F488604

General Info

Members Datasets Scaffolds Average Seq Length
1031 333 2062 96

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100044987|Ga0070714_1000449872
Length 115
Sequence MCTAESSVPFSTPTRNARLAAMPRYLIVRSFEVGEDQMPPVGRRSRELTETEFPEITWEHSHVVVDDEGLVRTYCVYEAPNEQVVRDHSSRLGRHTLDVLHEIAGDVTPADFPPV

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
57 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
131 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
132 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
135 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
136 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
137 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
138 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
139 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
140 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
141 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
142 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
143 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
144 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
145 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
146 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
147 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
149 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
150 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
151 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
152 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
153 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
154 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
155 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
156 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
157 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
158 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
159 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
160 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
174 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
175 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
176 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
177 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
178 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
179 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
180 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
181 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
182 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
183 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
184 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
185 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
186 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
187 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
188 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
189 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
190 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
193 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
194 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
195 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
196 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
199 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
200 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
201 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
202 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
203 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
204 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
205 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
206 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
207 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
208 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
209 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
210 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
211 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
212 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
213 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
214 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
215 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
216 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
217 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
218 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
219 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
220 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
221 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
222 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
223 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
224 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
225 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
226 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
227 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
228 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
229 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
230 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
231 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
232 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
233 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
234 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
235 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
236 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
237 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
238 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
239 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
240 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
241 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
242 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
243 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
244 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
245 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
246 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
247 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
248 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
249 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
250 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
251 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
252 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
253 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
254 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
255 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
256 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
257 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
258 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
259 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
260 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
261 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
262 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
263 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
264 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
265 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
266 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
267 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
268 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
269 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
270 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
271 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
272 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
273 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
274 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
275 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
276 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
277 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
278 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
279 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
280 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
281 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
282 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
283 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
284 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
285 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
286 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
287 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
288 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
289 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
302 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
303 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
304 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
305 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
306 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
307 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
308 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
309 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
310 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
311 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
312 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
313 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
314 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
315 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
316 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
319 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
320 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
321 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
322 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
323 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
324 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
325 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
326 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
327 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
328 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
329 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
330 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
331 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
332 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
333 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.74
Metatranscriptomes 1.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.1
Nodule 0
Rhizoplane 18.33
Rhizosphere 80.21
Stem 0
Stem Tuber 0
Unclassified 21.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100044987 3300005435 Bacteria 3739
2 JGI25406J46586_10074476 3300003203 Unclassified 1056
3 Ga0070683_100008714 3300005329 Bacteria 8625
4 Ga0068869_100302511 3300005334 Bacteria 1292
5 Ga0070680_100087689 3300005336 Unclassified 2573
6 Ga0070680_100739598 3300005336 Unclassified 847
