F488604
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1031 | 333 | 2062 | 96 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_100044987|Ga0070714_1000449872 |
| Length | 115 |
| Sequence | MCTAESSVPFSTPTRNARLAAMPRYLIVRSFEVGEDQMPPVGRRSRELTETEFPEITWEHSHVVVDDEGLVRTYCVYEAPNEQVVRDHSSRLGRHTLDVLHEIAGDVTPADFPPV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 47 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 48 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 54 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 55 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 56 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 57 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 84 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 131 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 132 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 133 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 134 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 135 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 136 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 137 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 138 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 139 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 140 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 141 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 142 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 143 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 144 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 145 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 146 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 147 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 148 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 149 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 150 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 151 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 152 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 153 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 154 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 155 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 156 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 157 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 159 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 160 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 161 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 162 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 163 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 164 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 167 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 168 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 169 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 170 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 171 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 172 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 173 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 174 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 175 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 176 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 177 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 178 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 179 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 180 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 181 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 182 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 183 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 184 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 185 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 186 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 187 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 188 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 189 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 190 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 191 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 192 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 193 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 194 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 195 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 196 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 197 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 198 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 199 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 200 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 201 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 202 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 203 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 204 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 205 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 206 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 207 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 208 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 276 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 277 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 278 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 279 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 280 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 281 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 284 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 285 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 286 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 287 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 288 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 289 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 330 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 333 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.74 |
| Metatranscriptomes | 1.26 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.1 |
| Nodule | 0 |
| Rhizoplane | 18.33 |
| Rhizosphere | 80.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 21.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070714_100044987 | 3300005435 | Bacteria | 3739 |
| 2 | JGI25406J46586_10074476 | 3300003203 | Unclassified | 1056 |
| 3 | Ga0070683_100008714 | 3300005329 | Bacteria | 8625 |
| 4 | Ga0068869_100302511 | 3300005334 | Bacteria | 1292 |
| 5 | Ga0070680_100087689 | 3300005336 | Unclassified | 2573 |
| 6 | Ga0070680_100739598 | 3300005336 | Unclassified | 847 |
| 7 | Ga0070682_100269657 | 3300005337 | Bacteria | 1236 |
| 8 | Ga0070682_100374438 | 3300005337 | Bacteria | 1069 |
| 9 | Ga0068868_100315759 | 3300005338 | Bacteria | 1330 |
| 10 | Ga0068868_101040909 | 3300005338 | Bacteria | 751 |
| 11 | Ga0070660_100570096 | 3300005339 | Bacteria | 945 |
| 12 | Ga0070691_10529732 | 3300005341 | Bacteria | 685 |
| 13 | Ga0070661_100389653 | 3300005344 | Bacteria | 1100 |
| 14 | Ga0070671_100329543 | 3300005355 | Bacteria | 1301 |
| 15 | Ga0070671_101859887 | 3300005355 | Bacteria | 535 |
| 16 | Ga0070673_100267654 | 3300005364 | Bacteria | 1495 |
| 17 | Ga0070703_10015069 | 3300005406 | Unclassified | 2210 |
| 18 | Ga0070709_10009572 | 3300005434 | Bacteria | 5349 |
| 19 | Ga0070709_10113405 | 3300005434 | Bacteria | 1825 |
| 20 | Ga0070709_10128603 | 3300005434 | Unclassified | 1726 |
| 21 | Ga0070714_100012637 | 3300005435 | Bacteria | 6743 |
| 22 | Ga0070714_100014579 | 3300005435 | Bacteria | 6315 |
| 23 | Ga0070714_100018152 | 3300005435 | Bacteria | 5708 |
| 24 | Ga0070714_100022459 | 3300005435 | Bacteria | 5174 |
| 25 | Ga0070714_100199748 | 3300005435 | Bacteria | 1829 |
| 26 | Ga0070714_100568086 | 3300005435 | Bacteria | 1087 |
| 27 | Ga0070714_100900862 | 3300005435 | Unclassified | 859 |
| 28 | Ga0070714_100994636 | 3300005435 | Bacteria | 816 |
| 29 | Ga0070714_101854181 | 3300005435 | Unclassified | 589 |
| 30 | Ga0070713_100029732 | 3300005436 | Bacteria | 4329 |
| 31 | Ga0070713_100032857 | 3300005436 | Bacteria | 4149 |
| 32 | Ga0070713_100338972 | 3300005436 | Bacteria | 1392 |
| 33 | Ga0070710_10004975 | 3300005437 | Bacteria | 6291 |
| 34 | Ga0070710_10087364 | 3300005437 | Bacteria | 1832 |
| 35 | Ga0070710_10439895 | 3300005437 | Bacteria | 882 |
| 36 | Ga0070710_11244902 | 3300005437 | Unclassified | 551 |
| 37 | Ga0070701_10840617 | 3300005438 | Unclassified | 629 |
| 38 | Ga0070711_100016112 | 3300005439 | Bacteria | 4741 |
| 39 | Ga0070711_100032237 | 3300005439 | Bacteria | 3483 |
| 40 | Ga0070711_100059898 | 3300005439 | Bacteria | 2645 |
| 41 | Ga0070711_100220361 | 3300005439 | Bacteria | 1474 |
| 42 | Ga0070711_100340197 | 3300005439 | Unclassified | 1204 |
| 43 | Ga0070711_100705779 | 3300005439 | Bacteria | 850 |
| 44 | Ga0070711_100835486 | 3300005439 | Unclassified | 783 |
| 45 | Ga0070705_100083751 | 3300005440 | Bacteria | 1966 |
| 46 | Ga0070705_100835393 | 3300005440 | Bacteria | 736 |
| 47 | Ga0070694_100048418 | 3300005444 | Unclassified | 2859 |
| 48 | Ga0070708_100032971 | 3300005445 | Bacteria | 4497 |
| 49 | Ga0070708_100042208 | 3300005445 | Bacteria | 4003 |
| 50 | Ga0070678_100166577 | 3300005456 | Bacteria | 1791 |
| 51 | Ga0070678_100219891 | 3300005456 | Bacteria | 1578 |
| 52 | Ga0070678_100293951 | 3300005456 | Bacteria | 1378 |
| 53 | Ga0070681_10017759 | 3300005458 | Bacteria | 7109 |
| 54 | Ga0070681_10189495 | 3300005458 | Unclassified | 1976 |
| 55 | Ga0070681_10210796 | 3300005458 | Bacteria | 1859 |
| 56 | Ga0070681_10806861 | 3300005458 | Unclassified | 856 |
| 57 | Ga0070681_11382352 | 3300005458 | Unclassified | 627 |
| 58 | Ga0070706_100200886 | 3300005467 | Unclassified | 1862 |
| 59 | Ga0070707_100003292 | 3300005468 | Bacteria | 15262 |
| 60 | Ga0070707_100030999 | 3300005468 | Bacteria | 5092 |
| 61 | Ga0070707_100067645 | 3300005468 | Bacteria | 3437 |
| 62 | Ga0070707_100130514 | 3300005468 | Bacteria | 2444 |
| 63 | Ga0070707_100751057 | 3300005468 | Bacteria | 939 |
| 64 | Ga0070707_100807610 | 3300005468 | Bacteria | 902 |
| 65 | Ga0070698_100070724 | 3300005471 | Bacteria | 3501 |
| 66 | Ga0070698_100092362 | 3300005471 | Unclassified | 3007 |
| 67 | Ga0070698_100383148 | 3300005471 | Bacteria | 1339 |
| 68 | Ga0070698_101927075 | 3300005471 | Unclassified | 544 |
| 69 | Ga0070699_100034221 | 3300005518 | Bacteria | 4391 |
| 70 | Ga0070699_100852578 | 3300005518 | Bacteria | 834 |
| 71 | Ga0070679_100013498 | 3300005530 | Bacteria | 7823 |
| 72 | Ga0070679_100029310 | 3300005530 | Bacteria | 5430 |
| 73 | Ga0070679_100075691 | 3300005530 | Bacteria | 3355 |
| 74 | Ga0070679_100192736 | 3300005530 | Bacteria | 2006 |
| 75 | Ga0070679_100487634 | 3300005530 | Bacteria | 1177 |
| 76 | Ga0070679_100618679 | 3300005530 | Bacteria | 1026 |
| 77 | Ga0070684_100025832 | 3300005535 | Bacteria | 4941 |
| 78 | Ga0070684_100113292 | 3300005535 | Bacteria | 2434 |
| 79 | Ga0070684_101428742 | 3300005535 | Unclassified | 652 |
| 80 | Ga0070697_100121161 | 3300005536 | Bacteria | 2188 |
| 81 | Ga0070697_100530871 | 3300005536 | Bacteria | 1031 |
| 82 | Ga0070697_100637429 | 3300005536 | Bacteria | 938 |
| 83 | Ga0070697_101047273 | 3300005536 | Unclassified | 726 |
| 84 | Ga0068853_100839209 | 3300005539 | Bacteria | 881 |
| 85 | Ga0068853_101304260 | 3300005539 | Unclassified | 702 |
| 86 | Ga0070695_100029800 | 3300005545 | Bacteria | 3393 |
| 87 | Ga0070695_100100925 | 3300005545 | Bacteria | 1943 |
| 88 | Ga0070695_101600147 | 3300005545 | Unclassified | 544 |
| 89 | Ga0070696_100072644 | 3300005546 | Bacteria | 2423 |
| 90 | Ga0070696_100103323 | 3300005546 | Bacteria | 2045 |
| 91 | Ga0070696_100445056 | 3300005546 | Bacteria | 1021 |
| 92 | Ga0070696_102002931 | 3300005546 | Unclassified | 503 |
| 93 | Ga0070693_100125958 | 3300005547 | Unclassified | 1595 |
| 94 | Ga0070693_100286921 | 3300005547 | Bacteria | 1104 |
| 95 | Ga0070665_101297338 | 3300005548 | Bacteria | 738 |
| 96 | Ga0070704_100016869 | 3300005549 | Unclassified | 4628 |
| 97 | Ga0070704_100028271 | 3300005549 | Bacteria | 3729 |
| 98 | Ga0070704_100813373 | 3300005549 | Bacteria | 836 |
| 99 | Ga0068855_100135143 | 3300005563 | Unclassified | 2814 |
| 100 | Ga0068855_100903574 | 3300005563 | Bacteria | 933 |
| 101 | Ga0070664_101089030 | 3300005564 | Bacteria | 752 |
| 102 | Ga0068857_100650787 | 3300005577 | Bacteria | 999 |
| 103 | Ga0068856_100004254 | 3300005614 | Bacteria | 14295 |
| 104 | Ga0068856_100050235 | 3300005614 | Bacteria | 4111 |
| 105 | Ga0068856_100607405 | 3300005614 | Unclassified | 1115 |
| 106 | Ga0068856_100760348 | 3300005614 | Bacteria | 989 |
| 107 | Ga0068856_101043901 | 3300005614 | Bacteria | 835 |
| 108 | Ga0070702_100043322 | 3300005615 | Unclassified | 2536 |
| 109 | Ga0070702_100053062 | 3300005615 | Bacteria | 2328 |
| 110 | Ga0070702_100121565 | 3300005615 | Unclassified | 1636 |
| 111 | Ga0068852_100518844 | 3300005616 | Bacteria | 1189 |
| 112 | Ga0068864_102421851 | 3300005618 | Bacteria | 531 |
| 113 | Ga0068851_11106993 | 3300005834 | Unclassified | 503 |
