Ga0068861_100187223 | 3300005719 | Bacteria | 1727 |
| 133 | Ga0068861_100245014 | 3300005719 | Bacteria | 1526 |
| 134 | Ga0068861_100623252 | 3300005719 | Bacteria | 993 |
| 135 | Ga0068861_101007191 | 3300005719 | Bacteria | 795 |
| 136 | Ga0068851_10025412 | 3300005834 | Bacteria | 2905 |
| 137 | Ga0068851_10031111 | 3300005834 | Bacteria | 2649 |
| 138 | Ga0068851_10072501 | 3300005834 | Bacteria | 1784 |
| 139 | Ga0068851_10190201 | 3300005834 | Bacteria | 1141 |
| 140 | Ga0068870_10020090 | 3300005840 | Bacteria | 3248 |
| 141 | Ga0068863_100467996 | 3300005841 | Bacteria | 1238 |
| 142 | Ga0068858_100062074 | 3300005842 | Bacteria | 3455 |
| 143 | Ga0068858_100185255 | 3300005842 | Bacteria | 1966 |
| 144 | Ga0068860_100085969 | 3300005843 | Bacteria | 2992 |
| 145 | Ga0068860_100244828 | 3300005843 | Bacteria | 1744 |
| 146 | Ga0068860_100612966 | 3300005843 | Bacteria | 1094 |
| 147 | Ga0068860_100838720 | 3300005843 | Bacteria | 933 |
| 148 | Ga0068862_100077669 | 3300005844 | Bacteria | 2875 |
| 149 | Ga0068862_100088109 | 3300005844 | Bacteria | 2700 |
| 150 | Ga0068862_100396313 | 3300005844 | Bacteria | 1290 |
| 151 | Ga0081455_10015101 | 3300005937 | Bacteria | 7518 |
| 152 | Ga0081455_10070871 | 3300005937 | Bacteria | 2892 |
| 153 | Ga0081538_10031021 | 3300005981 | Bacteria | 3615 |
| 154 | Ga0081540_1004227 | 3300005983 | Bacteria | 11032 |
| 155 | Ga0081540_1005956 | 3300005983 | Bacteria | 8991 |
| 156 | Ga0081540_1011679 | 3300005983 | Bacteria | 5852 |
| 157 | Ga0081540_1017794 | 3300005983 | Bacteria | 4387 |
| 158 | Ga0081540_1034458 | 3300005983 | Bacteria | 2730 |
| 159 | Ga0081539_10000129 | 3300005985 | Bacteria | 178675 |
| 160 | Ga0081539_10083384 | 3300005985 | Bacteria | 1673 |
| 161 | Ga0070717_10044411 | 3300006028 | Bacteria | 3628 |
| 162 | Ga0070717_10148412 | 3300006028 | Bacteria | 2027 |
| 163 | Ga0070717_10319684 | 3300006028 | Bacteria | 1383 |
| 164 | Ga0075365_10338297 | 3300006038 | Bacteria | 1060 |
| 165 | Ga0075363_100048277 | 3300006048 | Bacteria | 2263 |
| 166 | Ga0075363_100085219 | 3300006048 | Bacteria | 1733 |
| 167 | Ga0075364_10135415 | 3300006051 | Bacteria | 1655 |
| 168 | Ga0070715_10000398 | 3300006163 | Bacteria | 10996 |
| 169 | Ga0070716_100000855 | 3300006173 | Bacteria | 13112 |
| 170 | Ga0070716_100042118 | 3300006173 | Bacteria | 2548 |
| 171 | Ga0070716_100050514 | 3300006173 | Bacteria | 2361 |
| 172 | Ga0070712_100002401 | 3300006175 | Bacteria | 11532 |
| 173 | Ga0070712_100077201 | 3300006175 | Bacteria | 2400 |
| 174 | Ga0070712_100078419 | 3300006175 | Bacteria | 2384 |
| 175 | Ga0075362_10226304 | 3300006177 | Bacteria | 915 |
| 176 | Ga0075367_10014691 | 3300006178 | Bacteria | 4240 |
| 177 | Ga0075367_10178278 | 3300006178 | Bacteria | 1324 |
| 178 | Ga0075369_10035392 | 3300006186 | Bacteria | 2122 |
| 179 | Ga0075369_10087744 | 3300006186 | Bacteria | 1386 |
| 180 | Ga0075366_10106050 | 3300006195 | Bacteria | 1689 |
| 181 | Ga0075366_10280779 | 3300006195 | Bacteria | 1018 |
| 182 | Ga0097621_100048249 | 3300006237 | Bacteria | 3454 |
| 183 | Ga0097621_100070313 | 3300006237 | Bacteria | 2890 |
| 184 | Ga0097621_100380192 | 3300006237 | Bacteria | 1261 |
| 185 | Ga0075370_10027084 | 3300006353 | Bacteria | 3179 |
| 186 | Ga0075370_10065511 | 3300006353 | Bacteria | 2072 |
| 187 | Ga0075370_10096619 | 3300006353 | Bacteria | 1707 |
| 188 | Ga0075370_10114895 | 3300006353 | Bacteria | 1564 |
| 189 | Ga0068871_100071996 | 3300006358 | Bacteria | 2845 |
| 190 | Ga0068871_100198467 | 3300006358 | Bacteria | 1731 |
| 191 | Ga0068871_100634370 | 3300006358 | Bacteria | 974 |
| 192 | Ga0075428_100135129 | 3300006844 | Bacteria | 2682 |
| 193 | Ga0075434_100087805 | 3300006871 | Bacteria | 3111 |
| 194 | Ga0068865_100072098 | 3300006881 | Bacteria | 2452 |
| 195 | Ga0068865_100227384 | 3300006881 | Bacteria | 1462 |
| 196 | Ga0075436_100174423 | 3300006914 | Bacteria | 1518 |
| 197 | Ga0097620_100220217 | 3300006931 | Bacteria | 1985 |
| 198 | Ga0099824_1007455 | 3300006942 | Bacteria | 14477 |
| 199 | Ga0099822_1003626 | 3300006943 | Bacteria | 19843 |
| 200 | Ga0099794_10087376 | 3300007265 | Bacteria | 1544 |
| 201 | Ga0099795_10057989 | 3300007788 | Bacteria | 1429 |
| 202 | Ga0099795_10059078 | 3300007788 | Bacteria | 1418 |
| 203 | Ga0105250_10027965 | 3300009092 | Bacteria | 2271 |
| 204 | Ga0105250_10218176 | 3300009092 | Bacteria | 808 |
| 205 | Ga0105240_10050544 | 3300009093 | Bacteria | 5240 |
| 206 | Ga0105240_10096986 | 3300009093 | Bacteria | 3592 |
| 207 | Ga0105240_10182695 | 3300009093 | Bacteria | 2473 |
| 208 | Ga0105240_10188976 | 3300009093 | Bacteria | 2423 |
| 209 | Ga0105240_10210988 | 3300009093 | Bacteria | 2269 |
| 210 | Ga0105240_10239958 | 3300009093 | Bacteria | 2102 |
| 211 | Ga0111539_10069080 | 3300009094 | Bacteria | 4171 |
| 212 | Ga0111539_10737878 | 3300009094 | Bacteria | 1146 |
| 213 | Ga0105245_10115435 | 3300009098 | Bacteria | 2502 |
| 214 | Ga0105245_10150267 | 3300009098 | Bacteria | 2201 |
| 215 | Ga0105245_10173813 | 3300009098 | Bacteria | 2053 |
| 216 | Ga0105245_10539658 | 3300009098 | Bacteria | 1187 |
| 217 | Ga0105245_10713119 | 3300009098 | Bacteria | 1037 |
| 218 | Ga0105247_10142058 | 3300009101 | Bacteria | 1574 |
| 219 | Ga0105247_10293917 | 3300009101 | Bacteria | 1125 |
| 220 | Ga0105247_10429017 | 3300009101 | Bacteria | 948 |
| 221 | Ga0114129_10561585 | 3300009147 | Bacteria | 1483 |
| 222 | Ga0114129_10592812 | 3300009147 | Bacteria | 1437 |
| 223 | Ga0105243_10529701 | 3300009148 | Bacteria | 1122 |
| 224 | Ga0105243_10664928 | 3300009148 | Bacteria | 1011 |
| 225 | Ga0105243_10700264 | 3300009148 | Bacteria | 987 |
| 226 | Ga0105241_10000556 | 3300009174 | Bacteria | 28213 |
| 227 | Ga0105241_10032736 | 3300009174 | Bacteria | 3900 |
| 228 | Ga0105241_10132625 | 3300009174 | Bacteria | 2019 |
| 229 | Ga0105241_10186445 | 3300009174 | Bacteria | 1724 |
| 230 | Ga0105241_10247469 | 3300009174 | Bacteria | 1510 |
| 231 | Ga0105242_10372422 | 3300009176 | Bacteria | 1325 |
| 232 | Ga0105248_10133219 | 3300009177 | Bacteria | 2804 |
| 233 | Ga0105248_10150577 | 3300009177 | Bacteria | 2625 |
| 234 | Ga0105248_10590387 | 3300009177 | Bacteria | 1253 |
| 235 | Ga0105237_10097243 | 3300009545 | Bacteria | 2934 |
| 236 | Ga0105237_10111662 | 3300009545 | Bacteria | 2725 |
| 237 | Ga0105237_10168161 | 3300009545 | Bacteria | 2192 |
| 238 | Ga0105237_10170183 | 3300009545 | Bacteria | 2178 |
| 239 | Ga0105237_10183771 | 3300009545 | Bacteria | 2091 |
| 240 | Ga0105237_10433976 | 3300009545 | Bacteria | 1319 |
| 241 | Ga0105237_10570293 | 3300009545 | Bacteria | 1139 |
| 242 | Ga0105238_10001118 | 3300009551 | Bacteria | 27100 |
| 243 | Ga0105238_10086110 | 3300009551 | Bacteria | 3129 |
| 244 | Ga0105238_10110294 | 3300009551 | Bacteria | 2732 |
| 245 | Ga0105238_10138686 | 3300009551 | Bacteria | 2409 |
| 246 | Ga0105238_10154557 | 3300009551 | Bacteria | 2269 |
| 247 | Ga0105238_10247070 | 3300009551 | Bacteria | 1762 |
| 248 | Ga0105238_10282193 | 3300009551 | Bacteria | 1642 |
| 249 | Ga0105238_10334621 | 3300009551 | Bacteria | 1501 |
| 250 | Ga0105238_10384886 | 3300009551 | Bacteria | 1394 |
| 251 | Ga0105238_10420114 | 3300009551 | Bacteria | 1332 |
| 252 | Ga0105238_10541106 | 3300009551 | Bacteria | 1168 |
| 253 | Ga0105238_10554773 | 3300009551 | Bacteria | 1153 |
| 254 | Ga0105249_10285936 | 3300009553 | Bacteria | 1649 |
| 255 | Ga0099796_10016406 | 3300010159 | Bacteria | 2186 |
| 256 | Ga0105239_10003377 | 3300010375 | Bacteria | 19579 |
| 257 | Ga0105239_10042482 | 3300010375 | Bacteria | 4982 |
| 258 | Ga0105239_10112770 | 3300010375 | Bacteria | 3015 |
| 259 | Ga0105239_10128295 | 3300010375 | Bacteria | 2820 |
| 260 | Ga0105239_10169787 | 3300010375 | Bacteria | 2439 |
| 261 | Ga0105239_10208890 | 3300010375 | Bacteria | 2188 |
| 262 | Ga0105239_10307425 | 3300010375 | Bacteria | 1786 |
| 263 | Ga0105239_10356443 | 3300010375 | Bacteria | 1652 |
| 264 | Ga0105239_11138764 | 3300010375 | Bacteria | 899 |
| 265 | Ga0105246_10002976 | 3300011119 | Bacteria | 10268 |
| 266 | Ga0105246_10099080 | 3300011119 | Bacteria | 2118 |
| 267 | Ga0105246_10144258 | 3300011119 | Bacteria | 1794 |
| 268 | Ga0105246_10572571 | 3300011119 | Bacteria | 971 |
| 269 | Ga0157371_10139090 | 3300013102 | Bacteria | 1730 |
| 270 | Ga0157370_10301252 | 3300013104 | Bacteria | 1480 |
| 271 | Ga0157369_10005940 | 3300013105 | Bacteria | 14174 |
| 272 | Ga0157369_10028801 | 3300013105 | Bacteria | 6143 |
| 273 | Ga0157369_10073139 | 3300013105 | Bacteria | 3678 |
| 274 | Ga0157369_10137930 | 3300013105 | Bacteria | 2581 |
| 275 | Ga0157374_10018391 | 3300013296 | Bacteria | 6166 |
| 276 | Ga0157374_10066154 | 3300013296 | Bacteria | 3397 |
| 277 | Ga0157374_10103537 | 3300013296 | Bacteria | 2731 |
| 278 | Ga0157374_10634417 | 3300013296 | Bacteria | 1080 |
| 279 | Ga0157378_10710594 | 3300013297 | Bacteria | 1025 |
| 280 | Ga0163162_10038654 | 3300013306 | Bacteria | 4763 |
| 281 | Ga0163162_10136848 | 3300013306 | Bacteria | 2561 |
| 282 | Ga0163162_10258988 | 3300013306 | Bacteria | 1871 |
| 283 | Ga0163162_10298931 | 3300013306 | Bacteria | 1742 |
| 284 | Ga0163162_10376976 | 3300013306 | Bacteria | 1552 |
| 285 | Ga0157372_10265412 | 3300013307 | Bacteria | 1994 |
| 286 | Ga0157372_10408605 | 3300013307 | Bacteria | 1582 |
| 287 | Ga0157375_10927566 | 3300013308 | Bacteria | 1014 |
| 288 | Ga0163163_10019531 | 3300014325 | Bacteria | 6365 |
| 289 | Ga0163163_10071306 | 3300014325 | Bacteria | 3462 |
| 290 | Ga0163163_10161559 | 3300014325 | Bacteria | 2286 |
| 291 | Ga0163163_10474227 | 3300014325 | Bacteria | 1312 |
| 292 | Ga0163163_10541512 | 3300014325 | Bacteria | 1226 |
| 293 | Ga0157380_10105640 | 3300014326 | Bacteria | 2354 |
| 294 | Ga0157380_11186249 | 3300014326 | Bacteria | 806 |
| 295 | Ga0157379_10552376 | 3300014968 | Bacteria | 1072 |
| 296 | Ga0157379_10562209 | 3300014968 | Bacteria | 1062 |
| 297 | Ga0157376_10153258 | 3300014969 | Bacteria | 2081 |
| 298 | Ga0157376_10163634 | 3300014969 | Bacteria | 2019 |
| 299 | Ga0163161_10203893 | 3300017792 | Bacteria | 1525 |
| 300 | Ga0163161_10319597 | 3300017792 | Bacteria | 1227 |
| 301 | Ga0163161_10549125 | 3300017792 | Bacteria | 947 |
| 302 | Ga0213872_10053657 | 3300021361 | Bacteria | 1828 |
| 303 | Ga0213872_10076345 | 3300021361 | Bacteria | 1507 |
| 304 | Ga0213876_10108649 | 3300021384 | Bacteria | 1472 |
| 305 | Ga0224712_10024362 | 3300022467 | Bacteria | 2113 |
| 306 | Ga0209564_1011241 | 3300025295 | Bacteria | 4031 |
| 307 | Ga0209758_1000030 | 3300025297 | Bacteria | 509217 |
| 308 | Ga0209758_1000884 | 3300025297 | Bacteria | 41143 |
| 309 | Ga0209758_1013214 | 3300025297 | Bacteria | 4532 |
| 310 | Ga0209758_1014853 | 3300025297 | Bacteria | 4096 |
| 311 | Ga0209758_1028563 | 3300025297 | Bacteria | 2355 |
| 312 | Ga0209758_1049175 | 3300025297 | Bacteria | 1491 |
| 313 | Ga0209758_1096754 | 3300025297 | Bacteria | 850 |
| 314 | Ga0209256_1013559 | 3300025299 | Bacteria | 3014 |
| 315 | Ga0207426_1035680 | 3300025302 | Bacteria | 1585 |
| 316 | Ga0209051_1030461 | 3300025303 | Bacteria | 2093 |