7 Ga0070682_100269657 3300005337 Bacteria 1236
8 Ga0070682_100374438 3300005337 Bacteria 1069
9 Ga0068868_100315759 3300005338 Bacteria 1330
10 Ga0068868_101040909 3300005338 Bacteria 751
11 Ga0070660_100570096 3300005339 Bacteria 945
12 Ga0070691_10529732 3300005341 Bacteria 685
13 Ga0070661_100389653 3300005344 Bacteria 1100
14 Ga0070671_100329543 3300005355 Bacteria 1301
15 Ga0070671_101859887 3300005355 Bacteria 535
16 Ga0070673_100267654 3300005364 Bacteria 1495
17 Ga0070703_10015069 3300005406 Unclassified 2210
18 Ga0070709_10009572 3300005434 Bacteria 5349
19 Ga0070709_10113405 3300005434 Bacteria 1825
20 Ga0070709_10128603 3300005434 Unclassified 1726
21 Ga0070714_100012637 3300005435 Bacteria 6743
22 Ga0070714_100014579 3300005435 Bacteria 6315
23 Ga0070714_100018152 3300005435 Bacteria 5708
24 Ga0070714_100022459 3300005435 Bacteria 5174
25 Ga0070714_100199748 3300005435 Bacteria 1829
26 Ga0070714_100568086 3300005435 Bacteria 1087
27 Ga0070714_100900862 3300005435 Unclassified 859
28 Ga0070714_100994636 3300005435 Bacteria 816
29 Ga0070714_101854181 3300005435 Unclassified 589
30 Ga0070713_100029732 3300005436 Bacteria 4329
31 Ga0070713_100032857 3300005436 Bacteria 4149
32 Ga0070713_100338972 3300005436 Bacteria 1392
33 Ga0070710_10004975 3300005437 Bacteria 6291
34 Ga0070710_10087364 3300005437 Bacteria 1832
35 Ga0070710_10439895 3300005437 Bacteria 882
36 Ga0070710_11244902 3300005437 Unclassified 551
37 Ga0070701_10840617 3300005438 Unclassified 629
38 Ga0070711_100016112 3300005439 Bacteria 4741
39 Ga0070711_100032237 3300005439 Bacteria 3483
40 Ga0070711_100059898 3300005439 Bacteria 2645
41 Ga0070711_100220361 3300005439 Bacteria 1474
42 Ga0070711_100340197 3300005439 Unclassified 1204
43 Ga0070711_100705779 3300005439 Bacteria 850
44 Ga0070711_100835486 3300005439 Unclassified 783
45 Ga0070705_100083751 3300005440 Bacteria 1966
46 Ga0070705_100835393 3300005440 Bacteria 736
47 Ga0070694_100048418 3300005444 Unclassified 2859
48 Ga0070708_100032971 3300005445 Bacteria 4497
49 Ga0070708_100042208 3300005445 Bacteria 4003
50 Ga0070678_100166577 3300005456 Bacteria 1791
51 Ga0070678_100219891 3300005456 Bacteria 1578
52 Ga0070678_100293951 3300005456 Bacteria 1378
53 Ga0070681_10017759 3300005458 Bacteria 7109
54 Ga0070681_10189495 3300005458 Unclassified 1976
55 Ga0070681_10210796 3300005458 Bacteria 1859
56 Ga0070681_10806861 3300005458 Unclassified 856
57 Ga0070681_11382352 3300005458 Unclassified 627
58 Ga0070706_100200886 3300005467 Unclassified 1862
59 Ga0070707_100003292 3300005468 Bacteria 15262
60 Ga0070707_100030999 3300005468 Bacteria 5092
61 Ga0070707_100067645 3300005468 Bacteria 3437
62 Ga0070707_100130514 3300005468 Bacteria 2444
63 Ga0070707_100751057 3300005468 Bacteria 939
64 Ga0070707_100807610 3300005468 Bacteria 902
65 Ga0070698_100070724 3300005471 Bacteria 3501
66 Ga0070698_100092362 3300005471 Unclassified 3007
67 Ga0070698_100383148 3300005471 Bacteria 1339
68 Ga0070698_101927075 3300005471 Unclassified 544
69 Ga0070699_100034221 3300005518 Bacteria 4391
70 Ga0070699_100852578 3300005518 Bacteria 834
71 Ga0070679_100013498 3300005530 Bacteria 7823
72 Ga0070679_100029310 3300005530 Bacteria 5430
73 Ga0070679_100075691 3300005530 Bacteria 3355
74 Ga0070679_100192736 3300005530 Bacteria 2006
75 Ga0070679_100487634 3300005530 Bacteria 1177
76 Ga0070679_100618679 3300005530 Bacteria 1026
77 Ga0070684_100025832 3300005535 Bacteria 4941
78 Ga0070684_100113292 3300005535 Bacteria 2434
79 Ga0070684_101428742 3300005535 Unclassified 652
80 Ga0070697_100121161 3300005536 Bacteria 2188
81 Ga0070697_100530871 3300005536 Bacteria 1031
82 Ga0070697_100637429 3300005536 Bacteria 938
83 Ga0070697_101047273 3300005536 Unclassified 726
84 Ga0068853_100839209 3300005539 Bacteria 881
85 Ga0068853_101304260 3300005539 Unclassified 702
86 Ga0070695_100029800 3300005545 Bacteria 3393
87 Ga0070695_100100925 3300005545 Bacteria 1943
88 Ga0070695_101600147 3300005545 Unclassified 544
89 Ga0070696_100072644 3300005546 Bacteria 2423
90 Ga0070696_100103323 3300005546 Bacteria 2045
91 Ga0070696_100445056 3300005546 Bacteria 1021
92 Ga0070696_102002931 3300005546 Unclassified 503
93 Ga0070693_100125958 3300005547 Unclassified 1595
94 Ga0070693_100286921 3300005547 Bacteria 1104
95 Ga0070665_101297338 3300005548 Bacteria 738
96 Ga0070704_100016869 3300005549 Unclassified 4628
97 Ga0070704_100028271 3300005549 Bacteria 3729
98 Ga0070704_100813373 3300005549 Bacteria 836
99 Ga0068855_100135143 3300005563 Unclassified 2814
100 Ga0068855_100903574 3300005563 Bacteria 933
101 Ga0070664_101089030 3300005564 Bacteria 752
102 Ga0068857_100650787 3300005577 Bacteria 999
103 Ga0068856_100004254 3300005614 Bacteria 14295
104 Ga0068856_100050235 3300005614 Bacteria 4111
105 Ga0068856_100607405 3300005614 Unclassified 1115
106 Ga0068856_100760348 3300005614 Bacteria 989
107 Ga0068856_101043901 3300005614 Bacteria 835
108 Ga0070702_100043322 3300005615 Unclassified 2536
109 Ga0070702_100053062 3300005615 Bacteria 2328
110 Ga0070702_100121565 3300005615 Unclassified 1636
111 Ga0068852_100518844 3300005616 Bacteria 1189
112 Ga0068864_102421851 3300005618 Bacteria 531
113 Ga0068851_11106993 3300005834 Unclassified 503
114 Ga0068863_100392542 3300005841 Bacteria 1356
115 Ga0068863_100767560 3300005841 Bacteria 961
116 Ga0068863_101217984 3300005841 Bacteria 759
117 Ga0068862_102119068 3300005844 Unclassified 573
118 Ga0081539_10039813 3300005985 Bacteria 2768
119 Ga0070717_10027339 3300006028 Bacteria 4559
120 Ga0070717_10027807 3300006028 Bacteria 4521
121 Ga0070717_10120582 3300006028 Unclassified 2246
122 Ga0070717_10678454 3300006028 Bacteria 936
123 Ga0070717_11426899 3300006028 Bacteria 628
124 Ga0070717_11504980 3300006028 Bacteria 611
125 Ga0070717_11598868 3300006028 Bacteria 591
126 Ga0070715_10002018 3300006163 Bacteria 6126
127 Ga0070715_10027774 3300006163 Bacteria 2263
128 Ga0070715_10088512 3300006163 Bacteria 1420
129 Ga0070715_10101030 3300006163 Unclassified 1345
130 Ga0070715_10121710 3300006163 Bacteria 1245
131 Ga0070716_100003623 3300006173 Bacteria 7299
132 Ga0070716_100034746 3300006173 Bacteria 2766
133 Ga0070716_100211802 3300006173 Bacteria 1295
134 Ga0070716_100568865 3300006173 Unclassified 848
135 Ga0070716_100692776 3300006173 Bacteria 777
136 Ga0070712_100015533 3300006175 Unclassified 4909
137 Ga0070712_100054694 3300006175 Unclassified 2791
138 Ga0070712_100106139 3300006175 Bacteria 2087
139 Ga0070712_100119231 3300006175 Bacteria 1983
140 Ga0070712_100149113 3300006175 Bacteria 1794
141 Ga0070712_100343895 3300006175 Bacteria 1219
142 Ga0070712_100499910 3300006175 Bacteria 1019
143 Ga0070712_101294266 3300006175 Bacteria 635
144 Ga0097621_100161681 3300006237 Bacteria 1925
145 Ga0097621_100379597 3300006237 Unclassified 1262
146 Ga0097621_102046341 3300006237 Bacteria 547
147 Ga0075434_100043444 3300006871 Unclassified 4458
148 Ga0075434_100133108 3300006871 Unclassified 2506
149 Ga0075436_100189029 3300006914 Unclassified 1457
150 Ga0075435_100715229 3300007076 Bacteria 871
151 Ga0099795_10235061 3300007788 Unclassified 785
152 Ga0105250_10411921 3300009092 Bacteria 601
153 Ga0105240_10015125 3300009093 Bacteria 10503
154 Ga0105240_10134586 3300009093 Bacteria 2961
155 Ga0105240_10167588 3300009093 Bacteria 2604
156 Ga0111539_10195218 3300009094 Unclassified 2361
157 Ga0105245_10016693 3300009098 Bacteria 6411
158 Ga0105245_10183849 3300009098 Bacteria 1998
159 Ga0105245_10227907 3300009098 Bacteria 1801
160 Ga0105245_10431703 3300009098 Bacteria 1322
161 Ga0105245_10547207 3300009098 Bacteria 1179
162 Ga0105245_10824105 3300009098 Unclassified 967
163 Ga0105245_11164001 3300009098 Bacteria 818
164 Ga0105245_11912974 3300009098 Unclassified 646
165 Ga0105245_12888960 3300009098 Bacteria 532
166 Ga0105247_10058823 3300009101 Bacteria 2378
167 Ga0114129_10087988 3300009147 Bacteria 4307
168 Ga0114129_10604341 3300009147 Bacteria 1421
169 Ga0114129_11790497 3300009147 Unclassified 747
170 Ga0105243_10374295 3300009148 Bacteria 1315
171 Ga0105241_10255032 3300009174 Unclassified 1489
172 Ga0105241_10772695 3300009174 Unclassified 883
173 Ga0105241_12100560 3300009174 Unclassified 558
174 Ga0105241_12517157 3300009174 Unclassified 516
175 Ga0105242_10241211 3300009176 Bacteria 1625
176 Ga0105242_11098723 3300009176 Unclassified 809
177 Ga0105242_11283619 3300009176 Bacteria 755
178 Ga0105242_11324382 3300009176 Bacteria 745
179 Ga0105242_11614090 3300009176 Bacteria 682
180 Ga0105242_13218470 3300009176 Unclassified 507
181 Ga0105248_10096239 3300009177 Bacteria 3334
182 Ga0105248_10504275 3300009177 Archaea 1364
183 Ga0105248_12630977 3300009177 Bacteria 574
184 Ga0105237_10012550 3300009545 Bacteria 8926
185 Ga0105237_10028267 3300009545 Bacteria 5714
186 Ga0105237_11199409 3300009545 Unclassified 766
187 Ga0105238_10349967 3300009551 Bacteria 1466
188 Ga0105238_10369292 3300009551 Bacteria 1425
189 Ga0105249_10037672 3300009553 Bacteria 4388
190 Ga0099796_10350624 3300010159 Bacteria 636
191 Ga0105239_10239298 3300010375 Bacteria 2037
192 Ga0105239_10403265 3300010375 Bacteria 1547
193 Ga0105239_11196110 3300010375 Unclassified 876
194 Ga0105239_12392623 3300010375 Bacteria 615
195 Ga0105239_12505340 3300010375 Bacteria 601
196 Ga0105246_10035088 3300011119 Unclassified 3349
197 Ga0157373_10317508 3300013100 Unclassified 1108
198 Ga0157373_10326846 3300013100 Unclassified 1091
199 Ga0157371_11004614 3300013102 Bacteria 636
200 Ga0157370_10041660 3300013104 Bacteria 4428
201 Ga0157370_10335150 3300013104 Bacteria 1395
202 Ga0157370_10420249 3300013104 Bacteria 1230
203 Ga0157370_10960531 3300013104 Unclassified 774
204 Ga0157370_11754878 3300013104 Unclassified 557
205 Ga0157369_10057047 3300013105 Bacteria 4214
206 Ga0157369_10223656 3300013105 Bacteria 1969
207 Ga0157369_10250603 3300013105 Bacteria 1848
208 Ga0157369_10725789 3300013105 Bacteria 1023
209 Ga0157369_11329175 3300013105 Unclassified 732
210 Ga0157374_10219442 3300013296 Bacteria 1865
211 Ga0157374_10251991 3300013296 Bacteria 1737
212 Ga0157374_10589009 3300013296 Bacteria 1121
213 Ga0157374_11023029 3300013296 Unclassified 846
214 Ga0157374_11408182 3300013296 Unclassified 720
215 Ga0157374_12867765 3300013296 Unclassified 509
216 Ga0157378_10154640 3300013297 Bacteria 2139
217 Ga0157378_10713374 3300013297 Bacteria 1023
218 Ga0163162_10340282 3300013306 Bacteria 1633
219 Ga0157372_10027075 3300013307 Bacteria 6240
220 Ga0157372_10209493 3300013307 Unclassified 2259
221 Ga0157372_10271712 3300013307 Unclassified 1970
222 Ga0157372_10851579 3300013307 Bacteria 1058
223 Ga0157372_11159453 3300013307 Unclassified 893
224 Ga0157372_12855581 3300013307 Bacteria 553
225 Ga0157375_10160165 3300013308 Bacteria 2392
226 Ga0157375_11635309 3300013308 Unclassified 762