| 114 | Ga0068863_100392542 | 3300005841 | Bacteria | 1356 |
| 115 | Ga0068863_100767560 | 3300005841 | Bacteria | 961 |
| 116 | Ga0068863_101217984 | 3300005841 | Bacteria | 759 |
| 117 | Ga0068862_102119068 | 3300005844 | Unclassified | 573 |
| 118 | Ga0081539_10039813 | 3300005985 | Bacteria | 2768 |
| 119 | Ga0070717_10027339 | 3300006028 | Bacteria | 4559 |
| 120 | Ga0070717_10027807 | 3300006028 | Bacteria | 4521 |
| 121 | Ga0070717_10120582 | 3300006028 | Unclassified | 2246 |
| 122 | Ga0070717_10678454 | 3300006028 | Bacteria | 936 |
| 123 | Ga0070717_11426899 | 3300006028 | Bacteria | 628 |
| 124 | Ga0070717_11504980 | 3300006028 | Bacteria | 611 |
| 125 | Ga0070717_11598868 | 3300006028 | Bacteria | 591 |
| 126 | Ga0070715_10002018 | 3300006163 | Bacteria | 6126 |
| 127 | Ga0070715_10027774 | 3300006163 | Bacteria | 2263 |
| 128 | Ga0070715_10088512 | 3300006163 | Bacteria | 1420 |
| 129 | Ga0070715_10101030 | 3300006163 | Unclassified | 1345 |
| 130 | Ga0070715_10121710 | 3300006163 | Bacteria | 1245 |
| 131 | Ga0070716_100003623 | 3300006173 | Bacteria | 7299 |
| 132 | Ga0070716_100034746 | 3300006173 | Bacteria | 2766 |
| 133 | Ga0070716_100211802 | 3300006173 | Bacteria | 1295 |
| 134 | Ga0070716_100568865 | 3300006173 | Unclassified | 848 |
| 135 | Ga0070716_100692776 | 3300006173 | Bacteria | 777 |
| 136 | Ga0070712_100015533 | 3300006175 | Unclassified | 4909 |
| 137 | Ga0070712_100054694 | 3300006175 | Unclassified | 2791 |
| 138 | Ga0070712_100106139 | 3300006175 | Bacteria | 2087 |
| 139 | Ga0070712_100119231 | 3300006175 | Bacteria | 1983 |
| 140 | Ga0070712_100149113 | 3300006175 | Bacteria | 1794 |
| 141 | Ga0070712_100343895 | 3300006175 | Bacteria | 1219 |
| 142 | Ga0070712_100499910 | 3300006175 | Bacteria | 1019 |
| 143 | Ga0070712_101294266 | 3300006175 | Bacteria | 635 |
| 144 | Ga0097621_100161681 | 3300006237 | Bacteria | 1925 |
| 145 | Ga0097621_100379597 | 3300006237 | Unclassified | 1262 |
| 146 | Ga0097621_102046341 | 3300006237 | Bacteria | 547 |
| 147 | Ga0075434_100043444 | 3300006871 | Unclassified | 4458 |
| 148 | Ga0075434_100133108 | 3300006871 | Unclassified | 2506 |
| 149 | Ga0075436_100189029 | 3300006914 | Unclassified | 1457 |
| 150 | Ga0075435_100715229 | 3300007076 | Bacteria | 871 |
| 151 | Ga0099795_10235061 | 3300007788 | Unclassified | 785 |
| 152 | Ga0105250_10411921 | 3300009092 | Bacteria | 601 |
| 153 | Ga0105240_10015125 | 3300009093 | Bacteria | 10503 |
| 154 | Ga0105240_10134586 | 3300009093 | Bacteria | 2961 |
| 155 | Ga0105240_10167588 | 3300009093 | Bacteria | 2604 |
| 156 | Ga0111539_10195218 | 3300009094 | Unclassified | 2361 |
| 157 | Ga0105245_10016693 | 3300009098 | Bacteria | 6411 |
| 158 | Ga0105245_10183849 | 3300009098 | Bacteria | 1998 |
| 159 | Ga0105245_10227907 | 3300009098 | Bacteria | 1801 |
| 160 | Ga0105245_10431703 | 3300009098 | Bacteria | 1322 |
| 161 | Ga0105245_10547207 | 3300009098 | Bacteria | 1179 |
| 162 | Ga0105245_10824105 | 3300009098 | Unclassified | 967 |
| 163 | Ga0105245_11164001 | 3300009098 | Bacteria | 818 |
| 164 | Ga0105245_11912974 | 3300009098 | Unclassified | 646 |
| 165 | Ga0105245_12888960 | 3300009098 | Bacteria | 532 |
| 166 | Ga0105247_10058823 | 3300009101 | Bacteria | 2378 |
| 167 | Ga0114129_10087988 | 3300009147 | Bacteria | 4307 |
| 168 | Ga0114129_10604341 | 3300009147 | Bacteria | 1421 |
| 169 | Ga0114129_11790497 | 3300009147 | Unclassified | 747 |
| 170 | Ga0105243_10374295 | 3300009148 | Bacteria | 1315 |
| 171 | Ga0105241_10255032 | 3300009174 | Unclassified | 1489 |
| 172 | Ga0105241_10772695 | 3300009174 | Unclassified | 883 |
| 173 | Ga0105241_12100560 | 3300009174 | Unclassified | 558 |
| 174 | Ga0105241_12517157 | 3300009174 | Unclassified | 516 |
| 175 | Ga0105242_10241211 | 3300009176 | Bacteria | 1625 |
| 176 | Ga0105242_11098723 | 3300009176 | Unclassified | 809 |
| 177 | Ga0105242_11283619 | 3300009176 | Bacteria | 755 |
| 178 | Ga0105242_11324382 | 3300009176 | Bacteria | 745 |
| 179 | Ga0105242_11614090 | 3300009176 | Bacteria | 682 |
| 180 | Ga0105242_13218470 | 3300009176 | Unclassified | 507 |
| 181 | Ga0105248_10096239 | 3300009177 | Bacteria | 3334 |
| 182 | Ga0105248_10504275 | 3300009177 | Archaea | 1364 |
| 183 | Ga0105248_12630977 | 3300009177 | Bacteria | 574 |
| 184 | Ga0105237_10012550 | 3300009545 | Bacteria | 8926 |
| 185 | Ga0105237_10028267 | 3300009545 | Bacteria | 5714 |
| 186 | Ga0105237_11199409 | 3300009545 | Unclassified | 766 |
| 187 | Ga0105238_10349967 | 3300009551 | Bacteria | 1466 |
| 188 | Ga0105238_10369292 | 3300009551 | Bacteria | 1425 |
| 189 | Ga0105249_10037672 | 3300009553 | Bacteria | 4388 |
| 190 | Ga0099796_10350624 | 3300010159 | Bacteria | 636 |
| 191 | Ga0105239_10239298 | 3300010375 | Bacteria | 2037 |
| 192 | Ga0105239_10403265 | 3300010375 | Bacteria | 1547 |
| 193 | Ga0105239_11196110 | 3300010375 | Unclassified | 876 |
| 194 | Ga0105239_12392623 | 3300010375 | Bacteria | 615 |
| 195 | Ga0105239_12505340 | 3300010375 | Bacteria | 601 |
| 196 | Ga0105246_10035088 | 3300011119 | Unclassified | 3349 |
| 197 | Ga0157373_10317508 | 3300013100 | Unclassified | 1108 |
| 198 | Ga0157373_10326846 | 3300013100 | Unclassified | 1091 |
| 199 | Ga0157371_11004614 | 3300013102 | Bacteria | 636 |
| 200 | Ga0157370_10041660 | 3300013104 | Bacteria | 4428 |
| 201 | Ga0157370_10335150 | 3300013104 | Bacteria | 1395 |
| 202 | Ga0157370_10420249 | 3300013104 | Bacteria | 1230 |
| 203 | Ga0157370_10960531 | 3300013104 | Unclassified | 774 |
| 204 | Ga0157370_11754878 | 3300013104 | Unclassified | 557 |
| 205 | Ga0157369_10057047 | 3300013105 | Bacteria | 4214 |
| 206 | Ga0157369_10223656 | 3300013105 | Bacteria | 1969 |
| 207 | Ga0157369_10250603 | 3300013105 | Bacteria | 1848 |
| 208 | Ga0157369_10725789 | 3300013105 | Bacteria | 1023 |
| 209 | Ga0157369_11329175 | 3300013105 | Unclassified | 732 |
| 210 | Ga0157374_10219442 | 3300013296 | Bacteria | 1865 |
| 211 | Ga0157374_10251991 | 3300013296 | Bacteria | 1737 |
| 212 | Ga0157374_10589009 | 3300013296 | Bacteria | 1121 |
| 213 | Ga0157374_11023029 | 3300013296 | Unclassified | 846 |
| 214 | Ga0157374_11408182 | 3300013296 | Unclassified | 720 |
| 215 | Ga0157374_12867765 | 3300013296 | Unclassified | 509 |
| 216 | Ga0157378_10154640 | 3300013297 | Bacteria | 2139 |
| 217 | Ga0157378_10713374 | 3300013297 | Bacteria | 1023 |
| 218 | Ga0163162_10340282 | 3300013306 | Bacteria | 1633 |
| 219 | Ga0157372_10027075 | 3300013307 | Bacteria | 6240 |
| 220 | Ga0157372_10209493 | 3300013307 | Unclassified | 2259 |
| 221 | Ga0157372_10271712 | 3300013307 | Unclassified | 1970 |
| 222 | Ga0157372_10851579 | 3300013307 | Bacteria | 1058 |
| 223 | Ga0157372_11159453 | 3300013307 | Unclassified | 893 |
| 224 | Ga0157372_12855581 | 3300013307 | Bacteria | 553 |
| 225 | Ga0157375_10160165 | 3300013308 | Bacteria | 2392 |
| 226 | Ga0157375_11635309 | 3300013308 | Unclassified | 762 |
| 227 | Ga0157375_11801722 | 3300013308 | Bacteria | 726 |
| 228 | Ga0157375_11988140 | 3300013308 | Bacteria | 691 |
| 229 | Ga0163163_10585244 | 3300014325 | Bacteria | 1179 |
| 230 | Ga0163163_11798295 | 3300014325 | Unclassified | 673 |
| 231 | Ga0182008_10049929 | 3300014497 | Bacteria | 2076 |
| 232 | Ga0157377_10563426 | 3300014745 | Archaea | 807 |
| 233 | Ga0157376_10014957 | 3300014969 | Bacteria | 5847 |
| 234 | Ga0157376_10651172 | 3300014969 | Bacteria | 1054 |
| 235 | Ga0157376_11682950 | 3300014969 | Unclassified | 669 |
| 236 | Ga0157376_11879242 | 3300014969 | Unclassified | 636 |
| 237 | Ga0197907_10854251 | 3300020069 | Bacteria | 763 |
| 238 | Ga0206356_10209225 | 3300020070 | Bacteria | 2315 |
| 239 | Ga0206356_10929994 | 3300020070 | Bacteria | 1586 |
| 240 | Ga0206356_10977224 | 3300020070 | Bacteria | 2100 |
| 241 | Ga0206350_11514786 | 3300020080 | Bacteria | 791 |
| 242 | Ga0206354_10859821 | 3300020081 | Bacteria | 1014 |
| 243 | Ga0206354_11318015 | 3300020081 | Bacteria | 2308 |
| 244 | Ga0206354_11338473 | 3300020081 | Bacteria | 3651 |
| 245 | Ga0206353_10588232 | 3300020082 | Bacteria | 2230 |
| 246 | Ga0206353_10632433 | 3300020082 | Bacteria | 1685 |
| 247 | Ga0206353_11523787 | 3300020082 | Bacteria | 4221 |
| 248 | Ga0224712_10203731 | 3300022467 | Bacteria | 900 |
| 249 | Ga0224712_10593113 | 3300022467 | Unclassified | 541 |
| 250 | Ga0207692_10007655 | 3300025898 | Bacteria | 4433 |
| 251 | Ga0207692_10035063 | 3300025898 | Bacteria | 2435 |
| 252 | Ga0207692_10072795 | 3300025898 | Bacteria | 1816 |
| 253 | Ga0207692_10276641 | 3300025898 | Bacteria | 1014 |
| 254 | Ga0207692_10378547 | 3300025898 | Bacteria | 878 |
| 255 | Ga0207710_10057191 | 3300025900 | Bacteria | 1761 |
| 256 | Ga0207680_10159651 | 3300025903 | Bacteria | 1510 |
| 257 | Ga0207685_10026097 | 3300025905 | Bacteria | 2026 |
| 258 | Ga0207685_10097114 | 3300025905 | Bacteria | 1253 |
| 259 | Ga0207699_10006811 | 3300025906 | Bacteria | 5558 |
| 260 | Ga0207699_10021993 | 3300025906 | Bacteria | 3448 |
| 261 | Ga0207699_10024515 | 3300025906 | Bacteria | 3301 |
| 262 | Ga0207699_10407059 | 3300025906 | Bacteria | 970 |
| 263 | Ga0207684_10106127 | 3300025910 | Bacteria | 2403 |
| 264 | Ga0207684_10287828 | 3300025910 | Unclassified | 1417 |
| 265 | Ga0207654_10373898 | 3300025911 | Unclassified | 986 |
| 266 | Ga0207654_10471296 | 3300025911 | Bacteria | 883 |
| 267 | Ga0207707_10013971 | 3300025912 | Bacteria | 7001 |
| 268 | Ga0207707_10073428 | 3300025912 | Bacteria | 2983 |
| 269 | Ga0207707_10086553 | 3300025912 | Bacteria | 2738 |
| 270 | Ga0207707_10452391 | 3300025912 | Bacteria | 1099 |
| 271 | Ga0207707_10604065 | 3300025912 | Bacteria | 928 |
| 272 | Ga0207707_11510962 | 3300025912 | Unclassified | 532 |
| 273 | Ga0207695_10201378 | 3300025913 | Unclassified | 1905 |
| 274 | Ga0207693_10002044 | 3300025915 | Bacteria | 17664 |
| 275 | Ga0207693_10002632 | 3300025915 | Bacteria | 15592 |
| 276 | Ga0207693_10002681 | 3300025915 | Bacteria | 15453 |
| 277 | Ga0207693_10009259 | 3300025915 | Bacteria | 8039 |
| 278 | Ga0207693_10019134 | 3300025915 | Bacteria | 5450 |
| 279 | Ga0207693_10035288 | 3300025915 | Bacteria | 3943 |
| 280 | Ga0207693_10081175 | 3300025915 | Bacteria | 2539 |
| 281 | Ga0207693_10330786 | 3300025915 | Bacteria | 1193 |
| 282 | Ga0207693_10397242 | 3300025915 | Bacteria | 1078 |
| 283 | Ga0207693_11083133 | 3300025915 | Bacteria | 609 |
| 284 | Ga0207663_10000508 | 3300025916 | Bacteria | 17037 |
| 285 | Ga0207663_10032689 | 3300025916 | Bacteria | 3091 |
| 286 | Ga0207663_10077201 | 3300025916 | Unclassified | 2167 |
| 287 | Ga0207663_10087540 | 3300025916 | Bacteria | 2057 |
| 288 | Ga0207663_10099076 | 3300025916 | Bacteria | 1953 |
| 289 | Ga0207663_10101709 | 3300025916 | Unclassified | 1931 |
| 290 | Ga0207663_10234312 | 3300025916 | Unclassified | 1343 |
| 291 | Ga0207663_10695420 | 3300025916 | Unclassified | 805 |
| 292 | Ga0207663_11210377 | 3300025916 | Bacteria | 608 |
| 293 | Ga0207660_10275697 | 3300025917 | Bacteria | 1333 |
| 294 | Ga0207660_10286421 | 3300025917 | Bacteria | 1309 |
| 295 | Ga0207660_10348157 | 3300025917 | Bacteria | 1187 |
| 296 | Ga0207660_10360316 | 3300025917 | Bacteria | 1166 |
| 297 | Ga0207660_10937524 | 3300025917 | Bacteria | 706 |
| 298 | Ga0207657_10254595 | 3300025919 | Bacteria | 1399 |
| 299 | Ga0207657_10795837 | 3300025919 | Bacteria | 731 |
| 300 | Ga0207649_10123357 | 3300025920 | Bacteria | 1750 |
| 301 | Ga0207649_10479108 | 3300025920 | Bacteria | 943 |
| 302 | Ga0207649_10631031 | 3300025920 | Bacteria | 826 |
| 303 | Ga0207652_10012591 | 3300025921 | Bacteria | 6837 |
| 304 | Ga0207652_10022150 | 3300025921 | Bacteria | 5252 |
| 305 | Ga0207652_10027860 | 3300025921 | Bacteria | 4712 |
| 306 | Ga0207652_10908793 | 3300025921 | Bacteria | 777 |
| 307 | Ga0207652_10967957 | 3300025921 | Unclassified | 749 |
| 308 | Ga0207646_10000553 | 3300025922 | Bacteria | 49225 |
| 309 | Ga0207646_10025249 | 3300025922 | Bacteria | 5437 |
| 310 | Ga0207646_10602795 | 3300025922 | Bacteria | 986 |
| 311 | Ga0207646_10714825 | 3300025922 | Bacteria | 895 |
| 312 | Ga0207646_11719579 | 3300025922 | Bacteria | 538 |
| 313 | Ga0207694_10479132 | 3300025924 | Bacteria | 1041 |
| 314 | Ga0207694_11857698 | 3300025924 | Bacteria | 506 |
| 315 | Ga0207687_10331837 | 3300025927 | Bacteria | 1234 |
| 316 | Ga0207687_10611929 | 3300025927 | Unclassified | 919 |
| 317 | Ga0207687_10629001 | 3300025927 | Archaea | 907 |
| 318 | Ga0207687_10867196 | 3300025927 | Bacteria | 772 |
| 319 | Ga0207687_11567026 | 3300025927 | Unclassified | 566 |
| 320 | Ga0207700_10007688 | 3300025928 | Bacteria | 6619 |
| 321 | Ga0207700_10012145 | 3300025928 | Bacteria | 5539 |
| 322 | Ga0207700_10080039 | 3300025928 | Bacteria | 2546 |
| 323 | Ga0207700_10155834 | 3300025928 | Bacteria | 1892 |
| 324 | Ga0207700_12035398 | 3300025928 | Bacteria | 501 |
| 325 | Ga0207664_10050845 | 3300025929 | Bacteria | 3270 |
| 326 | Ga0207664_10066343 | 3300025929 | Bacteria | 2893 |
| 327 | Ga0207664_10071530 | 3300025929 | Bacteria | 2794 |
| 328 | Ga0207664_10079356 | 3300025929 | Bacteria | 2664 |