| 317 | Ga0209257_1001828 | 3300025304 | Bacteria | 23272 |
| 318 | Ga0207656_10122379 | 3300025321 | Bacteria | 1212 |
| 319 | Ga0207692_10000436 | 3300025898 | Bacteria | 14690 |
| 320 | Ga0207692_10002177 | 3300025898 | Bacteria | 7484 |
| 321 | Ga0207647_10116726 | 3300025904 | Bacteria | 1576 |
| 322 | Ga0207685_10001124 | 3300025905 | Bacteria | 5325 |
| 323 | Ga0207699_10000614 | 3300025906 | Bacteria | 17364 |
| 324 | Ga0207699_10002471 | 3300025906 | Bacteria | 8722 |
| 325 | Ga0207699_10133309 | 3300025906 | Bacteria | 1623 |
| 326 | Ga0207699_10200079 | 3300025906 | Bacteria | 1353 |
| 327 | Ga0207645_10076102 | 3300025907 | Bacteria | 2149 |
| 328 | Ga0207705_10185981 | 3300025909 | Bacteria | 1569 |
| 329 | Ga0207654_10020235 | 3300025911 | Bacteria | 3525 |
| 330 | Ga0207654_10083441 | 3300025911 | Bacteria | 1929 |
| 331 | Ga0207654_10106373 | 3300025911 | Bacteria | 1737 |
| 332 | Ga0207707_10000507 | 3300025912 | Bacteria | 40006 |
| 333 | Ga0207707_10055582 | 3300025912 | Bacteria | 3443 |
| 334 | Ga0207707_10080235 | 3300025912 | Bacteria | 2849 |
| 335 | Ga0207707_10206749 | 3300025912 | Bacteria | 1711 |
| 336 | Ga0207695_10159728 | 3300025913 | Bacteria | 2186 |
| 337 | Ga0207671_10043855 | 3300025914 | Bacteria | 3307 |
| 338 | Ga0207671_10059565 | 3300025914 | Bacteria | 2832 |
| 339 | Ga0207671_10062667 | 3300025914 | Bacteria | 2762 |
| 340 | Ga0207671_10119667 | 3300025914 | Bacteria | 2012 |
| 341 | Ga0207693_10000073 | 3300025915 | Bacteria | 89380 |
| 342 | Ga0207693_10032985 | 3300025915 | Bacteria | 4087 |
| 343 | Ga0207693_10103061 | 3300025915 | Bacteria | 2238 |
| 344 | Ga0207693_10121851 | 3300025915 | Bacteria | 2048 |
| 345 | Ga0207663_10001948 | 3300025916 | Bacteria | 9767 |
| 346 | Ga0207663_10002898 | 3300025916 | Bacteria | 8291 |
| 347 | Ga0207663_10032432 | 3300025916 | Bacteria | 3101 |
| 348 | Ga0207663_10049285 | 3300025916 | Bacteria | 2612 |
| 349 | Ga0207660_10072378 | 3300025917 | Bacteria | 2510 |
| 350 | Ga0207660_10125988 | 3300025917 | Bacteria | 1945 |
| 351 | Ga0207660_10264582 | 3300025917 | Bacteria | 1361 |
| 352 | Ga0207657_10057865 | 3300025919 | Bacteria | 3339 |
| 353 | Ga0207657_10424725 | 3300025919 | Bacteria | 1044 |
| 354 | Ga0207649_10028468 | 3300025920 | Bacteria | 3290 |
| 355 | Ga0207649_10229202 | 3300025920 | Bacteria | 1327 |
| 356 | Ga0207652_10012795 | 3300025921 | Bacteria | 6784 |
| 357 | Ga0207652_10037383 | 3300025921 | Bacteria | 4109 |
| 358 | Ga0207652_10042125 | 3300025921 | Bacteria | 3884 |
| 359 | Ga0207652_10050802 | 3300025921 | Bacteria | 3553 |
| 360 | Ga0207681_10217820 | 3300025923 | Bacteria | 1475 |
| 361 | Ga0207681_10287434 | 3300025923 | Bacteria | 1297 |
| 362 | Ga0207694_10080614 | 3300025924 | Bacteria | 2555 |
| 363 | Ga0207694_10378143 | 3300025924 | Bacteria | 1175 |
| 364 | Ga0207694_10454299 | 3300025924 | Bacteria | 1070 |
| 365 | Ga0207650_10261331 | 3300025925 | Bacteria | 1404 |
| 366 | Ga0207659_10403457 | 3300025926 | Bacteria | 1144 |
| 367 | Ga0207687_10045974 | 3300025927 | Bacteria | 3020 |
| 368 | Ga0207687_10128782 | 3300025927 | Bacteria | 1904 |
| 369 | Ga0207687_10350930 | 3300025927 | Bacteria | 1202 |
| 370 | Ga0207687_10433511 | 3300025927 | Bacteria | 1087 |
| 371 | Ga0207700_10025351 | 3300025928 | Bacteria | 4116 |
| 372 | Ga0207700_10035109 | 3300025928 | Bacteria | 3607 |
| 373 | Ga0207700_10148699 | 3300025928 | Bacteria | 1933 |
| 374 | Ga0207700_10225961 | 3300025928 | Bacteria | 1589 |
| 375 | Ga0207700_10354083 | 3300025928 | Bacteria | 1279 |
| 376 | Ga0207664_10020170 | 3300025929 | Bacteria | 4936 |
| 377 | Ga0207664_10065570 | 3300025929 | Bacteria | 2908 |
| 378 | Ga0207664_10096495 | 3300025929 | Bacteria | 2434 |
| 379 | Ga0207664_10387589 | 3300025929 | Bacteria | 1241 |
| 380 | Ga0207644_10202357 | 3300025931 | Bacteria | 1567 |
| 381 | Ga0207706_10229062 | 3300025933 | Bacteria | 1626 |
| 382 | Ga0207706_10326216 | 3300025933 | Bacteria | 1336 |
| 383 | Ga0207706_10398003 | 3300025933 | Bacteria | 1194 |
| 384 | Ga0207665_10003417 | 3300025939 | Bacteria | 10628 |
| 385 | Ga0207665_10018682 | 3300025939 | Bacteria | 4555 |
| 386 | Ga0207665_10069382 | 3300025939 | Bacteria | 2403 |
| 387 | Ga0207691_10149860 | 3300025940 | Bacteria | 2051 |
| 388 | Ga0207711_10042896 | 3300025941 | Bacteria | 3856 |
| 389 | Ga0207689_10047982 | 3300025942 | Bacteria | 3523 |
| 390 | Ga0207689_10127295 | 3300025942 | Bacteria | 2095 |
| 391 | Ga0207689_10174652 | 3300025942 | Bacteria | 1771 |
| 392 | Ga0207661_10004250 | 3300025944 | Bacteria | 10026 |
| 393 | Ga0207661_10092256 | 3300025944 | Bacteria | 2524 |
| 394 | Ga0207661_10481308 | 3300025944 | Bacteria | 1133 |
| 395 | Ga0207679_10143762 | 3300025945 | Bacteria | 1932 |
| 396 | Ga0207667_10104676 | 3300025949 | Bacteria | 2919 |
| 397 | Ga0207712_10022193 | 3300025961 | Bacteria | 4177 |
| 398 | Ga0207712_10182902 | 3300025961 | Bacteria | 1648 |
| 399 | Ga0207668_10019132 | 3300025972 | Bacteria | 4323 |
| 400 | Ga0207668_10026192 | 3300025972 | Bacteria | 3783 |
| 401 | Ga0207668_10355918 | 3300025972 | Bacteria | 1225 |
| 402 | Ga0207668_10464085 | 3300025972 | Bacteria | 1083 |
| 403 | Ga0207668_10818175 | 3300025972 | Bacteria | 825 |
| 404 | Ga0207640_10104600 | 3300025981 | Bacteria | 1993 |
| 405 | Ga0207640_10636540 | 3300025981 | Bacteria | 907 |
| 406 | Ga0207658_10310948 | 3300025986 | Bacteria | 1361 |
| 407 | Ga0207677_10052950 | 3300026023 | Bacteria | 2760 |
| 408 | Ga0207703_10653425 | 3300026035 | Bacteria | 998 |
| 409 | Ga0207639_10105575 | 3300026041 | Bacteria | 2285 |
| 410 | Ga0207639_10144980 | 3300026041 | Bacteria | 1983 |
| 411 | Ga0207639_10156688 | 3300026041 | Bacteria | 1914 |
| 412 | Ga0207639_10258721 | 3300026041 | Bacteria | 1521 |
| 413 | Ga0207639_10441924 | 3300026041 | Bacteria | 1179 |
| 414 | Ga0207678_10083144 | 3300026067 | Bacteria | 2738 |
| 415 | Ga0207678_10163527 | 3300026067 | Bacteria | 1901 |
| 416 | Ga0207678_10169863 | 3300026067 | Bacteria | 1862 |
| 417 | Ga0207678_10203857 | 3300026067 | Bacteria | 1692 |
| 418 | Ga0207678_10357457 | 3300026067 | Bacteria | 1260 |
| 419 | Ga0207678_10401509 | 3300026067 | Bacteria | 1187 |
| 420 | Ga0207708_10113453 | 3300026075 | Bacteria | 2106 |
| 421 | Ga0207702_10119190 | 3300026078 | Bacteria | 2359 |
| 422 | Ga0207702_10155056 | 3300026078 | Bacteria | 2087 |
| 423 | Ga0207648_10134888 | 3300026089 | Bacteria | 2174 |
| 424 | Ga0207648_10516731 | 3300026089 | Bacteria | 1094 |
| 425 | Ga0207648_10761624 | 3300026089 | Bacteria | 900 |
| 426 | Ga0207676_10277787 | 3300026095 | Bacteria | 1519 |
| 427 | Ga0207676_10392255 | 3300026095 | Bacteria | 1295 |
| 428 | Ga0207676_10425726 | 3300026095 | Bacteria | 1246 |
| 429 | Ga0207674_10078797 | 3300026116 | Bacteria | 3300 |
| 430 | Ga0207674_10083483 | 3300026116 | Bacteria | 3194 |
| 431 | Ga0207674_10098474 | 3300026116 | Bacteria | 2907 |
| 432 | Ga0207674_10113272 | 3300026116 | Bacteria | 2685 |
| 433 | Ga0207674_10553834 | 3300026116 | Bacteria | 1111 |
| 434 | Ga0207674_10705396 | 3300026116 | Bacteria | 974 |
| 435 | Ga0207675_100076998 | 3300026118 | Bacteria | 3124 |
| 436 | Ga0207675_100197830 | 3300026118 | Bacteria | 1930 |
| 437 | Ga0207675_100299981 | 3300026118 | Bacteria | 1565 |
| 438 | Ga0207675_100454934 | 3300026118 | Bacteria | 1269 |
| 439 | Ga0207683_10057555 | 3300026121 | Bacteria | 3412 |
| 440 | Ga0207683_10083768 | 3300026121 | Bacteria | 2834 |
| 441 | Ga0207698_10013313 | 3300026142 | Bacteria | 5423 |
| 442 | Ga0207698_10423277 | 3300026142 | Bacteria | 1278 |
| 443 | Ga0207698_10892715 | 3300026142 | Bacteria | 896 |
| 444 | Ga0209179_1002213 | 3300027512 | Bacteria | 2584 |
| 445 | Ga0209588_1061257 | 3300027671 | Bacteria | 1216 |
| 446 | Ga0207428_10226313 | 3300027907 | Bacteria | 1401 |
| 447 | Ga0268266_10002115 | 3300028379 | Bacteria | 21933 |
| 448 | Ga0268266_10005468 | 3300028379 | Bacteria | 11831 |
| 449 | Ga0268266_10007493 | 3300028379 | Bacteria | 9840 |
| 450 | Ga0268266_10035845 | 3300028379 | Bacteria | 4219 |
| 451 | Ga0268266_10217397 | 3300028379 | Bacteria | 1755 |
| 452 | Ga0268266_10486223 | 3300028379 | Bacteria | 1177 |
| 453 | Ga0268266_10636860 | 3300028379 | Bacteria | 1025 |
| 454 | Ga0268265_10016419 | 3300028380 | Bacteria | 5085 |
| 455 | Ga0268265_10168406 | 3300028380 | Bacteria | 1869 |
| 456 | Ga0268265_10349102 | 3300028380 | Bacteria | 1350 |
| 457 | Ga0265334_10021370 | 3300028573 | Bacteria | 2643 |
| 458 | Ga0307517_10056003 | 3300028786 | Bacteria | 3857 |
| 459 | Ga0307515_10237437 | 3300028794 | Bacteria | 1601 |
| 460 | Ga0265330_10014874 | 3300031235 | Bacteria | 3606 |
| 461 | Ga0265325_10030084 | 3300031241 | Bacteria | 2914 |
| 462 | Ga0265340_10002860 | 3300031247 | Bacteria | 9822 |
| 463 | Ga0265339_10037194 | 3300031249 | Bacteria | 2721 |
| 464 | Ga0265331_10018235 | 3300031250 | Bacteria | 3646 |
| 465 | Ga0307408_100226380 | 3300031548 | Bacteria | 1529 |
| 466 | Ga0307508_10093722 | 3300031616 | Bacteria | 2593 |
| 467 | Ga0265314_10217802 | 3300031711 | Bacteria | 1116 |
| 468 | Ga0265314_10352715 | 3300031711 | Bacteria | 809 |
| 469 | Ga0265342_10022589 | 3300031712 | Bacteria | 3997 |
| 470 | Ga0307516_10007789 | 3300031730 | Bacteria | 12230 |
| 471 | Ga0307412_10019253 | 3300031911 | Bacteria | 4128 |
| 472 | Ga0307412_10279613 | 3300031911 | Bacteria | 1310 |
| 473 | Ga0307409_100029443 | 3300031995 | Bacteria | 3930 |
| 474 | Ga0307411_10237681 | 3300032005 | Bacteria | 1424 |
| 475 | Ga0307415_100172915 | 3300032126 | Bacteria | 1686 |
| 476 | Ga0307415_100348384 | 3300032126 | Bacteria | 1246 |
| 477 | Ga0307415_100595362 | 3300032126 | Bacteria | 983 |
| 478 | Ga0307510_10015013 | 3300033180 | Bacteria | 9158 |
| 479 | Ga0307510_10054988 | 3300033180 | Bacteria | 4162 |
| 480 | Ga0307510_10056817 | 3300033180 | Bacteria | 4069 |
| 481 | Ga0373930_0014806 | 3300034816 | Bacteria | 1457 |
| 482 | Ga0373938_0038472 | 3300034957 | Bacteria | 1055 |
| 483 | Ga0373929_0004687 | 3300035085 | Bacteria | 2452 |
| 484 | Ga0373952_0013818 | 3300035092 | Bacteria | 1608 |
| 485 | Ga0373923_0005306 | 3300035111 | Bacteria | 4371 |
| 486 | Ga0373923_0184773 | 3300035111 | Bacteria | 959 |
| 487 | Ga0373923_0220991 | 3300035111 | Bacteria | 880 |
| 488 | Ga0373936_0018702 | 3300035113 | Bacteria | 2678 |
| 489 | Ga0373936_0104672 | 3300035113 | Bacteria | 1197 |
| 490 | Ga0373936_0112795 | 3300035113 | Bacteria | 1155 |
| 491 | Ga0373936_0170223 | 3300035113 | Bacteria | 952 |
| 492 | Ga0373945_0023924 | 3300035116 | Bacteria | 2113 |
| 493 | Ga0373954_0127749 | 3300035118 | Bacteria | 1236 |
| 494 | Ga0373943_0001689 | 3300035170 | Bacteria | 10015 |
| 495 | Ga0373943_0007773 | 3300035170 | Bacteria | 4815 |
| 496 | Ga0373946_0037280 | 3300035171 | Bacteria | 1975 |
| 497 | Ga0373946_0092646 | 3300035171 | Bacteria | 1341 |
| 498 | Ga0373955_0009621 | 3300035172 | Bacteria | 4537 |
| 499 | Ga0373924_0016286 | 3300035410 | Bacteria | 2837 |
| 500 | Ga0373924_0145123 | 3300035410 | Bacteria | 1036 |
| 501 | Ga0373931_0008046 | 3300035691 | Bacteria | 4988 |
| 502 | Ga0373931_0175853 | 3300035691 | Bacteria | 1264 |