227 Ga0157375_11801722 3300013308 Bacteria 726
228 Ga0157375_11988140 3300013308 Bacteria 691
229 Ga0163163_10585244 3300014325 Bacteria 1179
230 Ga0163163_11798295 3300014325 Unclassified 673
231 Ga0182008_10049929 3300014497 Bacteria 2076
232 Ga0157377_10563426 3300014745 Archaea 807
233 Ga0157376_10014957 3300014969 Bacteria 5847
234 Ga0157376_10651172 3300014969 Bacteria 1054
235 Ga0157376_11682950 3300014969 Unclassified 669
236 Ga0157376_11879242 3300014969 Unclassified 636
237 Ga0197907_10854251 3300020069 Bacteria 763
238 Ga0206356_10209225 3300020070 Bacteria 2315
239 Ga0206356_10929994 3300020070 Bacteria 1586
240 Ga0206356_10977224 3300020070 Bacteria 2100
241 Ga0206350_11514786 3300020080 Bacteria 791
242 Ga0206354_10859821 3300020081 Bacteria 1014
243 Ga0206354_11318015 3300020081 Bacteria 2308
244 Ga0206354_11338473 3300020081 Bacteria 3651
245 Ga0206353_10588232 3300020082 Bacteria 2230
246 Ga0206353_10632433 3300020082 Bacteria 1685
247 Ga0206353_11523787 3300020082 Bacteria 4221
248 Ga0224712_10203731 3300022467 Bacteria 900
249 Ga0224712_10593113 3300022467 Unclassified 541
250 Ga0207692_10007655 3300025898 Bacteria 4433
251 Ga0207692_10035063 3300025898 Bacteria 2435
252 Ga0207692_10072795 3300025898 Bacteria 1816
253 Ga0207692_10276641 3300025898 Bacteria 1014
254 Ga0207692_10378547 3300025898 Bacteria 878
255 Ga0207710_10057191 3300025900 Bacteria 1761
256 Ga0207680_10159651 3300025903 Bacteria 1510
257 Ga0207685_10026097 3300025905 Bacteria 2026
258 Ga0207685_10097114 3300025905 Bacteria 1253
259 Ga0207699_10006811 3300025906 Bacteria 5558
260 Ga0207699_10021993 3300025906 Bacteria 3448
261 Ga0207699_10024515 3300025906 Bacteria 3301
262 Ga0207699_10407059 3300025906 Bacteria 970
263 Ga0207684_10106127 3300025910 Bacteria 2403
264 Ga0207684_10287828 3300025910 Unclassified 1417
265 Ga0207654_10373898 3300025911 Unclassified 986
266 Ga0207654_10471296 3300025911 Bacteria 883
267 Ga0207707_10013971 3300025912 Bacteria 7001
268 Ga0207707_10073428 3300025912 Bacteria 2983
269 Ga0207707_10086553 3300025912 Bacteria 2738
270 Ga0207707_10452391 3300025912 Bacteria 1099
271 Ga0207707_10604065 3300025912 Bacteria 928
272 Ga0207707_11510962 3300025912 Unclassified 532
273 Ga0207695_10201378 3300025913 Unclassified 1905
274 Ga0207693_10002044 3300025915 Bacteria 17664
275 Ga0207693_10002632 3300025915 Bacteria 15592
276 Ga0207693_10002681 3300025915 Bacteria 15453
277 Ga0207693_10009259 3300025915 Bacteria 8039
278 Ga0207693_10019134 3300025915 Bacteria 5450
279 Ga0207693_10035288 3300025915 Bacteria 3943
280 Ga0207693_10081175 3300025915 Bacteria 2539
281 Ga0207693_10330786 3300025915 Bacteria 1193
282 Ga0207693_10397242 3300025915 Bacteria 1078
283 Ga0207693_11083133 3300025915 Bacteria 609
284 Ga0207663_10000508 3300025916 Bacteria 17037
285 Ga0207663_10032689 3300025916 Bacteria 3091
286 Ga0207663_10077201 3300025916 Unclassified 2167
287 Ga0207663_10087540 3300025916 Bacteria 2057
288 Ga0207663_10099076 3300025916 Bacteria 1953
289 Ga0207663_10101709 3300025916 Unclassified 1931
290 Ga0207663_10234312 3300025916 Unclassified 1343
291 Ga0207663_10695420 3300025916 Unclassified 805
292 Ga0207663_11210377 3300025916 Bacteria 608
293 Ga0207660_10275697 3300025917 Bacteria 1333
294 Ga0207660_10286421 3300025917 Bacteria 1309
295 Ga0207660_10348157 3300025917 Bacteria 1187
296 Ga0207660_10360316 3300025917 Bacteria 1166
297 Ga0207660_10937524 3300025917 Bacteria 706
298 Ga0207657_10254595 3300025919 Bacteria 1399
299 Ga0207657_10795837 3300025919 Bacteria 731
300 Ga0207649_10123357 3300025920 Bacteria 1750
301 Ga0207649_10479108 3300025920 Bacteria 943
302 Ga0207649_10631031 3300025920 Bacteria 826
303 Ga0207652_10012591 3300025921 Bacteria 6837
304 Ga0207652_10022150 3300025921 Bacteria 5252
305 Ga0207652_10027860 3300025921 Bacteria 4712
306 Ga0207652_10908793 3300025921 Bacteria 777
307 Ga0207652_10967957 3300025921 Unclassified 749
308 Ga0207646_10000553 3300025922 Bacteria 49225
309 Ga0207646_10025249 3300025922 Bacteria 5437
310 Ga0207646_10602795 3300025922 Bacteria 986
311 Ga0207646_10714825 3300025922 Bacteria 895
312 Ga0207646_11719579 3300025922 Bacteria 538
313 Ga0207694_10479132 3300025924 Bacteria 1041
314 Ga0207694_11857698 3300025924 Bacteria 506
315 Ga0207687_10331837 3300025927 Bacteria 1234
316 Ga0207687_10611929 3300025927 Unclassified 919
317 Ga0207687_10629001 3300025927 Archaea 907
318 Ga0207687_10867196 3300025927 Bacteria 772
319 Ga0207687_11567026 3300025927 Unclassified 566
320 Ga0207700_10007688 3300025928 Bacteria 6619
321 Ga0207700_10012145 3300025928 Bacteria 5539
322 Ga0207700_10080039 3300025928 Bacteria 2546
323 Ga0207700_10155834 3300025928 Bacteria 1892
324 Ga0207700_12035398 3300025928 Bacteria 501
325 Ga0207664_10050845 3300025929 Bacteria 3270
326 Ga0207664_10066343 3300025929 Bacteria 2893
327 Ga0207664_10071530 3300025929 Bacteria 2794
328 Ga0207664_10079356 3300025929 Bacteria 2664
329 Ga0207664_10085788 3300025929 Bacteria 2571
330 Ga0207664_10117133 3300025929 Bacteria 2224
331 Ga0207664_10158548 3300025929 Bacteria 1928
332 Ga0207664_10380090 3300025929 Bacteria 1254
333 Ga0207664_10388494 3300025929 Bacteria 1240
334 Ga0207664_10472223 3300025929 Bacteria 1121
335 Ga0207664_11241983 3300025929 Unclassified 664
336 Ga0207644_10384722 3300025931 Bacteria 1145
337 Ga0207644_10550342 3300025931 Bacteria 955
338 Ga0207686_10491426 3300025934 Bacteria 951
339 Ga0207686_10590606 3300025934 Bacteria 873
340 Ga0207686_10984347 3300025934 Bacteria 684
341 Ga0207686_11076609 3300025934 Bacteria 655
342 Ga0207704_10232998 3300025938 Unclassified 1371
343 Ga0207665_10000420 3300025939 Bacteria 29260
344 Ga0207665_10000735 3300025939 Bacteria 22043
345 Ga0207665_10012183 3300025939 Bacteria 5648
346 Ga0207665_10270846 3300025939 Bacteria 1261
347 Ga0207665_10735566 3300025939 Bacteria 777
348 Ga0207665_10742006 3300025939 Bacteria 774
349 Ga0207711_10231139 3300025941 Bacteria 1694
350 Ga0207661_10025486 3300025944 Bacteria 4495
351 Ga0207661_10248377 3300025944 Bacteria 1581
352 Ga0207661_10526160 3300025944 Bacteria 1082
353 Ga0207661_10901905 3300025944 Bacteria 814
354 Ga0207679_10112354 3300025945 Bacteria 2153
355 Ga0207679_11088668 3300025945 Unclassified 733
356 Ga0207667_11283431 3300025949 Unclassified 709
357 Ga0207667_11350335 3300025949 Unclassified 688
358 Ga0207651_10427296 3300025960 Bacteria 1132
359 Ga0207640_11308005 3300025981 Bacteria 647
360 Ga0207677_10243304 3300026023 Bacteria 1457
361 Ga0207677_11040201 3300026023 Archaea 744
362 Ga0207678_10080546 3300026067 Bacteria 2788
363 Ga0207702_10002127 3300026078 Bacteria 19055
364 Ga0207702_10306948 3300026078 Unclassified 1507
365 Ga0207702_10817124 3300026078 Bacteria 922
366 Ga0207641_10200581 3300026088 Bacteria 1839
367 Ga0207676_10488775 3300026095 Bacteria 1167
368 Ga0207675_101070799 3300026118 Bacteria 826
369 Ga0207683_10010038 3300026121 Bacteria 8080
370 Ga0207683_10180593 3300026121 Bacteria 1913
371 Ga0207683_10288615 3300026121 Bacteria 1500
372 Ga0207683_10431800 3300026121 Bacteria 1214
373 Ga0207683_11345374 3300026121 Bacteria 661
374 Ga0207698_10141674 3300026142 Bacteria 2072
375 Ga0265319_1027334 3300028563 Bacteria 2025
376 Ga0265318_10001995 3300028577 Bacteria 11325
377 Ga0265320_10013534 3300031240 Bacteria 4689
378 Ga0307415_101649232 3300032126 Bacteria 617
379 Ga0307415_101750526 3300032126 Bacteria 600
380 Ga0373930_0021512 3300034816 Bacteria 1268
381 Ga0373948_0025382 3300034817 Bacteria 1162
382 Ga0373958_0031139 3300034819 Bacteria 1047
383 Ga0373958_0063671 3300034819 Unclassified 804
384 Ga0373959_0003704 3300034820 Bacteria 2445
385 Ga0373938_0051971 3300034957 Bacteria 938
386 Ga0373938_0099726 3300034957 Bacteria 728
387 Ga0373928_0036020 3300035084 Bacteria 1117
388 Ga0373929_0017279 3300035085 Bacteria 1422
389 Ga0373929_0053251 3300035085 Bacteria 930
390 Ga0373929_0104294 3300035085 Bacteria 718
391 Ga0373934_0214641 3300035086 Unclassified 793
392 Ga0373940_0004754 3300035088 Bacteria 2893
393 Ga0373940_0103942 3300035088 Bacteria 865
394 Ga0373940_0173710 3300035088 Bacteria 697
395 Ga0373949_0004330 3300035090 Bacteria 3259
396 Ga0373951_0024277 3300035091 Bacteria 1404
397 Ga0373951_0039012 3300035091 Bacteria 1140
398 Ga0373951_0177453 3300035091 Unclassified 610
399 Ga0373952_0008815 3300035092 Bacteria 1919
400 Ga0373952_0041755 3300035092 Bacteria 1062
401 Ga0373932_0404758 3300035112 Bacteria 528
402 Ga0373936_0036090 3300035113 Bacteria 1970
403 Ga0373939_0116077 3300035114 Bacteria 938
404 Ga0373939_0177434 3300035114 Bacteria 792
405 Ga0373941_0095468 3300035115 Bacteria 1027
406 Ga0373941_0311637 3300035115 Bacteria 631
407 Ga0373941_0330330 3300035115 Bacteria 615
408 Ga0373945_0055367 3300035116 Bacteria 1468
409 Ga0373954_0617612 3300035118 Unclassified 537
410 Ga0373956_0033447 3300035119 Bacteria 2261
411 Ga0373956_0090986 3300035119 Bacteria 1408
412 Ga0373960_0072793 3300035121 Bacteria 1066
413 Ga0373943_0005843 3300035170 Bacteria 5527
414 Ga0373943_0123758 3300035170 Bacteria 1377
415 Ga0373943_0729239 3300035170 Bacteria 588
416 Ga0373946_0002458 3300035171 Bacteria 6553
417 Ga0373955_0259162 3300035172 Bacteria 1044
418 Ga0373955_0471770 3300035172 Bacteria 766
419 Ga0373942_0012904 3300035207 Unclassified 2002
420 Ga0373942_0029097 3300035207 Bacteria 1448
421 Ga0373961_0043474 3300035241 Bacteria 1307
422 Ga0373961_0078683 3300035241 Bacteria 1033
423 Ga0373962_0009635 3300035242 Bacteria 2397
424 Ga0373924_0046113 3300035410 Bacteria 1795
425 Ga0373924_0326725 3300035410 Bacteria 682
426 Ga0373931_0006947 3300035691 Bacteria 5325
427 Ga0373931_0161360 3300035691 Archaea 1314
428 Ga0373931_0545981 3300035691 Bacteria 752
429 Ga0373927_0055210 3300035695 Bacteria 2569
430 Ga0373947_0036579 3300035725 Bacteria 2911
431 Ga0373947_0383810 3300035725 Bacteria 946
432 Ga0373937_0075216 3300036401 Bacteria 3117
433 Ga0373937_0178437 3300036401 Bacteria 1994
434 Ga0373925_0006100 3300037068 Bacteria 8913
435 Ga0373925_0916674 3300037068 Bacteria 722
436 Ga0395899_0056460 3300037312 Bacteria 2902
437 Ga0395900_0031866 3300037418 Bacteria 5419
438 Ga0395900_0096250 3300037418 Bacteria 3041
439 Ga0395900_0191997 3300037418 Unclassified 2071
440 Ga0395900_1400769 3300037418 Unclassified 612
441 Ga0395898_0018384 3300037466 Bacteria 7128
442 Ga0395898_0076680 3300037466 Unclassified 3227
443 Ga0395898_0098542 3300037466 Bacteria 2807
444 Ga0395898_0847201 3300037466 Bacteria 853
445 Ga0395898_1734233 3300037466 Unclassified 547
446 Ga0395905_0965536 3300037471 Unclassified 755
447 Ga0395901_0093576 3300038443 Bacteria 3147
448 Ga0395901_0388442 3300038443 Unclassified 1435
449 Ga0395901_0435612 3300038443 Bacteria 1342
450 Ga0395901_0786448 3300038443 Unclassified 942
