F488545

General Info

Members Datasets Scaffolds Average Seq Length
1028 715 2056 142

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10002600|Ga0070709_100026007
Length 165
Sequence MAAPGLAGNGHRLAGRYRPMSEINVTPLVDVMLVLLVVFMVAAPLLTVGVPVDLPQTQAPPITEPKEPLVITINGEGRIFLQETEVPTDSLVPRLQAITDNNSDAPLYVRGDKGINYGRVVEVMSLVGAAGFHKVSLIAEAPKGATGKTFSGGTPSDRSARAVRR

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
18 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
80 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
93 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
104 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
107 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
108 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
109 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
110 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
111 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
112 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
113 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
114 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
115 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
117 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
119 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
120 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
121 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
122 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
125 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
126 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
127 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
130 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
133 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
135 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
138 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
179 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
183 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
184 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
185 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
186 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
187 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
188 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
189 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
190 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
191 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
192 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
193 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
194 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
195 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
196 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
197 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
198 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
199 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
200 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
201 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
202 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
205 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
206 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
208 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
209 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
212 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
214 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
215 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
216 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
217 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
218 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
219 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
220 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
221 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
222 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
223 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
224 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
225 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
226 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
227 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
228 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
229 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
230 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
231 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
232 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
233 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
234 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
235 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
236 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
237 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
238 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
239 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
240 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
241 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
242 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
243 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
244 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
245 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
246 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
247 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
248 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
249 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
250 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
251 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
252 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
253 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
254 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
255 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
256 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
257 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
258 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
259 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
260 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
261 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
262 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
263 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
264 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
265 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
266 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
267 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
268 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
269 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
270 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
271 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
272 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
273 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
274 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
275 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
276 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
277 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
278 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
279 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
280 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
281 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
282 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
283 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
284 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
285 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
286 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
287 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
288 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
289 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
290 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
291 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
292 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
293 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
294 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
295 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
296 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
297 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
298 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
299 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
300 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
301 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
302 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
303 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
304 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
305 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
306 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
307 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
308 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
309 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
310 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
311 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