| 503 | Ga0373935_0000475 | 3300035692 | Bacteria | 20819 |
| 504 | Ga0373935_0103513 | 3300035692 | Bacteria | 1880 |
| 505 | Ga0373935_0183394 | 3300035692 | Bacteria | 1438 |
| 506 | Ga0373935_0211160 | 3300035692 | Bacteria | 1345 |
| 507 | Ga0373927_0000109 | 3300035695 | Bacteria | 62878 |
| 508 | Ga0373933_0000277 | 3300035724 | Bacteria | 33337 |
| 509 | Ga0373933_0085318 | 3300035724 | Bacteria | 1941 |
| 510 | Ga0373947_0001517 | 3300035725 | Bacteria | 14225 |
| 511 | Ga0373947_0013161 | 3300035725 | Bacteria | 4741 |
| 512 | Ga0373947_0019778 | 3300035725 | Bacteria | 3885 |
| 513 | Ga0373947_0228775 | 3300035725 | Bacteria | 1224 |
| 514 | Ga0373947_0240679 | 3300035725 | Bacteria | 1194 |
| 515 | Ga0373947_0579388 | 3300035725 | Bacteria | 764 |
| 516 | Ga0373937_0115871 | 3300036401 | Bacteria | 2495 |
| 517 | Ga0373937_0349958 | 3300036401 | Bacteria | 1399 |
| 518 | Ga0373937_0566891 | 3300036401 | Bacteria | 1078 |
| 519 | Ga0373925_0003850 | 3300037068 | Bacteria | 11496 |
| 520 | Ga0373925_0007819 | 3300037068 | Bacteria | 7787 |
| 521 | Ga0373925_0252316 | 3300037068 | Bacteria | 1415 |
| 522 | Ga0373925_0621399 | 3300037068 | Bacteria | 890 |
| 523 | Ga0395898_0034807 | 3300037466 | Bacteria | 5014 |
| 524 | Ga0395898_0080064 | 3300037466 | Bacteria | 3151 |
| 525 | Ga0395898_0106656 | 3300037466 | Bacteria | 2687 |
| 526 | Ga0395905_0004328 | 3300037471 | Bacteria | 14793 |
| 527 | Ga0395905_0216871 | 3300037471 | Bacteria | 1792 |
| 528 | Ga0436364_0471855 | 3300037853 | Bacteria | 2847 |
| 529 | Ga0436365_0201120 | 3300039437 | Bacteria | 952 |
| 530 | Ga0436365_0831055 | 3300039437 | Bacteria | 918 |
| 531 | Ga0436365_1327145 | 3300039437 | Bacteria | 20947 |
| 532 | Ga0436365_1407698 | 3300039437 | Bacteria | 1783 |
| 533 | Ga0436365_1666708 | 3300039437 | Bacteria | 809 |
| 534 | Ga0436360_0864835 | 3300039438 | Bacteria | 1157 |
| 535 | Ga0436360_1095564 | 3300039438 | Bacteria | 1089 |
| 536 | Ga0436360_1115343 | 3300039438 | Bacteria | 1147 |
| 537 | Ga0436361_0433301 | 3300039447 | Bacteria | 1497 |
| 538 | Ga0436361_0645745 | 3300039447 | Bacteria | 4065 |
| 539 | Ga0436363_1013469 | 3300039450 | Bacteria | 1099 |
| 540 | Ga0436363_1556259 | 3300039450 | Bacteria | 810 |
| 541 | Ga0436362_0970073 | 3300039453 | Bacteria | 2268 |
| 542 | Ga0451787_602466 | 3300041441 | Bacteria | 1332 |
| 543 | Ga0451789_1147981 | 3300041443 | Bacteria | 1223 |
| 544 | Ga0451804_0580637 | 3300041463 | Bacteria | 820 |
| 545 | Ga0451853_2831650 | 3300041512 | Bacteria | 1528 |
| 546 | Ga0439431_0109467 | 3300041997 | Bacteria | 764 |
| 547 | Ga0466969_0057271 | 3300044656 | Bacteria | 1900 |
| 548 | Ga0466966_0022110 | 3300044684 | Bacteria | 4176 |
| 549 | Ga0466966_0084491 | 3300044684 | Bacteria | 1974 |
| 550 | Ga0466966_0119129 | 3300044684 | Bacteria | 1623 |
| 551 | Ga0466961_0052071 | 3300044693 | Bacteria | 2613 |
| 552 | Ga0466971_0054614 | 3300044719 | Bacteria | 1800 |
| 553 | Ga0466970_0248176 | 3300044765 | Bacteria | 997 |
| 554 | Ga0466959_0018092 | 3300045049 | Bacteria | 5171 |
| 555 | Ga0466959_0214864 | 3300045049 | Bacteria | 1335 |
| 556 | Ga0466958_0025627 | 3300045836 | Bacteria | 3479 |
| 557 | Ga0466967_0053967 | 3300045976 | Bacteria | 3535 |
| 558 | Ga0466967_0263263 | 3300045976 | Bacteria | 1650 |
| 559 | Ga0466967_0294824 | 3300045976 | Bacteria | 1559 |
| 560 | Ga0466967_0367889 | 3300045976 | Bacteria | 1394 |
| 561 | Ga0495617_051112 | 3300046452 | Bacteria | 1374 |
| 562 | Ga0495617_060442 | 3300046452 | Bacteria | 1254 |
| 563 | Ga0495592_0004987 | 3300046454 | Bacteria | 9771 |
| 564 | Ga0495603_0001679 | 3300046455 | Bacteria | 13001 |
| 565 | Ga0495603_0003381 | 3300046455 | Bacteria | 9500 |
| 566 | Ga0495603_0046481 | 3300046455 | Bacteria | 2586 |
| 567 | Ga0495603_0053009 | 3300046455 | Bacteria | 2407 |
| 568 | Ga0495603_0388102 | 3300046455 | Bacteria | 800 |
| 569 | Ga0495603_0423078 | 3300046455 | Bacteria | 763 |
| 570 | Ga0495590_0057949 | 3300046457 | Bacteria | 1354 |
| 571 | Ga0495590_0117987 | 3300046457 | Bacteria | 950 |
| 572 | Ga0495629_0010559 | 3300046459 | Bacteria | 6720 |
| 573 | Ga0495629_0095261 | 3300046459 | Bacteria | 2077 |
| 574 | Ga0495629_0171081 | 3300046459 | Bacteria | 1507 |
| 575 | Ga0495629_0286934 | 3300046459 | Bacteria | 1129 |
| 576 | Ga0495638_0037250 | 3300046460 | Bacteria | 3094 |
| 577 | Ga0495641_0025626 | 3300046461 | Bacteria | 2892 |
| 578 | Ga0495651_0029565 | 3300046462 | Bacteria | 4274 |
| 579 | Ga0495650_0058205 | 3300046471 | Bacteria | 1561 |
| 580 | Ga0495580_0002333 | 3300046472 | Bacteria | 16564 |
| 581 | Ga0495580_0081554 | 3300046472 | Bacteria | 2254 |
| 582 | Ga0495582_0000356 | 3300046473 | Bacteria | 25036 |
| 583 | Ga0495582_0139807 | 3300046473 | Bacteria | 1372 |
| 584 | Ga0495582_0256351 | 3300046473 | Bacteria | 1003 |
| 585 | Ga0495605_0094532 | 3300046474 | Bacteria | 1381 |
| 586 | Ga0495639_0000342 | 3300046475 | Bacteria | 22483 |
| 587 | Ga0495639_0006414 | 3300046475 | Bacteria | 5061 |
| 588 | Ga0495639_0122476 | 3300046475 | Bacteria | 1241 |
| 589 | Ga0495662_0000005 | 3300046476 | Bacteria | 81157 |
| 590 | Ga0495664_0023641 | 3300046477 | Bacteria | 3567 |
| 591 | Ga0495664_0035701 | 3300046477 | Bacteria | 2928 |
| 592 | Ga0495664_0201665 | 3300046477 | Bacteria | 1205 |
| 593 | Ga0495664_0468535 | 3300046477 | Bacteria | 753 |
| 594 | Ga0495584_0079196 | 3300046491 | Bacteria | 1653 |
| 595 | Ga0495585_0078301 | 3300046492 | Bacteria | 1793 |
| 596 | Ga0495594_0000263 | 3300046499 | Bacteria | 25757 |
| 597 | Ga0495594_0071459 | 3300046499 | Bacteria | 1930 |
| 598 | Ga0495607_0083053 | 3300046501 | Bacteria | 1756 |
| 599 | Ga0495607_0097251 | 3300046501 | Bacteria | 1583 |
| 600 | Ga0495606_0013910 | 3300046507 | Bacteria | 6317 |
| 601 | Ga0495606_0097967 | 3300046507 | Bacteria | 1790 |
| 602 | Ga0495606_0099295 | 3300046507 | Bacteria | 1775 |
| 603 | Ga0495606_0332465 | 3300046507 | Bacteria | 812 |
| 604 | Ga0495608_0158356 | 3300046511 | Bacteria | 1441 |
| 605 | Ga0495610_0024830 | 3300046512 | Bacteria | 3228 |
| 606 | Ga0495616_0023169 | 3300046513 | Bacteria | 3343 |
| 607 | Ga0495618_0087877 | 3300046514 | Bacteria | 1988 |
| 608 | Ga0495618_0268284 | 3300046514 | Bacteria | 1067 |
| 609 | Ga0495620_0020567 | 3300046515 | Bacteria | 3222 |
| 610 | Ga0495620_0079912 | 3300046515 | Bacteria | 1324 |
| 611 | Ga0495628_0051527 | 3300046516 | Bacteria | 3254 |
| 612 | Ga0495628_0068114 | 3300046516 | Bacteria | 2778 |
| 613 | Ga0495630_0035088 | 3300046517 | Bacteria | 3748 |
| 614 | Ga0495630_0043430 | 3300046517 | Bacteria | 3358 |
| 615 | Ga0495631_0067460 | 3300046518 | Bacteria | 1547 |
| 616 | Ga0495632_0063467 | 3300046519 | Bacteria | 1788 |
| 617 | Ga0495632_0064468 | 3300046519 | Bacteria | 1771 |
| 618 | Ga0495637_0018711 | 3300046520 | Bacteria | 3209 |
| 619 | Ga0495637_0032860 | 3300046520 | Bacteria | 2283 |
| 620 | Ga0495644_0107657 | 3300046523 | Bacteria | 1057 |
| 621 | Ga0495648_0028166 | 3300046524 | Bacteria | 3746 |
| 622 | Ga0495663_0032967 | 3300046525 | Bacteria | 1545 |
| 623 | Ga0495663_0089388 | 3300046525 | Bacteria | 1002 |
| 624 | Ga0495666_0032504 | 3300046526 | Bacteria | 2553 |
| 625 | Ga0495666_0062713 | 3300046526 | Bacteria | 1775 |
| 626 | Ga0495666_0122385 | 3300046526 | Bacteria | 1218 |
| 627 | Ga0495642_0154386 | 3300046528 | Bacteria | 994 |
| 628 | Ga0495652_0199499 | 3300046529 | Bacteria | 1519 |
| 629 | Ga0495654_0027297 | 3300046530 | Bacteria | 2928 |
| 630 | Ga0495654_0079788 | 3300046530 | Bacteria | 1537 |
| 631 | Ga0495665_0000037 | 3300046531 | Bacteria | 52348 |
| 632 | Ga0495665_0032996 | 3300046531 | Bacteria | 2769 |
| 633 | Ga0495640_0025913 | 3300046533 | Bacteria | 4246 |
| 634 | Ga0495640_0095544 | 3300046533 | Bacteria | 1956 |
| 635 | Ga0495586_0034451 | 3300046535 | Bacteria | 2720 |
| 636 | Ga0495621_0028989 | 3300046539 | Bacteria | 1885 |
| 637 | Ga0495597_0007237 | 3300046542 | Bacteria | 5654 |
| 638 | Ga0495597_0169573 | 3300046542 | Bacteria | 887 |
| 639 | Ga0495645_0088806 | 3300046543 | Bacteria | 2210 |
| 640 | Ga0495645_0203885 | 3300046543 | Bacteria | 1340 |
| 641 | Ga0495622_0000861 | 3300046557 | Bacteria | 16648 |
| 642 | Ga0495622_0030639 | 3300046557 | Bacteria | 2514 |
| 643 | Ga0495622_0051589 | 3300046557 | Bacteria | 1908 |
| 644 | Ga0495633_0044955 | 3300046558 | Bacteria | 2092 |
| 645 | Ga0495656_0009178 | 3300046615 | Bacteria | 3552 |
| 646 | Ga0495656_0251749 | 3300046615 | Bacteria | 892 |
| 647 | Ga0495656_0288306 | 3300046615 | Bacteria | 838 |
| 648 | Ga0495668_0061597 | 3300046616 | Bacteria | 2069 |
| 649 | Ga0495668_0096975 | 3300046616 | Bacteria | 1613 |
| 650 | Ga0495634_0001407 | 3300046642 | Bacteria | 21535 |
| 651 | Ga0495634_0025636 | 3300046642 | Bacteria | 4119 |
| 652 | Ga0495611_0028577 | 3300046648 | Bacteria | 2443 |
| 653 | Ga0495611_0090333 | 3300046648 | Bacteria | 1415 |
| 654 | Ga0495625_0119524 | 3300046660 | Bacteria | 1794 |
| 655 | Ga0495625_0182692 | 3300046660 | Bacteria | 1393 |
| 656 | Ga0495635_0001096 | 3300046663 | Bacteria | 17974 |
| 657 | Ga0495659_0004176 | 3300046664 | Bacteria | 4557 |
| 658 | Ga0495659_0032717 | 3300046664 | Bacteria | 1822 |
| 659 | Ga0495661_0026266 | 3300046665 | Bacteria | 3751 |
| 660 | Ga0495588_0038439 | 3300046674 | Bacteria | 2434 |
| 661 | Ga0495588_0267126 | 3300046674 | Bacteria | 901 |
| 662 | Ga0495588_0433605 | 3300046674 | Bacteria | 690 |
| 663 | Ga0495657_0451997 | 3300046675 | Bacteria | 752 |
| 664 | Ga0495599_0027648 | 3300046678 | Bacteria | 3554 |
| 665 | Ga0495647_0001874 | 3300046681 | Bacteria | 6537 |
| 666 | Ga0495658_0002684 | 3300046683 | Bacteria | 8956 |
| 667 | Ga0495658_0002728 | 3300046683 | Bacteria | 8878 |
| 668 | Ga0495669_0043979 | 3300046684 | Bacteria | 1989 |
| 669 | Ga0495669_0236242 | 3300046684 | Bacteria | 877 |
| 670 | Ga0495613_0126013 | 3300046689 | Bacteria | 1836 |
| 671 | Ga0495624_0054409 | 3300046690 | Bacteria | 2523 |
| 672 | Ga0495624_0117693 | 3300046690 | Bacteria | 1632 |
| 673 | Ga0495624_0355074 | 3300046690 | Bacteria | 881 |
| 674 | Ga0495624_0448501 | 3300046690 | Bacteria | 773 |
| 675 | Ga0495670_0189595 | 3300046691 | Bacteria | 1087 |
| 676 | Ga0495649_0185104 | 3300046694 | Bacteria | 1085 |
| 677 | Ga0495600_0280933 | 3300046809 | Bacteria | 1054 |
| 678 | Ga0495600_0288525 | 3300046809 | Bacteria | 1037 |
| 679 | Ga0495660_0018232 | 3300046810 | Bacteria | 4034 |
| 680 | Ga0495581_0000178 | 3300047315 | Bacteria | 29093 |
| 681 | Ga0495581_0132368 | 3300047315 | Bacteria | 1453 |
| 682 | Ga0495581_0198780 | 3300047315 | Bacteria | 1173 |
| 683 | Ga0495604_0148605 | 3300047317 | Bacteria | 1667 |
| 684 | Ga0495636_0209625 | 3300047318 | Bacteria | 892 |
| 685 | Ga0495674_0002753 | 3300047319 | Bacteria | 17057 |
| 686 | Ga0495674_0010388 | 3300047319 | Bacteria | 8815 |
| 687 | Ga0495676_0003500 | 3300047321 | Bacteria | 14215 |
| 688 | Ga0495677_0033145 | 3300047445 | Bacteria | 1882 |
| 689 | Ga0495677_0073373 | 3300047445 | Bacteria | 1277 |
| 690 | Ga0495681_0096873 | 3300047470 | Bacteria | 1295 |
| 691 | Ga0495684_0215685 | 3300047471 | Bacteria | 1409 |