451 Ga0395901_1184889 3300038443 Bacteria 730
452 Ga0395901_1480051 3300038443 Bacteria 635
453 Ga0395901_1709782 3300038443 Bacteria 580
454 Ga0242420_002859 3300038996 Bacteria 2503
455 Ga0436365_1018822 3300039437 Bacteria 588
456 Ga0436365_1845339 3300039437 Bacteria 5851
457 Ga0436363_1297307 3300039450 Bacteria 502
458 Ga0451789_0159463 3300041443 Bacteria 1504
459 Ga0451789_1117892 3300041443 Bacteria 903
460 Ga0451791_1441736 3300041451 Bacteria 775
461 Ga0451793_0781476 3300041452 Unclassified 1501
462 Ga0451797_0905678 3300041453 Bacteria 864
463 Ga0451795_0206216 3300041456 Bacteria 657
464 Ga0451800_0832588 3300041459 Unclassified 668
465 Ga0451802_1519977 3300041460 Unclassified 904
466 Ga0451807_1684640 3300041486 Bacteria 702
467 Ga0451807_2631029 3300041486 Bacteria 572
468 Ga0451833_0907646 3300041491 Bacteria 745
469 Ga0451835_0165989 3300041492 Bacteria 4794
470 Ga0451841_0441814 3300041498 Bacteria 693
471 Ga0451845_0518208 3300041501 Unclassified 618
472 Ga0451849_0440083 3300041505 Bacteria 1636
473 Ga0451851_0760096 3300041507 Bacteria 721
474 Ga0451843_1243594 3300041509 Bacteria 519
475 Ga0451855_0567418 3300041511 Bacteria 1063
476 Ga0451853_1729694 3300041512 Bacteria 559
477 Ga0451853_2873286 3300041512 Bacteria 761
478 Ga0451853_3003812 3300041512 Bacteria 2246
479 Ga0451577_0309935 3300042876 Bacteria 1431
480 Ga0466969_0405906 3300044656 Unclassified 619
481 Ga0466972_0020003 3300044658 Bacteria 3346
482 Ga0466965_0028894 3300044683 Bacteria 2696
483 Ga0466965_0242338 3300044683 Unclassified 965
484 Ga0466965_0350879 3300044683 Unclassified 808
485 Ga0466966_0374321 3300044684 Bacteria 856
486 Ga0466961_0003702 3300044693 Bacteria 9550
487 Ga0466961_0067970 3300044693 Bacteria 2263
488 Ga0466961_0262753 3300044693 Bacteria 1058
489 Ga0466961_0429827 3300044693 Unclassified 800
490 Ga0466963_0001756 3300044694 Bacteria 11812
491 Ga0466963_0002348 3300044694 Bacteria 10560
492 Ga0466963_0004180 3300044694 Bacteria 8359
493 Ga0466963_0007632 3300044694 Bacteria 6456
494 Ga0466963_0018701 3300044694 Bacteria 4336
495 Ga0466963_0026333 3300044694 Bacteria 3718
496 Ga0466963_0031702 3300044694 Bacteria 3418
497 Ga0466963_0069340 3300044694 Bacteria 2369
498 Ga0466963_0233007 3300044694 Bacteria 1290
499 Ga0466963_0271007 3300044694 Bacteria 1192
500 Ga0466963_0552366 3300044694 Unclassified 813
501 Ga0466963_1218601 3300044694 Bacteria 529
502 Ga0466964_0000525 3300044706 Bacteria 11988
503 Ga0466964_0000994 3300044706 Bacteria 9415
504 Ga0466964_0003775 3300044706 Bacteria 5556
505 Ga0466964_0007993 3300044706 Bacteria 3962
506 Ga0466964_0035399 3300044706 Bacteria 1996
507 Ga0466964_0062339 3300044706 Bacteria 1554
508 Ga0466964_0142702 3300044706 Bacteria 1102
509 Ga0466964_0151060 3300044706 Unclassified 1077
510 Ga0466964_0200068 3300044706 Unclassified 958
511 Ga0466964_0357933 3300044706 Unclassified 752
512 Ga0466964_0391649 3300044706 Unclassified 724
513 Ga0466964_0589041 3300044706 Bacteria 608
514 Ga0466964_0906258 3300044706 Bacteria 505
515 Ga0453684_1283265 3300044712 Unclassified 765
516 Ga0466971_0009819 3300044719 Bacteria 4178
517 Ga0466971_0010438 3300044719 Bacteria 4059
518 Ga0466971_0013818 3300044719 Bacteria 3550
519 Ga0466971_0044520 3300044719 Bacteria 1993
520 Ga0466971_0053962 3300044719 Bacteria 1811
521 Ga0466971_0289294 3300044719 Unclassified 785
522 Ga0466971_0339332 3300044719 Unclassified 726
523 Ga0466968_0005265 3300044735 Bacteria 4847
524 Ga0466968_0015234 3300044735 Bacteria 3045
525 Ga0466968_0018597 3300044735 Bacteria 2789
526 Ga0466968_0051499 3300044735 Bacteria 1759
527 Ga0466968_0084377 3300044735 Unclassified 1400
528 Ga0466968_0086357 3300044735 Bacteria 1385
529 Ga0466968_0121384 3300044735 Bacteria 1182
530 Ga0466968_0139114 3300044735 Unclassified 1109
531 Ga0466970_0005859 3300044765 Bacteria 6117
532 Ga0466970_0073473 3300044765 Bacteria 1840
533 Ga0466970_0362458 3300044765 Unclassified 823
534 Ga0466970_0721513 3300044765 Bacteria 582
535 Ga0466957_0004828 3300044842 Bacteria 7544
536 Ga0466957_0005555 3300044842 Bacteria 7084
537 Ga0466957_0006047 3300044842 Bacteria 6832
538 Ga0466957_0011889 3300044842 Bacteria 5030
539 Ga0466957_0018095 3300044842 Bacteria 4133
540 Ga0466957_0275044 3300044842 Bacteria 1125
541 Ga0466960_0004688 3300044901 Bacteria 5364
542 Ga0466960_0008077 3300044901 Bacteria 4299
543 Ga0466960_0033551 3300044901 Bacteria 2386
544 Ga0466960_0116432 3300044901 Bacteria 1395
545 Ga0466960_0272312 3300044901 Bacteria 946
546 Ga0466960_0446303 3300044901 Bacteria 751
547 Ga0466960_0454608 3300044901 Unclassified 745
548 Ga0466960_0538166 3300044901 Archaea 688
549 Ga0466959_0015897 3300045049 Bacteria 5491
550 Ga0466959_0050596 3300045049 Bacteria 3050
551 Ga0466959_0965040 3300045049 Bacteria 568
552 Ga0466959_1054889 3300045049 Bacteria 541
553 Ga0466959_1199626 3300045049 Bacteria 504
554 Ga0466958_0002929 3300045836 Bacteria 8722
555 Ga0466958_0005412 3300045836 Bacteria 6865
556 Ga0466958_0011296 3300045836 Bacteria 5027
557 Ga0466958_0028435 3300045836 Bacteria 3315
558 Ga0466958_0048129 3300045836 Bacteria 2575
559 Ga0466958_0056669 3300045836 Bacteria 2381
560 Ga0466958_0067979 3300045836 Unclassified 2177
561 Ga0466958_0110521 3300045836 Unclassified 1715
562 Ga0466958_0158993 3300045836 Bacteria 1427
563 Ga0466958_0459343 3300045836 Unclassified 825
564 Ga0466958_0555924 3300045836 Unclassified 746
565 Ga0466967_0000181 3300045976 Bacteria 26132
566 Ga0466967_0001859 3300045976 Bacteria 12719
567 Ga0466967_0002422 3300045976 Bacteria 11597
568 Ga0466967_0005491 3300045976 Bacteria 8794
569 Ga0466967_0014686 3300045976 Bacteria 6113
570 Ga0466967_0068114 3300045976 Bacteria 3177
571 Ga0466967_0074393 3300045976 Bacteria 3051
572 Ga0466967_0088637 3300045976 Bacteria 2808
573 Ga0466967_0100386 3300045976 Unclassified 2644
574 Ga0466967_0126866 3300045976 Bacteria 2364
575 Ga0466967_0139453 3300045976 Unclassified 2257
576 Ga0466967_0165741 3300045976 Bacteria 2076
577 Ga0466967_0196692 3300045976 Bacteria 1907
578 Ga0466967_0267007 3300045976 Bacteria 1638
579 Ga0466967_0485760 3300045976 Bacteria 1210
580 Ga0466967_0500806 3300045976 Bacteria 1192
581 Ga0466967_0798986 3300045976 Unclassified 937
582 Ga0466967_0850685 3300045976 Bacteria 906
583 Ga0466967_0881700 3300045976 Bacteria 889
584 Ga0466967_2023598 3300045976 Unclassified 572
585 Ga0495592_0142320 3300046454 Bacteria 1667
586 Ga0495592_0204372 3300046454 Bacteria 1331
587 Ga0495592_0253078 3300046454 Unclassified 1163
588 Ga0495592_0692054 3300046454 Unclassified 614
589 Ga0495592_0839267 3300046454 Bacteria 543
590 Ga0495590_0198758 3300046457 Unclassified 736
591 Ga0495629_0011930 3300046459 Bacteria 6301
592 Ga0495629_0026893 3300046459 Bacteria 4086
593 Ga0495629_0031988 3300046459 Bacteria 3725
594 Ga0495629_0111558 3300046459 Bacteria 1906
595 Ga0495629_0659676 3300046459 Bacteria 697
596 Ga0495641_0008161 3300046461 Bacteria 6429
597 Ga0495641_0059726 3300046461 Bacteria 1723
598 Ga0495641_0074057 3300046461 Bacteria 1527
599 Ga0495651_0005362 3300046462 Bacteria 9784
600 Ga0495651_0007784 3300046462 Bacteria 8197
601 Ga0495651_0558334 3300046462 Unclassified 726
602 Ga0495651_0648826 3300046462 Bacteria 662
603 Ga0495651_0901980 3300046462 Unclassified 540
604 Ga0495653_0001446 3300046463 Bacteria 18517
605 Ga0495653_0052854 3300046463 Bacteria 3112
606 Ga0495653_0054981 3300046463 Unclassified 3039
607 Ga0495653_0063153 3300046463 Bacteria 2796
608 Ga0495653_0144133 3300046463 Bacteria 1672
609 Ga0495580_0147855 3300046472 Bacteria 1628
610 Ga0495582_0009318 3300046473 Bacteria 5413
611 Ga0495582_0020875 3300046473 Bacteria 3587
612 Ga0495582_0050252 3300046473 Bacteria 2297
613 Ga0495582_0364114 3300046473 Bacteria 833
614 Ga0495582_0481022 3300046473 Bacteria 717
615 Ga0495605_0126527 3300046474 Unclassified 1155
616 Ga0495639_0002011 3300046475 Bacteria 9004
617 Ga0495662_0016039 3300046476 Bacteria 3634
618 Ga0495664_0004565 3300046477 Bacteria 7575
619 Ga0495664_0024751 3300046477 Bacteria 3490
620 Ga0495664_0107746 3300046477 Unclassified 1681
621 Ga0495664_0178884 3300046477 Bacteria 1286
622 Ga0495584_0050121 3300046491 Bacteria 2103
623 Ga0495584_0439128 3300046491 Bacteria 664
624 Ga0495585_0525145 3300046492 Bacteria 561
625 Ga0495594_0112040 3300046499 Bacteria 1539
626 Ga0495596_0110804 3300046500 Bacteria 1066
627 Ga0495596_0119946 3300046500 Unclassified 1021
628 Ga0495596_0146307 3300046500 Unclassified 918
629 Ga0495607_0046837 3300046501 Bacteria 2536
630 Ga0495583_0355368 3300046506 Unclassified 578
631 Ga0495608_0011699 3300046511 Bacteria 6104
632 Ga0495608_0014294 3300046511 Bacteria 5508
633 Ga0495608_0155900 3300046511 Bacteria 1453
634 Ga0495608_0800884 3300046511 Unclassified 556
635 Ga0495618_0110230 3300046514 Bacteria 1762
636 Ga0495618_0245073 3300046514 Bacteria 1125
637 Ga0495618_0372328 3300046514 Bacteria 877
638 Ga0495618_0642978 3300046514 Unclassified 628
639 Ga0495628_0001531 3300046516 Bacteria 21192
640 Ga0495628_0032089 3300046516 Bacteria 4243
641 Ga0495628_0071674 3300046516 Bacteria 2700
642 Ga0495628_0092481 3300046516 Bacteria 2339
643 Ga0495628_0944865 3300046516 Unclassified 596
644 Ga0495630_0015365 3300046517 Bacteria 5590
645 Ga0495630_0080472 3300046517 Bacteria 2457
646 Ga0495630_0309480 3300046517 Bacteria 1207
647 Ga0495630_1374556 3300046517 Unclassified 531
648 Ga0495631_0135491 3300046518 Bacteria 1058
649 Ga0495631_0437154 3300046518 Unclassified 557
650 Ga0495644_0098219 3300046523 Bacteria 1107
651 Ga0495644_0249709 3300046523 Unclassified 689
652 Ga0495663_0082304 3300046525 Bacteria 1038
653 Ga0495666_0003040 3300046526 Bacteria 8427
654 Ga0495642_0037906 3300046528 Bacteria 1952
655 Ga0495642_0333795 3300046528 Bacteria 666
656 Ga0495652_0003999 3300046529 Bacteria 14269
657 Ga0495652_0088795 3300046529 Bacteria 2532
658 Ga0495652_0090487 3300046529 Bacteria 2503
659 Ga0495652_0286228 3300046529 Unclassified 1204
660 Ga0495652_0433587 3300046529 Bacteria 923
661 Ga0495665_0030875 3300046531 Bacteria 2866
662 Ga0495665_0613114 3300046531 Unclassified 543
663 Ga0495640_0075987 3300046533 Bacteria 2242
664 Ga0495640_0083107 3300046533 Unclassified 2125
665 Ga0495640_0123539 3300046533 Bacteria 1680
666 Ga0495640_0768448 3300046533 Unclassified 575
667 Ga0495586_0038808 3300046535 Bacteria 2559
668 Ga0495586_0096027 3300046535 Unclassified 1641
669 Ga0495586_0127639 3300046535 Unclassified 1423
670 Ga0495587_0281180 3300046536 Unclassified 932
671 Ga0495587_0394234 3300046536 Bacteria 769
672 Ga0495587_0591590 3300046536 Unclassified 611
673 Ga0495598_0143526 3300046537 Unclassified 828
674 Ga0495645_0029925 3300046543 Bacteria 3966
675 Ga0495645_0034488 3300046543 Bacteria 3692
676 Ga0495645_0037053 3300046543 Bacteria 3554