| 329 | Ga0207664_10085788 | 3300025929 | Bacteria | 2571 |
| 330 | Ga0207664_10117133 | 3300025929 | Bacteria | 2224 |
| 331 | Ga0207664_10158548 | 3300025929 | Bacteria | 1928 |
| 332 | Ga0207664_10380090 | 3300025929 | Bacteria | 1254 |
| 333 | Ga0207664_10388494 | 3300025929 | Bacteria | 1240 |
| 334 | Ga0207664_10472223 | 3300025929 | Bacteria | 1121 |
| 335 | Ga0207664_11241983 | 3300025929 | Unclassified | 664 |
| 336 | Ga0207644_10384722 | 3300025931 | Bacteria | 1145 |
| 337 | Ga0207644_10550342 | 3300025931 | Bacteria | 955 |
| 338 | Ga0207686_10491426 | 3300025934 | Bacteria | 951 |
| 339 | Ga0207686_10590606 | 3300025934 | Bacteria | 873 |
| 340 | Ga0207686_10984347 | 3300025934 | Bacteria | 684 |
| 341 | Ga0207686_11076609 | 3300025934 | Bacteria | 655 |
| 342 | Ga0207704_10232998 | 3300025938 | Unclassified | 1371 |
| 343 | Ga0207665_10000420 | 3300025939 | Bacteria | 29260 |
| 344 | Ga0207665_10000735 | 3300025939 | Bacteria | 22043 |
| 345 | Ga0207665_10012183 | 3300025939 | Bacteria | 5648 |
| 346 | Ga0207665_10270846 | 3300025939 | Bacteria | 1261 |
| 347 | Ga0207665_10735566 | 3300025939 | Bacteria | 777 |
| 348 | Ga0207665_10742006 | 3300025939 | Bacteria | 774 |
| 349 | Ga0207711_10231139 | 3300025941 | Bacteria | 1694 |
| 350 | Ga0207661_10025486 | 3300025944 | Bacteria | 4495 |
| 351 | Ga0207661_10248377 | 3300025944 | Bacteria | 1581 |
| 352 | Ga0207661_10526160 | 3300025944 | Bacteria | 1082 |
| 353 | Ga0207661_10901905 | 3300025944 | Bacteria | 814 |
| 354 | Ga0207679_10112354 | 3300025945 | Bacteria | 2153 |
| 355 | Ga0207679_11088668 | 3300025945 | Unclassified | 733 |
| 356 | Ga0207667_11283431 | 3300025949 | Unclassified | 709 |
| 357 | Ga0207667_11350335 | 3300025949 | Unclassified | 688 |
| 358 | Ga0207651_10427296 | 3300025960 | Bacteria | 1132 |
| 359 | Ga0207640_11308005 | 3300025981 | Bacteria | 647 |
| 360 | Ga0207677_10243304 | 3300026023 | Bacteria | 1457 |
| 361 | Ga0207677_11040201 | 3300026023 | Archaea | 744 |
| 362 | Ga0207678_10080546 | 3300026067 | Bacteria | 2788 |
| 363 | Ga0207702_10002127 | 3300026078 | Bacteria | 19055 |
| 364 | Ga0207702_10306948 | 3300026078 | Unclassified | 1507 |
| 365 | Ga0207702_10817124 | 3300026078 | Bacteria | 922 |
| 366 | Ga0207641_10200581 | 3300026088 | Bacteria | 1839 |
| 367 | Ga0207676_10488775 | 3300026095 | Bacteria | 1167 |
| 368 | Ga0207675_101070799 | 3300026118 | Bacteria | 826 |
| 369 | Ga0207683_10010038 | 3300026121 | Bacteria | 8080 |
| 370 | Ga0207683_10180593 | 3300026121 | Bacteria | 1913 |
| 371 | Ga0207683_10288615 | 3300026121 | Bacteria | 1500 |
| 372 | Ga0207683_10431800 | 3300026121 | Bacteria | 1214 |
| 373 | Ga0207683_11345374 | 3300026121 | Bacteria | 661 |
| 374 | Ga0207698_10141674 | 3300026142 | Bacteria | 2072 |
| 375 | Ga0265319_1027334 | 3300028563 | Bacteria | 2025 |
| 376 | Ga0265318_10001995 | 3300028577 | Bacteria | 11325 |
| 377 | Ga0265320_10013534 | 3300031240 | Bacteria | 4689 |
| 378 | Ga0307415_101649232 | 3300032126 | Bacteria | 617 |
| 379 | Ga0307415_101750526 | 3300032126 | Bacteria | 600 |
| 380 | Ga0373930_0021512 | 3300034816 | Bacteria | 1268 |
| 381 | Ga0373948_0025382 | 3300034817 | Bacteria | 1162 |
| 382 | Ga0373958_0031139 | 3300034819 | Bacteria | 1047 |
| 383 | Ga0373958_0063671 | 3300034819 | Unclassified | 804 |
| 384 | Ga0373959_0003704 | 3300034820 | Bacteria | 2445 |
| 385 | Ga0373938_0051971 | 3300034957 | Bacteria | 938 |
| 386 | Ga0373938_0099726 | 3300034957 | Bacteria | 728 |
| 387 | Ga0373928_0036020 | 3300035084 | Bacteria | 1117 |
| 388 | Ga0373929_0017279 | 3300035085 | Bacteria | 1422 |
| 389 | Ga0373929_0053251 | 3300035085 | Bacteria | 930 |
| 390 | Ga0373929_0104294 | 3300035085 | Bacteria | 718 |
| 391 | Ga0373934_0214641 | 3300035086 | Unclassified | 793 |
| 392 | Ga0373940_0004754 | 3300035088 | Bacteria | 2893 |
| 393 | Ga0373940_0103942 | 3300035088 | Bacteria | 865 |
| 394 | Ga0373940_0173710 | 3300035088 | Bacteria | 697 |
| 395 | Ga0373949_0004330 | 3300035090 | Bacteria | 3259 |
| 396 | Ga0373951_0024277 | 3300035091 | Bacteria | 1404 |
| 397 | Ga0373951_0039012 | 3300035091 | Bacteria | 1140 |
| 398 | Ga0373951_0177453 | 3300035091 | Unclassified | 610 |
| 399 | Ga0373952_0008815 | 3300035092 | Bacteria | 1919 |
| 400 | Ga0373952_0041755 | 3300035092 | Bacteria | 1062 |
| 401 | Ga0373932_0404758 | 3300035112 | Bacteria | 528 |
| 402 | Ga0373936_0036090 | 3300035113 | Bacteria | 1970 |
| 403 | Ga0373939_0116077 | 3300035114 | Bacteria | 938 |
| 404 | Ga0373939_0177434 | 3300035114 | Bacteria | 792 |
| 405 | Ga0373941_0095468 | 3300035115 | Bacteria | 1027 |
| 406 | Ga0373941_0311637 | 3300035115 | Bacteria | 631 |
| 407 | Ga0373941_0330330 | 3300035115 | Bacteria | 615 |
| 408 | Ga0373945_0055367 | 3300035116 | Bacteria | 1468 |
| 409 | Ga0373954_0617612 | 3300035118 | Unclassified | 537 |
| 410 | Ga0373956_0033447 | 3300035119 | Bacteria | 2261 |
| 411 | Ga0373956_0090986 | 3300035119 | Bacteria | 1408 |
| 412 | Ga0373960_0072793 | 3300035121 | Bacteria | 1066 |
| 413 | Ga0373943_0005843 | 3300035170 | Bacteria | 5527 |
| 414 | Ga0373943_0123758 | 3300035170 | Bacteria | 1377 |
| 415 | Ga0373943_0729239 | 3300035170 | Bacteria | 588 |
| 416 | Ga0373946_0002458 | 3300035171 | Bacteria | 6553 |
| 417 | Ga0373955_0259162 | 3300035172 | Bacteria | 1044 |
| 418 | Ga0373955_0471770 | 3300035172 | Bacteria | 766 |
| 419 | Ga0373942_0012904 | 3300035207 | Unclassified | 2002 |
| 420 | Ga0373942_0029097 | 3300035207 | Bacteria | 1448 |
| 421 | Ga0373961_0043474 | 3300035241 | Bacteria | 1307 |
| 422 | Ga0373961_0078683 | 3300035241 | Bacteria | 1033 |
| 423 | Ga0373962_0009635 | 3300035242 | Bacteria | 2397 |
| 424 | Ga0373924_0046113 | 3300035410 | Bacteria | 1795 |
| 425 | Ga0373924_0326725 | 3300035410 | Bacteria | 682 |
| 426 | Ga0373931_0006947 | 3300035691 | Bacteria | 5325 |
| 427 | Ga0373931_0161360 | 3300035691 | Archaea | 1314 |
| 428 | Ga0373931_0545981 | 3300035691 | Bacteria | 752 |
| 429 | Ga0373927_0055210 | 3300035695 | Bacteria | 2569 |
| 430 | Ga0373947_0036579 | 3300035725 | Bacteria | 2911 |
| 431 | Ga0373947_0383810 | 3300035725 | Bacteria | 946 |
| 432 | Ga0373937_0075216 | 3300036401 | Bacteria | 3117 |
| 433 | Ga0373937_0178437 | 3300036401 | Bacteria | 1994 |
| 434 | Ga0373925_0006100 | 3300037068 | Bacteria | 8913 |
| 435 | Ga0373925_0916674 | 3300037068 | Bacteria | 722 |
| 436 | Ga0395899_0056460 | 3300037312 | Bacteria | 2902 |
| 437 | Ga0395900_0031866 | 3300037418 | Bacteria | 5419 |
| 438 | Ga0395900_0096250 | 3300037418 | Bacteria | 3041 |
| 439 | Ga0395900_0191997 | 3300037418 | Unclassified | 2071 |
| 440 | Ga0395900_1400769 | 3300037418 | Unclassified | 612 |
| 441 | Ga0395898_0018384 | 3300037466 | Bacteria | 7128 |
| 442 | Ga0395898_0076680 | 3300037466 | Unclassified | 3227 |
| 443 | Ga0395898_0098542 | 3300037466 | Bacteria | 2807 |
| 444 | Ga0395898_0847201 | 3300037466 | Bacteria | 853 |
| 445 | Ga0395898_1734233 | 3300037466 | Unclassified | 547 |
| 446 | Ga0395905_0965536 | 3300037471 | Unclassified | 755 |
| 447 | Ga0395901_0093576 | 3300038443 | Bacteria | 3147 |
| 448 | Ga0395901_0388442 | 3300038443 | Unclassified | 1435 |
| 449 | Ga0395901_0435612 | 3300038443 | Bacteria | 1342 |
| 450 | Ga0395901_0786448 | 3300038443 | Unclassified | 942 |
| 451 | Ga0395901_1184889 | 3300038443 | Bacteria | 730 |
| 452 | Ga0395901_1480051 | 3300038443 | Bacteria | 635 |
| 453 | Ga0395901_1709782 | 3300038443 | Bacteria | 580 |
| 454 | Ga0242420_002859 | 3300038996 | Bacteria | 2503 |
| 455 | Ga0436365_1018822 | 3300039437 | Bacteria | 588 |
| 456 | Ga0436365_1845339 | 3300039437 | Bacteria | 5851 |
| 457 | Ga0436363_1297307 | 3300039450 | Bacteria | 502 |
| 458 | Ga0451789_0159463 | 3300041443 | Bacteria | 1504 |
| 459 | Ga0451789_1117892 | 3300041443 | Bacteria | 903 |
| 460 | Ga0451791_1441736 | 3300041451 | Bacteria | 775 |
| 461 | Ga0451793_0781476 | 3300041452 | Unclassified | 1501 |
| 462 | Ga0451797_0905678 | 3300041453 | Bacteria | 864 |
| 463 | Ga0451795_0206216 | 3300041456 | Bacteria | 657 |
| 464 | Ga0451800_0832588 | 3300041459 | Unclassified | 668 |
| 465 | Ga0451802_1519977 | 3300041460 | Unclassified | 904 |
| 466 | Ga0451807_1684640 | 3300041486 | Bacteria | 702 |
| 467 | Ga0451807_2631029 | 3300041486 | Bacteria | 572 |
| 468 | Ga0451833_0907646 | 3300041491 | Bacteria | 745 |
| 469 | Ga0451835_0165989 | 3300041492 | Bacteria | 4794 |
| 470 | Ga0451841_0441814 | 3300041498 | Bacteria | 693 |
| 471 | Ga0451845_0518208 | 3300041501 | Unclassified | 618 |
| 472 | Ga0451849_0440083 | 3300041505 | Bacteria | 1636 |
| 473 | Ga0451851_0760096 | 3300041507 | Bacteria | 721 |
| 474 | Ga0451843_1243594 | 3300041509 | Bacteria | 519 |
| 475 | Ga0451855_0567418 | 3300041511 | Bacteria | 1063 |
| 476 | Ga0451853_1729694 | 3300041512 | Bacteria | 559 |
| 477 | Ga0451853_2873286 | 3300041512 | Bacteria | 761 |
| 478 | Ga0451853_3003812 | 3300041512 | Bacteria | 2246 |
| 479 | Ga0451577_0309935 | 3300042876 | Bacteria | 1431 |
| 480 | Ga0466969_0405906 | 3300044656 | Unclassified | 619 |
| 481 | Ga0466972_0020003 | 3300044658 | Bacteria | 3346 |
| 482 | Ga0466965_0028894 | 3300044683 | Bacteria | 2696 |
| 483 | Ga0466965_0242338 | 3300044683 | Unclassified | 965 |
| 484 | Ga0466965_0350879 | 3300044683 | Unclassified | 808 |
| 485 | Ga0466966_0374321 | 3300044684 | Bacteria | 856 |
| 486 | Ga0466961_0003702 | 3300044693 | Bacteria | 9550 |
| 487 | Ga0466961_0067970 | 3300044693 | Bacteria | 2263 |
| 488 | Ga0466961_0262753 | 3300044693 | Bacteria | 1058 |
| 489 | Ga0466961_0429827 | 3300044693 | Unclassified | 800 |
| 490 | Ga0466963_0001756 | 3300044694 | Bacteria | 11812 |
| 491 | Ga0466963_0002348 | 3300044694 | Bacteria | 10560 |
| 492 | Ga0466963_0004180 | 3300044694 | Bacteria | 8359 |
| 493 | Ga0466963_0007632 | 3300044694 | Bacteria | 6456 |
| 494 | Ga0466963_0018701 | 3300044694 | Bacteria | 4336 |
| 495 | Ga0466963_0026333 | 3300044694 | Bacteria | 3718 |
| 496 | Ga0466963_0031702 | 3300044694 | Bacteria | 3418 |
| 497 | Ga0466963_0069340 | 3300044694 | Bacteria | 2369 |
| 498 | Ga0466963_0233007 | 3300044694 | Bacteria | 1290 |
| 499 | Ga0466963_0271007 | 3300044694 | Bacteria | 1192 |
| 500 | Ga0466963_0552366 | 3300044694 | Unclassified | 813 |
| 501 | Ga0466963_1218601 | 3300044694 | Bacteria | 529 |
| 502 | Ga0466964_0000525 | 3300044706 | Bacteria | 11988 |
| 503 | Ga0466964_0000994 | 3300044706 | Bacteria | 9415 |
| 504 | Ga0466964_0003775 | 3300044706 | Bacteria | 5556 |
| 505 | Ga0466964_0007993 | 3300044706 | Bacteria | 3962 |
| 506 | Ga0466964_0035399 | 3300044706 | Bacteria | 1996 |
| 507 | Ga0466964_0062339 | 3300044706 | Bacteria | 1554 |
| 508 | Ga0466964_0142702 | 3300044706 | Bacteria | 1102 |
| 509 | Ga0466964_0151060 | 3300044706 | Unclassified | 1077 |
| 510 | Ga0466964_0200068 | 3300044706 | Unclassified | 958 |
| 511 | Ga0466964_0357933 | 3300044706 | Unclassified | 752 |
| 512 | Ga0466964_0391649 | 3300044706 | Unclassified | 724 |
| 513 | Ga0466964_0589041 | 3300044706 | Bacteria | 608 |
| 514 | Ga0466964_0906258 | 3300044706 | Bacteria | 505 |
| 515 | Ga0453684_1283265 | 3300044712 | Unclassified | 765 |
| 516 | Ga0466971_0009819 | 3300044719 | Bacteria | 4178 |
| 517 | Ga0466971_0010438 | 3300044719 | Bacteria | 4059 |
| 518 | Ga0466971_0013818 | 3300044719 | Bacteria | 3550 |
| 519 | Ga0466971_0044520 | 3300044719 | Bacteria | 1993 |
| 520 | Ga0466971_0053962 | 3300044719 | Bacteria | 1811 |
| 521 | Ga0466971_0289294 | 3300044719 | Unclassified | 785 |
| 522 | Ga0466971_0339332 | 3300044719 | Unclassified | 726 |
| 523 | Ga0466968_0005265 | 3300044735 | Bacteria | 4847 |
| 524 | Ga0466968_0015234 | 3300044735 | Bacteria | 3045 |
| 525 | Ga0466968_0018597 | 3300044735 | Bacteria | 2789 |
| 526 | Ga0466968_0051499 | 3300044735 | Bacteria | 1759 |
| 527 | Ga0466968_0084377 | 3300044735 | Unclassified | 1400 |
| 528 | Ga0466968_0086357 | 3300044735 | Bacteria | 1385 |
| 529 | Ga0466968_0121384 | 3300044735 | Bacteria | 1182 |
| 530 | Ga0466968_0139114 | 3300044735 | Unclassified | 1109 |
| 531 | Ga0466970_0005859 | 3300044765 | Bacteria | 6117 |
| 532 | Ga0466970_0073473 | 3300044765 | Bacteria | 1840 |
| 533 | Ga0466970_0362458 | 3300044765 | Unclassified | 823 |
| 534 | Ga0466970_0721513 | 3300044765 | Bacteria | 582 |
| 535 | Ga0466957_0004828 | 3300044842 | Bacteria | 7544 |
| 536 | Ga0466957_0005555 | 3300044842 | Bacteria | 7084 |
| 537 | Ga0466957_0006047 | 3300044842 | Bacteria | 6832 |
| 538 | Ga0466957_0011889 | 3300044842 | Bacteria | 5030 |
| 539 | Ga0466957_0018095 | 3300044842 | Bacteria | 4133 |
| 540 | Ga0466957_0275044 | 3300044842 | Bacteria | 1125 |
| 541 | Ga0466960_0004688 | 3300044901 | Bacteria | 5364 |
| 542 | Ga0466960_0008077 | 3300044901 | Bacteria | 4299 |
| 543 | Ga0466960_0033551 | 3300044901 | Bacteria | 2386 |
| 544 | Ga0466960_0116432 | 3300044901 | Bacteria | 1395 |
| 545 | Ga0466960_0272312 | 3300044901 | Bacteria | 946 |
| 546 | Ga0466960_0446303 | 3300044901 | Bacteria | 751 |
| 547 | Ga0466960_0454608 | 3300044901 | Unclassified | 745 |
| 548 | Ga0466960_0538166 | 3300044901 | Archaea | 688 |