| 692 | Ga0495686_0133873 | 3300047472 | Bacteria | 1468 |
| 693 | Ga0495686_0339679 | 3300047472 | Bacteria | 819 |
| 694 | Ga0495593_0000316 | 3300047673 | Bacteria | 26624 |
| 695 | Ga0495602_0493524 | 3300048088 | Bacteria | 857 |
| 696 | Ga0495614_0049870 | 3300048089 | Bacteria | 1794 |
| 697 | Ga0496100_0079126 | 3300048903 | Bacteria | 2214 |
| 698 | Ga0496100_0101064 | 3300048903 | Bacteria | 1987 |
| 699 | Ga0496100_0420784 | 3300048903 | Bacteria | 1020 |
| 700 | Ga0496101_0017667 | 3300048904 | Bacteria | 4838 |
| 701 | Ga0496101_0023257 | 3300048904 | Bacteria | 4279 |
| 702 | Ga0496101_0303031 | 3300048904 | Bacteria | 1252 |
| 703 | Ga0496102_0003027 | 3300048905 | Bacteria | 14230 |
| 704 | Ga0496102_0024703 | 3300048905 | Bacteria | 5344 |
| 705 | Ga0496102_0167118 | 3300048905 | Bacteria | 2070 |
| 706 | Ga0496102_0277000 | 3300048905 | Bacteria | 1581 |
| 707 | Ga0496102_0280038 | 3300048905 | Bacteria | 1572 |
| 708 | Ga0496102_0377173 | 3300048905 | Bacteria | 1335 |
| 709 | Ga0496102_0578148 | 3300048905 | Bacteria | 1046 |
| 710 | Ga0496103_0072723 | 3300048906 | Bacteria | 2154 |
| 711 | Ga0496103_0099203 | 3300048906 | Bacteria | 1842 |
| 712 | Ga0496103_0179617 | 3300048906 | Bacteria | 1360 |
| 713 | Ga0496104_0014468 | 3300048907 | Bacteria | 7127 |
| 714 | Ga0496104_0019263 | 3300048907 | Bacteria | 6241 |
| 715 | Ga0496104_0054721 | 3300048907 | Bacteria | 3772 |
| 716 | Ga0496104_0093417 | 3300048907 | Bacteria | 2877 |
| 717 | Ga0496104_0107933 | 3300048907 | Bacteria | 2667 |
| 718 | Ga0496104_0273197 | 3300048907 | Bacteria | 1603 |
| 719 | Ga0496105_0006909 | 3300048908 | Bacteria | 8737 |
| 720 | Ga0496105_0011852 | 3300048908 | Bacteria | 6904 |
| 721 | Ga0496105_0090835 | 3300048908 | Bacteria | 2522 |
| 722 | Ga0496106_0004540 | 3300048909 | Bacteria | 10285 |
| 723 | Ga0496106_0005100 | 3300048909 | Bacteria | 9726 |
| 724 | Ga0496106_0007097 | 3300048909 | Bacteria | 8280 |
| 725 | Ga0496106_0109397 | 3300048909 | Bacteria | 2150 |
| 726 | Ga0496106_0181291 | 3300048909 | Bacteria | 1672 |
| 727 | Ga0496106_0433704 | 3300048909 | Bacteria | 1056 |
| 728 | Ga0496107_0002745 | 3300048910 | Bacteria | 11577 |
| 729 | Ga0496107_0003195 | 3300048910 | Bacteria | 10892 |
| 730 | Ga0496107_0031112 | 3300048910 | Bacteria | 3806 |
| 731 | Ga0496107_0090699 | 3300048910 | Bacteria | 2233 |
| 732 | Ga0496107_0138332 | 3300048910 | Bacteria | 1800 |
| 733 | Ga0496108_0004363 | 3300048911 | Bacteria | 11379 |
| 734 | Ga0496108_0009717 | 3300048911 | Bacteria | 7797 |
| 735 | Ga0496108_0104574 | 3300048911 | Bacteria | 2416 |
| 736 | Ga0496108_0154543 | 3300048911 | Bacteria | 1981 |
| 737 | Ga0496108_0256962 | 3300048911 | Bacteria | 1520 |
| 738 | Ga0496109_0001464 | 3300048912 | Bacteria | 19584 |
| 739 | Ga0496109_0046938 | 3300048912 | Bacteria | 3925 |
| 740 | Ga0496109_0398998 | 3300048912 | Bacteria | 1299 |
| 741 | Ga0496109_0576579 | 3300048912 | Bacteria | 1060 |
| 742 | Ga0496110_0018896 | 3300048913 | Bacteria | 5790 |
| 743 | Ga0496110_0034712 | 3300048913 | Bacteria | 4371 |
| 744 | Ga0496110_0044223 | 3300048913 | Bacteria | 3889 |
| 745 | Ga0496110_0415291 | 3300048913 | Bacteria | 1227 |
| 746 | Ga0496111_0001578 | 3300048914 | Bacteria | 13162 |
| 747 | Ga0496111_0128769 | 3300048914 | Bacteria | 1872 |
| 748 | Ga0496111_0136694 | 3300048914 | Bacteria | 1815 |
| 749 | Ga0496111_0348072 | 3300048914 | Bacteria | 1097 |
| 750 | Ga0496111_0561916 | 3300048914 | Bacteria | 837 |
| 751 | Ga0496112_0000065 | 3300048915 | Bacteria | 70119 |
| 752 | Ga0496112_0005294 | 3300048915 | Bacteria | 11127 |
| 753 | Ga0496112_0019830 | 3300048915 | Bacteria | 6361 |
| 754 | Ga0496112_0041342 | 3300048915 | Bacteria | 4510 |
| 755 | Ga0496112_0064118 | 3300048915 | Bacteria | 3625 |
| 756 | Ga0496112_0065401 | 3300048915 | Bacteria | 3588 |
| 757 | Ga0496112_0066165 | 3300048915 | Bacteria | 3566 |
| 758 | Ga0496112_0183798 | 3300048915 | Bacteria | 2054 |
| 759 | Ga0496113_0025148 | 3300048916 | Bacteria | 4241 |
| 760 | Ga0496113_0043570 | 3300048916 | Bacteria | 3321 |
| 761 | Ga0496113_0070739 | 3300048916 | Bacteria | 2653 |
| 762 | Ga0496114_0027122 | 3300048917 | Bacteria | 4691 |
| 763 | Ga0496114_0046631 | 3300048917 | Bacteria | 3602 |
| 764 | Ga0496114_0054221 | 3300048917 | Bacteria | 3344 |
| 765 | Ga0496114_0176681 | 3300048917 | Bacteria | 1863 |
| 766 | Ga0496115_0001194 | 3300048918 | Bacteria | 18622 |
| 767 | Ga0496115_0025527 | 3300048918 | Bacteria | 4601 |
| 768 | Ga0496115_0027413 | 3300048918 | Bacteria | 4456 |
| 769 | Ga0496115_0038350 | 3300048918 | Bacteria | 3802 |
| 770 | Ga0496115_0095642 | 3300048918 | Bacteria | 2432 |
| 771 | Ga0496115_0128410 | 3300048918 | Bacteria | 2089 |
| 772 | Ga0496115_0143795 | 3300048918 | Bacteria | 1968 |
| 773 | Ga0496115_0290849 | 3300048918 | Bacteria | 1340 |
| 774 | Ga0496115_0302568 | 3300048918 | Bacteria | 1310 |
| 775 | Ga0496115_0638897 | 3300048918 | Bacteria | 842 |
| 776 | Ga0496116_0225608 | 3300048919 | Bacteria | 955 |
| 777 | Ga0496117_0061880 | 3300048920 | Bacteria | 2569 |
| 778 | Ga0496117_0096250 | 3300048920 | Bacteria | 1889 |
| 779 | Ga0496117_0192788 | 3300048920 | Bacteria | 1159 |
| 780 | Ga0496118_0001252 | 3300048921 | Bacteria | 39012 |
| 781 | Ga0496118_0087469 | 3300048921 | Bacteria | 2161 |
| 782 | Ga0496118_0093433 | 3300048921 | Bacteria | 2060 |
| 783 | Ga0496119_0148946 | 3300048922 | Bacteria | 1256 |
| 784 | Ga0496121_0002583 | 3300048924 | Bacteria | 27387 |
| 785 | Ga0496121_0003137 | 3300048924 | Bacteria | 23845 |
| 786 | Ga0496121_0060827 | 3300048924 | Bacteria | 3104 |
| 787 | Ga0496121_0127753 | 3300048924 | Bacteria | 1908 |
| 788 | Ga0496121_0279929 | 3300048924 | Bacteria | 1141 |
| 789 | Ga0496121_0305176 | 3300048924 | Bacteria | 1078 |
| 790 | Ga0496122_0018007 | 3300048925 | Bacteria | 6552 |
| 791 | Ga0496122_0152571 | 3300048925 | Bacteria | 1423 |
| 792 | Ga0496124_0001521 | 3300048927 | Bacteria | 33784 |
| 793 | Ga0496124_0115453 | 3300048927 | Bacteria | 2154 |
| 794 | Ga0496124_0138334 | 3300048927 | Bacteria | 1925 |
| 795 | Ga0496124_0274396 | 3300048927 | Bacteria | 1233 |
| 796 | Ga0496125_0005379 | 3300048928 | Bacteria | 14274 |
| 797 | Ga0496125_0077146 | 3300048928 | Bacteria | 2570 |
| 798 | Ga0496125_0218855 | 3300048928 | Bacteria | 1229 |
| 799 | Ga0496126_0011417 | 3300048929 | Bacteria | 9199 |
| 800 | Ga0496126_0018774 | 3300048929 | Bacteria | 6838 |
| 801 | Ga0496126_0038684 | 3300048929 | Bacteria | 4435 |
| 802 | Ga0496126_0042154 | 3300048929 | Bacteria | 4216 |
| 803 | Ga0496126_0088042 | 3300048929 | Bacteria | 2736 |
| 804 | Ga0496126_0115460 | 3300048929 | Bacteria | 2334 |
| 805 | Ga0496126_0127003 | 3300048929 | Bacteria | 2206 |
| 806 | Ga0496126_0139463 | 3300048929 | Bacteria | 2088 |
| 807 | Ga0496126_0144347 | 3300048929 | Bacteria | 2046 |
| 808 | Ga0496126_0171536 | 3300048929 | Bacteria | 1848 |
| 809 | Ga0496126_0254205 | 3300048929 | Bacteria | 1463 |
| 810 | Ga0496126_0407511 | 3300048929 | Bacteria | 1101 |
| 811 | Ga0496126_0414539 | 3300048929 | Bacteria | 1090 |
| 812 | Ga0495682_0011591 | 3300049460 | Bacteria | 3391 |
| 813 | Ga0495682_0190965 | 3300049460 | Bacteria | 727 |
| 814 | Ga0501031_0041557 | 3300049568 | Bacteria | 3001 |
| 815 | Ga0501032_0000309 | 3300049569 | Bacteria | 41024 |
| 816 | Ga0501033_0001152 | 3300049570 | Bacteria | 23889 |
| 817 | Ga0501034_0000082 | 3300049571 | Bacteria | 170039 |
| 818 | Ga0501036_0000121 | 3300049572 | Bacteria | 48901 |
| 819 | Ga0501037_0000298 | 3300049573 | Bacteria | 41924 |
| 820 | Ga0501038_0000089 | 3300049574 | Bacteria | 78009 |
| 821 | Ga0501039_0003149 | 3300049575 | Bacteria | 12346 |
| 822 | Ga0501042_0071949 | 3300049578 | Bacteria | 2474 |
| 823 | Ga0501043_0000109 | 3300049579 | Bacteria | 77120 |
| 824 | Ga0501046_0001498 | 3300049580 | Bacteria | 22323 |
| 825 | Ga0501047_0000331 | 3300049581 | Bacteria | 54371 |
| 826 | Ga0501048_0000124 | 3300049582 | Bacteria | 44765 |
| 827 | Ga0501048_0506215 | 3300049582 | Bacteria | 866 |
| 828 | Ga0501067_0000754 | 3300049583 | Bacteria | 17403 |
| 829 | Ga0501067_0047779 | 3300049583 | Bacteria | 2374 |
| 830 | Ga0501067_0098290 | 3300049583 | Bacteria | 1626 |
| 831 | Ga0501068_0002837 | 3300049584 | Bacteria | 9217 |
| 832 | Ga0501069_0049227 | 3300049585 | Bacteria | 2342 |
| 833 | Ga0501069_0110475 | 3300049585 | Bacteria | 1565 |
| 834 | Ga0501070_0008306 | 3300049586 | Bacteria | 8773 |
| 835 | Ga0501070_0027444 | 3300049586 | Bacteria | 4776 |
| 836 | Ga0501071_0095223 | 3300049587 | Bacteria | 2191 |
| 837 | Ga0501072_0005612 | 3300049588 | Bacteria | 9547 |
| 838 | Ga0501073_0003213 | 3300049589 | Bacteria | 12268 |
| 839 | Ga0501073_0342240 | 3300049589 | Bacteria | 1032 |
| 840 | Ga0501074_0000673 | 3300049590 | Bacteria | 21320 |
| 841 | Ga0501076_0352203 | 3300049592 | Bacteria | 1209 |
| 842 | Ga0501079_0010772 | 3300049741 | Bacteria | 6961 |
| 843 | Ga0501079_0184361 | 3300049741 | Bacteria | 1629 |
| 844 | Ga0501080_0000151 | 3300049742 | Bacteria | 49588 |
| 845 | Ga0501080_0074625 | 3300049742 | Bacteria | 3154 |
| 846 | Ga0501083_0000799 | 3300049744 | Bacteria | 20624 |
| 847 | Ga0501035_0000150 | 3300049822 | Bacteria | 85450 |
| 848 | Ga0501035_0757036 | 3300049822 | Bacteria | 779 |
| 849 | Ga0501044_0000247 | 3300049823 | Bacteria | 68674 |
| 850 | Ga0501044_0068187 | 3300049823 | Bacteria | 3624 |
| 851 | Ga0501045_0008227 | 3300049824 | Bacteria | 7264 |
| 852 | nmdc:mga03683_17316_c1 | 3300050489 | Bacteria | 1514 |
| 853 | nmdc:mga03n38_7726_c1 | 3300050490 | Bacteria | 3817 |
| 854 | nmdc:mga00v17_16216_c1 | 3300050491 | Bacteria | 4199 |
| 855 | nmdc:mga0yw44_170248_c1 | 3300050492 | Bacteria | 1430 |
| 856 | nmdc:mga0yw44_31747_c1 | 3300050492 | Bacteria | 3074 |
| 857 | nmdc:mga06z11_1024_c1 | 3300050494 | Bacteria | 10191 |
| 858 | nmdc:mga06z11_152821_c1 | 3300050494 | Bacteria | 1313 |
| 859 | nmdc:mga06z11_26272_c1 | 3300050494 | Bacteria | 2769 |
| 860 | nmdc:mga06z11_336794_c1 | 3300050494 | Bacteria | 902 |
| 861 | nmdc:mga06z11_64441_c1 | 3300050494 | Bacteria | 1920 |
| 862 | nmdc:mga04h51_109235_c1 | 3300050495 | Bacteria | 1017 |
| 863 | nmdc:mga04h51_59515_c1 | 3300050495 | Bacteria | 1306 |
| 864 | nmdc:mga07m45_15473_c1 | 3300050496 | Bacteria | 4074 |
| 865 | nmdc:mga07m45_314291_c1 | 3300050496 | Bacteria | 911 |
| 866 | nmdc:mga08y16_460868_c1 | 3300050511 | Bacteria | 1295 |
| 867 | nmdc:mga08y16_88232_c1 | 3300050511 | Bacteria | 3232 |
| 868 | nmdc:mga0n895_182682_c1 | 3300050512 | Bacteria | 2129 |
| 869 | nmdc:mga08x19_149742_c1 | 3300050514 | Bacteria | 1579 |
| 870 | nmdc:mga0sz30_44122_c1 | 3300050516 | Bacteria | 1482 |
| 871 | nmdc:mga0sz30_50067_c1 | 3300050516 | Bacteria | 1771 |
| 872 | Ga0495601_0051109 | 3300053077 | Bacteria | 2609 |
| 873 | Ga0495601_0063187 | 3300053077 | Bacteria | 2353 |
| 874 | Ga0495601_0609158 | 3300053077 | Bacteria | 700 |
| 875 | Ga0495655_0148339 | 3300053083 | Bacteria | 736 |
| 876 | Ga0495595_0038182 | 3300053084 | Bacteria | 2187 |
| 877 | Ga0495619_0065541 | 3300053085 | Bacteria | 2423 |
| 878 | Ga0495619_0265853 | 3300053085 | Bacteria | 1189 |