677 Ga0495667_0012490 3300046559 Bacteria 5760
678 Ga0495667_0049992 3300046559 Bacteria 2760
679 Ga0495667_0073119 3300046559 Unclassified 2234
680 Ga0495667_0396105 3300046559 Unclassified 870
681 Ga0495656_0045428 3300046615 Unclassified 1854
682 Ga0495634_0006777 3300046642 Bacteria 8677
683 Ga0495634_0289678 3300046642 Unclassified 992
684 Ga0495635_0012714 3300046663 Bacteria 5902
685 Ga0495635_0224062 3300046663 Bacteria 1271
686 Ga0495659_0117797 3300046664 Bacteria 1043
687 Ga0495661_0451214 3300046665 Bacteria 619
688 Ga0495588_0648942 3300046674 Bacteria 552
689 Ga0495657_0015624 3300046675 Bacteria 5549
690 Ga0495657_0016463 3300046675 Bacteria 5387
691 Ga0495657_0845270 3300046675 Unclassified 522
692 Ga0495599_0013809 3300046678 Bacteria 4997
693 Ga0495599_0022201 3300046678 Unclassified 3961
694 Ga0495599_0026957 3300046678 Bacteria 3600
695 Ga0495599_0297753 3300046678 Bacteria 974
696 Ga0495599_0461926 3300046678 Unclassified 751
697 Ga0495623_0086453 3300046679 Unclassified 1932
698 Ga0495623_0162314 3300046679 Unclassified 1312
699 Ga0495623_0609564 3300046679 Unclassified 566
700 Ga0495646_0073315 3300046680 Unclassified 2011
701 Ga0495646_0125332 3300046680 Bacteria 1450
702 Ga0495646_0171106 3300046680 Bacteria 1197
703 Ga0495646_0558876 3300046680 Bacteria 584
704 Ga0495647_0005940 3300046681 Bacteria 4020
705 Ga0495647_0033876 3300046681 Unclassified 1911
706 Ga0495658_0121701 3300046683 Bacteria 1579
707 Ga0495658_0152066 3300046683 Unclassified 1422
708 Ga0495658_0189380 3300046683 Unclassified 1278
709 Ga0495613_0012474 3300046689 Bacteria 6315
710 Ga0495613_0016946 3300046689 Bacteria 5424
711 Ga0495613_0025648 3300046689 Bacteria 4392
712 Ga0495613_0087726 3300046689 Bacteria 2255
713 Ga0495613_0143535 3300046689 Unclassified 1705
714 Ga0495613_0942340 3300046689 Bacteria 557
715 Ga0495624_0043468 3300046690 Bacteria 2866
716 Ga0495624_0219882 3300046690 Unclassified 1152
717 Ga0495624_0377594 3300046690 Bacteria 852
718 Ga0495670_0476683 3300046691 Unclassified 677
719 Ga0495589_0130359 3300046794 Bacteria 1208
720 Ga0495589_0473804 3300046794 Unclassified 572
721 Ga0495600_0020996 3300046809 Bacteria 4179
722 Ga0495600_0065899 3300046809 Bacteria 2368
723 Ga0495600_0282583 3300046809 Bacteria 1050
724 Ga0495581_0011521 3300047315 Bacteria 5116
725 Ga0495581_0022746 3300047315 Bacteria 3630
726 Ga0495604_0000060 3300047317 Bacteria 95444
727 Ga0495604_0195253 3300047317 Bacteria 1408
728 Ga0495604_0277129 3300047317 Bacteria 1134
729 Ga0495636_0102621 3300047318 Bacteria 1252
730 Ga0495674_0009509 3300047319 Bacteria 9235
731 Ga0495674_0227034 3300047319 Bacteria 1542
732 Ga0495674_0270803 3300047319 Unclassified 1393
733 Ga0495674_0369414 3300047319 Unclassified 1162
734 Ga0495674_0507982 3300047319 Unclassified 963
735 Ga0495676_0027116 3300047321 Bacteria 4918
736 Ga0495676_0032895 3300047321 Bacteria 4372
737 Ga0495676_0279535 3300047321 Bacteria 1131
738 Ga0495676_0973631 3300047321 Bacteria 542
739 Ga0495676_1075450 3300047321 Unclassified 512
740 Ga0495680_0013289 3300047322 Bacteria 7190
741 Ga0495680_0018573 3300047322 Bacteria 5895
742 Ga0495680_0089265 3300047322 Bacteria 2314
743 Ga0495680_0100989 3300047322 Bacteria 2149
744 Ga0495680_0135198 3300047322 Unclassified 1808
745 Ga0495680_0187741 3300047322 Bacteria 1488
746 Ga0495680_0688347 3300047322 Bacteria 676
747 Ga0495675_0000223 3300047444 Bacteria 41211
748 Ga0495675_0205380 3300047444 Bacteria 1198
749 Ga0495677_0071145 3300047445 Unclassified 1296
750 Ga0495679_084482 3300047446 Unclassified 897
751 Ga0495684_0005780 3300047471 Bacteria 9623
752 Ga0495684_0115533 3300047471 Bacteria 2023
753 Ga0495684_0160899 3300047471 Bacteria 1674
754 Ga0495684_1022660 3300047471 Unclassified 523
755 Ga0495593_0006797 3300047673 Bacteria 6694
756 Ga0495593_0089320 3300047673 Unclassified 1588
757 Ga0495593_0484960 3300047673 Unclassified 619
758 Ga0495602_0020512 3300048088 Bacteria 6528
759 Ga0495602_0047074 3300048088 Bacteria 3889
760 Ga0495602_0291296 3300048088 Bacteria 1198
761 Ga0495614_0006112 3300048089 Bacteria 5414
762 Ga0496100_0002820 3300048903 Bacteria 8910
763 Ga0496100_0004456 3300048903 Bacteria 7429
764 Ga0496100_0078020 3300048903 Unclassified 2228
765 Ga0496100_0136307 3300048903 Bacteria 1734
766 Ga0496100_0161686 3300048903 Unclassified 1606
767 Ga0496100_0271454 3300048903 Bacteria 1261
768 Ga0496100_0514513 3300048903 Bacteria 923
769 Ga0496100_1601417 3300048903 Bacteria 515
770 Ga0496101_0015044 3300048904 Bacteria 5207
771 Ga0496101_0051136 3300048904 Bacteria 2976
772 Ga0496101_0096112 3300048904 Bacteria 2211
773 Ga0496101_0129026 3300048904 Unclassified 1918
774 Ga0496101_0139886 3300048904 Bacteria 1844
775 Ga0496101_0143618 3300048904 Bacteria 1821
776 Ga0496101_0227950 3300048904 Unclassified 1447
777 Ga0496101_0244432 3300048904 Bacteria 1397
778 Ga0496101_0293688 3300048904 Bacteria 1272
779 Ga0496101_0443800 3300048904 Bacteria 1024
780 Ga0496101_0623476 3300048904 Bacteria 852
781 Ga0496101_1085193 3300048904 Bacteria 629
782 Ga0496102_0008982 3300048905 Bacteria 8576
783 Ga0496102_0012097 3300048905 Bacteria 7457
784 Ga0496102_0024965 3300048905 Bacteria 5317
785 Ga0496102_0049877 3300048905 Bacteria 3809
786 Ga0496102_0194492 3300048905 Bacteria 1911
787 Ga0496102_0372425 3300048905 Bacteria 1344
788 Ga0496102_0615568 3300048905 Bacteria 1009
789 Ga0496102_0937136 3300048905 Bacteria 787
790 Ga0496102_1022933 3300048905 Bacteria 747
791 Ga0496102_1368350 3300048905 Unclassified 627
792 Ga0496102_1523581 3300048905 Unclassified 587
793 Ga0496103_0002119 3300048906 Bacteria 12620
794 Ga0496103_0013098 3300048906 Bacteria 4917
795 Ga0496103_0040840 3300048906 Bacteria 2851
796 Ga0496103_0050008 3300048906 Bacteria 2585
797 Ga0496103_0112747 3300048906 Bacteria 1728
798 Ga0496103_0559011 3300048906 Bacteria 730
799 Ga0496104_0021508 3300048907 Bacteria 5923
800 Ga0496104_0032912 3300048907 Bacteria 4826
801 Ga0496104_0038794 3300048907 Bacteria 4458
802 Ga0496104_0090158 3300048907 Bacteria 2929
803 Ga0496104_0100962 3300048907 Bacteria 2762
804 Ga0496104_0169631 3300048907 Bacteria 2092
805 Ga0496104_0236253 3300048907 Viruses 1739
806 Ga0496104_0318056 3300048907 Bacteria 1469
807 Ga0496104_1236069 3300048907 Bacteria 650
808 Ga0496104_1736124 3300048907 Unclassified 526
809 Ga0496105_0001516 3300048908 Bacteria 16418
810 Ga0496105_0008728 3300048908 Bacteria 7886
811 Ga0496105_0009662 3300048908 Bacteria 7552
812 Ga0496105_0015376 3300048908 Bacteria 6097
813 Ga0496105_0019200 3300048908 Bacteria 5512
814 Ga0496105_0032574 3300048908 Bacteria 4278
815 Ga0496105_0099935 3300048908 Unclassified 2396
816 Ga0496105_0216276 3300048908 Bacteria 1561
817 Ga0496105_0622194 3300048908 Bacteria 836
818 Ga0496105_1057259 3300048908 Unclassified 604
819 Ga0496106_0031861 3300048909 Bacteria 3928
820 Ga0496106_0041331 3300048909 Unclassified 3454
821 Ga0496106_0053844 3300048909 Bacteria 3039
822 Ga0496106_0055830 3300048909 Bacteria 2985
823 Ga0496106_0177195 3300048909 Bacteria 1691
824 Ga0496106_0267831 3300048909 Bacteria 1367
825 Ga0496106_0476345 3300048909 Bacteria 1003
826 Ga0496106_0547722 3300048909 Bacteria 928
827 Ga0496106_0622730 3300048909 Unclassified 863
828 Ga0496106_1109975 3300048909 Bacteria 619
829 Ga0496107_0002386 3300048910 Bacteria 12155
830 Ga0496107_0003768 3300048910 Bacteria 10180
831 Ga0496107_0016421 3300048910 Bacteria 5198
832 Ga0496107_0019539 3300048910 Bacteria 4779
833 Ga0496107_0045975 3300048910 Bacteria 3141
834 Ga0496107_0139903 3300048910 Unclassified 1789
835 Ga0496107_0176372 3300048910 Bacteria 1587
836 Ga0496107_0446732 3300048910 Bacteria 960
837 Ga0496107_0626141 3300048910 Bacteria 794
838 Ga0496107_0694458 3300048910 Bacteria 749
839 Ga0496107_0727387 3300048910 Bacteria 729
840 Ga0496108_0008962 3300048911 Bacteria 8109
841 Ga0496108_0014661 3300048911 Bacteria 6399
842 Ga0496108_0015917 3300048911 Bacteria 6130
843 Ga0496108_0034844 3300048911 Bacteria 4182
844 Ga0496108_0041551 3300048911 Bacteria 3839
845 Ga0496108_0052324 3300048911 Bacteria 3421
846 Ga0496108_0053838 3300048911 Unclassified 3376
847 Ga0496108_0083652 3300048911 Bacteria 2707
848 Ga0496108_0258229 3300048911 Bacteria 1516
849 Ga0496108_0448331 3300048911 Unclassified 1127
850 Ga0496108_0844095 3300048911 Unclassified 788
851 Ga0496108_0847616 3300048911 Bacteria 787
852 Ga0496108_1525656 3300048911 Bacteria 555
853 Ga0496108_1696474 3300048911 Bacteria 520
854 Ga0496109_0006089 3300048912 Bacteria 10134
855 Ga0496109_0010728 3300048912 Bacteria 7841
856 Ga0496109_0012997 3300048912 Bacteria 7198
857 Ga0496109_0020867 3300048912 Bacteria 5790
858 Ga0496109_0049713 3300048912 Bacteria 3818
859 Ga0496109_0069300 3300048912 Bacteria 3234
860 Ga0496109_0074935 3300048912 Bacteria 3111
861 Ga0496109_0086712 3300048912 Bacteria 2891
862 Ga0496109_0149958 3300048912 Bacteria 2183
863 Ga0496109_0251573 3300048912 Bacteria 1664
864 Ga0496109_0331274 3300048912 Bacteria 1437
865 Ga0496109_0706720 3300048912 Bacteria 945
866 Ga0496109_0877556 3300048912 Bacteria 835
867 Ga0496109_1886229 3300048912 Bacteria 530
868 Ga0496110_0007733 3300048913 Bacteria 8604
869 Ga0496110_0014389 3300048913 Bacteria 6569
870 Ga0496110_0021072 3300048913 Bacteria 5510
871 Ga0496110_0039161 3300048913 Bacteria 4127
872 Ga0496110_0067654 3300048913 Bacteria 3161
873 Ga0496110_0169580 3300048913 Bacteria 1980
874 Ga0496110_0177401 3300048913 Unclassified 1934
875 Ga0496110_0285397 3300048913 Bacteria 1503
876 Ga0496110_0464233 3300048913 Unclassified 1154
877 Ga0496110_0513246 3300048913 Bacteria 1091
878 Ga0496110_0830491 3300048913 Unclassified 829
879 Ga0496110_1082597 3300048913 Unclassified 709
880 Ga0496110_1328559 3300048913 Unclassified 628
881 Ga0496111_0010559 3300048914 Bacteria 6202
882 Ga0496111_0069679 3300048914 Bacteria 2557
883 Ga0496111_0086020 3300048914 Bacteria 2300
884 Ga0496111_0095115 3300048914 Bacteria 2186
885 Ga0496111_0223026 3300048914 Archaea 1400
886 Ga0496111_0300901 3300048914 Bacteria 1189
887 Ga0496111_0388770 3300048914 Unclassified 1031
888 Ga0496111_0390857 3300048914 Bacteria 1028
889 Ga0496111_0620218 3300048914 Unclassified 791
890 Ga0496111_0753400 3300048914 Bacteria 706
891 Ga0496111_1255444 3300048914 Bacteria 523
892 Ga0496112_0007227 3300048915 Bacteria 9842
893 Ga0496112_0031071 3300048915 Bacteria 5175
894 Ga0496112_0034432 3300048915 Bacteria 4929
895 Ga0496112_0037934 3300048915 Bacteria 4705
896 Ga0496112_0041755 3300048915 Bacteria 4488
897 Ga0496112_0136716 3300048915 Bacteria 2421
898 Ga0496112_0161655 3300048915 Bacteria 2206
899 Ga0496112_0181535 3300048915 Bacteria 2068
900 Ga0496112_0186188 3300048915 Bacteria 2039
901 Ga0496112_0203401 3300048915 Bacteria 1939