| 549 | Ga0466959_0015897 | 3300045049 | Bacteria | 5491 |
| 550 | Ga0466959_0050596 | 3300045049 | Bacteria | 3050 |
| 551 | Ga0466959_0965040 | 3300045049 | Bacteria | 568 |
| 552 | Ga0466959_1054889 | 3300045049 | Bacteria | 541 |
| 553 | Ga0466959_1199626 | 3300045049 | Bacteria | 504 |
| 554 | Ga0466958_0002929 | 3300045836 | Bacteria | 8722 |
| 555 | Ga0466958_0005412 | 3300045836 | Bacteria | 6865 |
| 556 | Ga0466958_0011296 | 3300045836 | Bacteria | 5027 |
| 557 | Ga0466958_0028435 | 3300045836 | Bacteria | 3315 |
| 558 | Ga0466958_0048129 | 3300045836 | Bacteria | 2575 |
| 559 | Ga0466958_0056669 | 3300045836 | Bacteria | 2381 |
| 560 | Ga0466958_0067979 | 3300045836 | Unclassified | 2177 |
| 561 | Ga0466958_0110521 | 3300045836 | Unclassified | 1715 |
| 562 | Ga0466958_0158993 | 3300045836 | Bacteria | 1427 |
| 563 | Ga0466958_0459343 | 3300045836 | Unclassified | 825 |
| 564 | Ga0466958_0555924 | 3300045836 | Unclassified | 746 |
| 565 | Ga0466967_0000181 | 3300045976 | Bacteria | 26132 |
| 566 | Ga0466967_0001859 | 3300045976 | Bacteria | 12719 |
| 567 | Ga0466967_0002422 | 3300045976 | Bacteria | 11597 |
| 568 | Ga0466967_0005491 | 3300045976 | Bacteria | 8794 |
| 569 | Ga0466967_0014686 | 3300045976 | Bacteria | 6113 |
| 570 | Ga0466967_0068114 | 3300045976 | Bacteria | 3177 |
| 571 | Ga0466967_0074393 | 3300045976 | Bacteria | 3051 |
| 572 | Ga0466967_0088637 | 3300045976 | Bacteria | 2808 |
| 573 | Ga0466967_0100386 | 3300045976 | Unclassified | 2644 |
| 574 | Ga0466967_0126866 | 3300045976 | Bacteria | 2364 |
| 575 | Ga0466967_0139453 | 3300045976 | Unclassified | 2257 |
| 576 | Ga0466967_0165741 | 3300045976 | Bacteria | 2076 |
| 577 | Ga0466967_0196692 | 3300045976 | Bacteria | 1907 |
| 578 | Ga0466967_0267007 | 3300045976 | Bacteria | 1638 |
| 579 | Ga0466967_0485760 | 3300045976 | Bacteria | 1210 |
| 580 | Ga0466967_0500806 | 3300045976 | Bacteria | 1192 |
| 581 | Ga0466967_0798986 | 3300045976 | Unclassified | 937 |
| 582 | Ga0466967_0850685 | 3300045976 | Bacteria | 906 |
| 583 | Ga0466967_0881700 | 3300045976 | Bacteria | 889 |
| 584 | Ga0466967_2023598 | 3300045976 | Unclassified | 572 |
| 585 | Ga0495592_0142320 | 3300046454 | Bacteria | 1667 |
| 586 | Ga0495592_0204372 | 3300046454 | Bacteria | 1331 |
| 587 | Ga0495592_0253078 | 3300046454 | Unclassified | 1163 |
| 588 | Ga0495592_0692054 | 3300046454 | Unclassified | 614 |
| 589 | Ga0495592_0839267 | 3300046454 | Bacteria | 543 |
| 590 | Ga0495590_0198758 | 3300046457 | Unclassified | 736 |
| 591 | Ga0495629_0011930 | 3300046459 | Bacteria | 6301 |
| 592 | Ga0495629_0026893 | 3300046459 | Bacteria | 4086 |
| 593 | Ga0495629_0031988 | 3300046459 | Bacteria | 3725 |
| 594 | Ga0495629_0111558 | 3300046459 | Bacteria | 1906 |
| 595 | Ga0495629_0659676 | 3300046459 | Bacteria | 697 |
| 596 | Ga0495641_0008161 | 3300046461 | Bacteria | 6429 |
| 597 | Ga0495641_0059726 | 3300046461 | Bacteria | 1723 |
| 598 | Ga0495641_0074057 | 3300046461 | Bacteria | 1527 |
| 599 | Ga0495651_0005362 | 3300046462 | Bacteria | 9784 |
| 600 | Ga0495651_0007784 | 3300046462 | Bacteria | 8197 |
| 601 | Ga0495651_0558334 | 3300046462 | Unclassified | 726 |
| 602 | Ga0495651_0648826 | 3300046462 | Bacteria | 662 |
| 603 | Ga0495651_0901980 | 3300046462 | Unclassified | 540 |
| 604 | Ga0495653_0001446 | 3300046463 | Bacteria | 18517 |
| 605 | Ga0495653_0052854 | 3300046463 | Bacteria | 3112 |
| 606 | Ga0495653_0054981 | 3300046463 | Unclassified | 3039 |
| 607 | Ga0495653_0063153 | 3300046463 | Bacteria | 2796 |
| 608 | Ga0495653_0144133 | 3300046463 | Bacteria | 1672 |
| 609 | Ga0495580_0147855 | 3300046472 | Bacteria | 1628 |
| 610 | Ga0495582_0009318 | 3300046473 | Bacteria | 5413 |
| 611 | Ga0495582_0020875 | 3300046473 | Bacteria | 3587 |
| 612 | Ga0495582_0050252 | 3300046473 | Bacteria | 2297 |
| 613 | Ga0495582_0364114 | 3300046473 | Bacteria | 833 |
| 614 | Ga0495582_0481022 | 3300046473 | Bacteria | 717 |
| 615 | Ga0495605_0126527 | 3300046474 | Unclassified | 1155 |
| 616 | Ga0495639_0002011 | 3300046475 | Bacteria | 9004 |
| 617 | Ga0495662_0016039 | 3300046476 | Bacteria | 3634 |
| 618 | Ga0495664_0004565 | 3300046477 | Bacteria | 7575 |
| 619 | Ga0495664_0024751 | 3300046477 | Bacteria | 3490 |
| 620 | Ga0495664_0107746 | 3300046477 | Unclassified | 1681 |
| 621 | Ga0495664_0178884 | 3300046477 | Bacteria | 1286 |
| 622 | Ga0495584_0050121 | 3300046491 | Bacteria | 2103 |
| 623 | Ga0495584_0439128 | 3300046491 | Bacteria | 664 |
| 624 | Ga0495585_0525145 | 3300046492 | Bacteria | 561 |
| 625 | Ga0495594_0112040 | 3300046499 | Bacteria | 1539 |
| 626 | Ga0495596_0110804 | 3300046500 | Bacteria | 1066 |
| 627 | Ga0495596_0119946 | 3300046500 | Unclassified | 1021 |
| 628 | Ga0495596_0146307 | 3300046500 | Unclassified | 918 |
| 629 | Ga0495607_0046837 | 3300046501 | Bacteria | 2536 |
| 630 | Ga0495583_0355368 | 3300046506 | Unclassified | 578 |
| 631 | Ga0495608_0011699 | 3300046511 | Bacteria | 6104 |
| 632 | Ga0495608_0014294 | 3300046511 | Bacteria | 5508 |
| 633 | Ga0495608_0155900 | 3300046511 | Bacteria | 1453 |
| 634 | Ga0495608_0800884 | 3300046511 | Unclassified | 556 |
| 635 | Ga0495618_0110230 | 3300046514 | Bacteria | 1762 |
| 636 | Ga0495618_0245073 | 3300046514 | Bacteria | 1125 |
| 637 | Ga0495618_0372328 | 3300046514 | Bacteria | 877 |
| 638 | Ga0495618_0642978 | 3300046514 | Unclassified | 628 |
| 639 | Ga0495628_0001531 | 3300046516 | Bacteria | 21192 |
| 640 | Ga0495628_0032089 | 3300046516 | Bacteria | 4243 |
| 641 | Ga0495628_0071674 | 3300046516 | Bacteria | 2700 |
| 642 | Ga0495628_0092481 | 3300046516 | Bacteria | 2339 |
| 643 | Ga0495628_0944865 | 3300046516 | Unclassified | 596 |
| 644 | Ga0495630_0015365 | 3300046517 | Bacteria | 5590 |
| 645 | Ga0495630_0080472 | 3300046517 | Bacteria | 2457 |
| 646 | Ga0495630_0309480 | 3300046517 | Bacteria | 1207 |
| 647 | Ga0495630_1374556 | 3300046517 | Unclassified | 531 |
| 648 | Ga0495631_0135491 | 3300046518 | Bacteria | 1058 |
| 649 | Ga0495631_0437154 | 3300046518 | Unclassified | 557 |
| 650 | Ga0495644_0098219 | 3300046523 | Bacteria | 1107 |
| 651 | Ga0495644_0249709 | 3300046523 | Unclassified | 689 |
| 652 | Ga0495663_0082304 | 3300046525 | Bacteria | 1038 |
| 653 | Ga0495666_0003040 | 3300046526 | Bacteria | 8427 |
| 654 | Ga0495642_0037906 | 3300046528 | Bacteria | 1952 |
| 655 | Ga0495642_0333795 | 3300046528 | Bacteria | 666 |
| 656 | Ga0495652_0003999 | 3300046529 | Bacteria | 14269 |
| 657 | Ga0495652_0088795 | 3300046529 | Bacteria | 2532 |
| 658 | Ga0495652_0090487 | 3300046529 | Bacteria | 2503 |
| 659 | Ga0495652_0286228 | 3300046529 | Unclassified | 1204 |
| 660 | Ga0495652_0433587 | 3300046529 | Bacteria | 923 |
| 661 | Ga0495665_0030875 | 3300046531 | Bacteria | 2866 |
| 662 | Ga0495665_0613114 | 3300046531 | Unclassified | 543 |
| 663 | Ga0495640_0075987 | 3300046533 | Bacteria | 2242 |
| 664 | Ga0495640_0083107 | 3300046533 | Unclassified | 2125 |
| 665 | Ga0495640_0123539 | 3300046533 | Bacteria | 1680 |
| 666 | Ga0495640_0768448 | 3300046533 | Unclassified | 575 |
| 667 | Ga0495586_0038808 | 3300046535 | Bacteria | 2559 |
| 668 | Ga0495586_0096027 | 3300046535 | Unclassified | 1641 |
| 669 | Ga0495586_0127639 | 3300046535 | Unclassified | 1423 |
| 670 | Ga0495587_0281180 | 3300046536 | Unclassified | 932 |
| 671 | Ga0495587_0394234 | 3300046536 | Bacteria | 769 |
| 672 | Ga0495587_0591590 | 3300046536 | Unclassified | 611 |
| 673 | Ga0495598_0143526 | 3300046537 | Unclassified | 828 |
| 674 | Ga0495645_0029925 | 3300046543 | Bacteria | 3966 |
| 675 | Ga0495645_0034488 | 3300046543 | Bacteria | 3692 |
| 676 | Ga0495645_0037053 | 3300046543 | Bacteria | 3554 |
| 677 | Ga0495667_0012490 | 3300046559 | Bacteria | 5760 |
| 678 | Ga0495667_0049992 | 3300046559 | Bacteria | 2760 |
| 679 | Ga0495667_0073119 | 3300046559 | Unclassified | 2234 |
| 680 | Ga0495667_0396105 | 3300046559 | Unclassified | 870 |
| 681 | Ga0495656_0045428 | 3300046615 | Unclassified | 1854 |
| 682 | Ga0495634_0006777 | 3300046642 | Bacteria | 8677 |
| 683 | Ga0495634_0289678 | 3300046642 | Unclassified | 992 |
| 684 | Ga0495635_0012714 | 3300046663 | Bacteria | 5902 |
| 685 | Ga0495635_0224062 | 3300046663 | Bacteria | 1271 |
| 686 | Ga0495659_0117797 | 3300046664 | Bacteria | 1043 |
| 687 | Ga0495661_0451214 | 3300046665 | Bacteria | 619 |
| 688 | Ga0495588_0648942 | 3300046674 | Bacteria | 552 |
| 689 | Ga0495657_0015624 | 3300046675 | Bacteria | 5549 |
| 690 | Ga0495657_0016463 | 3300046675 | Bacteria | 5387 |
| 691 | Ga0495657_0845270 | 3300046675 | Unclassified | 522 |
| 692 | Ga0495599_0013809 | 3300046678 | Bacteria | 4997 |
| 693 | Ga0495599_0022201 | 3300046678 | Unclassified | 3961 |
| 694 | Ga0495599_0026957 | 3300046678 | Bacteria | 3600 |
| 695 | Ga0495599_0297753 | 3300046678 | Bacteria | 974 |
| 696 | Ga0495599_0461926 | 3300046678 | Unclassified | 751 |
| 697 | Ga0495623_0086453 | 3300046679 | Unclassified | 1932 |
| 698 | Ga0495623_0162314 | 3300046679 | Unclassified | 1312 |
| 699 | Ga0495623_0609564 | 3300046679 | Unclassified | 566 |
| 700 | Ga0495646_0073315 | 3300046680 | Unclassified | 2011 |
| 701 | Ga0495646_0125332 | 3300046680 | Bacteria | 1450 |
| 702 | Ga0495646_0171106 | 3300046680 | Bacteria | 1197 |
| 703 | Ga0495646_0558876 | 3300046680 | Bacteria | 584 |
| 704 | Ga0495647_0005940 | 3300046681 | Bacteria | 4020 |
| 705 | Ga0495647_0033876 | 3300046681 | Unclassified | 1911 |
| 706 | Ga0495658_0121701 | 3300046683 | Bacteria | 1579 |
| 707 | Ga0495658_0152066 | 3300046683 | Unclassified | 1422 |
| 708 | Ga0495658_0189380 | 3300046683 | Unclassified | 1278 |
| 709 | Ga0495613_0012474 | 3300046689 | Bacteria | 6315 |
| 710 | Ga0495613_0016946 | 3300046689 | Bacteria | 5424 |
| 711 | Ga0495613_0025648 | 3300046689 | Bacteria | 4392 |
| 712 | Ga0495613_0087726 | 3300046689 | Bacteria | 2255 |
| 713 | Ga0495613_0143535 | 3300046689 | Unclassified | 1705 |
| 714 | Ga0495613_0942340 | 3300046689 | Bacteria | 557 |
| 715 | Ga0495624_0043468 | 3300046690 | Bacteria | 2866 |
| 716 | Ga0495624_0219882 | 3300046690 | Unclassified | 1152 |
| 717 | Ga0495624_0377594 | 3300046690 | Bacteria | 852 |
| 718 | Ga0495670_0476683 | 3300046691 | Unclassified | 677 |
| 719 | Ga0495589_0130359 | 3300046794 | Bacteria | 1208 |
| 720 | Ga0495589_0473804 | 3300046794 | Unclassified | 572 |
| 721 | Ga0495600_0020996 | 3300046809 | Bacteria | 4179 |
| 722 | Ga0495600_0065899 | 3300046809 | Bacteria | 2368 |
| 723 | Ga0495600_0282583 | 3300046809 | Bacteria | 1050 |
| 724 | Ga0495581_0011521 | 3300047315 | Bacteria | 5116 |
| 725 | Ga0495581_0022746 | 3300047315 | Bacteria | 3630 |
| 726 | Ga0495604_0000060 | 3300047317 | Bacteria | 95444 |
| 727 | Ga0495604_0195253 | 3300047317 | Bacteria | 1408 |
| 728 | Ga0495604_0277129 | 3300047317 | Bacteria | 1134 |
| 729 | Ga0495636_0102621 | 3300047318 | Bacteria | 1252 |
| 730 | Ga0495674_0009509 | 3300047319 | Bacteria | 9235 |
| 731 | Ga0495674_0227034 | 3300047319 | Bacteria | 1542 |
| 732 | Ga0495674_0270803 | 3300047319 | Unclassified | 1393 |
| 733 | Ga0495674_0369414 | 3300047319 | Unclassified | 1162 |
| 734 | Ga0495674_0507982 | 3300047319 | Unclassified | 963 |
| 735 | Ga0495676_0027116 | 3300047321 | Bacteria | 4918 |
| 736 | Ga0495676_0032895 | 3300047321 | Bacteria | 4372 |
| 737 | Ga0495676_0279535 | 3300047321 | Bacteria | 1131 |
| 738 | Ga0495676_0973631 | 3300047321 | Bacteria | 542 |
| 739 | Ga0495676_1075450 | 3300047321 | Unclassified | 512 |
| 740 | Ga0495680_0013289 | 3300047322 | Bacteria | 7190 |
| 741 | Ga0495680_0018573 | 3300047322 | Bacteria | 5895 |
| 742 | Ga0495680_0089265 | 3300047322 | Bacteria | 2314 |
| 743 | Ga0495680_0100989 | 3300047322 | Bacteria | 2149 |
| 744 | Ga0495680_0135198 | 3300047322 | Unclassified | 1808 |
| 745 | Ga0495680_0187741 | 3300047322 | Bacteria | 1488 |
| 746 | Ga0495680_0688347 | 3300047322 | Bacteria | 676 |
| 747 | Ga0495675_0000223 | 3300047444 | Bacteria | 41211 |
| 748 | Ga0495675_0205380 | 3300047444 | Bacteria | 1198 |
| 749 | Ga0495677_0071145 | 3300047445 | Unclassified | 1296 |
| 750 | Ga0495679_084482 | 3300047446 | Unclassified | 897 |
| 751 | Ga0495684_0005780 | 3300047471 | Bacteria | 9623 |
| 752 | Ga0495684_0115533 | 3300047471 | Bacteria | 2023 |
| 753 | Ga0495684_0160899 | 3300047471 | Bacteria | 1674 |
| 754 | Ga0495684_1022660 | 3300047471 | Unclassified | 523 |
| 755 | Ga0495593_0006797 | 3300047673 | Bacteria | 6694 |
| 756 | Ga0495593_0089320 | 3300047673 | Unclassified | 1588 |
| 757 | Ga0495593_0484960 | 3300047673 | Unclassified | 619 |
| 758 | Ga0495602_0020512 | 3300048088 | Bacteria | 6528 |
| 759 | Ga0495602_0047074 | 3300048088 | Bacteria | 3889 |
| 760 | Ga0495602_0291296 | 3300048088 | Bacteria | 1198 |
| 761 | Ga0495614_0006112 | 3300048089 | Bacteria | 5414 |
| 762 | Ga0496100_0002820 | 3300048903 | Bacteria | 8910 |
| 763 | Ga0496100_0004456 | 3300048903 | Bacteria | 7429 |
| 764 | Ga0496100_0078020 | 3300048903 | Unclassified | 2228 |
| 765 | Ga0496100_0136307 | 3300048903 | Bacteria | 1734 |