| 879 | Ga0500578_0177234 | 3300053086 | Bacteria | 1315 |
| 880 | Ga0500643_031589 | 3300053087 | Bacteria | 1613 |
| 881 | Ga0500581_044177 | 3300053089 | Bacteria | 2277 |
| 882 | Ga0500581_113117 | 3300053089 | Bacteria | 1320 |
| 883 | Ga0500646_0003403 | 3300053090 | Bacteria | 4080 |
| 884 | Ga0500583_0041335 | 3300053092 | Bacteria | 2093 |
| 885 | Ga0500566_0001953 | 3300053094 | Bacteria | 12134 |
| 886 | Ga0500566_0002739 | 3300053094 | Bacteria | 10496 |
| 887 | Ga0500640_044371 | 3300053095 | Bacteria | 1951 |
| 888 | Ga0500650_0000885 | 3300053098 | Bacteria | 8373 |
| 889 | Ga0500650_0063383 | 3300053098 | Bacteria | 1727 |
| 890 | Ga0500650_0227542 | 3300053098 | Bacteria | 842 |
| 891 | Ga0500554_001373 | 3300053102 | Bacteria | 4711 |
| 892 | Ga0500556_0000019 | 3300053104 | Bacteria | 186017 |
| 893 | Ga0500556_0097386 | 3300053104 | Bacteria | 1130 |
| 894 | Ga0500562_007205 | 3300053108 | Bacteria | 2806 |
| 895 | Ga0500569_005216 | 3300053109 | Bacteria | 2782 |
| 896 | Ga0500569_078603 | 3300053109 | Bacteria | 1051 |
| 897 | Ga0500569_080508 | 3300053109 | Bacteria | 1041 |
| 898 | Ga0500572_003137 | 3300053111 | Bacteria | 3828 |
| 899 | Ga0500591_055153 | 3300053115 | Bacteria | 1850 |
| 900 | Ga0500592_000579 | 3300053116 | Bacteria | 6028 |
| 901 | Ga0500593_053882 | 3300053117 | Bacteria | 1781 |
| 902 | Ga0500594_0007253 | 3300053118 | Bacteria | 2506 |
| 903 | Ga0500594_0013695 | 3300053118 | Bacteria | 1931 |
| 904 | Ga0500595_011328 | 3300053119 | Bacteria | 3496 |
| 905 | Ga0500608_055567 | 3300053122 | Bacteria | 1898 |
| 906 | Ga0500614_032215 | 3300053123 | Bacteria | 1288 |
| 907 | Ga0500617_046161 | 3300053124 | Bacteria | 1948 |
| 908 | Ga0500642_0000048 | 3300053130 | Bacteria | 81787 |
| 909 | Ga0500642_0082625 | 3300053130 | Bacteria | 1477 |
| 910 | Ga0500658_0007623 | 3300053134 | Bacteria | 3998 |
| 911 | Ga0500658_0078730 | 3300053134 | Bacteria | 1405 |
| 912 | Ga0500559_0011154 | 3300053136 | Bacteria | 3844 |
| 913 | Ga0500568_0002172 | 3300053139 | Bacteria | 11820 |
| 914 | Ga0500568_0031404 | 3300053139 | Bacteria | 2192 |
| 915 | Ga0500577_0085822 | 3300053142 | Bacteria | 1263 |
| 916 | Ga0500588_0018360 | 3300053146 | Bacteria | 1841 |
| 917 | Ga0500589_083133 | 3300053147 | Bacteria | 1426 |
| 918 | Ga0500590_043222 | 3300053148 | Bacteria | 2312 |
| 919 | Ga0500603_002009 | 3300053150 | Bacteria | 4517 |
| 920 | Ga0500604_0017964 | 3300053151 | Bacteria | 1965 |
| 921 | Ga0500604_0042783 | 3300053151 | Bacteria | 1374 |
| 922 | Ga0500616_0000059 | 3300053153 | Bacteria | 259741 |
| 923 | Ga0500627_0016814 | 3300053158 | Bacteria | 2861 |
| 924 | Ga0500630_060269 | 3300053159 | Bacteria | 1814 |
| 925 | Ga0500633_0098681 | 3300053160 | Bacteria | 1073 |
| 926 | Ga0500634_0025972 | 3300053161 | Bacteria | 3189 |
| 927 | Ga0500634_0131183 | 3300053161 | Bacteria | 1203 |
| 928 | Ga0500634_0146835 | 3300053161 | Bacteria | 1108 |
| 929 | Ga0500638_081795 | 3300053162 | Bacteria | 1532 |
| 930 | Ga0500638_118075 | 3300053162 | Bacteria | 1217 |
| 931 | Ga0500639_009259 | 3300053163 | Bacteria | 5144 |
| 932 | Ga0500636_0102323 | 3300053177 | Bacteria | 1627 |
| 933 | Ga0500637_0000500 | 3300053178 | Bacteria | 15189 |
| 934 | Ga0500637_0029756 | 3300053178 | Bacteria | 3032 |
| 935 | Ga0500637_0113783 | 3300053178 | Bacteria | 1569 |
| 936 | Ga0500645_013023 | 3300053730 | Bacteria | 2677 |
| 937 | Ga0500609_018977 | 3300053731 | Bacteria | 937 |
| 938 | Ga0500601_016127 | 3300053737 | Bacteria | 851 |
| 939 | Ga0501084_0025853 | 3300054114 | Bacteria | 4895 |
| 940 | Ga0500661_022621 | 3300055283 | Bacteria | 1114 |
| 941 | Ga0501082_0009016 | 3300060353 | Bacteria | 8606 |
| 942 | Ga0466962_0093006 | 3300061719 | Bacteria | 1446 |
| 943 | 2508695896 | 2508501042 | Bacteria | 8719808 |
| 944 | 2513694013 | 2513237101 | Bacteria | 7952346 |
| 945 | 2513876916 | 2513237139 | Bacteria | 8737671 |
| 946 | 2514016101 | 2513237161 | Bacteria | 8871253 |
| 947 | 2617353271 | 2617270735 | Bacteria | 9163226 |
| 948 | 2723849317 | 2721755755 | Bacteria | 8322773 |
| 949 | 2793065654 | 2791355196 | Bacteria | 7323613 |
| 950 | 2793065905 | 2791355196 | Bacteria | 7323613 |
| 951 | 2793077119 | |||
| 952 | 2805921290 | 2802429603 | Bacteria | 8777136 |
| 953 | 2824608807 | 2824600985 | Bacteria | 8488197 |
| 954 | 2824617425 | 2824609381 | Bacteria | 8672835 |
| 955 | 2824660774 | 2824653114 | Bacteria | 8493680 |
| 956 | 2824677705 | 2824671348 | Bacteria | 8369588 |
| 957 | 2824683536 | 2824679649 | Bacteria | 8248951 |
| 958 | 2824695251 | 2824687955 | Bacteria | 8360029 |
| 959 | 2824704008 | 2824696289 | Bacteria | 8335049 |
| 960 | 2824777528 | 2824773399 | Bacteria | 8360218 |
| 961 | 2838125764 | 2838122688 | Bacteria | 8803140 |
| 962 | 2841947975 | 2841941048 | Bacteria | 8688029 |
| 963 | 2841952806 | 2841949485 | Bacteria | 8680857 |
| 964 | 2841972803 | 2841966195 | Bacteria | 8673214 |
| 965 | 2841977580 | 2841974524 | Bacteria | 8931498 |
| 966 | 2841984862 | 2841983080 | Bacteria | 8395090 |
| 967 | 2842041387 | 2842038055 | Bacteria | 8002051 |
| 968 | 2842049429 | 2842045827 | Bacteria | 8006841 |
| 969 | 2847942695 | 2847939898 | Bacteria | 8606328 |
| 970 | 2849083439 | 2849076700 | Bacteria | 7039503 |
| 971 | 2874608454 | 2874604998 | Bacteria | 7834745 |
| 972 | 2874621388 | 2874620515 | Bacteria | 8290088 |
| 973 | 2874629181 | 2874628541 | Bacteria | 8630250 |
| 974 | 2876809969 | 2876808645 | Bacteria | 8824342 |
| 975 | 2879112782 | 2879110137 | Bacteria | 8907982 |
| 976 | 2888427501 | 2888419890 | Bacteria | 7857137 |
| 977 | 2889035893 | 2889033259 | Bacteria | 9099371 |
| 978 | 2904668058 | 2904666416 | Bacteria | 8226587 |
| 979 | 2922364366 | 2922361189 | Bacteria | 7436256 |
| 980 | 2922389063 | 2922386360 | Bacteria | 7017218 |
| 981 | 2922400776 | 2922393267 | Bacteria | 8285685 |
| 982 | 2932789058 | 2932784394 | Bacteria | 9704911 |
| 983 | 2932808818 | 2932801729 | Bacteria | 7987968 |
| 984 | 2932814305 | 2932809354 | Bacteria | 9135765 |
| 985 | 2932820431 | 2932818245 | Bacteria | 9955613 |
| 986 | 2932834307 | 2932828146 | Bacteria | 9745859 |
| 987 | 2935614692 | 2935608549 | Bacteria | 8203142 |
| 988 | 2935619991 | 2935616580 | Bacteria | 9032984 |
| 989 | 2935648142 | 2935638405 | Bacteria | 10015038 |
| 990 | 2935673403 | 2935665750 | Bacteria | 9571747 |
| 991 | 2935686806 | 2935684952 | Bacteria | 9590419 |
| 992 | 2935701514 | 2935694250 | Bacteria | 9291695 |
| 993 | 2935716494 | 2935713505 | Bacteria | 9608509 |
| 994 | 2935723381 | 2935722832 | Bacteria | 9608746 |
| 995 | 2935734937 | 2935732158 | Bacteria | 9706831 |
| 996 | 2935744272 | 2935741537 | Bacteria | 9707219 |
| 997 | 2935752772 | 2935750917 | Bacteria | 9590372 |
| 998 | 2935764681 | 2935760218 | Bacteria | 9817913 |
| 999 | 2935806208 | 2935801545 | Bacteria | 9301974 |
| 1000 | 2935816980 | 2935810662 | Bacteria | 9401221 |
| 1001 | 2935826267 | 2935819856 | Bacteria | 8261050 |
| 1002 | 2935837633 | 2935827899 | Bacteria | 10038562 |
| 1003 | 2935841355 | 2935837841 | Bacteria | 9454360 |
| 1004 | 2935853763 | 2935847175 | Bacteria | 8228321 |
| 1005 | 2935858877 | 2935855204 | Bacteria | 9035059 |
| 1006 | 2935864058 | 2935864058 | Bacteria | 9784707 |
| 1007 | 2935875628 | 2935873716 | Bacteria | 9632195 |
| 1008 | 2935883311 | 2935883170 | Bacteria | 7964738 |
| 1009 | 2935924145 | 2935916978 | Bacteria | 9113783 |
| 1010 | 2935932802 | 2935926038 | Bacteria | 8601059 |
| 1011 | 2935937365 | 2935934488 | Bacteria | 8602579 |
| 1012 | 2935949434 | 2935942939 | Bacteria | 8599779 |
| 1013 | 2935958167 | 2935951376 | Bacteria | 8602333 |
| 1014 | 2935971178 | 2935967501 | Bacteria | 8603075 |
| 1015 | 2935985364 | 2935984226 | Bacteria | 8302647 |
| 1016 | 2935995429 | 2935992306 | Bacteria | 9802711 |
| 1017 | 2936007851 | 2936002035 | Bacteria | 9362176 |
| 1018 | 2936043971 | 2936037263 | Bacteria | 9446081 |
| 1019 | 2936056872 | 2936055302 | Bacteria | 8785755 |
| 1020 | 2940558685 | 2940556831 | Bacteria | 9590747 |
| 1021 | 2941543581 | 2941538514 | Bacteria | 9402094 |
| 1022 | 8006967848 | 8006964411 | Bacteria | 8966052 |
| 1023 | 8006992470 | 8006984368 | Bacteria | 9651211 |
| 1024 | 8006998514 | 8006994254 | Bacteria | 8309700 |
| 1025 | 8016517744 | 8016511872 | Bacteria | 9921665 |
| 1026 | 8016635209 | 8016630954 | Bacteria | 9217207 |
| 1027 | 8017058886 | 8017057580 | Bacteria | 10023680 |
| 1028 | 8019576765 | 8019576017 | Bacteria | 10049540 |
| 1029 | 8019594821 | 8019586578 | Bacteria | 10212056 |
| 1030 | 8019606920 | 8019597564 | Bacteria | 10041141 |
| 1031 | 8019611589 | 8019608314 | Bacteria | 10042931 |
| 1032 | 8056676281 | 8056673599 | Bacteria | 7871253 |
| 1033 | Ga0496124_0182754 | |||
| 1034 | JGI25153J46596_10022904 | |||
| 1035 | rootL2_10161206 | |||
| 1036 | rootL2_10205455 | |||
| 1037 | rootH1_10066983 | |||
| 1038 | rootH1_10114185 | |||
| 1039 | JGI25404J52841_10020122 | |||
| 1040 | Ga0055543_1004157 | |||
| 1041 | Ga0065165_1001154 | |||
| 1042 | Ga0065165_1009552 | |||
| 1043 | Ga0070658_10251334 | |||
| 1044 | Ga0070676_10213956 | |||
| 1045 | Ga0070683_100038284 | |||
| 1046 | Ga0070683_100082292 | |||
| 1047 | Ga0068869_100019987 | |||
| 1048 | Ga0068869_100028909 | |||
| 1049 | Ga0070666_10414414 | |||
| 1050 | Ga0070680_100090173 | |||
| 1051 | Ga0070680_100296001 | |||
| 1052 | Ga0070682_100217035 | |||
| 1053 | Ga0068868_100022836 | |||
| 1054 | Ga0068868_100095676 | |||
| 1055 | Ga0070660_100163307 | |||
| 1056 | Ga0070660_100182193 | |||
| 1057 | Ga0070660_100274881 | |||
| 1058 | Ga0070689_100929188 | |||
| 1059 | Ga0070691_10067403 | |||
| 1060 | Ga0070691_10236206 | |||
| 1061 | Ga0070661_100188622 | |||
| 1062 | Ga0070661_100328453 | |||
| 1063 | Ga0070692_10226670 | |||
| 1064 | Ga0070668_100046579 | |||
| 1065 | Ga0070668_100063000 | |||
| 1066 | Ga0070668_100265259 | |||
| 1067 | Ga0070668_100286836 | |||
| 1068 | Ga0070668_100390981 | |||
| 1069 | Ga0070669_100167442 | |||
| 1070 | Ga0070671_100013134 | |||
| 1071 | Ga0070667_100105278 | |||
| 1072 | Ga0070667_101162959 | |||
| 1073 | Ga0070709_10001027 | |||
| 1074 | Ga0070709_10005403 | |||
| 1075 | Ga0070709_10017504 | |||
| 1076 | Ga0070709_10056309 | |||
| 1077 | Ga0070714_100002014 | |||
| 1078 | Ga0070714_100038190 | |||
| 1079 | Ga0070714_100113883 | |||
| 1080 | Ga0070713_100004390 | |||
| 1081 | Ga0070713_100016677 | |||
| 1082 | Ga0070713_100052787 | |||
| 1083 | Ga0070713_100178132 | |||
| 1084 | Ga0070713_100281925 | |||
| 1085 | Ga0070713_100412001 | |||
| 1086 | Ga0070710_10001042 | |||
| 1087 | Ga0070710_10001742 | |||
| 1088 | Ga0070710_10506972 | |||
| 1089 | Ga0070711_100003508 | |||
| 1090 | Ga0070711_100010129 | |||
| 1091 | Ga0070711_100046349 | |||
| 1092 | Ga0070700_100114854 | |||
| 1093 | Ga0070700_100348808 | |||
| 1094 | Ga0070663_100018623 | |||
| 1095 | Ga0070663_100065498 | |||
| 1096 | Ga0070663_100080448 | |||
| 1097 | Ga0070663_100106570 | |||
| 1098 | Ga0070663_100230832 | |||
| 1099 | Ga0070663_100286360 | |||
| 1100 | Ga0070678_100043057 | |||
| 1101 | Ga0070678_100052680 | |||