902 Ga0496112_0228266 3300048915 Bacteria 1817
903 Ga0496112_0262322 3300048915 Bacteria 1677
904 Ga0496112_0286451 3300048915 Bacteria 1594
905 Ga0496112_0426039 3300048915 Bacteria 1265
906 Ga0496112_0860740 3300048915 Unclassified 829
907 Ga0496112_0907012 3300048915 Bacteria 803
908 Ga0496112_0981746 3300048915 Bacteria 765
909 Ga0496113_0008647 3300048916 Bacteria 6641
910 Ga0496113_0049667 3300048916 Bacteria 3125
911 Ga0496113_0061202 3300048916 Bacteria 2840
912 Ga0496113_0105795 3300048916 Archaea 2185
913 Ga0496113_0130371 3300048916 Bacteria 1972
914 Ga0496113_0235086 3300048916 Bacteria 1462
915 Ga0496113_0265690 3300048916 Bacteria 1371
916 Ga0496113_0270368 3300048916 Bacteria 1358
917 Ga0496113_0527660 3300048916 Bacteria 948
918 Ga0496113_0600330 3300048916 Bacteria 881
919 Ga0496113_0659924 3300048916 Unclassified 836
920 Ga0496113_0683621 3300048916 Archaea 820
921 Ga0496113_1111755 3300048916 Bacteria 619
922 Ga0496113_1345939 3300048916 Bacteria 554
923 Ga0496114_0008381 3300048917 Bacteria 8188
924 Ga0496114_0011405 3300048917 Bacteria 7102
925 Ga0496114_0043182 3300048917 Bacteria 3738
926 Ga0496114_0047606 3300048917 Bacteria 3566
927 Ga0496114_0083674 3300048917 Bacteria 2700
928 Ga0496114_0306086 3300048917 Bacteria 1403
929 Ga0496114_0956302 3300048917 Bacteria 739
930 Ga0496114_1527086 3300048917 Bacteria 556
931 Ga0496114_1555035 3300048917 Bacteria 549
932 Ga0496115_0003191 3300048918 Bacteria 11773
933 Ga0496115_0007836 3300048918 Bacteria 7874
934 Ga0496115_0040293 3300048918 Bacteria 3713
935 Ga0496115_0073791 3300048918 Bacteria 2770
936 Ga0496115_0092557 3300048918 Bacteria 2471
937 Ga0496115_0103772 3300048918 Bacteria 2333
938 Ga0496115_0165741 3300048918 Bacteria 1827
939 Ga0496115_0351269 3300048918 Bacteria 1202
940 Ga0496115_0892101 3300048918 Bacteria 686
941 Ga0501031_0000270 3300049568 Bacteria 29387
942 Ga0501032_0001838 3300049569 Bacteria 16786
943 Ga0501033_0206071 3300049570 Unclassified 1403
944 Ga0501036_0015962 3300049572 Bacteria 6272
945 Ga0501037_0043551 3300049573 Bacteria 3298
946 Ga0501038_0003487 3300049574 Bacteria 14654
947 Ga0501040_0028875 3300049576 Bacteria 3740
948 Ga0501041_0004847 3300049577 Bacteria 7822
949 Ga0501042_0003753 3300049578 Bacteria 9597
950 Ga0501043_0012759 3300049579 Bacteria 6568
951 Ga0501046_0008121 3300049580 Bacteria 9168
952 Ga0501048_0650924 3300049582 Bacteria 756
953 Ga0501067_0001546 3300049583 Bacteria 12552
954 Ga0501067_0007583 3300049583 Bacteria 6031
955 Ga0501067_0013188 3300049583 Bacteria 4576
956 Ga0501067_0088494 3300049583 Bacteria 1719
957 Ga0501067_0355374 3300049583 Bacteria 817
958 Ga0501068_0081802 3300049584 Bacteria 1983
959 Ga0501068_0271601 3300049584 Bacteria 1082
960 Ga0501069_0004650 3300049585 Bacteria 7093
961 Ga0501069_0012853 3300049585 Bacteria 4457
962 Ga0501069_0024080 3300049585 Bacteria 3321
963 Ga0501069_0492869 3300049585 Bacteria 731
964 Ga0501069_0562839 3300049585 Unclassified 683
965 Ga0501070_0001395 3300049586 Bacteria 21609
966 Ga0501070_0297128 3300049586 Bacteria 1316
967 Ga0501071_0273011 3300049587 Bacteria 1278
968 Ga0501072_0601869 3300049588 Unclassified 866
969 Ga0501073_0019252 3300049589 Bacteria 4931
970 Ga0501074_0075052 3300049590 Bacteria 2427
971 Ga0501075_0010586 3300049591 Bacteria 6486
972 Ga0501076_0880144 3300049592 Bacteria 738
973 Ga0501077_0023939 3300049593 Bacteria 3873
974 Ga0501079_0032967 3300049741 Bacteria 3983
975 Ga0501080_0003360 3300049742 Bacteria 14128
976 Ga0501081_0186261 3300049743 Bacteria 1502
977 Ga0501081_0406251 3300049743 Unclassified 1008
978 Ga0501083_0022271 3300049744 Bacteria 4396
979 Ga0501035_0132999 3300049822 Bacteria 2167
980 Ga0501044_0057674 3300049823 Bacteria 3985
981 Ga0501045_0041931 3300049824 Bacteria 3330
982 nmdc:mga05p37_530737_c1 3300050507 Bacteria 1344
983 nmdc:mga05p37_60368_c1 3300050507 Bacteria 4669
984 nmdc:mga08y16_286263_c1 3300050511 Unclassified 1699
985 nmdc:mga0n895_1252961_c1 3300050512 Bacteria 714
986 nmdc:mga0n895_161716_c1 3300050512 Unclassified 2271
987 nmdc:mga0n895_34358_c1 3300050512 Bacteria 4879
988 nmdc:mga0rr50_110760_c1 3300050513 Unclassified 2172
989 nmdc:mga0rr50_174756_c1 3300050513 Bacteria 1752
990 nmdc:mga0rr50_67976_c1 3300050513 Bacteria 2709
991 nmdc:mga08x19_31482_c1 3300050514 Bacteria 3337
992 nmdc:mga08x19_45618_c1 3300050514 Bacteria 2801
993 nmdc:mga08x19_69708_c1 3300050514 Unclassified 2290
994 nmdc:mga0a205_141402_c1 3300050515 Bacteria 2307
995 nmdc:mga0a205_1527627_c1 3300050515 Bacteria 516
996 nmdc:mga0a205_399185_c1 3300050515 Bacteria 1239
997 nmdc:mga0a205_79097_c1 3300050515 Unclassified 3177
998 Ga0495601_0000328 3300053077 Bacteria 25250
999 Ga0495601_0023115 3300053077 Bacteria 3818
1000 Ga0495601_0029973 3300053077 Bacteria 3377
1001 Ga0495601_0063649 3300053077 Unclassified 2344
1002 Ga0495601_0117223 3300053077 Bacteria 1727
1003 Ga0495601_0683715 3300053077 Unclassified 655
1004 Ga0495612_0001001 3300053078 Bacteria 11620
1005 Ga0495612_0044108 3300053078 Bacteria 1824
1006 Ga0495612_0176808 3300053078 Bacteria 936
1007 Ga0495612_0265210 3300053078 Unclassified 766
1008 Ga0495595_0000605 3300053084 Bacteria 13662
1009 Ga0495595_0002546 3300053084 Bacteria 7154
1010 Ga0495595_0030743 3300053084 Bacteria 2410
1011 Ga0495595_0322786 3300053084 Unclassified 777
1012 Ga0495595_0450859 3300053084 Bacteria 654
1013 Ga0495619_0010795 3300053085 Bacteria 5747
1014 Ga0495619_0043958 3300053085 Unclassified 2930
1015 Ga0495619_0136676 3300053085 Unclassified 1686
1016 Ga0495619_0466820 3300053085 Unclassified 869
1017 Ga0495619_0899512 3300053085 Bacteria 595
1018 Ga0495619_1001298 3300053085 Unclassified 559
1019 Ga0500566_0021035 3300053094 Bacteria 3837
1020 Ga0501084_0522327 3300054114 Bacteria 1003
1021 Ga0501082_0044936 3300060353 Bacteria 3810
1022 Ga0501082_0125957 3300060353 Bacteria 2221
1023 Ga0466962_0021516 3300061719 Bacteria 3097
1024 Ga0466962_0023024 3300061719 Bacteria 2995
1025 Ga0466962_0048012 3300061719 Bacteria 2040
1026 Ga0466962_0051814 3300061719 Bacteria 1962
1027 Ga0466962_0071584 3300061719 Unclassified 1656
1028 Ga0466962_0355085 3300061719 Unclassified 730
1029 Ga0530510_0003335 3300061734 Bacteria 11042
1030 Ga0530510_0014416 3300061734 Bacteria 5573
1031 Ga0530510_0016879 3300061734 Bacteria 5171
1032 Ga0070714_100044987
1033 JGI25406J46586_10074476
1034 Ga0070683_100008714
1035 Ga0068869_100302511
1036 Ga0070680_100087689
1037 Ga0070680_100739598
1038 Ga0070682_100269657
1039 Ga0070682_100374438
1040 Ga0068868_100315759
1041 Ga0068868_101040909
1042 Ga0070660_100570096
1043 Ga0070691_10529732
1044 Ga0070661_100389653
1045 Ga0070671_100329543
1046 Ga0070671_101859887
1047 Ga0070673_100267654
1048 Ga0070703_10015069
1049 Ga0070709_10009572
1050 Ga0070709_10113405
1051 Ga0070709_10128603
1052 Ga0070714_100012637
1053 Ga0070714_100014579
1054 Ga0070714_100018152
1055 Ga0070714_100022459
1056 Ga0070714_100199748
1057 Ga0070714_100568086
1058 Ga0070714_100900862
1059 Ga0070714_100994636
1060 Ga0070714_101854181
1061 Ga0070713_100029732
1062 Ga0070713_100032857
1063 Ga0070713_100338972
1064 Ga0070710_10004975
1065 Ga0070710_10087364
1066 Ga0070710_10439895
1067 Ga0070710_11244902
1068 Ga0070701_10840617
1069 Ga0070711_100016112
1070 Ga0070711_100032237
1071 Ga0070711_100059898
1072 Ga0070711_100220361
1073 Ga0070711_100340197
1074 Ga0070711_100705779
1075 Ga0070711_100835486
1076 Ga0070705_100083751
1077 Ga0070705_100835393
1078 Ga0070694_100048418
1079 Ga0070708_100032971
1080 Ga0070708_100042208
1081 Ga0070678_100166577
1082 Ga0070678_100219891
1083 Ga0070678_100293951
1084 Ga0070681_10017759
1085 Ga0070681_10189495
1086 Ga0070681_10210796
1087 Ga0070681_10806861
1088 Ga0070681_11382352
1089 Ga0070706_100200886
1090 Ga0070707_100003292
1091 Ga0070707_100030999
1092 Ga0070707_100067645
1093 Ga0070707_100130514
1094 Ga0070707_100751057
1095 Ga0070707_100807610
1096 Ga0070698_100070724
1097 Ga0070698_100092362
1098 Ga0070698_100383148
1099 Ga0070698_101927075
1100 Ga0070699_100034221
1101 Ga0070699_100852578
1102 Ga0070679_100013498
1103 Ga0070679_100029310
1104 Ga0070679_100075691
1105 Ga0070679_100192736
1106 Ga0070679_100487634
1107 Ga0070679_100618679
1108 Ga0070684_100025832
1109 Ga0070684_100113292
1110 Ga0070684_101428742
1111 Ga0070697_100121161
1112 Ga0070697_100530871
1113 Ga0070697_100637429
1114 Ga0070697_101047273
1115 Ga0068853_100839209
1116 Ga0068853_101304260
1117 Ga0070695_100029800
1118 Ga0070695_100100925
1119 Ga0070695_101600147
1120 Ga0070696_100072644
1121 Ga0070696_100103323
1122 Ga0070696_100445056
1123 Ga0070696_102002931
1124 Ga0070693_100125958
1125 Ga0070693_100286921
1126 Ga0070665_101297338
1127 Ga0070704_100016869
1128 Ga0070704_100028271
1129 Ga0070704_100813373
1130 Ga0068855_100135143
1131 Ga0068855_100903574
1132 Ga0070664_101089030
1133 Ga0068857_100650787
1134 Ga0068856_100004254
1135 Ga0068856_100050235
1136 Ga0068856_100607405
1137 Ga0068856_100760348
1138 Ga0068856_101043901
1139 Ga0070702_100043322
1140 Ga0070702_100053062
1141 Ga0070702_100121565
1142 Ga0068852_100518844
1143 Ga0068864_102421851
1144 Ga0068851_11106993
1145 Ga0068863_100392542
1146 Ga0068863_100767560
1147 Ga0068863_101217984
1148 Ga0068862_102119068
1149 Ga0081539_10039813
1150 Ga0070717_10027339
1151 Ga0070717_10027807
1152 Ga0070717_10120582
1153 Ga0070717_10678454
1154 Ga0070717_11426899
1155 Ga0070717_11504980
1156 Ga0070717_11598868
1157 Ga0070715_10002018
1158 Ga0070715_10027774
1159 Ga0070715_10088512
1160 Ga0070715_10101030
1161 Ga0070715_10121710
1162 Ga0070716_100003623
1163 Ga0070716_100034746
1164 Ga0070716_100211802
1165 Ga0070716_100568865
1166 Ga0070716_100692776
1167 Ga0070712_100015533
1168 Ga0070712_100054694
1169 Ga0070712_100106139
1170 Ga0070712_100119231
1171 Ga0070712_100149113
1172 Ga0070712_100343895
1173 Ga0070712_100499910
1174 Ga0070712_101294266
1175 Ga0097621_100161681
1176 Ga0097621_100379597
1177 Ga0097621_102046341
1178 Ga0075434_100043444
1179 Ga0075434_100133108
1180 Ga0075436_100189029
1181 Ga0075435_100715229
1182 Ga0099795_10235061
1183 Ga0105250_10411921
1184 Ga0105240_10015125
1185 Ga0105240_10134586
1186 Ga0105240_10167588
1187 Ga0111539_10195218
1188 Ga0105245_10016693
1189 Ga0105245_10183849
1190 Ga0105245_10227907
1191 Ga0105245_10431703
1192 Ga0105245_10547207
1193 Ga0105245_10824105
1194 Ga0105245_11164001
1195 Ga0105245_11912974
1196 Ga0105245_12888960
1197 Ga0105247_10058823
1198 Ga0114129_10087988
1199 Ga0114129_10604341
1200 Ga0114129_11790497
1201 Ga0105243_10374295
1202 Ga0105241_10255032
1203 Ga0105241_10772695
1204 Ga0105241_12100560
1205 Ga0105241_12517157
1206 Ga0105242_10241211
1207 Ga0105242_11098723
1208 Ga0105242_11283619
1209 Ga0105242_11324382
1210 Ga0105242_11614090
1211 Ga0105242_13218470