312 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
313 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
314 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
315 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
316 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
317 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
318 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
319 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
320 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
321 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
322 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
323 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
324 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
325 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
326 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
327 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
328 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
329 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
330 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
339 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
340 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
341 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
342 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
343 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
344 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
345 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
346 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
347 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
348 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
349 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
350 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
351 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
352 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
353 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
354 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
355 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
356 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
357 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
358 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
359 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
360 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
361 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
362 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
363 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
364 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
365 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
366 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
367 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
368 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
369 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
370 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
371 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
372 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
382 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
383 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
384 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
385 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
386 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
387 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
388 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
389 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
390 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
391 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
392 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
393 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
394 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
395 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
396 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
397 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
398 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
399 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
400 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
401 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
402 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
403 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
404 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
405 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
406 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
407 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
408 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
409 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
410 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
411 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
412 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
413 2519899620 Rhizobium sp. Pop5 Isolate Nodule
414 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
415 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
416 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
417 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
418 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
419 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
420 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
421 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
422 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
423 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
424 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
425 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
426 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
427 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
428 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
429 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
430 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
431 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
432 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
433 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
434 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
435 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
436 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
437 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
438 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
439 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
440 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
441 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
442 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
443 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
444 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
445 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
446 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
447 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
448 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
449 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
450 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
451 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
452 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
453 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
454 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
455 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
456 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
457 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
458 2643221568 Rhizobium sp. Root564 Isolate Unclassified
459 2643221599 Rhizobium sp. Root708 Isolate Unclassified
460 2643221607 Rhizobium sp. Root73 Isolate Unclassified
461 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
462 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
463 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
464 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
465 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
466 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
467 2643221688 Rhizobium sp. Root482 Isolate Unclassified
468 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
469 2643221693 Rhizobium sp. Root491 Isolate Unclassified
470 2643221718 Rhizobium sp. Root268 Isolate Unclassified
471 2643221719 Rhizobium sp. Root274 Isolate Unclassified
472 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
473 2718217882 Rhizobium sp. N741 Isolate Nodule
474 2718217927 Rhizobium sp. N324 Isolate Nodule
475 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
476 2718218009 Rhizobium sp. N561 Isolate Nodule
477 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
478 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
479 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
480 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
481 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
482 2718218363 Rhizobium sp. N113 Isolate Nodule
483 2718218365 Rhizobium sp. N731 Isolate Nodule
484 2718218366 Rhizobium sp. N621 Isolate Nodule
485 2718218423 Rhizobium sp. N941 Isolate Nodule
486 2721755514 Rhizobium sp. N6212 Isolate Nodule