| 1102 | Ga0070678_100455505 | |||
| 1103 | Ga0070662_100111438 | |||
| 1104 | Ga0070681_10009040 | |||
| 1105 | Ga0070681_10055005 | |||
| 1106 | Ga0070681_10070515 | |||
| 1107 | Ga0070681_10188680 | |||
| 1108 | Ga0070681_10249267 | |||
| 1109 | Ga0070681_10354528 | |||
| 1110 | Ga0068867_100051402 | |||
| 1111 | Ga0070706_100123166 | |||
| 1112 | Ga0070698_100649991 | |||
| 1113 | Ga0070699_100146075 | |||
| 1114 | Ga0070679_100004286 | |||
| 1115 | Ga0070679_100038414 | |||
| 1116 | Ga0070679_100232580 | |||
| 1117 | Ga0070679_100516842 | |||
| 1118 | Ga0070684_100031374 | |||
| 1119 | Ga0070684_100059917 | |||
| 1120 | Ga0070684_100212710 | |||
| 1121 | Ga0068853_100039035 | |||
| 1122 | Ga0068853_100082805 | |||
| 1123 | Ga0068853_100092600 | |||
| 1124 | Ga0068853_100107686 | |||
| 1125 | Ga0068853_100171372 | |||
| 1126 | Ga0068853_100194351 | |||
| 1127 | Ga0068853_100243463 | |||
| 1128 | Ga0068853_100488351 | |||
| 1129 | Ga0068853_100621675 | |||
| 1130 | Ga0070672_100126254 | |||
| 1131 | Ga0070686_100176013 | |||
| 1132 | Ga0070665_100062716 | |||
| 1133 | Ga0070665_100063938 | |||
| 1134 | Ga0070665_100105554 | |||
| 1135 | Ga0070665_100186295 | |||
| 1136 | Ga0070665_100867548 | |||
| 1137 | Ga0070704_100271395 | |||
| 1138 | Ga0068855_100020446 | |||
| 1139 | Ga0068855_100056006 | |||
| 1140 | Ga0068855_100099741 | |||
| 1141 | Ga0068855_100202696 | |||
| 1142 | Ga0068855_100264388 | |||
| 1143 | Ga0070664_100049361 | |||
| 1144 | Ga0070664_100059412 | |||
| 1145 | Ga0070664_100109514 | |||
| 1146 | Ga0068857_100056048 | |||
| 1147 | Ga0068857_100091695 | |||
| 1148 | Ga0068857_100179874 | |||
| 1149 | Ga0068857_100179886 | |||
| 1150 | Ga0068857_100213788 | |||
| 1151 | Ga0068854_100346291 | |||
| 1152 | Ga0068856_100042399 | |||
| 1153 | Ga0068856_100252474 | |||
| 1154 | Ga0070702_100131886 | |||
| 1155 | Ga0070702_100247313 | |||
| 1156 | Ga0068852_100116648 | |||
| 1157 | Ga0068852_100117092 | |||
| 1158 | Ga0068852_100390953 | |||
| 1159 | Ga0068852_100930884 | |||
| 1160 | Ga0068859_100220206 | |||
| 1161 | Ga0068864_100079049 | |||
| 1162 | Ga0068864_100401546 | |||
| 1163 | Ga0068864_100501471 | |||
| 1164 | Ga0068861_100187223 | |||
| 1165 | Ga0068861_100245014 | |||
| 1166 | Ga0068861_100623252 | |||
| 1167 | Ga0068861_101007191 | |||
| 1168 | Ga0068851_10025412 | |||
| 1169 | Ga0068851_10031111 | |||
| 1170 | Ga0068851_10072501 | |||
| 1171 | Ga0068851_10190201 | |||
| 1172 | Ga0068870_10020090 | |||
| 1173 | Ga0068863_100467996 | |||
| 1174 | Ga0068858_100062074 | |||
| 1175 | Ga0068858_100185255 | |||
| 1176 | Ga0068860_100085969 | |||
| 1177 | Ga0068860_100244828 | |||
| 1178 | Ga0068860_100612966 | |||
| 1179 | Ga0068860_100838720 | |||
| 1180 | Ga0068862_100077669 | |||
| 1181 | Ga0068862_100088109 | |||
| 1182 | Ga0068862_100396313 | |||
| 1183 | Ga0081455_10015101 | |||
| 1184 | Ga0081455_10070871 | |||
| 1185 | Ga0081538_10031021 | |||
| 1186 | Ga0081540_1004227 | |||
| 1187 | Ga0081540_1005956 | |||
| 1188 | Ga0081540_1011679 | |||
| 1189 | Ga0081540_1017794 | |||
| 1190 | Ga0081540_1034458 | |||
| 1191 | Ga0081539_10000129 | |||
| 1192 | Ga0081539_10083384 | |||
| 1193 | Ga0070717_10044411 | |||
| 1194 | Ga0070717_10148412 | |||
| 1195 | Ga0070717_10319684 | |||
| 1196 | Ga0075365_10338297 | |||
| 1197 | Ga0075363_100048277 | |||
| 1198 | Ga0075363_100085219 | |||
| 1199 | Ga0075364_10135415 | |||
| 1200 | Ga0070715_10000398 | |||
| 1201 | Ga0070716_100000855 | |||
| 1202 | Ga0070716_100042118 | |||
| 1203 | Ga0070716_100050514 | |||
| 1204 | Ga0070712_100002401 | |||
| 1205 | Ga0070712_100077201 | |||
| 1206 | Ga0070712_100078419 | |||
| 1207 | Ga0075362_10226304 | |||
| 1208 | Ga0075367_10014691 | |||
| 1209 | Ga0075367_10178278 | |||
| 1210 | Ga0075369_10035392 | |||
| 1211 | Ga0075369_10087744 | |||
| 1212 | Ga0075366_10106050 | |||
| 1213 | Ga0075366_10280779 | |||
| 1214 | Ga0097621_100048249 | |||
| 1215 | Ga0097621_100070313 | |||
| 1216 | Ga0097621_100380192 | |||
| 1217 | Ga0075370_10027084 | |||
| 1218 | Ga0075370_10065511 | |||
| 1219 | Ga0075370_10096619 | |||
| 1220 | Ga0075370_10114895 | |||
| 1221 | Ga0068871_100071996 | |||
| 1222 | Ga0068871_100198467 | |||
| 1223 | Ga0068871_100634370 | |||
| 1224 | Ga0075428_100135129 | |||
| 1225 | Ga0075434_100087805 | |||
| 1226 | Ga0068865_100072098 | |||
| 1227 | Ga0068865_100227384 | |||
| 1228 | Ga0075436_100174423 | |||
| 1229 | Ga0097620_100220217 | |||
| 1230 | Ga0099824_1007455 | |||
| 1231 | Ga0099822_1003626 | |||
| 1232 | Ga0099794_10087376 | |||
| 1233 | Ga0099795_10057989 | |||
| 1234 | Ga0099795_10059078 | |||
| 1235 | Ga0105250_10027965 | |||
| 1236 | Ga0105250_10218176 | |||
| 1237 | Ga0105240_10050544 | |||
| 1238 | Ga0105240_10096986 | |||
| 1239 | Ga0105240_10182695 | |||
| 1240 | Ga0105240_10188976 | |||
| 1241 | Ga0105240_10210988 | |||
| 1242 | Ga0105240_10239958 | |||
| 1243 | Ga0111539_10069080 | |||
| 1244 | Ga0111539_10737878 | |||
| 1245 | Ga0105245_10115435 | |||
| 1246 | Ga0105245_10150267 | |||
| 1247 | Ga0105245_10173813 | |||
| 1248 | Ga0105245_10539658 | |||
| 1249 | Ga0105245_10713119 | |||
| 1250 | Ga0105247_10142058 | |||
| 1251 | Ga0105247_10293917 | |||
| 1252 | Ga0105247_10429017 | |||
| 1253 | Ga0114129_10561585 | |||
| 1254 | Ga0114129_10592812 | |||
| 1255 | Ga0105243_10529701 | |||
| 1256 | Ga0105243_10664928 | |||
| 1257 | Ga0105243_10700264 | |||
| 1258 | Ga0105241_10000556 | |||
| 1259 | Ga0105241_10032736 | |||
| 1260 | Ga0105241_10132625 | |||
| 1261 | Ga0105241_10186445 | |||
| 1262 | Ga0105241_10247469 | |||
| 1263 | Ga0105242_10372422 | |||
| 1264 | Ga0105248_10133219 | |||
| 1265 | Ga0105248_10150577 | |||
| 1266 | Ga0105248_10590387 | |||
| 1267 | Ga0105237_10097243 | |||
| 1268 | Ga0105237_10111662 | |||
| 1269 | Ga0105237_10168161 | |||
| 1270 | Ga0105237_10170183 | |||
| 1271 | Ga0105237_10183771 | |||
| 1272 | Ga0105237_10433976 | |||
| 1273 | Ga0105237_10570293 | |||
| 1274 | Ga0105238_10001118 | |||
| 1275 | Ga0105238_10086110 | |||
| 1276 | Ga0105238_10110294 | |||
| 1277 | Ga0105238_10138686 | |||
| 1278 | Ga0105238_10154557 | |||
| 1279 | Ga0105238_10247070 | |||
| 1280 | Ga0105238_10282193 | |||
| 1281 | Ga0105238_10334621 | |||
| 1282 | Ga0105238_10384886 | |||
| 1283 | Ga0105238_10420114 | |||
| 1284 | Ga0105238_10541106 | |||
| 1285 | Ga0105238_10554773 | |||
| 1286 | Ga0105249_10285936 | |||
| 1287 | Ga0099796_10016406 | |||
| 1288 | Ga0105239_10003377 | |||
| 1289 | Ga0105239_10042482 | |||
| 1290 | Ga0105239_10112770 | |||
| 1291 | Ga0105239_10128295 | |||
| 1292 | Ga0105239_10169787 | |||
| 1293 | Ga0105239_10208890 | |||
| 1294 | Ga0105239_10307425 | |||
| 1295 | Ga0105239_10356443 | |||
| 1296 | Ga0105239_11138764 | |||
| 1297 | Ga0105246_10002976 | |||
| 1298 | Ga0105246_10099080 | |||
| 1299 | Ga0105246_10144258 | |||
| 1300 | Ga0105246_10572571 | |||
| 1301 | Ga0157371_10139090 | |||
| 1302 | Ga0157370_10301252 | |||
| 1303 | Ga0157369_10005940 | |||
| 1304 | Ga0157369_10028801 | |||
| 1305 | Ga0157369_10073139 | |||
| 1306 | Ga0157369_10137930 | |||
| 1307 | Ga0157374_10018391 | |||
| 1308 | Ga0157374_10066154 | |||
| 1309 | Ga0157374_10103537 | |||
| 1310 | Ga0157374_10634417 | |||
| 1311 | Ga0157378_10710594 | |||
| 1312 | Ga0163162_10038654 | |||
| 1313 | Ga0163162_10136848 | |||
| 1314 | Ga0163162_10258988 | |||
| 1315 | Ga0163162_10298931 | |||
| 1316 | Ga0163162_10376976 | |||
| 1317 | Ga0157372_10265412 | |||
| 1318 | Ga0157372_10408605 | |||
| 1319 | Ga0157375_10927566 | |||
| 1320 | Ga0163163_10019531 | |||
| 1321 | Ga0163163_10071306 | |||
| 1322 | Ga0163163_10161559 | |||
| 1323 | Ga0163163_10474227 | |||
| 1324 | Ga0163163_10541512 | |||
| 1325 | Ga0157380_10105640 | |||
| 1326 | Ga0157380_11186249 | |||
| 1327 | Ga0157379_10552376 | |||
| 1328 | Ga0157379_10562209 | |||
| 1329 | Ga0157376_10153258 | |||
| 1330 | Ga0157376_10163634 | |||
| 1331 | Ga0163161_10203893 | |||
| 1332 | Ga0163161_10319597 | |||
| 1333 | Ga0163161_10549125 | |||
| 1334 | Ga0213872_10053657 | |||
| 1335 | Ga0213872_10076345 | |||
| 1336 | Ga0213876_10108649 | |||
| 1337 | Ga0224712_10024362 | |||
| 1338 | Ga0209564_1011241 | |||
| 1339 | Ga0209758_1000030 | |||
| 1340 | Ga0209758_1000884 | |||
| 1341 | Ga0209758_1013214 | |||
| 1342 | Ga0209758_1014853 | |||
| 1343 | Ga0209758_1028563 | |||
| 1344 | Ga0209758_1049175 | |||
| 1345 | Ga0209758_1096754 | |||
| 1346 | Ga0209256_1013559 | |||
| 1347 | Ga0207426_1035680 | |||
| 1348 | Ga0209051_1030461 | |||
| 1349 | Ga0209257_1001828 | |||
| 1350 | Ga0207656_10122379 | |||
| 1351 | Ga0207692_10000436 | |||
| 1352 | Ga0207692_10002177 | |||
| 1353 | Ga0207647_10116726 | |||
| 1354 | Ga0207685_10001124 | |||
| 1355 | Ga0207699_10000614 | |||
| 1356 | Ga0207699_10002471 | |||
| 1357 | Ga0207699_10133309 | |||
| 1358 | Ga0207699_10200079 | |||
| 1359 | Ga0207645_10076102 | |||
| 1360 | Ga0207705_10185981 | |||
| 1361 | Ga0207654_10020235 | |||
| 1362 | Ga0207654_10083441 | |||
| 1363 | Ga0207654_10106373 | |||
| 1364 | Ga0207707_10000507 | |||
| 1365 | Ga0207707_10055582 | |||
| 1366 | Ga0207707_10080235 | |||
| 1367 | Ga0207707_10206749 | |||
| 1368 | Ga0207695_10159728 | |||
| 1369 | Ga0207671_10043855 | |||
| 1370 | Ga0207671_10059565 | |||
| 1371 | Ga0207671_10062667 | |||
| 1372 | Ga0207671_10119667 | |||
| 1373 | Ga0207693_10000073 | |||
| 1374 | Ga0207693_10032985 | |||
| 1375 | Ga0207693_10103061 | |||
| 1376 | Ga0207693_10121851 | |||
| 1377 | Ga0207663_10001948 | |||
| 1378 | Ga0207663_10002898 | |||
| 1379 | Ga0207663_10032432 | |||
| 1380 | Ga0207663_10049285 | |||
| 1381 | Ga0207660_10072378 | |||
| 1382 | Ga0207660_10125988 | |||
| 1383 | Ga0207660_10264582 | |||
| 1384 | Ga0207657_10057865 | |||
| 1385 | Ga0207657_10424725 | |||
| 1386 | Ga0207649_10028468 | |||
| 1387 | Ga0207649_10229202 | |||
| 1388 | Ga0207652_10012795 | |||
| 1389 | Ga0207652_10037383 | |||
| 1390 | Ga0207652_10042125 | |||
| 1391 | Ga0207652_10050802 | |||
| 1392 | Ga0207681_10217820 | |||
| 1393 | Ga0207681_10287434 | |||
| 1394 | Ga0207694_10080614 | |||
| 1395 | Ga0207694_10378143 | |||
| 1396 | Ga0207694_10454299 | |||
| 1397 | Ga0207650_10261331 | |||
| 1398 | Ga0207659_10403457 | |||
| 1399 | Ga0207687_10045974 | |||
| 1400 | Ga0207687_10128782 | |||
| 1401 | Ga0207687_10350930 | |||
| 1402 | Ga0207687_10433511 | |||
| 1403 | Ga0207700_10025351 | |||
| 1404 | Ga0207700_10035109 | |||
| 1405 | Ga0207700_10148699 | |||
| 1406 | Ga0207700_10225961 | |||
| 1407 | Ga0207700_10354083 | |||
| 1408 | Ga0207664_10020170 | |||
| 1409 | Ga0207664_10065570 | |||
| 1410 | Ga0207664_10096495 | |||
| 1411 | Ga0207664_10387589 | |||
| 1412 | Ga0207644_10202357 | |||
| 1413 | Ga0207706_10229062 | |||
| 1414 | Ga0207706_10326216 | |||
| 1415 | Ga0207706_10398003 | |||
| 1416 | Ga0207665_10003417 | |||
| 1417 | Ga0207665_10018682 | |||
| 1418 | Ga0207665_10069382 | |||
| 1419 | Ga0207691_10149860 | |||
| 1420 | Ga0207711_10042896 | |||
| 1421 | Ga0207689_10047982 | |||
| 1422 | Ga0207689_10127295 | |||
| 1423 | Ga0207689_10174652 | |||
| 1424 | Ga0207661_10004250 | |||
| 1425 | Ga0207661_10092256 | |||
| 1426 | Ga0207661_10481308 | |||
| 1427 | Ga0207679_10143762 | |||