| 766 | Ga0496100_0161686 | 3300048903 | Unclassified | 1606 |
| 767 | Ga0496100_0271454 | 3300048903 | Bacteria | 1261 |
| 768 | Ga0496100_0514513 | 3300048903 | Bacteria | 923 |
| 769 | Ga0496100_1601417 | 3300048903 | Bacteria | 515 |
| 770 | Ga0496101_0015044 | 3300048904 | Bacteria | 5207 |
| 771 | Ga0496101_0051136 | 3300048904 | Bacteria | 2976 |
| 772 | Ga0496101_0096112 | 3300048904 | Bacteria | 2211 |
| 773 | Ga0496101_0129026 | 3300048904 | Unclassified | 1918 |
| 774 | Ga0496101_0139886 | 3300048904 | Bacteria | 1844 |
| 775 | Ga0496101_0143618 | 3300048904 | Bacteria | 1821 |
| 776 | Ga0496101_0227950 | 3300048904 | Unclassified | 1447 |
| 777 | Ga0496101_0244432 | 3300048904 | Bacteria | 1397 |
| 778 | Ga0496101_0293688 | 3300048904 | Bacteria | 1272 |
| 779 | Ga0496101_0443800 | 3300048904 | Bacteria | 1024 |
| 780 | Ga0496101_0623476 | 3300048904 | Bacteria | 852 |
| 781 | Ga0496101_1085193 | 3300048904 | Bacteria | 629 |
| 782 | Ga0496102_0008982 | 3300048905 | Bacteria | 8576 |
| 783 | Ga0496102_0012097 | 3300048905 | Bacteria | 7457 |
| 784 | Ga0496102_0024965 | 3300048905 | Bacteria | 5317 |
| 785 | Ga0496102_0049877 | 3300048905 | Bacteria | 3809 |
| 786 | Ga0496102_0194492 | 3300048905 | Bacteria | 1911 |
| 787 | Ga0496102_0372425 | 3300048905 | Bacteria | 1344 |
| 788 | Ga0496102_0615568 | 3300048905 | Bacteria | 1009 |
| 789 | Ga0496102_0937136 | 3300048905 | Bacteria | 787 |
| 790 | Ga0496102_1022933 | 3300048905 | Bacteria | 747 |
| 791 | Ga0496102_1368350 | 3300048905 | Unclassified | 627 |
| 792 | Ga0496102_1523581 | 3300048905 | Unclassified | 587 |
| 793 | Ga0496103_0002119 | 3300048906 | Bacteria | 12620 |
| 794 | Ga0496103_0013098 | 3300048906 | Bacteria | 4917 |
| 795 | Ga0496103_0040840 | 3300048906 | Bacteria | 2851 |
| 796 | Ga0496103_0050008 | 3300048906 | Bacteria | 2585 |
| 797 | Ga0496103_0112747 | 3300048906 | Bacteria | 1728 |
| 798 | Ga0496103_0559011 | 3300048906 | Bacteria | 730 |
| 799 | Ga0496104_0021508 | 3300048907 | Bacteria | 5923 |
| 800 | Ga0496104_0032912 | 3300048907 | Bacteria | 4826 |
| 801 | Ga0496104_0038794 | 3300048907 | Bacteria | 4458 |
| 802 | Ga0496104_0090158 | 3300048907 | Bacteria | 2929 |
| 803 | Ga0496104_0100962 | 3300048907 | Bacteria | 2762 |
| 804 | Ga0496104_0169631 | 3300048907 | Bacteria | 2092 |
| 805 | Ga0496104_0236253 | 3300048907 | Viruses | 1739 |
| 806 | Ga0496104_0318056 | 3300048907 | Bacteria | 1469 |
| 807 | Ga0496104_1236069 | 3300048907 | Bacteria | 650 |
| 808 | Ga0496104_1736124 | 3300048907 | Unclassified | 526 |
| 809 | Ga0496105_0001516 | 3300048908 | Bacteria | 16418 |
| 810 | Ga0496105_0008728 | 3300048908 | Bacteria | 7886 |
| 811 | Ga0496105_0009662 | 3300048908 | Bacteria | 7552 |
| 812 | Ga0496105_0015376 | 3300048908 | Bacteria | 6097 |
| 813 | Ga0496105_0019200 | 3300048908 | Bacteria | 5512 |
| 814 | Ga0496105_0032574 | 3300048908 | Bacteria | 4278 |
| 815 | Ga0496105_0099935 | 3300048908 | Unclassified | 2396 |
| 816 | Ga0496105_0216276 | 3300048908 | Bacteria | 1561 |
| 817 | Ga0496105_0622194 | 3300048908 | Bacteria | 836 |
| 818 | Ga0496105_1057259 | 3300048908 | Unclassified | 604 |
| 819 | Ga0496106_0031861 | 3300048909 | Bacteria | 3928 |
| 820 | Ga0496106_0041331 | 3300048909 | Unclassified | 3454 |
| 821 | Ga0496106_0053844 | 3300048909 | Bacteria | 3039 |
| 822 | Ga0496106_0055830 | 3300048909 | Bacteria | 2985 |
| 823 | Ga0496106_0177195 | 3300048909 | Bacteria | 1691 |
| 824 | Ga0496106_0267831 | 3300048909 | Bacteria | 1367 |
| 825 | Ga0496106_0476345 | 3300048909 | Bacteria | 1003 |
| 826 | Ga0496106_0547722 | 3300048909 | Bacteria | 928 |
| 827 | Ga0496106_0622730 | 3300048909 | Unclassified | 863 |
| 828 | Ga0496106_1109975 | 3300048909 | Bacteria | 619 |
| 829 | Ga0496107_0002386 | 3300048910 | Bacteria | 12155 |
| 830 | Ga0496107_0003768 | 3300048910 | Bacteria | 10180 |
| 831 | Ga0496107_0016421 | 3300048910 | Bacteria | 5198 |
| 832 | Ga0496107_0019539 | 3300048910 | Bacteria | 4779 |
| 833 | Ga0496107_0045975 | 3300048910 | Bacteria | 3141 |
| 834 | Ga0496107_0139903 | 3300048910 | Unclassified | 1789 |
| 835 | Ga0496107_0176372 | 3300048910 | Bacteria | 1587 |
| 836 | Ga0496107_0446732 | 3300048910 | Bacteria | 960 |
| 837 | Ga0496107_0626141 | 3300048910 | Bacteria | 794 |
| 838 | Ga0496107_0694458 | 3300048910 | Bacteria | 749 |
| 839 | Ga0496107_0727387 | 3300048910 | Bacteria | 729 |
| 840 | Ga0496108_0008962 | 3300048911 | Bacteria | 8109 |
| 841 | Ga0496108_0014661 | 3300048911 | Bacteria | 6399 |
| 842 | Ga0496108_0015917 | 3300048911 | Bacteria | 6130 |
| 843 | Ga0496108_0034844 | 3300048911 | Bacteria | 4182 |
| 844 | Ga0496108_0041551 | 3300048911 | Bacteria | 3839 |
| 845 | Ga0496108_0052324 | 3300048911 | Bacteria | 3421 |
| 846 | Ga0496108_0053838 | 3300048911 | Unclassified | 3376 |
| 847 | Ga0496108_0083652 | 3300048911 | Bacteria | 2707 |
| 848 | Ga0496108_0258229 | 3300048911 | Bacteria | 1516 |
| 849 | Ga0496108_0448331 | 3300048911 | Unclassified | 1127 |
| 850 | Ga0496108_0844095 | 3300048911 | Unclassified | 788 |
| 851 | Ga0496108_0847616 | 3300048911 | Bacteria | 787 |
| 852 | Ga0496108_1525656 | 3300048911 | Bacteria | 555 |
| 853 | Ga0496108_1696474 | 3300048911 | Bacteria | 520 |
| 854 | Ga0496109_0006089 | 3300048912 | Bacteria | 10134 |
| 855 | Ga0496109_0010728 | 3300048912 | Bacteria | 7841 |
| 856 | Ga0496109_0012997 | 3300048912 | Bacteria | 7198 |
| 857 | Ga0496109_0020867 | 3300048912 | Bacteria | 5790 |
| 858 | Ga0496109_0049713 | 3300048912 | Bacteria | 3818 |
| 859 | Ga0496109_0069300 | 3300048912 | Bacteria | 3234 |
| 860 | Ga0496109_0074935 | 3300048912 | Bacteria | 3111 |
| 861 | Ga0496109_0086712 | 3300048912 | Bacteria | 2891 |
| 862 | Ga0496109_0149958 | 3300048912 | Bacteria | 2183 |
| 863 | Ga0496109_0251573 | 3300048912 | Bacteria | 1664 |
| 864 | Ga0496109_0331274 | 3300048912 | Bacteria | 1437 |
| 865 | Ga0496109_0706720 | 3300048912 | Bacteria | 945 |
| 866 | Ga0496109_0877556 | 3300048912 | Bacteria | 835 |
| 867 | Ga0496109_1886229 | 3300048912 | Bacteria | 530 |
| 868 | Ga0496110_0007733 | 3300048913 | Bacteria | 8604 |
| 869 | Ga0496110_0014389 | 3300048913 | Bacteria | 6569 |
| 870 | Ga0496110_0021072 | 3300048913 | Bacteria | 5510 |
| 871 | Ga0496110_0039161 | 3300048913 | Bacteria | 4127 |
| 872 | Ga0496110_0067654 | 3300048913 | Bacteria | 3161 |
| 873 | Ga0496110_0169580 | 3300048913 | Bacteria | 1980 |
| 874 | Ga0496110_0177401 | 3300048913 | Unclassified | 1934 |
| 875 | Ga0496110_0285397 | 3300048913 | Bacteria | 1503 |
| 876 | Ga0496110_0464233 | 3300048913 | Unclassified | 1154 |
| 877 | Ga0496110_0513246 | 3300048913 | Bacteria | 1091 |
| 878 | Ga0496110_0830491 | 3300048913 | Unclassified | 829 |
| 879 | Ga0496110_1082597 | 3300048913 | Unclassified | 709 |
| 880 | Ga0496110_1328559 | 3300048913 | Unclassified | 628 |
| 881 | Ga0496111_0010559 | 3300048914 | Bacteria | 6202 |
| 882 | Ga0496111_0069679 | 3300048914 | Bacteria | 2557 |
| 883 | Ga0496111_0086020 | 3300048914 | Bacteria | 2300 |
| 884 | Ga0496111_0095115 | 3300048914 | Bacteria | 2186 |
| 885 | Ga0496111_0223026 | 3300048914 | Archaea | 1400 |
| 886 | Ga0496111_0300901 | 3300048914 | Bacteria | 1189 |
| 887 | Ga0496111_0388770 | 3300048914 | Unclassified | 1031 |
| 888 | Ga0496111_0390857 | 3300048914 | Bacteria | 1028 |
| 889 | Ga0496111_0620218 | 3300048914 | Unclassified | 791 |
| 890 | Ga0496111_0753400 | 3300048914 | Bacteria | 706 |
| 891 | Ga0496111_1255444 | 3300048914 | Bacteria | 523 |
| 892 | Ga0496112_0007227 | 3300048915 | Bacteria | 9842 |
| 893 | Ga0496112_0031071 | 3300048915 | Bacteria | 5175 |
| 894 | Ga0496112_0034432 | 3300048915 | Bacteria | 4929 |
| 895 | Ga0496112_0037934 | 3300048915 | Bacteria | 4705 |
| 896 | Ga0496112_0041755 | 3300048915 | Bacteria | 4488 |
| 897 | Ga0496112_0136716 | 3300048915 | Bacteria | 2421 |
| 898 | Ga0496112_0161655 | 3300048915 | Bacteria | 2206 |
| 899 | Ga0496112_0181535 | 3300048915 | Bacteria | 2068 |
| 900 | Ga0496112_0186188 | 3300048915 | Bacteria | 2039 |
| 901 | Ga0496112_0203401 | 3300048915 | Bacteria | 1939 |
| 902 | Ga0496112_0228266 | 3300048915 | Bacteria | 1817 |
| 903 | Ga0496112_0262322 | 3300048915 | Bacteria | 1677 |
| 904 | Ga0496112_0286451 | 3300048915 | Bacteria | 1594 |
| 905 | Ga0496112_0426039 | 3300048915 | Bacteria | 1265 |
| 906 | Ga0496112_0860740 | 3300048915 | Unclassified | 829 |
| 907 | Ga0496112_0907012 | 3300048915 | Bacteria | 803 |
| 908 | Ga0496112_0981746 | 3300048915 | Bacteria | 765 |
| 909 | Ga0496113_0008647 | 3300048916 | Bacteria | 6641 |
| 910 | Ga0496113_0049667 | 3300048916 | Bacteria | 3125 |
| 911 | Ga0496113_0061202 | 3300048916 | Bacteria | 2840 |
| 912 | Ga0496113_0105795 | 3300048916 | Archaea | 2185 |
| 913 | Ga0496113_0130371 | 3300048916 | Bacteria | 1972 |
| 914 | Ga0496113_0235086 | 3300048916 | Bacteria | 1462 |
| 915 | Ga0496113_0265690 | 3300048916 | Bacteria | 1371 |
| 916 | Ga0496113_0270368 | 3300048916 | Bacteria | 1358 |
| 917 | Ga0496113_0527660 | 3300048916 | Bacteria | 948 |
| 918 | Ga0496113_0600330 | 3300048916 | Bacteria | 881 |
| 919 | Ga0496113_0659924 | 3300048916 | Unclassified | 836 |
| 920 | Ga0496113_0683621 | 3300048916 | Archaea | 820 |
| 921 | Ga0496113_1111755 | 3300048916 | Bacteria | 619 |
| 922 | Ga0496113_1345939 | 3300048916 | Bacteria | 554 |
| 923 | Ga0496114_0008381 | 3300048917 | Bacteria | 8188 |
| 924 | Ga0496114_0011405 | 3300048917 | Bacteria | 7102 |
| 925 | Ga0496114_0043182 | 3300048917 | Bacteria | 3738 |
| 926 | Ga0496114_0047606 | 3300048917 | Bacteria | 3566 |
| 927 | Ga0496114_0083674 | 3300048917 | Bacteria | 2700 |
| 928 | Ga0496114_0306086 | 3300048917 | Bacteria | 1403 |
| 929 | Ga0496114_0956302 | 3300048917 | Bacteria | 739 |
| 930 | Ga0496114_1527086 | 3300048917 | Bacteria | 556 |
| 931 | Ga0496114_1555035 | 3300048917 | Bacteria | 549 |
| 932 | Ga0496115_0003191 | 3300048918 | Bacteria | 11773 |
| 933 | Ga0496115_0007836 | 3300048918 | Bacteria | 7874 |
| 934 | Ga0496115_0040293 | 3300048918 | Bacteria | 3713 |
| 935 | Ga0496115_0073791 | 3300048918 | Bacteria | 2770 |
| 936 | Ga0496115_0092557 | 3300048918 | Bacteria | 2471 |
| 937 | Ga0496115_0103772 | 3300048918 | Bacteria | 2333 |
| 938 | Ga0496115_0165741 | 3300048918 | Bacteria | 1827 |
| 939 | Ga0496115_0351269 | 3300048918 | Bacteria | 1202 |
| 940 | Ga0496115_0892101 | 3300048918 | Bacteria | 686 |
| 941 | Ga0501031_0000270 | 3300049568 | Bacteria | 29387 |
| 942 | Ga0501032_0001838 | 3300049569 | Bacteria | 16786 |
| 943 | Ga0501033_0206071 | 3300049570 | Unclassified | 1403 |
| 944 | Ga0501036_0015962 | 3300049572 | Bacteria | 6272 |
| 945 | Ga0501037_0043551 | 3300049573 | Bacteria | 3298 |
| 946 | Ga0501038_0003487 | 3300049574 | Bacteria | 14654 |
| 947 | Ga0501040_0028875 | 3300049576 | Bacteria | 3740 |
| 948 | Ga0501041_0004847 | 3300049577 | Bacteria | 7822 |
| 949 | Ga0501042_0003753 | 3300049578 | Bacteria | 9597 |
| 950 | Ga0501043_0012759 | 3300049579 | Bacteria | 6568 |
| 951 | Ga0501046_0008121 | 3300049580 | Bacteria | 9168 |
| 952 | Ga0501048_0650924 | 3300049582 | Bacteria | 756 |
| 953 | Ga0501067_0001546 | 3300049583 | Bacteria | 12552 |
| 954 | Ga0501067_0007583 | 3300049583 | Bacteria | 6031 |
| 955 | Ga0501067_0013188 | 3300049583 | Bacteria | 4576 |
| 956 | Ga0501067_0088494 | 3300049583 | Bacteria | 1719 |
| 957 | Ga0501067_0355374 | 3300049583 | Bacteria | 817 |
| 958 | Ga0501068_0081802 | 3300049584 | Bacteria | 1983 |
| 959 | Ga0501068_0271601 | 3300049584 | Bacteria | 1082 |
| 960 | Ga0501069_0004650 | 3300049585 | Bacteria | 7093 |
| 961 | Ga0501069_0012853 | 3300049585 | Bacteria | 4457 |
| 962 | Ga0501069_0024080 | 3300049585 | Bacteria | 3321 |
| 963 | Ga0501069_0492869 | 3300049585 | Bacteria | 731 |
| 964 | Ga0501069_0562839 | 3300049585 | Unclassified | 683 |
| 965 | Ga0501070_0001395 | 3300049586 | Bacteria | 21609 |
| 966 | Ga0501070_0297128 | 3300049586 | Bacteria | 1316 |
| 967 | Ga0501071_0273011 | 3300049587 | Bacteria | 1278 |
| 968 | Ga0501072_0601869 | 3300049588 | Unclassified | 866 |
| 969 | Ga0501073_0019252 | 3300049589 | Bacteria | 4931 |
| 970 | Ga0501074_0075052 | 3300049590 | Bacteria | 2427 |
| 971 | Ga0501075_0010586 | 3300049591 | Bacteria | 6486 |
| 972 | Ga0501076_0880144 | 3300049592 | Bacteria | 738 |
| 973 | Ga0501077_0023939 | 3300049593 | Bacteria | 3873 |
| 974 | Ga0501079_0032967 | 3300049741 | Bacteria | 3983 |
| 975 | Ga0501080_0003360 | 3300049742 | Bacteria | 14128 |
| 976 | Ga0501081_0186261 | 3300049743 | Bacteria | 1502 |
| 977 | Ga0501081_0406251 | 3300049743 | Unclassified | 1008 |
| 978 | Ga0501083_0022271 | 3300049744 | Bacteria | 4396 |
| 979 | Ga0501035_0132999 | 3300049822 | Bacteria | 2167 |
| 980 | Ga0501044_0057674 | 3300049823 | Bacteria | 3985 |
| 981 | Ga0501045_0041931 | 3300049824 | Bacteria | 3330 |
| 982 | nmdc:mga05p37_530737_c1 | 3300050507 | Bacteria | 1344 |
| 983 | nmdc:mga05p37_60368_c1 | 3300050507 | Bacteria | 4669 |
| 984 | nmdc:mga08y16_286263_c1 | 3300050511 | Unclassified | 1699 |
| 985 | nmdc:mga0n895_1252961_c1 | 3300050512 | Bacteria | 714 |