1212 Ga0105248_10096239
1213 Ga0105248_10504275
1214 Ga0105248_12630977
1215 Ga0105237_10012550
1216 Ga0105237_10028267
1217 Ga0105237_11199409
1218 Ga0105238_10349967
1219 Ga0105238_10369292
1220 Ga0105249_10037672
1221 Ga0099796_10350624
1222 Ga0105239_10239298
1223 Ga0105239_10403265
1224 Ga0105239_11196110
1225 Ga0105239_12392623
1226 Ga0105239_12505340
1227 Ga0105246_10035088
1228 Ga0157373_10317508
1229 Ga0157373_10326846
1230 Ga0157371_11004614
1231 Ga0157370_10041660
1232 Ga0157370_10335150
1233 Ga0157370_10420249
1234 Ga0157370_10960531
1235 Ga0157370_11754878
1236 Ga0157369_10057047
1237 Ga0157369_10223656
1238 Ga0157369_10250603
1239 Ga0157369_10725789
1240 Ga0157369_11329175
1241 Ga0157374_10219442
1242 Ga0157374_10251991
1243 Ga0157374_10589009
1244 Ga0157374_11023029
1245 Ga0157374_11408182
1246 Ga0157374_12867765
1247 Ga0157378_10154640
1248 Ga0157378_10713374
1249 Ga0163162_10340282
1250 Ga0157372_10027075
1251 Ga0157372_10209493
1252 Ga0157372_10271712
1253 Ga0157372_10851579
1254 Ga0157372_11159453
1255 Ga0157372_12855581
1256 Ga0157375_10160165
1257 Ga0157375_11635309
1258 Ga0157375_11801722
1259 Ga0157375_11988140
1260 Ga0163163_10585244
1261 Ga0163163_11798295
1262 Ga0182008_10049929
1263 Ga0157377_10563426
1264 Ga0157376_10014957
1265 Ga0157376_10651172
1266 Ga0157376_11682950
1267 Ga0157376_11879242
1268 Ga0197907_10854251
1269 Ga0206356_10209225
1270 Ga0206356_10929994
1271 Ga0206356_10977224
1272 Ga0206350_11514786
1273 Ga0206354_10859821
1274 Ga0206354_11318015
1275 Ga0206354_11338473
1276 Ga0206353_10588232
1277 Ga0206353_10632433
1278 Ga0206353_11523787
1279 Ga0224712_10203731
1280 Ga0224712_10593113
1281 Ga0207692_10007655
1282 Ga0207692_10035063
1283 Ga0207692_10072795
1284 Ga0207692_10276641
1285 Ga0207692_10378547
1286 Ga0207710_10057191
1287 Ga0207680_10159651
1288 Ga0207685_10026097
1289 Ga0207685_10097114
1290 Ga0207699_10006811
1291 Ga0207699_10021993
1292 Ga0207699_10024515
1293 Ga0207699_10407059
1294 Ga0207684_10106127
1295 Ga0207684_10287828
1296 Ga0207654_10373898
1297 Ga0207654_10471296
1298 Ga0207707_10013971
1299 Ga0207707_10073428
1300 Ga0207707_10086553
1301 Ga0207707_10452391
1302 Ga0207707_10604065
1303 Ga0207707_11510962
1304 Ga0207695_10201378
1305 Ga0207693_10002044
1306 Ga0207693_10002632
1307 Ga0207693_10002681
1308 Ga0207693_10009259
1309 Ga0207693_10019134
1310 Ga0207693_10035288
1311 Ga0207693_10081175
1312 Ga0207693_10330786
1313 Ga0207693_10397242
1314 Ga0207693_11083133
1315 Ga0207663_10000508
1316 Ga0207663_10032689
1317 Ga0207663_10077201
1318 Ga0207663_10087540
1319 Ga0207663_10099076
1320 Ga0207663_10101709
1321 Ga0207663_10234312
1322 Ga0207663_10695420
1323 Ga0207663_11210377
1324 Ga0207660_10275697
1325 Ga0207660_10286421
1326 Ga0207660_10348157
1327 Ga0207660_10360316
1328 Ga0207660_10937524
1329 Ga0207657_10254595
1330 Ga0207657_10795837
1331 Ga0207649_10123357
1332 Ga0207649_10479108
1333 Ga0207649_10631031
1334 Ga0207652_10012591
1335 Ga0207652_10022150
1336 Ga0207652_10027860
1337 Ga0207652_10908793
1338 Ga0207652_10967957
1339 Ga0207646_10000553
1340 Ga0207646_10025249
1341 Ga0207646_10602795
1342 Ga0207646_10714825
1343 Ga0207646_11719579
1344 Ga0207694_10479132
1345 Ga0207694_11857698
1346 Ga0207687_10331837
1347 Ga0207687_10611929
1348 Ga0207687_10629001
1349 Ga0207687_10867196
1350 Ga0207687_11567026
1351 Ga0207700_10007688
1352 Ga0207700_10012145
1353 Ga0207700_10080039
1354 Ga0207700_10155834
1355 Ga0207700_12035398
1356 Ga0207664_10050845
1357 Ga0207664_10066343
1358 Ga0207664_10071530
1359 Ga0207664_10079356
1360 Ga0207664_10085788
1361 Ga0207664_10117133
1362 Ga0207664_10158548
1363 Ga0207664_10380090
1364 Ga0207664_10388494
1365 Ga0207664_10472223
1366 Ga0207664_11241983
1367 Ga0207644_10384722
1368 Ga0207644_10550342
1369 Ga0207686_10491426
1370 Ga0207686_10590606
1371 Ga0207686_10984347
1372 Ga0207686_11076609
1373 Ga0207704_10232998
1374 Ga0207665_10000420
1375 Ga0207665_10000735
1376 Ga0207665_10012183
1377 Ga0207665_10270846
1378 Ga0207665_10735566
1379 Ga0207665_10742006
1380 Ga0207711_10231139
1381 Ga0207661_10025486
1382 Ga0207661_10248377
1383 Ga0207661_10526160
1384 Ga0207661_10901905
1385 Ga0207679_10112354
1386 Ga0207679_11088668
1387 Ga0207667_11283431
1388 Ga0207667_11350335
1389 Ga0207651_10427296
1390 Ga0207640_11308005
1391 Ga0207677_10243304
1392 Ga0207677_11040201
1393 Ga0207678_10080546
1394 Ga0207702_10002127
1395 Ga0207702_10306948
1396 Ga0207702_10817124
1397 Ga0207641_10200581
1398 Ga0207676_10488775
1399 Ga0207675_101070799
1400 Ga0207683_10010038
1401 Ga0207683_10180593
1402 Ga0207683_10288615
1403 Ga0207683_10431800
1404 Ga0207683_11345374
1405 Ga0207698_10141674
1406 Ga0265319_1027334
1407 Ga0265318_10001995
1408 Ga0265320_10013534
1409 Ga0307415_101649232
1410 Ga0307415_101750526
1411 Ga0373930_0021512
1412 Ga0373948_0025382
1413 Ga0373958_0031139
1414 Ga0373958_0063671
1415 Ga0373959_0003704
1416 Ga0373938_0051971
1417 Ga0373938_0099726
1418 Ga0373928_0036020
1419 Ga0373929_0017279
1420 Ga0373929_0053251
1421 Ga0373929_0104294
1422 Ga0373934_0214641
1423 Ga0373940_0004754
1424 Ga0373940_0103942
1425 Ga0373940_0173710
1426 Ga0373949_0004330
1427 Ga0373951_0024277
1428 Ga0373951_0039012
1429 Ga0373951_0177453
1430 Ga0373952_0008815
1431 Ga0373952_0041755
1432 Ga0373932_0404758
1433 Ga0373936_0036090
1434 Ga0373939_0116077
1435 Ga0373939_0177434
1436 Ga0373941_0095468
1437 Ga0373941_0311637
1438 Ga0373941_0330330
1439 Ga0373945_0055367
1440 Ga0373954_0617612
1441 Ga0373956_0033447
1442 Ga0373956_0090986
1443 Ga0373960_0072793
1444 Ga0373943_0005843
1445 Ga0373943_0123758
1446 Ga0373943_0729239
1447 Ga0373946_0002458
1448 Ga0373955_0259162
1449 Ga0373955_0471770
1450 Ga0373942_0012904
1451 Ga0373942_0029097
1452 Ga0373961_0043474
1453 Ga0373961_0078683
1454 Ga0373962_0009635
1455 Ga0373924_0046113
1456 Ga0373924_0326725
1457 Ga0373931_0006947
1458 Ga0373931_0161360
1459 Ga0373931_0545981
1460 Ga0373927_0055210
1461 Ga0373947_0036579
1462 Ga0373947_0383810
1463 Ga0373937_0075216
1464 Ga0373937_0178437
1465 Ga0373925_0006100
1466 Ga0373925_0916674
1467 Ga0395899_0056460
1468 Ga0395900_0031866
1469 Ga0395900_0096250
1470 Ga0395900_0191997
1471 Ga0395900_1400769
1472 Ga0395898_0018384
1473 Ga0395898_0076680
1474 Ga0395898_0098542
1475 Ga0395898_0847201
1476 Ga0395898_1734233
1477 Ga0395905_0965536
1478 Ga0395901_0093576
1479 Ga0395901_0388442
1480 Ga0395901_0435612
1481 Ga0395901_0786448
1482 Ga0395901_1184889
1483 Ga0395901_1480051
1484 Ga0395901_1709782
1485 Ga0242420_002859
1486 Ga0436365_1018822
1487 Ga0436365_1845339
1488 Ga0436363_1297307
1489 Ga0451789_0159463
1490 Ga0451789_1117892
1491 Ga0451791_1441736
1492 Ga0451793_0781476
1493 Ga0451797_0905678
1494 Ga0451795_0206216
1495 Ga0451800_0832588
1496 Ga0451802_1519977
1497 Ga0451807_1684640
1498 Ga0451807_2631029
1499 Ga0451833_0907646
1500 Ga0451835_0165989
1501 Ga0451841_0441814
1502 Ga0451845_0518208
1503 Ga0451849_0440083
1504 Ga0451851_0760096
1505 Ga0451843_1243594
1506 Ga0451855_0567418
1507 Ga0451853_1729694
1508 Ga0451853_2873286
1509 Ga0451853_3003812
1510 Ga0451577_0309935
1511 Ga0466969_0405906
1512 Ga0466972_0020003
1513 Ga0466965_0028894
1514 Ga0466965_0242338
1515 Ga0466965_0350879
1516 Ga0466966_0374321
1517 Ga0466961_0003702
1518 Ga0466961_0067970
1519 Ga0466961_0262753
1520 Ga0466961_0429827
1521 Ga0466963_0001756
1522 Ga0466963_0002348
1523 Ga0466963_0004180
1524 Ga0466963_0007632
1525 Ga0466963_0018701
1526 Ga0466963_0026333
1527 Ga0466963_0031702
1528 Ga0466963_0069340
1529 Ga0466963_0233007
1530 Ga0466963_0271007
1531 Ga0466963_0552366
1532 Ga0466963_1218601
1533 Ga0466964_0000525
1534 Ga0466964_0000994
1535 Ga0466964_0003775
1536 Ga0466964_0007993
1537 Ga0466964_0035399
1538 Ga0466964_0062339
1539 Ga0466964_0142702
1540 Ga0466964_0151060
1541 Ga0466964_0200068
1542 Ga0466964_0357933
1543 Ga0466964_0391649
1544 Ga0466964_0589041
1545 Ga0466964_0906258
1546 Ga0453684_1283265
1547 Ga0466971_0009819
1548 Ga0466971_0010438
1549 Ga0466971_0013818
1550 Ga0466971_0044520
1551 Ga0466971_0053962
1552 Ga0466971_0289294
1553 Ga0466971_0339332
1554 Ga0466968_0005265
1555 Ga0466968_0015234
1556 Ga0466968_0018597
1557 Ga0466968_0051499
1558 Ga0466968_0084377
1559 Ga0466968_0086357
1560 Ga0466968_0121384
1561 Ga0466968_0139114
1562 Ga0466970_0005859
1563 Ga0466970_0073473
1564 Ga0466970_0362458
1565 Ga0466970_0721513
1566 Ga0466957_0004828
1567 Ga0466957_0005555
1568 Ga0466957_0006047
1569 Ga0466957_0011889
1570 Ga0466957_0018095
1571 Ga0466957_0275044
1572 Ga0466960_0004688
1573 Ga0466960_0008077
1574 Ga0466960_0033551
1575 Ga0466960_0116432
1576 Ga0466960_0272312
1577 Ga0466960_0446303
1578 Ga0466960_0454608
1579 Ga0466960_0538166
1580 Ga0466959_0015897
1581 Ga0466959_0050596
1582 Ga0466959_0965040
1583 Ga0466959_1054889
1584 Ga0466959_1199626
1585 Ga0466958_0002929
1586 Ga0466958_0005412
1587 Ga0466958_0011296
1588 Ga0466958_0028435
1589 Ga0466958_0048129
1590 Ga0466958_0056669
1591 Ga0466958_0067979
1592 Ga0466958_0110521
1593 Ga0466958_0158993
1594 Ga0466958_0459343
1595 Ga0466958_0555924
1596 Ga0466967_0000181
1597 Ga0466967_0001859
1598 Ga0466967_0002422
1599 Ga0466967_0005491
1600 Ga0466967_0014686
1601 Ga0466967_0068114
1602 Ga0466967_0074393
1603 Ga0466967_0088637
1604 Ga0466967_0100386
1605 Ga0466967_0126866
1606 Ga0466967_0139453
1607 Ga0466967_0165741
1608 Ga0466967_0196692
1609 Ga0466967_0267007
1610 Ga0466967_0485760
1611 Ga0466967_0500806
1612 Ga0466967_0798986
1613 Ga0466967_0850685
1614 Ga0466967_0881700
1615 Ga0466967_2023598
1616 Ga0495592_0142320
1617 Ga0495592_0204372
1618 Ga0495592_0253078
1619 Ga0495592_0692054
1620 Ga0495592_0839267
1621 Ga0495590_0198758
1622 Ga0495629_0011930
1623 Ga0495629_0026893
1624 Ga0495629_0031988
1625 Ga0495629_0111558
1626 Ga0495629_0659676
1627 Ga0495641_0008161
1628 Ga0495641_0059726
1629 Ga0495641_0074057
1630 Ga0495651_0005362
1631 Ga0495651_0007784
1632 Ga0495651_0558334
1633 Ga0495651_0648826
1634 Ga0495651_0901980
1635 Ga0495653_0001446
1636 Ga0495653_0052854
1637 Ga0495653_0054981
1638 Ga0495653_0063153
1639 Ga0495653_0144133
1640 Ga0495580_0147855
1641 Ga0495582_0009318
1642 Ga0495582_0020875
1643 Ga0495582_0050252
1644 Ga0495582_0364114
1645 Ga0495582_0481022
1646 Ga0495605_0126527
1647 Ga0495639_0002011
1648 Ga0495662_0016039
1649 Ga0495664_0004565
1650 Ga0495664_0024751
1651 Ga0495664_0107746
1652 Ga0495664_0178884
1653 Ga0495584_0050121
1654 Ga0495584_0439128
1655 Ga0495585_0525145
1656 Ga0495594_0112040
1657 Ga0495596_0110804
1658 Ga0495596_0119946
1659 Ga0495596_0146307
1660 Ga0495607_0046837
1661 Ga0495583_0355368
1662 Ga0495608_0011699
1663 Ga0495608_0014294
1664 Ga0495608_0155900
1665 Ga0495608_0800884
1666 Ga0495618_0110230
1667 Ga0495618_0245073
1668 Ga0495618_0372328
1669 Ga0495618_0642978