487 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
488 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
489 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
490 2721755809 Rhizobium sp. N541 Isolate Nodule
491 2721755810 Rhizobium sp. N871 Isolate Nodule
492 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
493 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
494 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
495 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
496 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
497 2728369365 Rhizobium sp. N1341 Isolate Nodule
498 2728369397 Rhizobium sp. N1314 Isolate Nodule
499 2738541293 Rhizobium sp. GV031 Isolate Unclassified
500 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
501 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
502 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
503 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
504 2791355256 Rhizobium sp. M10 Isolate Nodule
505 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
506 2791355260 Rhizobium sp. L9 Isolate Nodule
507 2791355261 Rhizobium sp. J15 Isolate Nodule
508 2791355262 Rhizobium sp. M1 Isolate Nodule
509 2791355263 Rhizobium chutanense C5 Isolate Nodule
510 2791355264 Rhizobium sp. S9 Isolate Nodule
511 2791355265 Rhizobium sp. H4 Isolate Nodule
512 2791355266 Rhizobium sp. L43 Isolate Nodule
513 2791355267 Rhizobium sp. L18 Isolate Nodule
514 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
515 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
516 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
517 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
518 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
519 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
520 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
521 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
522 2802429633 Rhizobium anhuiense J3 Isolate Nodule
523 2802429634 Rhizobium anhuiense S10 Isolate Nodule
524 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
525 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
526 2802429637 Rhizobium anhuiense C15 Isolate Nodule
527 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
528 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
529 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
530 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
531 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
532 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
533 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
534 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
535 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
536 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
537 2838048938 Rhizobium pisi 27/80 Isolate Nodule
538 2838061910 Rhizobium phaseoli L15 Isolate Nodule
539 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
540 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
541 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
542 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
543 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
544 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
545 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
546 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
547 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
548 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
549 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
550 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
551 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
552 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
553 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
554 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
555 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
556 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
557 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
558 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
559 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
560 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
561 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
562 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
563 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
564 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
565 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
566 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
567 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
568 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
569 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
570 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
571 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
572 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
573 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
574 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
575 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
576 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
577 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
578 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
579 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
580 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
581 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
582 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
583 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
584 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
585 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
586 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
587 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
588 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
589 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
590 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
591 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
592 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
593 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
594 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
595 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
596 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
597 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
598 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
599 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
600 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
601 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
602 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
603 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
604 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
605 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
606 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
607 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
608 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
609 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
610 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
611 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
612 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
613 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
614 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
615 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
616 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
617 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
618 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
619 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
620 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
621 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
622 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
623 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
624 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
625 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
626 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
627 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
628 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
629 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
630 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
631 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
632 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
633 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
634 2933599457 Rhizobium phaseoli M3 Isolate Nodule
635 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
636 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
637 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
638 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
639 2936381700 Rhizobium chutanense C16 Isolate Unclassified
640 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
641 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
642 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
643 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
644 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
645 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