| 986 | nmdc:mga0n895_161716_c1 | 3300050512 | Unclassified | 2271 |
| 987 | nmdc:mga0n895_34358_c1 | 3300050512 | Bacteria | 4879 |
| 988 | nmdc:mga0rr50_110760_c1 | 3300050513 | Unclassified | 2172 |
| 989 | nmdc:mga0rr50_174756_c1 | 3300050513 | Bacteria | 1752 |
| 990 | nmdc:mga0rr50_67976_c1 | 3300050513 | Bacteria | 2709 |
| 991 | nmdc:mga08x19_31482_c1 | 3300050514 | Bacteria | 3337 |
| 992 | nmdc:mga08x19_45618_c1 | 3300050514 | Bacteria | 2801 |
| 993 | nmdc:mga08x19_69708_c1 | 3300050514 | Unclassified | 2290 |
| 994 | nmdc:mga0a205_141402_c1 | 3300050515 | Bacteria | 2307 |
| 995 | nmdc:mga0a205_1527627_c1 | 3300050515 | Bacteria | 516 |
| 996 | nmdc:mga0a205_399185_c1 | 3300050515 | Bacteria | 1239 |
| 997 | nmdc:mga0a205_79097_c1 | 3300050515 | Unclassified | 3177 |
| 998 | Ga0495601_0000328 | 3300053077 | Bacteria | 25250 |
| 999 | Ga0495601_0023115 | 3300053077 | Bacteria | 3818 |
| 1000 | Ga0495601_0029973 | 3300053077 | Bacteria | 3377 |
| 1001 | Ga0495601_0063649 | 3300053077 | Unclassified | 2344 |
| 1002 | Ga0495601_0117223 | 3300053077 | Bacteria | 1727 |
| 1003 | Ga0495601_0683715 | 3300053077 | Unclassified | 655 |
| 1004 | Ga0495612_0001001 | 3300053078 | Bacteria | 11620 |
| 1005 | Ga0495612_0044108 | 3300053078 | Bacteria | 1824 |
| 1006 | Ga0495612_0176808 | 3300053078 | Bacteria | 936 |
| 1007 | Ga0495612_0265210 | 3300053078 | Unclassified | 766 |
| 1008 | Ga0495595_0000605 | 3300053084 | Bacteria | 13662 |
| 1009 | Ga0495595_0002546 | 3300053084 | Bacteria | 7154 |
| 1010 | Ga0495595_0030743 | 3300053084 | Bacteria | 2410 |
| 1011 | Ga0495595_0322786 | 3300053084 | Unclassified | 777 |
| 1012 | Ga0495595_0450859 | 3300053084 | Bacteria | 654 |
| 1013 | Ga0495619_0010795 | 3300053085 | Bacteria | 5747 |
| 1014 | Ga0495619_0043958 | 3300053085 | Unclassified | 2930 |
| 1015 | Ga0495619_0136676 | 3300053085 | Unclassified | 1686 |
| 1016 | Ga0495619_0466820 | 3300053085 | Unclassified | 869 |
| 1017 | Ga0495619_0899512 | 3300053085 | Bacteria | 595 |
| 1018 | Ga0495619_1001298 | 3300053085 | Unclassified | 559 |
| 1019 | Ga0500566_0021035 | 3300053094 | Bacteria | 3837 |
| 1020 | Ga0501084_0522327 | 3300054114 | Bacteria | 1003 |
| 1021 | Ga0501082_0044936 | 3300060353 | Bacteria | 3810 |
| 1022 | Ga0501082_0125957 | 3300060353 | Bacteria | 2221 |
| 1023 | Ga0466962_0021516 | 3300061719 | Bacteria | 3097 |
| 1024 | Ga0466962_0023024 | 3300061719 | Bacteria | 2995 |
| 1025 | Ga0466962_0048012 | 3300061719 | Bacteria | 2040 |
| 1026 | Ga0466962_0051814 | 3300061719 | Bacteria | 1962 |
| 1027 | Ga0466962_0071584 | 3300061719 | Unclassified | 1656 |
| 1028 | Ga0466962_0355085 | 3300061719 | Unclassified | 730 |
| 1029 | Ga0530510_0003335 | 3300061734 | Bacteria | 11042 |
| 1030 | Ga0530510_0014416 | 3300061734 | Bacteria | 5573 |
| 1031 | Ga0530510_0016879 | 3300061734 | Bacteria | 5171 |
| 1032 | Ga0070714_100044987 | |||
| 1033 | JGI25406J46586_10074476 | |||
| 1034 | Ga0070683_100008714 | |||
| 1035 | Ga0068869_100302511 | |||
| 1036 | Ga0070680_100087689 | |||
| 1037 | Ga0070680_100739598 | |||
| 1038 | Ga0070682_100269657 | |||
| 1039 | Ga0070682_100374438 | |||
| 1040 | Ga0068868_100315759 | |||
| 1041 | Ga0068868_101040909 | |||
| 1042 | Ga0070660_100570096 | |||
| 1043 | Ga0070691_10529732 | |||
| 1044 | Ga0070661_100389653 | |||
| 1045 | Ga0070671_100329543 | |||
| 1046 | Ga0070671_101859887 | |||
| 1047 | Ga0070673_100267654 | |||
| 1048 | Ga0070703_10015069 | |||
| 1049 | Ga0070709_10009572 | |||
| 1050 | Ga0070709_10113405 | |||
| 1051 | Ga0070709_10128603 | |||
| 1052 | Ga0070714_100012637 | |||
| 1053 | Ga0070714_100014579 | |||
| 1054 | Ga0070714_100018152 | |||
| 1055 | Ga0070714_100022459 | |||
| 1056 | Ga0070714_100199748 | |||
| 1057 | Ga0070714_100568086 | |||
| 1058 | Ga0070714_100900862 | |||
| 1059 | Ga0070714_100994636 | |||
| 1060 | Ga0070714_101854181 | |||
| 1061 | Ga0070713_100029732 | |||
| 1062 | Ga0070713_100032857 | |||
| 1063 | Ga0070713_100338972 | |||
| 1064 | Ga0070710_10004975 | |||
| 1065 | Ga0070710_10087364 | |||
| 1066 | Ga0070710_10439895 | |||
| 1067 | Ga0070710_11244902 | |||
| 1068 | Ga0070701_10840617 | |||
| 1069 | Ga0070711_100016112 | |||
| 1070 | Ga0070711_100032237 | |||
| 1071 | Ga0070711_100059898 | |||
| 1072 | Ga0070711_100220361 | |||
| 1073 | Ga0070711_100340197 | |||
| 1074 | Ga0070711_100705779 | |||
| 1075 | Ga0070711_100835486 | |||
| 1076 | Ga0070705_100083751 | |||
| 1077 | Ga0070705_100835393 | |||
| 1078 | Ga0070694_100048418 | |||
| 1079 | Ga0070708_100032971 | |||
| 1080 | Ga0070708_100042208 | |||
| 1081 | Ga0070678_100166577 | |||
| 1082 | Ga0070678_100219891 | |||
| 1083 | Ga0070678_100293951 | |||
| 1084 | Ga0070681_10017759 | |||
| 1085 | Ga0070681_10189495 | |||
| 1086 | Ga0070681_10210796 | |||
| 1087 | Ga0070681_10806861 | |||
| 1088 | Ga0070681_11382352 | |||
| 1089 | Ga0070706_100200886 | |||
| 1090 | Ga0070707_100003292 | |||
| 1091 | Ga0070707_100030999 | |||
| 1092 | Ga0070707_100067645 | |||
| 1093 | Ga0070707_100130514 | |||
| 1094 | Ga0070707_100751057 | |||
| 1095 | Ga0070707_100807610 | |||
| 1096 | Ga0070698_100070724 | |||
| 1097 | Ga0070698_100092362 | |||
| 1098 | Ga0070698_100383148 | |||
| 1099 | Ga0070698_101927075 | |||
| 1100 | Ga0070699_100034221 | |||
| 1101 | Ga0070699_100852578 | |||
| 1102 | Ga0070679_100013498 | |||
| 1103 | Ga0070679_100029310 | |||
| 1104 | Ga0070679_100075691 | |||
| 1105 | Ga0070679_100192736 | |||
| 1106 | Ga0070679_100487634 | |||
| 1107 | Ga0070679_100618679 | |||
| 1108 | Ga0070684_100025832 | |||
| 1109 | Ga0070684_100113292 | |||
| 1110 | Ga0070684_101428742 | |||
| 1111 | Ga0070697_100121161 | |||
| 1112 | Ga0070697_100530871 | |||
| 1113 | Ga0070697_100637429 | |||
| 1114 | Ga0070697_101047273 | |||
| 1115 | Ga0068853_100839209 | |||
| 1116 | Ga0068853_101304260 | |||
| 1117 | Ga0070695_100029800 | |||
| 1118 | Ga0070695_100100925 | |||
| 1119 | Ga0070695_101600147 | |||
| 1120 | Ga0070696_100072644 | |||
| 1121 | Ga0070696_100103323 | |||
| 1122 | Ga0070696_100445056 | |||
| 1123 | Ga0070696_102002931 | |||
| 1124 | Ga0070693_100125958 | |||
| 1125 | Ga0070693_100286921 | |||
| 1126 | Ga0070665_101297338 | |||
| 1127 | Ga0070704_100016869 | |||
| 1128 | Ga0070704_100028271 | |||
| 1129 | Ga0070704_100813373 | |||
| 1130 | Ga0068855_100135143 | |||
| 1131 | Ga0068855_100903574 | |||
| 1132 | Ga0070664_101089030 | |||
| 1133 | Ga0068857_100650787 | |||
| 1134 | Ga0068856_100004254 | |||
| 1135 | Ga0068856_100050235 | |||
| 1136 | Ga0068856_100607405 | |||
| 1137 | Ga0068856_100760348 | |||
| 1138 | Ga0068856_101043901 | |||
| 1139 | Ga0070702_100043322 | |||
| 1140 | Ga0070702_100053062 | |||
| 1141 | Ga0070702_100121565 | |||
| 1142 | Ga0068852_100518844 | |||
| 1143 | Ga0068864_102421851 | |||
| 1144 | Ga0068851_11106993 | |||
| 1145 | Ga0068863_100392542 | |||
| 1146 | Ga0068863_100767560 | |||
| 1147 | Ga0068863_101217984 | |||
| 1148 | Ga0068862_102119068 | |||
| 1149 | Ga0081539_10039813 | |||
| 1150 | Ga0070717_10027339 | |||
| 1151 | Ga0070717_10027807 | |||
| 1152 | Ga0070717_10120582 | |||
| 1153 | Ga0070717_10678454 | |||
| 1154 | Ga0070717_11426899 | |||
| 1155 | Ga0070717_11504980 | |||
| 1156 | Ga0070717_11598868 | |||
| 1157 | Ga0070715_10002018 | |||
| 1158 | Ga0070715_10027774 | |||
| 1159 | Ga0070715_10088512 | |||
| 1160 | Ga0070715_10101030 | |||
| 1161 | Ga0070715_10121710 | |||
| 1162 | Ga0070716_100003623 | |||
| 1163 | Ga0070716_100034746 | |||
| 1164 | Ga0070716_100211802 | |||
| 1165 | Ga0070716_100568865 | |||
| 1166 | Ga0070716_100692776 | |||
| 1167 | Ga0070712_100015533 | |||
| 1168 | Ga0070712_100054694 | |||
| 1169 | Ga0070712_100106139 | |||
| 1170 | Ga0070712_100119231 | |||
| 1171 | Ga0070712_100149113 | |||
| 1172 | Ga0070712_100343895 | |||
| 1173 | Ga0070712_100499910 | |||
| 1174 | Ga0070712_101294266 | |||
| 1175 | Ga0097621_100161681 | |||
| 1176 | Ga0097621_100379597 | |||
| 1177 | Ga0097621_102046341 | |||
| 1178 | Ga0075434_100043444 | |||
| 1179 | Ga0075434_100133108 | |||
| 1180 | Ga0075436_100189029 | |||
| 1181 | Ga0075435_100715229 | |||
| 1182 | Ga0099795_10235061 | |||
| 1183 | Ga0105250_10411921 | |||
| 1184 | Ga0105240_10015125 | |||
| 1185 | Ga0105240_10134586 | |||
| 1186 | Ga0105240_10167588 | |||
| 1187 | Ga0111539_10195218 | |||
| 1188 | Ga0105245_10016693 | |||
| 1189 | Ga0105245_10183849 | |||
| 1190 | Ga0105245_10227907 | |||
| 1191 | Ga0105245_10431703 | |||
| 1192 | Ga0105245_10547207 | |||
| 1193 | Ga0105245_10824105 | |||
| 1194 | Ga0105245_11164001 | |||
| 1195 | Ga0105245_11912974 | |||
| 1196 | Ga0105245_12888960 | |||
| 1197 | Ga0105247_10058823 | |||
| 1198 | Ga0114129_10087988 | |||
| 1199 | Ga0114129_10604341 | |||
| 1200 | Ga0114129_11790497 | |||
| 1201 | Ga0105243_10374295 | |||
| 1202 | Ga0105241_10255032 | |||
| 1203 | Ga0105241_10772695 | |||
| 1204 | Ga0105241_12100560 | |||
| 1205 | Ga0105241_12517157 | |||
| 1206 | Ga0105242_10241211 | |||
| 1207 | Ga0105242_11098723 | |||
| 1208 | Ga0105242_11283619 | |||
| 1209 | Ga0105242_11324382 | |||
| 1210 | Ga0105242_11614090 | |||
| 1211 | Ga0105242_13218470 | |||
| 1212 | Ga0105248_10096239 | |||
| 1213 | Ga0105248_10504275 | |||
| 1214 | Ga0105248_12630977 | |||
| 1215 | Ga0105237_10012550 | |||
| 1216 | Ga0105237_10028267 | |||
| 1217 | Ga0105237_11199409 | |||
| 1218 | Ga0105238_10349967 | |||
| 1219 | Ga0105238_10369292 | |||
| 1220 | Ga0105249_10037672 | |||
| 1221 | Ga0099796_10350624 | |||
| 1222 | Ga0105239_10239298 | |||
| 1223 | Ga0105239_10403265 | |||
| 1224 | Ga0105239_11196110 | |||
| 1225 | Ga0105239_12392623 | |||
| 1226 | Ga0105239_12505340 | |||
| 1227 | Ga0105246_10035088 | |||
| 1228 | Ga0157373_10317508 | |||
| 1229 | Ga0157373_10326846 | |||
| 1230 | Ga0157371_11004614 | |||
| 1231 | Ga0157370_10041660 | |||
| 1232 | Ga0157370_10335150 | |||
| 1233 | Ga0157370_10420249 | |||
| 1234 | Ga0157370_10960531 | |||
| 1235 | Ga0157370_11754878 | |||
| 1236 | Ga0157369_10057047 | |||
| 1237 | Ga0157369_10223656 | |||
| 1238 | Ga0157369_10250603 | |||
| 1239 | Ga0157369_10725789 | |||
| 1240 | Ga0157369_11329175 | |||
| 1241 | Ga0157374_10219442 | |||
| 1242 | Ga0157374_10251991 | |||
| 1243 | Ga0157374_10589009 | |||
| 1244 | Ga0157374_11023029 | |||
| 1245 | Ga0157374_11408182 | |||
| 1246 | Ga0157374_12867765 | |||
| 1247 | Ga0157378_10154640 | |||
| 1248 | Ga0157378_10713374 | |||
| 1249 | Ga0163162_10340282 | |||
| 1250 | Ga0157372_10027075 | |||
| 1251 | Ga0157372_10209493 | |||
| 1252 | Ga0157372_10271712 | |||
| 1253 | Ga0157372_10851579 | |||
| 1254 | Ga0157372_11159453 | |||
| 1255 | Ga0157372_12855581 | |||
| 1256 | Ga0157375_10160165 | |||
| 1257 | Ga0157375_11635309 | |||
| 1258 | Ga0157375_11801722 | |||
| 1259 | Ga0157375_11988140 | |||
| 1260 | Ga0163163_10585244 | |||
| 1261 | Ga0163163_11798295 | |||
| 1262 | Ga0182008_10049929 | |||
| 1263 | Ga0157377_10563426 | |||
| 1264 | Ga0157376_10014957 | |||
| 1265 | Ga0157376_10651172 | |||
| 1266 | Ga0157376_11682950 | |||
| 1267 | Ga0157376_11879242 | |||
| 1268 | Ga0197907_10854251 | |||
| 1269 | Ga0206356_10209225 | |||
| 1270 | Ga0206356_10929994 | |||
| 1271 | Ga0206356_10977224 | |||
| 1272 | Ga0206350_11514786 | |||
| 1273 | Ga0206354_10859821 | |||
| 1274 | Ga0206354_11318015 | |||
| 1275 | Ga0206354_11338473 | |||
| 1276 | Ga0206353_10588232 | |||
| 1277 | Ga0206353_10632433 | |||
| 1278 | Ga0206353_11523787 | |||
| 1279 | Ga0224712_10203731 | |||
| 1280 | Ga0224712_10593113 | |||
| 1281 | Ga0207692_10007655 | |||
| 1282 | Ga0207692_10035063 | |||
| 1283 | Ga0207692_10072795 | |||
| 1284 | Ga0207692_10276641 | |||
| 1285 | Ga0207692_10378547 | |||
| 1286 | Ga0207710_10057191 | |||
| 1287 | Ga0207680_10159651 | |||
| 1288 | Ga0207685_10026097 | |||
| 1289 | Ga0207685_10097114 | |||
| 1290 | Ga0207699_10006811 | |||
| 1291 | Ga0207699_10021993 | |||
| 1292 | Ga0207699_10024515 | |||
| 1293 | Ga0207699_10407059 | |||
| 1294 | Ga0207684_10106127 | |||
| 1295 | Ga0207684_10287828 | |||
| 1296 | Ga0207654_10373898 | |||
| 1297 | Ga0207654_10471296 | |||
| 1298 | Ga0207707_10013971 | |||
| 1299 | Ga0207707_10073428 | |||
| 1300 | Ga0207707_10086553 | |||
| 1301 | Ga0207707_10452391 | |||
| 1302 | Ga0207707_10604065 | |||
| 1303 | Ga0207707_11510962 | |||
| 1304 | Ga0207695_10201378 | |||
| 1305 | Ga0207693_10002044 | |||
| 1306 | Ga0207693_10002632 | |||
| 1307 | Ga0207693_10002681 | |||
| 1308 | Ga0207693_10009259 | |||
| 1309 | Ga0207693_10019134 | |||
| 1310 | Ga0207693_10035288 | |||
| 1311 | Ga0207693_10081175 | |||
| 1312 | Ga0207693_10330786 | |||
| 1313 | Ga0207693_10397242 | |||
| 1314 | Ga0207693_11083133 | |||
| 1315 | Ga0207663_10000508 | |||
| 1316 | Ga0207663_10032689 | |||
| 1317 | Ga0207663_10077201 | |||
| 1318 | Ga0207663_10087540 | |||
| 1319 | Ga0207663_10099076 | |||
| 1320 | Ga0207663_10101709 | |||
| 1321 | Ga0207663_10234312 | |||
| 1322 | Ga0207663_10695420 | |||
| 1323 | Ga0207663_11210377 | |||
| 1324 | Ga0207660_10275697 | |||
| 1325 | Ga0207660_10286421 | |||
| 1326 | Ga0207660_10348157 | |||
| 1327 | Ga0207660_10360316 | |||
| 1328 | Ga0207660_10937524 | |||