1670 Ga0495628_0001531
1671 Ga0495628_0032089
1672 Ga0495628_0071674
1673 Ga0495628_0092481
1674 Ga0495628_0944865
1675 Ga0495630_0015365
1676 Ga0495630_0080472
1677 Ga0495630_0309480
1678 Ga0495630_1374556
1679 Ga0495631_0135491
1680 Ga0495631_0437154
1681 Ga0495644_0098219
1682 Ga0495644_0249709
1683 Ga0495663_0082304
1684 Ga0495666_0003040
1685 Ga0495642_0037906
1686 Ga0495642_0333795
1687 Ga0495652_0003999
1688 Ga0495652_0088795
1689 Ga0495652_0090487
1690 Ga0495652_0286228
1691 Ga0495652_0433587
1692 Ga0495665_0030875
1693 Ga0495665_0613114
1694 Ga0495640_0075987
1695 Ga0495640_0083107
1696 Ga0495640_0123539
1697 Ga0495640_0768448
1698 Ga0495586_0038808
1699 Ga0495586_0096027
1700 Ga0495586_0127639
1701 Ga0495587_0281180
1702 Ga0495587_0394234
1703 Ga0495587_0591590
1704 Ga0495598_0143526
1705 Ga0495645_0029925
1706 Ga0495645_0034488
1707 Ga0495645_0037053
1708 Ga0495667_0012490
1709 Ga0495667_0049992
1710 Ga0495667_0073119
1711 Ga0495667_0396105
1712 Ga0495656_0045428
1713 Ga0495634_0006777
1714 Ga0495634_0289678
1715 Ga0495635_0012714
1716 Ga0495635_0224062
1717 Ga0495659_0117797
1718 Ga0495661_0451214
1719 Ga0495588_0648942
1720 Ga0495657_0015624
1721 Ga0495657_0016463
1722 Ga0495657_0845270
1723 Ga0495599_0013809
1724 Ga0495599_0022201
1725 Ga0495599_0026957
1726 Ga0495599_0297753
1727 Ga0495599_0461926
1728 Ga0495623_0086453
1729 Ga0495623_0162314
1730 Ga0495623_0609564
1731 Ga0495646_0073315
1732 Ga0495646_0125332
1733 Ga0495646_0171106
1734 Ga0495646_0558876
1735 Ga0495647_0005940
1736 Ga0495647_0033876
1737 Ga0495658_0121701
1738 Ga0495658_0152066
1739 Ga0495658_0189380
1740 Ga0495613_0012474
1741 Ga0495613_0016946
1742 Ga0495613_0025648
1743 Ga0495613_0087726
1744 Ga0495613_0143535
1745 Ga0495613_0942340
1746 Ga0495624_0043468
1747 Ga0495624_0219882
1748 Ga0495624_0377594
1749 Ga0495670_0476683
1750 Ga0495589_0130359
1751 Ga0495589_0473804
1752 Ga0495600_0020996
1753 Ga0495600_0065899
1754 Ga0495600_0282583
1755 Ga0495581_0011521
1756 Ga0495581_0022746
1757 Ga0495604_0000060
1758 Ga0495604_0195253
1759 Ga0495604_0277129
1760 Ga0495636_0102621
1761 Ga0495674_0009509
1762 Ga0495674_0227034
1763 Ga0495674_0270803
1764 Ga0495674_0369414
1765 Ga0495674_0507982
1766 Ga0495676_0027116
1767 Ga0495676_0032895
1768 Ga0495676_0279535
1769 Ga0495676_0973631
1770 Ga0495676_1075450
1771 Ga0495680_0013289
1772 Ga0495680_0018573
1773 Ga0495680_0089265
1774 Ga0495680_0100989
1775 Ga0495680_0135198
1776 Ga0495680_0187741
1777 Ga0495680_0688347
1778 Ga0495675_0000223
1779 Ga0495675_0205380
1780 Ga0495677_0071145
1781 Ga0495679_084482
1782 Ga0495684_0005780
1783 Ga0495684_0115533
1784 Ga0495684_0160899
1785 Ga0495684_1022660
1786 Ga0495593_0006797
1787 Ga0495593_0089320
1788 Ga0495593_0484960
1789 Ga0495602_0020512
1790 Ga0495602_0047074
1791 Ga0495602_0291296
1792 Ga0495614_0006112
1793 Ga0496100_0002820
1794 Ga0496100_0004456
1795 Ga0496100_0078020
1796 Ga0496100_0136307
1797 Ga0496100_0161686
1798 Ga0496100_0271454
1799 Ga0496100_0514513
1800 Ga0496100_1601417
1801 Ga0496101_0015044
1802 Ga0496101_0051136
1803 Ga0496101_0096112
1804 Ga0496101_0129026
1805 Ga0496101_0139886
1806 Ga0496101_0143618
1807 Ga0496101_0227950
1808 Ga0496101_0244432
1809 Ga0496101_0293688
1810 Ga0496101_0443800
1811 Ga0496101_0623476
1812 Ga0496101_1085193
1813 Ga0496102_0008982
1814 Ga0496102_0012097
1815 Ga0496102_0024965
1816 Ga0496102_0049877
1817 Ga0496102_0194492
1818 Ga0496102_0372425
1819 Ga0496102_0615568
1820 Ga0496102_0937136
1821 Ga0496102_1022933
1822 Ga0496102_1368350
1823 Ga0496102_1523581
1824 Ga0496103_0002119
1825 Ga0496103_0013098
1826 Ga0496103_0040840
1827 Ga0496103_0050008
1828 Ga0496103_0112747
1829 Ga0496103_0559011
1830 Ga0496104_0021508
1831 Ga0496104_0032912
1832 Ga0496104_0038794
1833 Ga0496104_0090158
1834 Ga0496104_0100962
1835 Ga0496104_0169631
1836 Ga0496104_0236253
1837 Ga0496104_0318056
1838 Ga0496104_1236069
1839 Ga0496104_1736124
1840 Ga0496105_0001516
1841 Ga0496105_0008728
1842 Ga0496105_0009662
1843 Ga0496105_0015376
1844 Ga0496105_0019200
1845 Ga0496105_0032574
1846 Ga0496105_0099935
1847 Ga0496105_0216276
1848 Ga0496105_0622194
1849 Ga0496105_1057259
1850 Ga0496106_0031861
1851 Ga0496106_0041331
1852 Ga0496106_0053844
1853 Ga0496106_0055830
1854 Ga0496106_0177195
1855 Ga0496106_0267831
1856 Ga0496106_0476345
1857 Ga0496106_0547722
1858 Ga0496106_0622730
1859 Ga0496106_1109975
1860 Ga0496107_0002386
1861 Ga0496107_0003768
1862 Ga0496107_0016421
1863 Ga0496107_0019539
1864 Ga0496107_0045975
1865 Ga0496107_0139903
1866 Ga0496107_0176372
1867 Ga0496107_0446732
1868 Ga0496107_0626141
1869 Ga0496107_0694458
1870 Ga0496107_0727387
1871 Ga0496108_0008962
1872 Ga0496108_0014661
1873 Ga0496108_0015917
1874 Ga0496108_0034844
1875 Ga0496108_0041551
1876 Ga0496108_0052324
1877 Ga0496108_0053838
1878 Ga0496108_0083652
1879 Ga0496108_0258229
1880 Ga0496108_0448331
1881 Ga0496108_0844095
1882 Ga0496108_0847616
1883 Ga0496108_1525656
1884 Ga0496108_1696474
1885 Ga0496109_0006089
1886 Ga0496109_0010728
1887 Ga0496109_0012997
1888 Ga0496109_0020867
1889 Ga0496109_0049713
1890 Ga0496109_0069300
1891 Ga0496109_0074935
1892 Ga0496109_0086712
1893 Ga0496109_0149958
1894 Ga0496109_0251573
1895 Ga0496109_0331274
1896 Ga0496109_0706720
1897 Ga0496109_0877556
1898 Ga0496109_1886229
1899 Ga0496110_0007733
1900 Ga0496110_0014389
1901 Ga0496110_0021072
1902 Ga0496110_0039161
1903 Ga0496110_0067654
1904 Ga0496110_0169580
1905 Ga0496110_0177401
1906 Ga0496110_0285397
1907 Ga0496110_0464233
1908 Ga0496110_0513246
1909 Ga0496110_0830491
1910 Ga0496110_1082597
1911 Ga0496110_1328559
1912 Ga0496111_0010559
1913 Ga0496111_0069679
1914 Ga0496111_0086020
1915 Ga0496111_0095115
1916 Ga0496111_0223026
1917 Ga0496111_0300901
1918 Ga0496111_0388770
1919 Ga0496111_0390857
1920 Ga0496111_0620218
1921 Ga0496111_0753400
1922 Ga0496111_1255444
1923 Ga0496112_0007227
1924 Ga0496112_0031071
1925 Ga0496112_0034432
1926 Ga0496112_0037934
1927 Ga0496112_0041755
1928 Ga0496112_0136716
1929 Ga0496112_0161655
1930 Ga0496112_0181535
1931 Ga0496112_0186188
1932 Ga0496112_0203401
1933 Ga0496112_0228266
1934 Ga0496112_0262322
1935 Ga0496112_0286451
1936 Ga0496112_0426039
1937 Ga0496112_0860740
1938 Ga0496112_0907012
1939 Ga0496112_0981746
1940 Ga0496113_0008647
1941 Ga0496113_0049667
1942 Ga0496113_0061202
1943 Ga0496113_0105795
1944 Ga0496113_0130371
1945 Ga0496113_0235086
1946 Ga0496113_0265690
1947 Ga0496113_0270368
1948 Ga0496113_0527660
1949 Ga0496113_0600330
1950 Ga0496113_0659924
1951 Ga0496113_0683621
1952 Ga0496113_1111755
1953 Ga0496113_1345939
1954 Ga0496114_0008381
1955 Ga0496114_0011405
1956 Ga0496114_0043182
1957 Ga0496114_0047606
1958 Ga0496114_0083674
1959 Ga0496114_0306086
1960 Ga0496114_0956302
1961 Ga0496114_1527086
1962 Ga0496114_1555035
1963 Ga0496115_0003191
1964 Ga0496115_0007836
1965 Ga0496115_0040293
1966 Ga0496115_0073791
1967 Ga0496115_0092557
1968 Ga0496115_0103772
1969 Ga0496115_0165741
1970 Ga0496115_0351269
1971 Ga0496115_0892101
1972 Ga0501031_0000270
1973 Ga0501032_0001838
1974 Ga0501033_0206071
1975 Ga0501036_0015962
1976 Ga0501037_0043551
1977 Ga0501038_0003487
1978 Ga0501040_0028875
1979 Ga0501041_0004847
1980 Ga0501042_0003753
1981 Ga0501043_0012759
1982 Ga0501046_0008121
1983 Ga0501048_0650924
1984 Ga0501067_0001546
1985 Ga0501067_0007583
1986 Ga0501067_0013188
1987 Ga0501067_0088494
1988 Ga0501067_0355374
1989 Ga0501068_0081802
1990 Ga0501068_0271601
1991 Ga0501069_0004650
1992 Ga0501069_0012853
1993 Ga0501069_0024080
1994 Ga0501069_0492869
1995 Ga0501069_0562839
1996 Ga0501070_0001395
1997 Ga0501070_0297128
1998 Ga0501071_0273011
1999 Ga0501072_0601869
2000 Ga0501073_0019252
2001 Ga0501074_0075052
2002 Ga0501075_0010586
2003 Ga0501076_0880144
2004 Ga0501077_0023939
2005 Ga0501079_0032967
2006 Ga0501080_0003360
2007 Ga0501081_0186261
2008 Ga0501081_0406251
2009 Ga0501083_0022271
2010 Ga0501035_0132999
2011 Ga0501044_0057674
2012 Ga0501045_0041931
2013 nmdc:mga05p37_530737_c1
2014 nmdc:mga05p37_60368_c1
2015 nmdc:mga08y16_286263_c1
2016 nmdc:mga0n895_1252961_c1
2017 nmdc:mga0n895_161716_c1
2018 nmdc:mga0n895_34358_c1
2019 nmdc:mga0rr50_110760_c1
2020 nmdc:mga0rr50_174756_c1
2021 nmdc:mga0rr50_67976_c1
2022 nmdc:mga08x19_31482_c1
2023 nmdc:mga08x19_45618_c1
2024 nmdc:mga08x19_69708_c1
2025 nmdc:mga0a205_141402_c1
2026 nmdc:mga0a205_1527627_c1
2027 nmdc:mga0a205_399185_c1
2028 nmdc:mga0a205_79097_c1
2029 Ga0495601_0000328
2030 Ga0495601_0023115
2031 Ga0495601_0029973
2032 Ga0495601_0063649
2033 Ga0495601_0117223
2034 Ga0495601_0683715
2035 Ga0495612_0001001
2036 Ga0495612_0044108
2037 Ga0495612_0176808
2038 Ga0495612_0265210
2039 Ga0495595_0000605
2040 Ga0495595_0002546
2041 Ga0495595_0030743
2042 Ga0495595_0322786
2043 Ga0495595_0450859
2044 Ga0495619_0010795
2045 Ga0495619_0043958
2046 Ga0495619_0136676
2047 Ga0495619_0466820
2048 Ga0495619_0899512
2049 Ga0495619_1001298
2050 Ga0500566_0021035
2051 Ga0501084_0522327
2052 Ga0501082_0044936
2053 Ga0501082_0125957
2054 Ga0466962_0021516
2055 Ga0466962_0023024
2056 Ga0466962_0048012
2057 Ga0466962_0051814
2058 Ga0466962_0071584
2059 Ga0466962_0355085
2060 Ga0530510_0003335
2061 Ga0530510_0014416
2062 Ga0530510_0016879

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14026

SCO4226-like

Nickel responsive protein SCO4226-like

25

103

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
4oi3-assembly1.cif.gz_B crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) 0.7511 3 85
4oi3-assembly1.cif.gz_B crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) 0.7354 3 85
4qle-assembly2.cif.gz_B crystal structure of i14a dhfr mutant complexed with folate and nadp+ 0.7251 31 57
4qlg-assembly2.cif.gz_B crystal structure of i14v dhfr mutant complexed with folate and nadp+ 0.7047 31 57
3ep8-assembly1.cif.gz_A human adometdc e178q mutant complexed with s-adenosylmethionine methyl ester and no putrescine bound 0.6963 34 57
ID Description Score Start End Superfamily
4oi3B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.7681 3 85 3.30.70.3090
af_Q2G1I7_88_170_3.30.70.3090 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.752 1 81 3.30.70.3090
4oi3B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.752 3 85 3.30.70.3090
2cfxA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.7345 2 86 3.30.70.920
af_Q2G1I7_88_170_3.30.70.3090 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.7127 1 81 3.30.70.3090
ID Description Score Start End GO Terms
AF-A0A538FSW4-F1-model_v4 DUF4242 domain-containing protein 0.9852 1 93
AF-A0A538FSW4-F1-model_v4 DUF4242 domain-containing protein 0.9749 1 93
AF-A0A538IWB9-F1-model_v4 DUF4242 domain-containing protein 0.9735 1 93
AF-A0A537WMF0-F1-model_v4 DUF4242 domain-containing protein 0.9674 1 91
AF-A0A538IWB9-F1-model_v4 DUF4242 domain-containing protein 0.9634 1 93

Map