| 1428 | Ga0207667_10104676 | |||
| 1429 | Ga0207712_10022193 | |||
| 1430 | Ga0207712_10182902 | |||
| 1431 | Ga0207668_10019132 | |||
| 1432 | Ga0207668_10026192 | |||
| 1433 | Ga0207668_10355918 | |||
| 1434 | Ga0207668_10464085 | |||
| 1435 | Ga0207668_10818175 | |||
| 1436 | Ga0207640_10104600 | |||
| 1437 | Ga0207640_10636540 | |||
| 1438 | Ga0207658_10310948 | |||
| 1439 | Ga0207677_10052950 | |||
| 1440 | Ga0207703_10653425 | |||
| 1441 | Ga0207639_10105575 | |||
| 1442 | Ga0207639_10144980 | |||
| 1443 | Ga0207639_10156688 | |||
| 1444 | Ga0207639_10258721 | |||
| 1445 | Ga0207639_10441924 | |||
| 1446 | Ga0207678_10083144 | |||
| 1447 | Ga0207678_10163527 | |||
| 1448 | Ga0207678_10169863 | |||
| 1449 | Ga0207678_10203857 | |||
| 1450 | Ga0207678_10357457 | |||
| 1451 | Ga0207678_10401509 | |||
| 1452 | Ga0207708_10113453 | |||
| 1453 | Ga0207702_10119190 | |||
| 1454 | Ga0207702_10155056 | |||
| 1455 | Ga0207648_10134888 | |||
| 1456 | Ga0207648_10516731 | |||
| 1457 | Ga0207648_10761624 | |||
| 1458 | Ga0207676_10277787 | |||
| 1459 | Ga0207676_10392255 | |||
| 1460 | Ga0207676_10425726 | |||
| 1461 | Ga0207674_10078797 | |||
| 1462 | Ga0207674_10083483 | |||
| 1463 | Ga0207674_10098474 | |||
| 1464 | Ga0207674_10113272 | |||
| 1465 | Ga0207674_10553834 | |||
| 1466 | Ga0207674_10705396 | |||
| 1467 | Ga0207675_100076998 | |||
| 1468 | Ga0207675_100197830 | |||
| 1469 | Ga0207675_100299981 | |||
| 1470 | Ga0207675_100454934 | |||
| 1471 | Ga0207683_10057555 | |||
| 1472 | Ga0207683_10083768 | |||
| 1473 | Ga0207698_10013313 | |||
| 1474 | Ga0207698_10423277 | |||
| 1475 | Ga0207698_10892715 | |||
| 1476 | Ga0209179_1002213 | |||
| 1477 | Ga0209588_1061257 | |||
| 1478 | Ga0207428_10226313 | |||
| 1479 | Ga0268266_10002115 | |||
| 1480 | Ga0268266_10005468 | |||
| 1481 | Ga0268266_10007493 | |||
| 1482 | Ga0268266_10035845 | |||
| 1483 | Ga0268266_10217397 | |||
| 1484 | Ga0268266_10486223 | |||
| 1485 | Ga0268266_10636860 | |||
| 1486 | Ga0268265_10016419 | |||
| 1487 | Ga0268265_10168406 | |||
| 1488 | Ga0268265_10349102 | |||
| 1489 | Ga0265334_10021370 | |||
| 1490 | Ga0307517_10056003 | |||
| 1491 | Ga0307515_10237437 | |||
| 1492 | Ga0265330_10014874 | |||
| 1493 | Ga0265325_10030084 | |||
| 1494 | Ga0265340_10002860 | |||
| 1495 | Ga0265339_10037194 | |||
| 1496 | Ga0265331_10018235 | |||
| 1497 | Ga0307408_100226380 | |||
| 1498 | Ga0307508_10093722 | |||
| 1499 | Ga0265314_10217802 | |||
| 1500 | Ga0265314_10352715 | |||
| 1501 | Ga0265342_10022589 | |||
| 1502 | Ga0307516_10007789 | |||
| 1503 | Ga0307412_10019253 | |||
| 1504 | Ga0307412_10279613 | |||
| 1505 | Ga0307409_100029443 | |||
| 1506 | Ga0307411_10237681 | |||
| 1507 | Ga0307415_100172915 | |||
| 1508 | Ga0307415_100348384 | |||
| 1509 | Ga0307415_100595362 | |||
| 1510 | Ga0307510_10015013 | |||
| 1511 | Ga0307510_10054988 | |||
| 1512 | Ga0307510_10056817 | |||
| 1513 | Ga0373930_0014806 | |||
| 1514 | Ga0373938_0038472 | |||
| 1515 | Ga0373929_0004687 | |||
| 1516 | Ga0373952_0013818 | |||
| 1517 | Ga0373923_0005306 | |||
| 1518 | Ga0373923_0184773 | |||
| 1519 | Ga0373923_0220991 | |||
| 1520 | Ga0373936_0018702 | |||
| 1521 | Ga0373936_0104672 | |||
| 1522 | Ga0373936_0112795 | |||
| 1523 | Ga0373936_0170223 | |||
| 1524 | Ga0373945_0023924 | |||
| 1525 | Ga0373954_0127749 | |||
| 1526 | Ga0373943_0001689 | |||
| 1527 | Ga0373943_0007773 | |||
| 1528 | Ga0373946_0037280 | |||
| 1529 | Ga0373946_0092646 | |||
| 1530 | Ga0373955_0009621 | |||
| 1531 | Ga0373924_0016286 | |||
| 1532 | Ga0373924_0145123 | |||
| 1533 | Ga0373931_0008046 | |||
| 1534 | Ga0373931_0175853 | |||
| 1535 | Ga0373935_0000475 | |||
| 1536 | Ga0373935_0103513 | |||
| 1537 | Ga0373935_0183394 | |||
| 1538 | Ga0373935_0211160 | |||
| 1539 | Ga0373927_0000109 | |||
| 1540 | Ga0373933_0000277 | |||
| 1541 | Ga0373933_0085318 | |||
| 1542 | Ga0373947_0001517 | |||
| 1543 | Ga0373947_0013161 | |||
| 1544 | Ga0373947_0019778 | |||
| 1545 | Ga0373947_0228775 | |||
| 1546 | Ga0373947_0240679 | |||
| 1547 | Ga0373947_0579388 | |||
| 1548 | Ga0373937_0115871 | |||
| 1549 | Ga0373937_0349958 | |||
| 1550 | Ga0373937_0566891 | |||
| 1551 | Ga0373925_0003850 | |||
| 1552 | Ga0373925_0007819 | |||
| 1553 | Ga0373925_0252316 | |||
| 1554 | Ga0373925_0621399 | |||
| 1555 | Ga0395898_0034807 | |||
| 1556 | Ga0395898_0080064 | |||
| 1557 | Ga0395898_0106656 | |||
| 1558 | Ga0395905_0004328 | |||
| 1559 | Ga0395905_0216871 | |||
| 1560 | Ga0436364_0471855 | |||
| 1561 | Ga0436365_0201120 | |||
| 1562 | Ga0436365_0831055 | |||
| 1563 | Ga0436365_1327145 | |||
| 1564 | Ga0436365_1407698 | |||
| 1565 | Ga0436365_1666708 | |||
| 1566 | Ga0436360_0864835 | |||
| 1567 | Ga0436360_1095564 | |||
| 1568 | Ga0436360_1115343 | |||
| 1569 | Ga0436361_0433301 | |||
| 1570 | Ga0436361_0645745 | |||
| 1571 | Ga0436363_1013469 | |||
| 1572 | Ga0436363_1556259 | |||
| 1573 | Ga0436362_0970073 | |||
| 1574 | Ga0451787_602466 | |||
| 1575 | Ga0451789_1147981 | |||
| 1576 | Ga0451804_0580637 | |||
| 1577 | Ga0451853_2831650 | |||
| 1578 | Ga0439431_0109467 | |||
| 1579 | Ga0466969_0057271 | |||
| 1580 | Ga0466966_0022110 | |||
| 1581 | Ga0466966_0084491 | |||
| 1582 | Ga0466966_0119129 | |||
| 1583 | Ga0466961_0052071 | |||
| 1584 | Ga0466971_0054614 | |||
| 1585 | Ga0466970_0248176 | |||
| 1586 | Ga0466959_0018092 | |||
| 1587 | Ga0466959_0214864 | |||
| 1588 | Ga0466958_0025627 | |||
| 1589 | Ga0466967_0053967 | |||
| 1590 | Ga0466967_0263263 | |||
| 1591 | Ga0466967_0294824 | |||
| 1592 | Ga0466967_0367889 | |||
| 1593 | Ga0495617_051112 | |||
| 1594 | Ga0495617_060442 | |||
| 1595 | Ga0495592_0004987 | |||
| 1596 | Ga0495603_0001679 | |||
| 1597 | Ga0495603_0003381 | |||
| 1598 | Ga0495603_0046481 | |||
| 1599 | Ga0495603_0053009 | |||
| 1600 | Ga0495603_0388102 | |||
| 1601 | Ga0495603_0423078 | |||
| 1602 | Ga0495590_0057949 | |||
| 1603 | Ga0495590_0117987 | |||
| 1604 | Ga0495629_0010559 | |||
| 1605 | Ga0495629_0095261 | |||
| 1606 | Ga0495629_0171081 | |||
| 1607 | Ga0495629_0286934 | |||
| 1608 | Ga0495638_0037250 | |||
| 1609 | Ga0495641_0025626 | |||
| 1610 | Ga0495651_0029565 | |||
| 1611 | Ga0495650_0058205 | |||
| 1612 | Ga0495580_0002333 | |||
| 1613 | Ga0495580_0081554 | |||
| 1614 | Ga0495582_0000356 | |||
| 1615 | Ga0495582_0139807 | |||
| 1616 | Ga0495582_0256351 | |||
| 1617 | Ga0495605_0094532 | |||
| 1618 | Ga0495639_0000342 | |||
| 1619 | Ga0495639_0006414 | |||
| 1620 | Ga0495639_0122476 | |||
| 1621 | Ga0495662_0000005 | |||
| 1622 | Ga0495664_0023641 | |||
| 1623 | Ga0495664_0035701 | |||
| 1624 | Ga0495664_0201665 | |||
| 1625 | Ga0495664_0468535 | |||
| 1626 | Ga0495584_0079196 | |||
| 1627 | Ga0495585_0078301 | |||
| 1628 | Ga0495594_0000263 | |||
| 1629 | Ga0495594_0071459 | |||
| 1630 | Ga0495607_0083053 | |||
| 1631 | Ga0495607_0097251 | |||
| 1632 | Ga0495606_0013910 | |||
| 1633 | Ga0495606_0097967 | |||
| 1634 | Ga0495606_0099295 | |||
| 1635 | Ga0495606_0332465 | |||
| 1636 | Ga0495608_0158356 | |||
| 1637 | Ga0495610_0024830 | |||
| 1638 | Ga0495616_0023169 | |||
| 1639 | Ga0495618_0087877 | |||
| 1640 | Ga0495618_0268284 | |||
| 1641 | Ga0495620_0020567 | |||
| 1642 | Ga0495620_0079912 | |||
| 1643 | Ga0495628_0051527 | |||
| 1644 | Ga0495628_0068114 | |||
| 1645 | Ga0495630_0035088 | |||
| 1646 | Ga0495630_0043430 | |||
| 1647 | Ga0495631_0067460 | |||
| 1648 | Ga0495632_0063467 | |||
| 1649 | Ga0495632_0064468 | |||
| 1650 | Ga0495637_0018711 | |||
| 1651 | Ga0495637_0032860 | |||
| 1652 | Ga0495644_0107657 | |||
| 1653 | Ga0495648_0028166 | |||
| 1654 | Ga0495663_0032967 | |||
| 1655 | Ga0495663_0089388 | |||
| 1656 | Ga0495666_0032504 | |||
| 1657 | Ga0495666_0062713 | |||
| 1658 | Ga0495666_0122385 | |||
| 1659 | Ga0495642_0154386 | |||
| 1660 | Ga0495652_0199499 | |||
| 1661 | Ga0495654_0027297 | |||
| 1662 | Ga0495654_0079788 | |||
| 1663 | Ga0495665_0000037 | |||
| 1664 | Ga0495665_0032996 | |||
| 1665 | Ga0495640_0025913 | |||
| 1666 | Ga0495640_0095544 | |||
| 1667 | Ga0495586_0034451 | |||
| 1668 | Ga0495621_0028989 | |||
| 1669 | Ga0495597_0007237 | |||
| 1670 | Ga0495597_0169573 | |||
| 1671 | Ga0495645_0088806 | |||
| 1672 | Ga0495645_0203885 | |||
| 1673 | Ga0495622_0000861 | |||
| 1674 | Ga0495622_0030639 | |||
| 1675 | Ga0495622_0051589 | |||
| 1676 | Ga0495633_0044955 | |||
| 1677 | Ga0495656_0009178 | |||
| 1678 | Ga0495656_0251749 | |||
| 1679 | Ga0495656_0288306 | |||
| 1680 | Ga0495668_0061597 | |||
| 1681 | Ga0495668_0096975 | |||
| 1682 | Ga0495634_0001407 | |||
| 1683 | Ga0495634_0025636 | |||
| 1684 | Ga0495611_0028577 | |||
| 1685 | Ga0495611_0090333 | |||
| 1686 | Ga0495625_0119524 | |||
| 1687 | Ga0495625_0182692 | |||
| 1688 | Ga0495635_0001096 | |||
| 1689 | Ga0495659_0004176 | |||
| 1690 | Ga0495659_0032717 | |||
| 1691 | Ga0495661_0026266 | |||
| 1692 | Ga0495588_0038439 | |||
| 1693 | Ga0495588_0267126 | |||
| 1694 | Ga0495588_0433605 | |||
| 1695 | Ga0495657_0451997 | |||
| 1696 | Ga0495599_0027648 | |||
| 1697 | Ga0495647_0001874 | |||
| 1698 | Ga0495658_0002684 | |||
| 1699 | Ga0495658_0002728 | |||
| 1700 | Ga0495669_0043979 | |||
| 1701 | Ga0495669_0236242 | |||
| 1702 | Ga0495613_0126013 | |||
| 1703 | Ga0495624_0054409 | |||
| 1704 | Ga0495624_0117693 | |||
| 1705 | Ga0495624_0355074 | |||
| 1706 | Ga0495624_0448501 | |||
| 1707 | Ga0495670_0189595 | |||
| 1708 | Ga0495649_0185104 | |||
| 1709 | Ga0495600_0280933 | |||
| 1710 | Ga0495600_0288525 | |||
| 1711 | Ga0495660_0018232 | |||
| 1712 | Ga0495581_0000178 | |||
| 1713 | Ga0495581_0132368 | |||
| 1714 | Ga0495581_0198780 | |||
| 1715 | Ga0495604_0148605 | |||
| 1716 | Ga0495636_0209625 | |||
| 1717 | Ga0495674_0002753 | |||
| 1718 | Ga0495674_0010388 | |||
| 1719 | Ga0495676_0003500 | |||
| 1720 | Ga0495677_0033145 | |||
| 1721 | Ga0495677_0073373 | |||
| 1722 | Ga0495681_0096873 | |||
| 1723 | Ga0495684_0215685 | |||
| 1724 | Ga0495686_0133873 | |||
| 1725 | Ga0495686_0339679 | |||
| 1726 | Ga0495593_0000316 | |||
| 1727 | Ga0495602_0493524 | |||
| 1728 | Ga0495614_0049870 | |||
| 1729 | Ga0496100_0079126 | |||
| 1730 | Ga0496100_0101064 | |||
| 1731 | Ga0496100_0420784 | |||
| 1732 | Ga0496101_0017667 | |||
| 1733 | Ga0496101_0023257 | |||
| 1734 | Ga0496101_0303031 | |||
| 1735 | Ga0496102_0003027 | |||
| 1736 | Ga0496102_0024703 | |||
| 1737 | Ga0496102_0167118 | |||
| 1738 | Ga0496102_0277000 | |||
| 1739 | Ga0496102_0280038 | |||
| 1740 | Ga0496102_0377173 | |||
| 1741 | Ga0496102_0578148 | |||
| 1742 | Ga0496103_0072723 | |||
| 1743 | Ga0496103_0099203 | |||
| 1744 | Ga0496103_0179617 | |||
| 1745 | Ga0496104_0014468 | |||
| 1746 | Ga0496104_0019263 | |||
| 1747 | Ga0496104_0054721 | |||
| 1748 | Ga0496104_0093417 | |||
| 1749 | Ga0496104_0107933 | |||
| 1750 | Ga0496104_0273197 | |||
| 1751 | Ga0496105_0006909 | |||
| 1752 | Ga0496105_0011852 | |||
| 1753 | Ga0496105_0090835 | |||
| 1754 | Ga0496106_0004540 | |||
| 1755 | Ga0496106_0005100 | |||
| 1756 | Ga0496106_0007097 | |||
| 1757 | Ga0496106_0109397 | |||
| 1758 | Ga0496106_0181291 | |||
| 1759 | Ga0496106_0433704 | |||
| 1760 | Ga0496107_0002745 | |||
| 1761 | Ga0496107_0003195 | |||