| 1329 | Ga0207657_10254595 | |||
| 1330 | Ga0207657_10795837 | |||
| 1331 | Ga0207649_10123357 | |||
| 1332 | Ga0207649_10479108 | |||
| 1333 | Ga0207649_10631031 | |||
| 1334 | Ga0207652_10012591 | |||
| 1335 | Ga0207652_10022150 | |||
| 1336 | Ga0207652_10027860 | |||
| 1337 | Ga0207652_10908793 | |||
| 1338 | Ga0207652_10967957 | |||
| 1339 | Ga0207646_10000553 | |||
| 1340 | Ga0207646_10025249 | |||
| 1341 | Ga0207646_10602795 | |||
| 1342 | Ga0207646_10714825 | |||
| 1343 | Ga0207646_11719579 | |||
| 1344 | Ga0207694_10479132 | |||
| 1345 | Ga0207694_11857698 | |||
| 1346 | Ga0207687_10331837 | |||
| 1347 | Ga0207687_10611929 | |||
| 1348 | Ga0207687_10629001 | |||
| 1349 | Ga0207687_10867196 | |||
| 1350 | Ga0207687_11567026 | |||
| 1351 | Ga0207700_10007688 | |||
| 1352 | Ga0207700_10012145 | |||
| 1353 | Ga0207700_10080039 | |||
| 1354 | Ga0207700_10155834 | |||
| 1355 | Ga0207700_12035398 | |||
| 1356 | Ga0207664_10050845 | |||
| 1357 | Ga0207664_10066343 | |||
| 1358 | Ga0207664_10071530 | |||
| 1359 | Ga0207664_10079356 | |||
| 1360 | Ga0207664_10085788 | |||
| 1361 | Ga0207664_10117133 | |||
| 1362 | Ga0207664_10158548 | |||
| 1363 | Ga0207664_10380090 | |||
| 1364 | Ga0207664_10388494 | |||
| 1365 | Ga0207664_10472223 | |||
| 1366 | Ga0207664_11241983 | |||
| 1367 | Ga0207644_10384722 | |||
| 1368 | Ga0207644_10550342 | |||
| 1369 | Ga0207686_10491426 | |||
| 1370 | Ga0207686_10590606 | |||
| 1371 | Ga0207686_10984347 | |||
| 1372 | Ga0207686_11076609 | |||
| 1373 | Ga0207704_10232998 | |||
| 1374 | Ga0207665_10000420 | |||
| 1375 | Ga0207665_10000735 | |||
| 1376 | Ga0207665_10012183 | |||
| 1377 | Ga0207665_10270846 | |||
| 1378 | Ga0207665_10735566 | |||
| 1379 | Ga0207665_10742006 | |||
| 1380 | Ga0207711_10231139 | |||
| 1381 | Ga0207661_10025486 | |||
| 1382 | Ga0207661_10248377 | |||
| 1383 | Ga0207661_10526160 | |||
| 1384 | Ga0207661_10901905 | |||
| 1385 | Ga0207679_10112354 | |||
| 1386 | Ga0207679_11088668 | |||
| 1387 | Ga0207667_11283431 | |||
| 1388 | Ga0207667_11350335 | |||
| 1389 | Ga0207651_10427296 | |||
| 1390 | Ga0207640_11308005 | |||
| 1391 | Ga0207677_10243304 | |||
| 1392 | Ga0207677_11040201 | |||
| 1393 | Ga0207678_10080546 | |||
| 1394 | Ga0207702_10002127 | |||
| 1395 | Ga0207702_10306948 | |||
| 1396 | Ga0207702_10817124 | |||
| 1397 | Ga0207641_10200581 | |||
| 1398 | Ga0207676_10488775 | |||
| 1399 | Ga0207675_101070799 | |||
| 1400 | Ga0207683_10010038 | |||
| 1401 | Ga0207683_10180593 | |||
| 1402 | Ga0207683_10288615 | |||
| 1403 | Ga0207683_10431800 | |||
| 1404 | Ga0207683_11345374 | |||
| 1405 | Ga0207698_10141674 | |||
| 1406 | Ga0265319_1027334 | |||
| 1407 | Ga0265318_10001995 | |||
| 1408 | Ga0265320_10013534 | |||
| 1409 | Ga0307415_101649232 | |||
| 1410 | Ga0307415_101750526 | |||
| 1411 | Ga0373930_0021512 | |||
| 1412 | Ga0373948_0025382 | |||
| 1413 | Ga0373958_0031139 | |||
| 1414 | Ga0373958_0063671 | |||
| 1415 | Ga0373959_0003704 | |||
| 1416 | Ga0373938_0051971 | |||
| 1417 | Ga0373938_0099726 | |||
| 1418 | Ga0373928_0036020 | |||
| 1419 | Ga0373929_0017279 | |||
| 1420 | Ga0373929_0053251 | |||
| 1421 | Ga0373929_0104294 | |||
| 1422 | Ga0373934_0214641 | |||
| 1423 | Ga0373940_0004754 | |||
| 1424 | Ga0373940_0103942 | |||
| 1425 | Ga0373940_0173710 | |||
| 1426 | Ga0373949_0004330 | |||
| 1427 | Ga0373951_0024277 | |||
| 1428 | Ga0373951_0039012 | |||
| 1429 | Ga0373951_0177453 | |||
| 1430 | Ga0373952_0008815 | |||
| 1431 | Ga0373952_0041755 | |||
| 1432 | Ga0373932_0404758 | |||
| 1433 | Ga0373936_0036090 | |||
| 1434 | Ga0373939_0116077 | |||
| 1435 | Ga0373939_0177434 | |||
| 1436 | Ga0373941_0095468 | |||
| 1437 | Ga0373941_0311637 | |||
| 1438 | Ga0373941_0330330 | |||
| 1439 | Ga0373945_0055367 | |||
| 1440 | Ga0373954_0617612 | |||
| 1441 | Ga0373956_0033447 | |||
| 1442 | Ga0373956_0090986 | |||
| 1443 | Ga0373960_0072793 | |||
| 1444 | Ga0373943_0005843 | |||
| 1445 | Ga0373943_0123758 | |||
| 1446 | Ga0373943_0729239 | |||
| 1447 | Ga0373946_0002458 | |||
| 1448 | Ga0373955_0259162 | |||
| 1449 | Ga0373955_0471770 | |||
| 1450 | Ga0373942_0012904 | |||
| 1451 | Ga0373942_0029097 | |||
| 1452 | Ga0373961_0043474 | |||
| 1453 | Ga0373961_0078683 | |||
| 1454 | Ga0373962_0009635 | |||
| 1455 | Ga0373924_0046113 | |||
| 1456 | Ga0373924_0326725 | |||
| 1457 | Ga0373931_0006947 | |||
| 1458 | Ga0373931_0161360 | |||
| 1459 | Ga0373931_0545981 | |||
| 1460 | Ga0373927_0055210 | |||
| 1461 | Ga0373947_0036579 | |||
| 1462 | Ga0373947_0383810 | |||
| 1463 | Ga0373937_0075216 | |||
| 1464 | Ga0373937_0178437 | |||
| 1465 | Ga0373925_0006100 | |||
| 1466 | Ga0373925_0916674 | |||
| 1467 | Ga0395899_0056460 | |||
| 1468 | Ga0395900_0031866 | |||
| 1469 | Ga0395900_0096250 | |||
| 1470 | Ga0395900_0191997 | |||
| 1471 | Ga0395900_1400769 | |||
| 1472 | Ga0395898_0018384 | |||
| 1473 | Ga0395898_0076680 | |||
| 1474 | Ga0395898_0098542 | |||
| 1475 | Ga0395898_0847201 | |||
| 1476 | Ga0395898_1734233 | |||
| 1477 | Ga0395905_0965536 | |||
| 1478 | Ga0395901_0093576 | |||
| 1479 | Ga0395901_0388442 | |||
| 1480 | Ga0395901_0435612 | |||
| 1481 | Ga0395901_0786448 | |||
| 1482 | Ga0395901_1184889 | |||
| 1483 | Ga0395901_1480051 | |||
| 1484 | Ga0395901_1709782 | |||
| 1485 | Ga0242420_002859 | |||
| 1486 | Ga0436365_1018822 | |||
| 1487 | Ga0436365_1845339 | |||
| 1488 | Ga0436363_1297307 | |||
| 1489 | Ga0451789_0159463 | |||
| 1490 | Ga0451789_1117892 | |||
| 1491 | Ga0451791_1441736 | |||
| 1492 | Ga0451793_0781476 | |||
| 1493 | Ga0451797_0905678 | |||
| 1494 | Ga0451795_0206216 | |||
| 1495 | Ga0451800_0832588 | |||
| 1496 | Ga0451802_1519977 | |||
| 1497 | Ga0451807_1684640 | |||
| 1498 | Ga0451807_2631029 | |||
| 1499 | Ga0451833_0907646 | |||
| 1500 | Ga0451835_0165989 | |||
| 1501 | Ga0451841_0441814 | |||
| 1502 | Ga0451845_0518208 | |||
| 1503 | Ga0451849_0440083 | |||
| 1504 | Ga0451851_0760096 | |||
| 1505 | Ga0451843_1243594 | |||
| 1506 | Ga0451855_0567418 | |||
| 1507 | Ga0451853_1729694 | |||
| 1508 | Ga0451853_2873286 | |||
| 1509 | Ga0451853_3003812 | |||
| 1510 | Ga0451577_0309935 | |||
| 1511 | Ga0466969_0405906 | |||
| 1512 | Ga0466972_0020003 | |||
| 1513 | Ga0466965_0028894 | |||
| 1514 | Ga0466965_0242338 | |||
| 1515 | Ga0466965_0350879 | |||
| 1516 | Ga0466966_0374321 | |||
| 1517 | Ga0466961_0003702 | |||
| 1518 | Ga0466961_0067970 | |||
| 1519 | Ga0466961_0262753 | |||
| 1520 | Ga0466961_0429827 | |||
| 1521 | Ga0466963_0001756 | |||
| 1522 | Ga0466963_0002348 | |||
| 1523 | Ga0466963_0004180 | |||
| 1524 | Ga0466963_0007632 | |||
| 1525 | Ga0466963_0018701 | |||
| 1526 | Ga0466963_0026333 | |||
| 1527 | Ga0466963_0031702 | |||
| 1528 | Ga0466963_0069340 | |||
| 1529 | Ga0466963_0233007 | |||
| 1530 | Ga0466963_0271007 | |||
| 1531 | Ga0466963_0552366 | |||
| 1532 | Ga0466963_1218601 | |||
| 1533 | Ga0466964_0000525 | |||
| 1534 | Ga0466964_0000994 | |||
| 1535 | Ga0466964_0003775 | |||
| 1536 | Ga0466964_0007993 | |||
| 1537 | Ga0466964_0035399 | |||
| 1538 | Ga0466964_0062339 | |||
| 1539 | Ga0466964_0142702 | |||
| 1540 | Ga0466964_0151060 | |||
| 1541 | Ga0466964_0200068 | |||
| 1542 | Ga0466964_0357933 | |||
| 1543 | Ga0466964_0391649 | |||
| 1544 | Ga0466964_0589041 | |||
| 1545 | Ga0466964_0906258 | |||
| 1546 | Ga0453684_1283265 | |||
| 1547 | Ga0466971_0009819 | |||
| 1548 | Ga0466971_0010438 | |||
| 1549 | Ga0466971_0013818 | |||
| 1550 | Ga0466971_0044520 | |||
| 1551 | Ga0466971_0053962 | |||
| 1552 | Ga0466971_0289294 | |||
| 1553 | Ga0466971_0339332 | |||
| 1554 | Ga0466968_0005265 | |||
| 1555 | Ga0466968_0015234 | |||
| 1556 | Ga0466968_0018597 | |||
| 1557 | Ga0466968_0051499 | |||
| 1558 | Ga0466968_0084377 | |||
| 1559 | Ga0466968_0086357 | |||
| 1560 | Ga0466968_0121384 | |||
| 1561 | Ga0466968_0139114 | |||
| 1562 | Ga0466970_0005859 | |||
| 1563 | Ga0466970_0073473 | |||
| 1564 | Ga0466970_0362458 | |||
| 1565 | Ga0466970_0721513 | |||
| 1566 | Ga0466957_0004828 | |||
| 1567 | Ga0466957_0005555 | |||
| 1568 | Ga0466957_0006047 | |||
| 1569 | Ga0466957_0011889 | |||
| 1570 | Ga0466957_0018095 | |||
| 1571 | Ga0466957_0275044 | |||
| 1572 | Ga0466960_0004688 | |||
| 1573 | Ga0466960_0008077 | |||
| 1574 | Ga0466960_0033551 | |||
| 1575 | Ga0466960_0116432 | |||
| 1576 | Ga0466960_0272312 | |||
| 1577 | Ga0466960_0446303 | |||
| 1578 | Ga0466960_0454608 | |||
| 1579 | Ga0466960_0538166 | |||
| 1580 | Ga0466959_0015897 | |||
| 1581 | Ga0466959_0050596 | |||
| 1582 | Ga0466959_0965040 | |||
| 1583 | Ga0466959_1054889 | |||
| 1584 | Ga0466959_1199626 | |||
| 1585 | Ga0466958_0002929 | |||
| 1586 | Ga0466958_0005412 | |||
| 1587 | Ga0466958_0011296 | |||
| 1588 | Ga0466958_0028435 | |||
| 1589 | Ga0466958_0048129 | |||
| 1590 | Ga0466958_0056669 | |||
| 1591 | Ga0466958_0067979 | |||
| 1592 | Ga0466958_0110521 | |||
| 1593 | Ga0466958_0158993 | |||
| 1594 | Ga0466958_0459343 | |||
| 1595 | Ga0466958_0555924 | |||
| 1596 | Ga0466967_0000181 | |||
| 1597 | Ga0466967_0001859 | |||
| 1598 | Ga0466967_0002422 | |||
| 1599 | Ga0466967_0005491 | |||
| 1600 | Ga0466967_0014686 | |||
| 1601 | Ga0466967_0068114 | |||
| 1602 | Ga0466967_0074393 | |||
| 1603 | Ga0466967_0088637 | |||
| 1604 | Ga0466967_0100386 | |||
| 1605 | Ga0466967_0126866 | |||
| 1606 | Ga0466967_0139453 | |||
| 1607 | Ga0466967_0165741 | |||
| 1608 | Ga0466967_0196692 | |||
| 1609 | Ga0466967_0267007 | |||
| 1610 | Ga0466967_0485760 | |||
| 1611 | Ga0466967_0500806 | |||
| 1612 | Ga0466967_0798986 | |||
| 1613 | Ga0466967_0850685 | |||
| 1614 | Ga0466967_0881700 | |||
| 1615 | Ga0466967_2023598 | |||
| 1616 | Ga0495592_0142320 | |||
| 1617 | Ga0495592_0204372 | |||
| 1618 | Ga0495592_0253078 | |||
| 1619 | Ga0495592_0692054 | |||
| 1620 | Ga0495592_0839267 | |||
| 1621 | Ga0495590_0198758 | |||
| 1622 | Ga0495629_0011930 | |||
| 1623 | Ga0495629_0026893 | |||
| 1624 | Ga0495629_0031988 | |||
| 1625 | Ga0495629_0111558 | |||
| 1626 | Ga0495629_0659676 | |||
| 1627 | Ga0495641_0008161 | |||
| 1628 | Ga0495641_0059726 | |||
| 1629 | Ga0495641_0074057 | |||
| 1630 | Ga0495651_0005362 | |||
| 1631 | Ga0495651_0007784 | |||
| 1632 | Ga0495651_0558334 | |||
| 1633 | Ga0495651_0648826 | |||
| 1634 | Ga0495651_0901980 | |||
| 1635 | Ga0495653_0001446 | |||
| 1636 | Ga0495653_0052854 | |||
| 1637 | Ga0495653_0054981 | |||
| 1638 | Ga0495653_0063153 | |||
| 1639 | Ga0495653_0144133 | |||
| 1640 | Ga0495580_0147855 | |||
| 1641 | Ga0495582_0009318 | |||
| 1642 | Ga0495582_0020875 | |||
| 1643 | Ga0495582_0050252 | |||
| 1644 | Ga0495582_0364114 | |||
| 1645 | Ga0495582_0481022 | |||
| 1646 | Ga0495605_0126527 | |||
| 1647 | Ga0495639_0002011 | |||
| 1648 | Ga0495662_0016039 | |||
| 1649 | Ga0495664_0004565 | |||
| 1650 | Ga0495664_0024751 | |||
| 1651 | Ga0495664_0107746 | |||
| 1652 | Ga0495664_0178884 | |||
| 1653 | Ga0495584_0050121 | |||
| 1654 | Ga0495584_0439128 | |||
| 1655 | Ga0495585_0525145 | |||
| 1656 | Ga0495594_0112040 | |||
| 1657 | Ga0495596_0110804 | |||
| 1658 | Ga0495596_0119946 | |||
| 1659 | Ga0495596_0146307 | |||
| 1660 | Ga0495607_0046837 | |||
| 1661 | Ga0495583_0355368 | |||
| 1662 | Ga0495608_0011699 | |||
| 1663 | Ga0495608_0014294 | |||
| 1664 | Ga0495608_0155900 | |||
| 1665 | Ga0495608_0800884 | |||
| 1666 | Ga0495618_0110230 | |||
| 1667 | Ga0495618_0245073 | |||
| 1668 | Ga0495618_0372328 | |||
| 1669 | Ga0495618_0642978 | |||
| 1670 | Ga0495628_0001531 | |||
| 1671 | Ga0495628_0032089 | |||
| 1672 | Ga0495628_0071674 | |||
| 1673 | Ga0495628_0092481 | |||
| 1674 | Ga0495628_0944865 | |||
| 1675 | Ga0495630_0015365 | |||
| 1676 | Ga0495630_0080472 | |||
| 1677 | Ga0495630_0309480 | |||
| 1678 | Ga0495630_1374556 | |||
| 1679 | Ga0495631_0135491 | |||
| 1680 | Ga0495631_0437154 | |||
| 1681 | Ga0495644_0098219 | |||
| 1682 | Ga0495644_0249709 | |||
| 1683 | Ga0495663_0082304 | |||
| 1684 | Ga0495666_0003040 | |||
| 1685 | Ga0495642_0037906 | |||
| 1686 | Ga0495642_0333795 | |||
| 1687 | Ga0495652_0003999 | |||
| 1688 | Ga0495652_0088795 | |||
| 1689 | Ga0495652_0090487 | |||
| 1690 | Ga0495652_0286228 | |||
| 1691 | Ga0495652_0433587 | |||
| 1692 | Ga0495665_0030875 | |||
| 1693 | Ga0495665_0613114 | |||
| 1694 | Ga0495640_0075987 | |||
| 1695 | Ga0495640_0083107 | |||
| 1696 | Ga0495640_0123539 | |||
| 1697 | Ga0495640_0768448 | |||
| 1698 | Ga0495586_0038808 | |||
| 1699 | Ga0495586_0096027 | |||
| 1700 | Ga0495586_0127639 | |||
| 1701 | Ga0495587_0281180 | |||
| 1702 | Ga0495587_0394234 | |||
| 1703 | Ga0495587_0591590 | |||
| 1704 | Ga0495598_0143526 | |||
| 1705 | Ga0495645_0029925 | |||
| 1706 | Ga0495645_0034488 | |||
| 1707 | Ga0495645_0037053 | |||
| 1708 | Ga0495667_0012490 | |||
| 1709 | Ga0495667_0049992 | |||
| 1710 | Ga0495667_0073119 | |||
| 1711 | Ga0495667_0396105 | |||
| 1712 | Ga0495656_0045428 | |||
| 1713 | Ga0495634_0006777 | |||
| 1714 | Ga0495634_0289678 | |||
| 1715 | Ga0495635_0012714 | |||
| 1716 | Ga0495635_0224062 | |||
| 1717 | Ga0495659_0117797 | |||
| 1718 | Ga0495661_0451214 | |||
| 1719 | Ga0495588_0648942 | |||
| 1720 | Ga0495657_0015624 | |||
| 1721 | Ga0495657_0016463 | |||
| 1722 | Ga0495657_0845270 | |||
| 1723 | Ga0495599_0013809 | |||
| 1724 | Ga0495599_0022201 | |||
| 1725 | Ga0495599_0026957 | |||
| 1726 | Ga0495599_0297753 | |||
| 1727 | Ga0495599_0461926 | |||
| 1728 | Ga0495623_0086453 | |||
| 1729 | Ga0495623_0162314 | |||
| 1730 | Ga0495623_0609564 | |||
| 1731 | Ga0495646_0073315 | |||
| 1732 | Ga0495646_0125332 | |||
| 1733 | Ga0495646_0171106 | |||
| 1734 | Ga0495646_0558876 | |||
| 1735 | Ga0495647_0005940 | |||
| 1736 | Ga0495647_0033876 | |||
| 1737 | Ga0495658_0121701 | |||
| 1738 | Ga0495658_0152066 | |||
| 1739 | Ga0495658_0189380 | |||
| 1740 | Ga0495613_0012474 | |||
| 1741 | Ga0495613_0016946 | |||
| 1742 | Ga0495613_0025648 | |||
| 1743 | Ga0495613_0087726 | |||
| 1744 | Ga0495613_0143535 | |||
| 1745 | Ga0495613_0942340 | |||
| 1746 | Ga0495624_0043468 | |||
| 1747 | Ga0495624_0219882 | |||
| 1748 | Ga0495624_0377594 | |||
| 1749 | Ga0495670_0476683 | |||
| 1750 | Ga0495589_0130359 | |||
| 1751 | Ga0495589_0473804 | |||
| 1752 | Ga0495600_0020996 | |||
| 1753 | Ga0495600_0065899 | |||
| 1754 | Ga0495600_0282583 | |||
| 1755 | Ga0495581_0011521 | |||
| 1756 | Ga0495581_0022746 | |||
| 1757 | Ga0495604_0000060 | |||
| 1758 | Ga0495604_0195253 | |||
| 1759 | Ga0495604_0277129 | |||
| 1760 | Ga0495636_0102621 | |||
| 1761 | Ga0495674_0009509 | |||
| 1762 | Ga0495674_0227034 | |||
| 1763 | Ga0495674_0270803 | |||
| 1764 | Ga0495674_0369414 | |||
| 1765 | Ga0495674_0507982 | |||
| 1766 | Ga0495676_0027116 | |||
| 1767 | Ga0495676_0032895 | |||
| 1768 | Ga0495676_0279535 | |||
| 1769 | Ga0495676_0973631 | |||
| 1770 | Ga0495676_1075450 | |||
| 1771 | Ga0495680_0013289 | |||
| 1772 | Ga0495680_0018573 | |||
| 1773 | Ga0495680_0089265 | |||
| 1774 | Ga0495680_0100989 | |||
| 1775 | Ga0495680_0135198 | |||
| 1776 | Ga0495680_0187741 | |||
| 1777 | Ga0495680_0688347 | |||
| 1778 | Ga0495675_0000223 | |||
| 1779 | Ga0495675_0205380 | |||
| 1780 | Ga0495677_0071145 | |||
| 1781 | Ga0495679_084482 | |||
| 1782 | Ga0495684_0005780 | |||
| 1783 | Ga0495684_0115533 | |||
| 1784 | Ga0495684_0160899 | |||
| 1785 | Ga0495684_1022660 | |||
| 1786 | Ga0495593_0006797 | |||
| 1787 | Ga0495593_0089320 | |||
| 1788 | Ga0495593_0484960 | |||
| 1789 | Ga0495602_0020512 | |||
| 1790 | Ga0495602_0047074 | |||
| 1791 | Ga0495602_0291296 | |||
| 1792 | Ga0495614_0006112 | |||
| 1793 | Ga0496100_0002820 | |||
| 1794 | Ga0496100_0004456 | |||
| 1795 | Ga0496100_0078020 | |||
| 1796 | Ga0496100_0136307 | |||
| 1797 | Ga0496100_0161686 | |||
| 1798 | Ga0496100_0271454 | |||
| 1799 | Ga0496100_0514513 | |||
| 1800 | Ga0496100_1601417 | |||
| 1801 | Ga0496101_0015044 | |||
| 1802 | Ga0496101_0051136 | |||
| 1803 | Ga0496101_0096112 | |||
| 1804 | Ga0496101_0129026 | |||
| 1805 | Ga0496101_0139886 | |||
| 1806 | Ga0496101_0143618 | |||
| 1807 | Ga0496101_0227950 | |||
| 1808 | Ga0496101_0244432 | |||
| 1809 | Ga0496101_0293688 | |||
| 1810 | Ga0496101_0443800 | |||
| 1811 | Ga0496101_0623476 | |||
| 1812 | Ga0496101_1085193 | |||
| 1813 | Ga0496102_0008982 | |||
| 1814 | Ga0496102_0012097 | |||
| 1815 | Ga0496102_0024965 | |||
| 1816 | Ga0496102_0049877 | |||
| 1817 | Ga0496102_0194492 | |||
| 1818 | Ga0496102_0372425 | |||
| 1819 | Ga0496102_0615568 | |||
| 1820 | Ga0496102_0937136 | |||
| 1821 | Ga0496102_1022933 | |||
| 1822 | Ga0496102_1368350 | |||
| 1823 | Ga0496102_1523581 | |||
| 1824 | Ga0496103_0002119 | |||
| 1825 | Ga0496103_0013098 | |||
| 1826 | Ga0496103_0040840 | |||
| 1827 | Ga0496103_0050008 | |||
| 1828 | Ga0496103_0112747 | |||
| 1829 | Ga0496103_0559011 | |||
| 1830 | Ga0496104_0021508 | |||
| 1831 | Ga0496104_0032912 | |||
| 1832 | Ga0496104_0038794 | |||
| 1833 | Ga0496104_0090158 | |||
| 1834 | Ga0496104_0100962 | |||
| 1835 | Ga0496104_0169631 | |||
| 1836 | Ga0496104_0236253 | |||
| 1837 | Ga0496104_0318056 | |||
| 1838 | Ga0496104_1236069 | |||
| 1839 | Ga0496104_1736124 | |||
| 1840 | Ga0496105_0001516 | |||
| 1841 | Ga0496105_0008728 | |||
| 1842 | Ga0496105_0009662 | |||
| 1843 | Ga0496105_0015376 | |||
| 1844 | Ga0496105_0019200 | |||
| 1845 | Ga0496105_0032574 | |||
| 1846 | Ga0496105_0099935 | |||
| 1847 | Ga0496105_0216276 | |||
| 1848 | Ga0496105_0622194 | |||
| 1849 | Ga0496105_1057259 | |||
| 1850 | Ga0496106_0031861 | |||
| 1851 | Ga0496106_0041331 | |||
| 1852 | Ga0496106_0053844 | |||
| 1853 | Ga0496106_0055830 | |||
| 1854 | Ga0496106_0177195 | |||
| 1855 | Ga0496106_0267831 | |||
| 1856 | Ga0496106_0476345 | |||
| 1857 | Ga0496106_0547722 | |||
| 1858 | Ga0496106_0622730 | |||
| 1859 | Ga0496106_1109975 | |||
| 1860 | Ga0496107_0002386 | |||
| 1861 | Ga0496107_0003768 | |||
| 1862 | Ga0496107_0016421 | |||
| 1863 | Ga0496107_0019539 | |||
| 1864 | Ga0496107_0045975 | |||
| 1865 | Ga0496107_0139903 | |||
| 1866 | Ga0496107_0176372 | |||
| 1867 | Ga0496107_0446732 | |||
| 1868 | Ga0496107_0626141 | |||
| 1869 | Ga0496107_0694458 | |||
| 1870 | Ga0496107_0727387 | |||
| 1871 | Ga0496108_0008962 | |||
| 1872 | Ga0496108_0014661 | |||
| 1873 | Ga0496108_0015917 | |||
| 1874 | Ga0496108_0034844 | |||
| 1875 | Ga0496108_0041551 | |||
| 1876 | Ga0496108_0052324 | |||
| 1877 | Ga0496108_0053838 | |||
| 1878 | Ga0496108_0083652 | |||
| 1879 | Ga0496108_0258229 | |||
| 1880 | Ga0496108_0448331 | |||
| 1881 | Ga0496108_0844095 | |||
| 1882 | Ga0496108_0847616 | |||
| 1883 | Ga0496108_1525656 | |||
| 1884 | Ga0496108_1696474 | |||
| 1885 | Ga0496109_0006089 | |||
| 1886 | Ga0496109_0010728 | |||
| 1887 | Ga0496109_0012997 | |||
| 1888 | Ga0496109_0020867 | |||
| 1889 | Ga0496109_0049713 | |||
| 1890 | Ga0496109_0069300 | |||
| 1891 | Ga0496109_0074935 | |||
| 1892 | Ga0496109_0086712 | |||
| 1893 | Ga0496109_0149958 | |||
| 1894 | Ga0496109_0251573 | |||
| 1895 | Ga0496109_0331274 | |||
| 1896 | Ga0496109_0706720 | |||
| 1897 | Ga0496109_0877556 | |||
| 1898 | Ga0496109_1886229 | |||
| 1899 | Ga0496110_0007733 | |||
| 1900 | Ga0496110_0014389 | |||
| 1901 | Ga0496110_0021072 | |||
| 1902 | Ga0496110_0039161 | |||
| 1903 | Ga0496110_0067654 | |||
| 1904 | Ga0496110_0169580 | |||
| 1905 | Ga0496110_0177401 | |||
| 1906 | Ga0496110_0285397 | |||
| 1907 | Ga0496110_0464233 | |||
| 1908 | Ga0496110_0513246 | |||
| 1909 | Ga0496110_0830491 | |||
| 1910 | Ga0496110_1082597 | |||
| 1911 | Ga0496110_1328559 | |||
| 1912 | Ga0496111_0010559 | |||
| 1913 | Ga0496111_0069679 | |||
| 1914 | Ga0496111_0086020 | |||
| 1915 | Ga0496111_0095115 | |||
| 1916 | Ga0496111_0223026 | |||
| 1917 | Ga0496111_0300901 | |||
| 1918 | Ga0496111_0388770 | |||
| 1919 | Ga0496111_0390857 | |||
| 1920 | Ga0496111_0620218 | |||
| 1921 | Ga0496111_0753400 | |||
| 1922 | Ga0496111_1255444 | |||
| 1923 | Ga0496112_0007227 | |||
| 1924 | Ga0496112_0031071 | |||
| 1925 | Ga0496112_0034432 | |||
| 1926 | Ga0496112_0037934 | |||
| 1927 | Ga0496112_0041755 | |||
| 1928 | Ga0496112_0136716 | |||
| 1929 | Ga0496112_0161655 | |||
| 1930 | Ga0496112_0181535 | |||
| 1931 | Ga0496112_0186188 | |||
| 1932 | Ga0496112_0203401 | |||
| 1933 | Ga0496112_0228266 | |||
| 1934 | Ga0496112_0262322 | |||
| 1935 | Ga0496112_0286451 | |||
| 1936 | Ga0496112_0426039 | |||
| 1937 | Ga0496112_0860740 | |||
| 1938 | Ga0496112_0907012 | |||
| 1939 | Ga0496112_0981746 | |||
| 1940 | Ga0496113_0008647 | |||
| 1941 | Ga0496113_0049667 | |||
| 1942 | Ga0496113_0061202 | |||
| 1943 | Ga0496113_0105795 | |||
| 1944 | Ga0496113_0130371 | |||
| 1945 | Ga0496113_0235086 | |||
| 1946 | Ga0496113_0265690 | |||
| 1947 | Ga0496113_0270368 | |||
| 1948 | Ga0496113_0527660 | |||
| 1949 | Ga0496113_0600330 | |||
| 1950 | Ga0496113_0659924 | |||
| 1951 | Ga0496113_0683621 | |||
| 1952 | Ga0496113_1111755 | |||
| 1953 | Ga0496113_1345939 | |||
| 1954 | Ga0496114_0008381 | |||
| 1955 | Ga0496114_0011405 | |||
| 1956 | Ga0496114_0043182 | |||
| 1957 | Ga0496114_0047606 | |||
| 1958 | Ga0496114_0083674 | |||
| 1959 | Ga0496114_0306086 | |||
| 1960 | Ga0496114_0956302 | |||
| 1961 | Ga0496114_1527086 | |||
| 1962 | Ga0496114_1555035 | |||
| 1963 | Ga0496115_0003191 | |||
| 1964 | Ga0496115_0007836 | |||
| 1965 | Ga0496115_0040293 | |||
| 1966 | Ga0496115_0073791 | |||
| 1967 | Ga0496115_0092557 | |||
| 1968 | Ga0496115_0103772 | |||
| 1969 | Ga0496115_0165741 | |||
| 1970 | Ga0496115_0351269 | |||
| 1971 | Ga0496115_0892101 | |||
| 1972 | Ga0501031_0000270 | |||
| 1973 | Ga0501032_0001838 | |||
| 1974 | Ga0501033_0206071 | |||
| 1975 | Ga0501036_0015962 | |||
| 1976 | Ga0501037_0043551 | |||
| 1977 | Ga0501038_0003487 | |||
| 1978 | Ga0501040_0028875 | |||
| 1979 | Ga0501041_0004847 | |||
| 1980 | Ga0501042_0003753 | |||
| 1981 | Ga0501043_0012759 | |||
| 1982 | Ga0501046_0008121 | |||
| 1983 | Ga0501048_0650924 | |||
| 1984 | Ga0501067_0001546 | |||
| 1985 | Ga0501067_0007583 | |||
| 1986 | Ga0501067_0013188 | |||
| 1987 | Ga0501067_0088494 | |||
| 1988 | Ga0501067_0355374 | |||
| 1989 | Ga0501068_0081802 | |||
| 1990 | Ga0501068_0271601 | |||
| 1991 | Ga0501069_0004650 | |||
| 1992 | Ga0501069_0012853 | |||
| 1993 | Ga0501069_0024080 | |||
| 1994 | Ga0501069_0492869 | |||
| 1995 | Ga0501069_0562839 | |||
| 1996 | Ga0501070_0001395 | |||
| 1997 | Ga0501070_0297128 | |||
| 1998 | Ga0501071_0273011 | |||
| 1999 | Ga0501072_0601869 | |||
| 2000 | Ga0501073_0019252 | |||
| 2001 | Ga0501074_0075052 | |||
| 2002 | Ga0501075_0010586 | |||
| 2003 | Ga0501076_0880144 | |||
| 2004 | Ga0501077_0023939 | |||
| 2005 | Ga0501079_0032967 | |||
| 2006 | Ga0501080_0003360 | |||
| 2007 | Ga0501081_0186261 | |||
| 2008 | Ga0501081_0406251 | |||
| 2009 | Ga0501083_0022271 | |||
| 2010 | Ga0501035_0132999 | |||
| 2011 | Ga0501044_0057674 | |||
| 2012 | Ga0501045_0041931 | |||
| 2013 | nmdc:mga05p37_530737_c1 | |||
| 2014 | nmdc:mga05p37_60368_c1 | |||
| 2015 | nmdc:mga08y16_286263_c1 | |||
| 2016 | nmdc:mga0n895_1252961_c1 | |||
| 2017 | nmdc:mga0n895_161716_c1 | |||
| 2018 | nmdc:mga0n895_34358_c1 | |||
| 2019 | nmdc:mga0rr50_110760_c1 | |||
| 2020 | nmdc:mga0rr50_174756_c1 | |||
| 2021 | nmdc:mga0rr50_67976_c1 | |||
| 2022 | nmdc:mga08x19_31482_c1 | |||
| 2023 | nmdc:mga08x19_45618_c1 | |||
| 2024 | nmdc:mga08x19_69708_c1 | |||
| 2025 | nmdc:mga0a205_141402_c1 | |||
| 2026 | nmdc:mga0a205_1527627_c1 | |||
| 2027 | nmdc:mga0a205_399185_c1 | |||
| 2028 | nmdc:mga0a205_79097_c1 | |||
| 2029 | Ga0495601_0000328 | |||
| 2030 | Ga0495601_0023115 | |||
| 2031 | Ga0495601_0029973 | |||
| 2032 | Ga0495601_0063649 | |||
| 2033 | Ga0495601_0117223 | |||
| 2034 | Ga0495601_0683715 | |||
| 2035 | Ga0495612_0001001 | |||
| 2036 | Ga0495612_0044108 | |||
| 2037 | Ga0495612_0176808 | |||
| 2038 | Ga0495612_0265210 | |||
| 2039 | Ga0495595_0000605 | |||
| 2040 | Ga0495595_0002546 | |||
| 2041 | Ga0495595_0030743 | |||
| 2042 | Ga0495595_0322786 | |||
| 2043 | Ga0495595_0450859 | |||
| 2044 | Ga0495619_0010795 | |||
| 2045 | Ga0495619_0043958 | |||
| 2046 | Ga0495619_0136676 | |||
| 2047 | Ga0495619_0466820 | |||
| 2048 | Ga0495619_0899512 | |||
| 2049 | Ga0495619_1001298 | |||
| 2050 | Ga0500566_0021035 | |||
| 2051 | Ga0501084_0522327 | |||
| 2052 | Ga0501082_0044936 | |||
| 2053 | Ga0501082_0125957 | |||
| 2054 | Ga0466962_0021516 | |||
| 2055 | Ga0466962_0023024 | |||
| 2056 | Ga0466962_0048012 | |||
| 2057 | Ga0466962_0051814 | |||
| 2058 | Ga0466962_0071584 | |||
| 2059 | Ga0466962_0355085 | |||
| 2060 | Ga0530510_0003335 | |||
| 2061 | Ga0530510_0014416 | |||
| 2062 | Ga0530510_0016879 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4oi3-assembly1.cif.gz_B | crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) | 0.7511 | 3 | 85 |
| 4oi3-assembly1.cif.gz_B | crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) | 0.7354 | 3 | 85 |
| 4qle-assembly2.cif.gz_B | crystal structure of i14a dhfr mutant complexed with folate and nadp+ | 0.7251 | 31 | 57 |
| 4qlg-assembly2.cif.gz_B | crystal structure of i14v dhfr mutant complexed with folate and nadp+ | 0.7047 | 31 | 57 |
| 3ep8-assembly1.cif.gz_A | human adometdc e178q mutant complexed with s-adenosylmethionine methyl ester and no putrescine bound | 0.6963 | 34 | 57 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4oi3B00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer | 0.7681 | 3 | 85 | 3.30.70.3090 |
| af_Q2G1I7_88_170_3.30.70.3090 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer | 0.752 | 1 | 81 | 3.30.70.3090 |
| 4oi3B00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer | 0.752 | 3 | 85 | 3.30.70.3090 |
| 2cfxA02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain | 0.7345 | 2 | 86 | 3.30.70.920 |
| af_Q2G1I7_88_170_3.30.70.3090 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer | 0.7127 | 1 | 81 | 3.30.70.3090 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538FSW4-F1-model_v4 | DUF4242 domain-containing protein | 0.9852 | 1 | 93 |
|
| AF-A0A538FSW4-F1-model_v4 | DUF4242 domain-containing protein | 0.9749 | 1 | 93 |
|
| AF-A0A538IWB9-F1-model_v4 | DUF4242 domain-containing protein | 0.9735 | 1 | 93 |
|
| AF-A0A537WMF0-F1-model_v4 | DUF4242 domain-containing protein | 0.9674 | 1 | 91 |
|
| AF-A0A538IWB9-F1-model_v4 | DUF4242 domain-containing protein | 0.9634 | 1 | 93 |
|