| 1762 | Ga0496107_0031112 | |||
| 1763 | Ga0496107_0090699 | |||
| 1764 | Ga0496107_0138332 | |||
| 1765 | Ga0496108_0004363 | |||
| 1766 | Ga0496108_0009717 | |||
| 1767 | Ga0496108_0104574 | |||
| 1768 | Ga0496108_0154543 | |||
| 1769 | Ga0496108_0256962 | |||
| 1770 | Ga0496109_0001464 | |||
| 1771 | Ga0496109_0046938 | |||
| 1772 | Ga0496109_0398998 | |||
| 1773 | Ga0496109_0576579 | |||
| 1774 | Ga0496110_0018896 | |||
| 1775 | Ga0496110_0034712 | |||
| 1776 | Ga0496110_0044223 | |||
| 1777 | Ga0496110_0415291 | |||
| 1778 | Ga0496111_0001578 | |||
| 1779 | Ga0496111_0128769 | |||
| 1780 | Ga0496111_0136694 | |||
| 1781 | Ga0496111_0348072 | |||
| 1782 | Ga0496111_0561916 | |||
| 1783 | Ga0496112_0000065 | |||
| 1784 | Ga0496112_0005294 | |||
| 1785 | Ga0496112_0019830 | |||
| 1786 | Ga0496112_0041342 | |||
| 1787 | Ga0496112_0064118 | |||
| 1788 | Ga0496112_0065401 | |||
| 1789 | Ga0496112_0066165 | |||
| 1790 | Ga0496112_0183798 | |||
| 1791 | Ga0496113_0025148 | |||
| 1792 | Ga0496113_0043570 | |||
| 1793 | Ga0496113_0070739 | |||
| 1794 | Ga0496114_0027122 | |||
| 1795 | Ga0496114_0046631 | |||
| 1796 | Ga0496114_0054221 | |||
| 1797 | Ga0496114_0176681 | |||
| 1798 | Ga0496115_0001194 | |||
| 1799 | Ga0496115_0025527 | |||
| 1800 | Ga0496115_0027413 | |||
| 1801 | Ga0496115_0038350 | |||
| 1802 | Ga0496115_0095642 | |||
| 1803 | Ga0496115_0128410 | |||
| 1804 | Ga0496115_0143795 | |||
| 1805 | Ga0496115_0290849 | |||
| 1806 | Ga0496115_0302568 | |||
| 1807 | Ga0496115_0638897 | |||
| 1808 | Ga0496116_0225608 | |||
| 1809 | Ga0496117_0061880 | |||
| 1810 | Ga0496117_0096250 | |||
| 1811 | Ga0496117_0192788 | |||
| 1812 | Ga0496118_0001252 | |||
| 1813 | Ga0496118_0087469 | |||
| 1814 | Ga0496118_0093433 | |||
| 1815 | Ga0496119_0148946 | |||
| 1816 | Ga0496121_0002583 | |||
| 1817 | Ga0496121_0003137 | |||
| 1818 | Ga0496121_0060827 | |||
| 1819 | Ga0496121_0127753 | |||
| 1820 | Ga0496121_0279929 | |||
| 1821 | Ga0496121_0305176 | |||
| 1822 | Ga0496122_0018007 | |||
| 1823 | Ga0496122_0152571 | |||
| 1824 | Ga0496124_0001521 | |||
| 1825 | Ga0496124_0115453 | |||
| 1826 | Ga0496124_0138334 | |||
| 1827 | Ga0496124_0274396 | |||
| 1828 | Ga0496125_0005379 | |||
| 1829 | Ga0496125_0077146 | |||
| 1830 | Ga0496125_0218855 | |||
| 1831 | Ga0496126_0011417 | |||
| 1832 | Ga0496126_0018774 | |||
| 1833 | Ga0496126_0038684 | |||
| 1834 | Ga0496126_0042154 | |||
| 1835 | Ga0496126_0088042 | |||
| 1836 | Ga0496126_0115460 | |||
| 1837 | Ga0496126_0127003 | |||
| 1838 | Ga0496126_0139463 | |||
| 1839 | Ga0496126_0144347 | |||
| 1840 | Ga0496126_0171536 | |||
| 1841 | Ga0496126_0254205 | |||
| 1842 | Ga0496126_0407511 | |||
| 1843 | Ga0496126_0414539 | |||
| 1844 | Ga0495682_0011591 | |||
| 1845 | Ga0495682_0190965 | |||
| 1846 | Ga0501031_0041557 | |||
| 1847 | Ga0501032_0000309 | |||
| 1848 | Ga0501033_0001152 | |||
| 1849 | Ga0501034_0000082 | |||
| 1850 | Ga0501036_0000121 | |||
| 1851 | Ga0501037_0000298 | |||
| 1852 | Ga0501038_0000089 | |||
| 1853 | Ga0501039_0003149 | |||
| 1854 | Ga0501042_0071949 | |||
| 1855 | Ga0501043_0000109 | |||
| 1856 | Ga0501046_0001498 | |||
| 1857 | Ga0501047_0000331 | |||
| 1858 | Ga0501048_0000124 | |||
| 1859 | Ga0501048_0506215 | |||
| 1860 | Ga0501067_0000754 | |||
| 1861 | Ga0501067_0047779 | |||
| 1862 | Ga0501067_0098290 | |||
| 1863 | Ga0501068_0002837 | |||
| 1864 | Ga0501069_0049227 | |||
| 1865 | Ga0501069_0110475 | |||
| 1866 | Ga0501070_0008306 | |||
| 1867 | Ga0501070_0027444 | |||
| 1868 | Ga0501071_0095223 | |||
| 1869 | Ga0501072_0005612 | |||
| 1870 | Ga0501073_0003213 | |||
| 1871 | Ga0501073_0342240 | |||
| 1872 | Ga0501074_0000673 | |||
| 1873 | Ga0501076_0352203 | |||
| 1874 | Ga0501079_0010772 | |||
| 1875 | Ga0501079_0184361 | |||
| 1876 | Ga0501080_0000151 | |||
| 1877 | Ga0501080_0074625 | |||
| 1878 | Ga0501083_0000799 | |||
| 1879 | Ga0501035_0000150 | |||
| 1880 | Ga0501035_0757036 | |||
| 1881 | Ga0501044_0000247 | |||
| 1882 | Ga0501044_0068187 | |||
| 1883 | Ga0501045_0008227 | |||
| 1884 | nmdc:mga03683_17316_c1 | |||
| 1885 | nmdc:mga03n38_7726_c1 | |||
| 1886 | nmdc:mga00v17_16216_c1 | |||
| 1887 | nmdc:mga0yw44_170248_c1 | |||
| 1888 | nmdc:mga0yw44_31747_c1 | |||
| 1889 | nmdc:mga06z11_1024_c1 | |||
| 1890 | nmdc:mga06z11_152821_c1 | |||
| 1891 | nmdc:mga06z11_26272_c1 | |||
| 1892 | nmdc:mga06z11_336794_c1 | |||
| 1893 | nmdc:mga06z11_64441_c1 | |||
| 1894 | nmdc:mga04h51_109235_c1 | |||
| 1895 | nmdc:mga04h51_59515_c1 | |||
| 1896 | nmdc:mga07m45_15473_c1 | |||
| 1897 | nmdc:mga07m45_314291_c1 | |||
| 1898 | nmdc:mga08y16_460868_c1 | |||
| 1899 | nmdc:mga08y16_88232_c1 | |||
| 1900 | nmdc:mga0n895_182682_c1 | |||
| 1901 | nmdc:mga08x19_149742_c1 | |||
| 1902 | nmdc:mga0sz30_44122_c1 | |||
| 1903 | nmdc:mga0sz30_50067_c1 | |||
| 1904 | Ga0495601_0051109 | |||
| 1905 | Ga0495601_0063187 | |||
| 1906 | Ga0495601_0609158 | |||
| 1907 | Ga0495655_0148339 | |||
| 1908 | Ga0495595_0038182 | |||
| 1909 | Ga0495619_0065541 | |||
| 1910 | Ga0495619_0265853 | |||
| 1911 | Ga0500578_0177234 | |||
| 1912 | Ga0500643_031589 | |||
| 1913 | Ga0500581_044177 | |||
| 1914 | Ga0500581_113117 | |||
| 1915 | Ga0500646_0003403 | |||
| 1916 | Ga0500583_0041335 | |||
| 1917 | Ga0500566_0001953 | |||
| 1918 | Ga0500566_0002739 | |||
| 1919 | Ga0500640_044371 | |||
| 1920 | Ga0500650_0000885 | |||
| 1921 | Ga0500650_0063383 | |||
| 1922 | Ga0500650_0227542 | |||
| 1923 | Ga0500554_001373 | |||
| 1924 | Ga0500556_0000019 | |||
| 1925 | Ga0500556_0097386 | |||
| 1926 | Ga0500562_007205 | |||
| 1927 | Ga0500569_005216 | |||
| 1928 | Ga0500569_078603 | |||
| 1929 | Ga0500569_080508 | |||
| 1930 | Ga0500572_003137 | |||
| 1931 | Ga0500591_055153 | |||
| 1932 | Ga0500592_000579 | |||
| 1933 | Ga0500593_053882 | |||
| 1934 | Ga0500594_0007253 | |||
| 1935 | Ga0500594_0013695 | |||
| 1936 | Ga0500595_011328 | |||
| 1937 | Ga0500608_055567 | |||
| 1938 | Ga0500614_032215 | |||
| 1939 | Ga0500617_046161 | |||
| 1940 | Ga0500642_0000048 | |||
| 1941 | Ga0500642_0082625 | |||
| 1942 | Ga0500658_0007623 | |||
| 1943 | Ga0500658_0078730 | |||
| 1944 | Ga0500559_0011154 | |||
| 1945 | Ga0500568_0002172 | |||
| 1946 | Ga0500568_0031404 | |||
| 1947 | Ga0500577_0085822 | |||
| 1948 | Ga0500588_0018360 | |||
| 1949 | Ga0500589_083133 | |||
| 1950 | Ga0500590_043222 | |||
| 1951 | Ga0500603_002009 | |||
| 1952 | Ga0500604_0017964 | |||
| 1953 | Ga0500604_0042783 | |||
| 1954 | Ga0500616_0000059 | |||
| 1955 | Ga0500627_0016814 | |||
| 1956 | Ga0500630_060269 | |||
| 1957 | Ga0500633_0098681 | |||
| 1958 | Ga0500634_0025972 | |||
| 1959 | Ga0500634_0131183 | |||
| 1960 | Ga0500634_0146835 | |||
| 1961 | Ga0500638_081795 | |||
| 1962 | Ga0500638_118075 | |||
| 1963 | Ga0500639_009259 | |||
| 1964 | Ga0500636_0102323 | |||
| 1965 | Ga0500637_0000500 | |||
| 1966 | Ga0500637_0029756 | |||
| 1967 | Ga0500637_0113783 | |||
| 1968 | Ga0500645_013023 | |||
| 1969 | Ga0500609_018977 | |||
| 1970 | Ga0500601_016127 | |||
| 1971 | Ga0501084_0025853 | |||
| 1972 | Ga0500661_022621 | |||
| 1973 | Ga0501082_0009016 | |||
| 1974 | Ga0466962_0093006 | |||
| 1975 | 2508695896 | |||
| 1976 | 2513694013 | |||
| 1977 | 2513876916 | |||
| 1978 | 2514016101 | |||
| 1979 | 2617353271 | |||
| 1980 | 2723849317 | |||
| 1981 | 2793065654 | |||
| 1982 | 2793065905 | |||
| 1983 | 2793077119 | |||
| 1984 | 2805921290 | |||
| 1985 | 2824608807 | |||
| 1986 | 2824617425 | |||
| 1987 | 2824660774 | |||
| 1988 | 2824677705 | |||
| 1989 | 2824683536 | |||
| 1990 | 2824695251 | |||
| 1991 | 2824704008 | |||
| 1992 | 2824777528 | |||
| 1993 | 2838125764 | |||
| 1994 | 2841947975 | |||
| 1995 | 2841952806 | |||
| 1996 | 2841972803 | |||
| 1997 | 2841977580 | |||
| 1998 | 2841984862 | |||
| 1999 | 2842041387 | |||
| 2000 | 2842049429 | |||
| 2001 | 2847942695 | |||
| 2002 | 2849083439 | |||
| 2003 | 2874608454 | |||
| 2004 | 2874621388 | |||
| 2005 | 2874629181 | |||
| 2006 | 2876809969 | |||
| 2007 | 2879112782 | |||
| 2008 | 2888427501 | |||
| 2009 | 2889035893 | |||
| 2010 | 2904668058 | |||
| 2011 | 2922364366 | |||
| 2012 | 2922389063 | |||
| 2013 | 2922400776 | |||
| 2014 | 2932789058 | |||
| 2015 | 2932808818 | |||
| 2016 | 2932814305 | |||
| 2017 | 2932820431 | |||
| 2018 | 2932834307 | |||
| 2019 | 2935614692 | |||
| 2020 | 2935619991 | |||
| 2021 | 2935648142 | |||
| 2022 | 2935673403 | |||
| 2023 | 2935686806 | |||
| 2024 | 2935701514 | |||
| 2025 | 2935716494 | |||
| 2026 | 2935723381 | |||
| 2027 | 2935734937 | |||
| 2028 | 2935744272 | |||
| 2029 | 2935752772 | |||
| 2030 | 2935764681 | |||
| 2031 | 2935806208 | |||
| 2032 | 2935816980 | |||
| 2033 | 2935826267 | |||
| 2034 | 2935837633 | |||
| 2035 | 2935841355 | |||
| 2036 | 2935853763 | |||
| 2037 | 2935858877 | |||
| 2038 | 2935864058 | |||
| 2039 | 2935875628 | |||
| 2040 | 2935883311 | |||
| 2041 | 2935924145 | |||
| 2042 | 2935932802 | |||
| 2043 | 2935937365 | |||
| 2044 | 2935949434 | |||
| 2045 | 2935958167 | |||
| 2046 | 2935971178 | |||
| 2047 | 2935985364 | |||
| 2048 | 2935995429 | |||
| 2049 | 2936007851 | |||
| 2050 | 2936043971 | |||
| 2051 | 2936056872 | |||
| 2052 | 2940558685 | |||
| 2053 | 2941543581 | |||
| 2054 | 8006967848 | |||
| 2055 | 8006992470 | |||
| 2056 | 8006998514 | |||
| 2057 | 8016517744 | |||
| 2058 | 8016635209 | |||
| 2059 | 8017058886 | |||
| 2060 | 8019576765 | |||
| 2061 | 8019594821 | |||
| 2062 | 8019606920 | |||
| 2063 | 8019611589 | |||
| 2064 | 8056676281 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7stc-assembly1.cif.gz_C | aqp5 t41h with ni2+ | 0.334 | 10 | 178 |
| 3tdo-assembly1.cif.gz_C | crystal structure of hsc at ph 9.0 | 0.3298 | 8 | 177 |
| 1j4n-assembly1.cif.gz_A | crystal structure of the aqp1 water channel | 0.314 | 8 | 178 |
| 3tds-assembly1.cif.gz_E | crystal structure of hsc f194i | 0.3122 | 8 | 177 |
| 4onr-assembly1.cif.gz_A | crystal structure of borrelia burgdorferi decorin-binding protein dbpa | 0.304 | 31 | 150 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_F1QFY1_274_398_1.20.1310.10 | Mainly Alpha;Up-down Bundle;5 helical Cullin repeat like;Cullin Repeats | 0.3817 | 53 | 142 | 1.20.1310.10 |
| 4i6iA03 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;IP3 receptor type 1 binding core, RIH domain | 0.3412 | 54 | 130 | 1.25.10.30 |
| af_Q9VPI2_392_518_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.339 | 51 | 182 | 1.10.287.70 |
| af_Q94AA1_34_188_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3209 | 61 | 206 | 1.20.1250.20 |
| af_P90947_501_646_1.20.120.230 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like | 0.3085 | 8 | 166 | 1.20.120.230 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2G1QS62-F1-model_v4 | Phosphoesterase PA-phosphatase | 0.9375 | 9 | 153 |
GO:0005886
|
| AF-H8Z5I4-F1-model_v4 | Putative membrane-associated protein | 0.9206 | 8 | 160 |
GO:0005886
|
| AF-A0A2T4Z699-F1-model_v4 | Membrane protein DedA with SNARE-associated domain | 0.9103 | 8 | 161 |
GO:0005886
|
| AF-A0A2D8AK32-F1-model_v4 | VTT domain-containing protein | 0.905 | 19 | 161 |
GO:0005886
|
| AF-A0A3M6E6F0-F1-model_v4 | PAP2 super protein/DedA protein | 0.9046 | 9 | 160 |
GO:0005886
|