646 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
647 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
648 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
649 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
650 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
651 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
652 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
653 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
654 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
655 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
656 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
657 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
658 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
659 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
660 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
661 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
662 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
663 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
664 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
665 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
666 2996887358 Rhizobium sp. R711 Isolate Nodule
667 2996893221 Rhizobium sp. R635 Isolate Nodule
668 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
669 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
670 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
671 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
672 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
673 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
674 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
675 8005258706 Rhizobium sp. R693 Isolate Nodule
676 8005275841 Rhizobium sp. N4311 Isolate Nodule
677 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
678 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
679 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
680 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
681 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
682 8005321885 Rhizobium sp. R72 Isolate Nodule
683 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
684 8005382845 Rhizobium sp. R634 Isolate Nodule
685 8005395548 Rhizobium sp. R339 Isolate Nodule
686 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
687 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
688 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
689 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
690 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
691 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
692 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
693 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
694 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
695 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
696 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
697 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
698 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
699 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
700 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
701 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
702 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
703 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
704 8018176218 Rhizobium sp. N122 Isolate Nodule
705 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
706 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
707 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
708 8024501048 Rhizobium sp. H4 Isolate Nodule
709 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
710 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
711 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
712 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
713 8056382006 Rhizobium croatiense 13T Isolate Nodule
714 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
715 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 66.15
Metatranscriptomes 1.46
Isolates 32.39

Biome Distribution

Category Percentage (%)
Aerial Root 0.49
Bulb 0
Endosphere 18.19
Nodule 22.47
Rhizoplane 2.72
Rhizosphere 41.44
Stem 0
Stem Tuber 0
Unclassified 0.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10002600 3300005434 Bacteria 9749
2 JGI24740J21852_10018463 3300001979 Bacteria 2472
3 JGI25155J39150_1000007 3300002704 Bacteria 238857
4 JGI25156J39149_1000050 3300002705 Bacteria 89634
5 JGI25156J39149_1000066 3300002705 Bacteria 82816
6 JGI25162J39368_1001208 3300002737 Bacteria 15045
7 JGI25162J39368_1001635 3300002737 Bacteria 11171
8 JGI25154J39366_1000035 3300002738 Bacteria 172224
9 JGI25158J39367_1000176 3300002739 Bacteria 15017
10 JGI25157J39369_1000036 3300002741 Bacteria 133671
11 JGI25152J39213_1001421 3300002773 Bacteria 10363
12 JGI25152J39213_1001960 3300002773 Bacteria 8161
13 JGI25152J39213_1002918 3300002773 Bacteria 6095
14 JGI25152J39213_1014438 3300002773 Bacteria 1603
15 JGI25152J39213_1014547 3300002773 Bacteria 1591
16 JGI25152J39213_1018482 3300002773 Bacteria 1287
17 JGI25150J39212_1000456 3300002774 Bacteria 17986
18 JGI25150J39212_1002289 3300002774 Bacteria 4837
19 JGI25159J45721_1000463 3300002987 Bacteria 18770
20 JGI25159J45721_1016251 3300002987 Bacteria 1595
21 JGI25151J46595_10000366 3300003187 Bacteria 47493
22 JGI25151J46595_10000704 3300003187 Bacteria 28016
23 JGI25151J46595_10006064 3300003187 Bacteria 6148
24 JGI25151J46595_10012330 3300003187 Bacteria 3893
25 JGI25151J46595_10012743 3300003187 Bacteria 3813
26 JGI25151J46595_10038691 3300003187 Bacteria 1771
27 JGI25151J46595_10059751 3300003187 Bacteria 1225
28 JGI25406J46586_10001353 3300003203 Bacteria 11535
29 JGI25165J46597_1001243 3300003214 Bacteria 15087
30 JGI25165J46597_1003093 3300003214 Bacteria 4478
31 JGI25153J46596_10003590 3300003215 Bacteria 8617
32 JGI25153J46596_10034233 3300003215 Bacteria 1664
33 JGI25153J46596_10036047 3300003215 Bacteria 1592
34 JGI25153J46596_10046137 3300003215 Bacteria 1294
35 JGI25160J50197_1000100 3300003354 Bacteria 86646
36 JGI25160J50197_1009462 3300003354 Bacteria 3612
37 JGI25160J50197_1013020 3300003354 Bacteria 2855
38 JGI25160J50197_1014109 3300003354 Bacteria 2689
39 JGI25161J50226_1000072 3300003374 Bacteria 86646
40 JGI25161J50226_1000104 3300003374 Bacteria 67942
41 JGI25161J50226_1001812 3300003374 Bacteria 5994
42 Ga0006562J51391_1019493 3300003578 Bacteria 4566
43 Ga0006562J51391_1020249 3300003578 Bacteria 2290
44 Ga0055526_1001175 3300003771 Bacteria 18963
45 Ga0055526_1003037 3300003771 Bacteria 10910
46 Ga0055526_1006773 3300003771 Bacteria 6123
47 Ga0055526_1013615 3300003771 Bacteria 3422
48 Ga0055524_1003691 3300003775 Bacteria 7328
49 Ga0055524_1005994 3300003775 Bacteria 5338
50 Ga0055524_1006649 3300003775 Bacteria 4998
51 Ga0055524_1024505 3300003775 Bacteria 1912
52 Ga0055524_1035902 3300003775 Bacteria 1344
53 Ga0055528_1000176 3300003790 Bacteria 54005
54 Ga0055528_1001761 3300003790 Bacteria 12455
55 Ga0055528_1002040 3300003790 Bacteria 11301
56 Ga0055528_1007044 3300003790 Bacteria 5024
57 Ga0055528_1010817 3300003790 Bacteria 3677
58 Ga0055528_1020949 3300003790 Bacteria 2098
59 Ga0055528_1043308 3300003790 Bacteria 981
60 Ga0055540_1020237 3300003792 Bacteria 1766
61 Ga0055531_10026148 3300003794 Bacteria 2092
62 Ga0058692_1003196 3300003856 Bacteria 5154
63 Ga0058692_1008998 3300003856 Bacteria 2547
64 Ga0058692_1033150 3300003856 Bacteria 959
65 Ga0055543_1000078 3300004625 Bacteria 85340
66 Ga0055543_1000280 3300004625 Bacteria 37509
67 Ga0055543_1001074 3300004625 Bacteria 11996
68 Ga0065165_1000623 3300005262 Bacteria 51455
69 Ga0065165_1021414 3300005262 Bacteria 2246
70 Ga0065707_10838875 3300005295 Bacteria 586
71 Ga0070658_10093266 3300005327 Bacteria 2483
72 Ga0070676_10194263 3300005328 Bacteria 1327
73 Ga0070670_100221076 3300005331 Bacteria 1648
74 Ga0070666_10075280 3300005335 Bacteria 2302
75 Ga0070682_100895558 3300005337 Bacteria 729
76 Ga0070660_100300132 3300005339 Bacteria 1317
77 Ga0070660_100609608 3300005339 Bacteria 913
78 Ga0070668_100037516 3300005347 Bacteria 3700
79 Ga0070668_100167526 3300005347 Bacteria 1787
80 Ga0070668_100423107 3300005347 Bacteria 1141
81 Ga0070668_100504190 3300005347 Bacteria 1048
82 Ga0070669_100267646 3300005353 Bacteria 1365
83 Ga0070669_100549601 3300005353 Bacteria 963
84 Ga0070669_100651171 3300005353 Bacteria 886
85 Ga0070671_100133503 3300005355 Bacteria 2092
86 Ga0070659_100258328 3300005366 Bacteria 1445
87 Ga0070667_100061891 3300005367 Bacteria 3170
88 Ga0070709_10088334 3300005434 Bacteria 2039
89 Ga0070714_100316852 3300005435 Bacteria 1457
90 Ga0070713_100006254 3300005436 Bacteria 8244
91 Ga0070713_100049034 3300005436 Bacteria 3481
92 Ga0070710_10005366 3300005437 Bacteria 6080
93 Ga0070711_100467737 3300005439 Bacteria 1034
94 Ga0070708_100159086 3300005445 Bacteria 2104
95 Ga0070708_100184987 3300005445 Bacteria 1948
96 Ga0070708_100503869 3300005445 Bacteria 1142
97 Ga0070708_100739910 3300005445 Bacteria 925
98 Ga0070663_100500606 3300005455 Bacteria 1009
99 Ga0070678_100466078 3300005456 Bacteria 1109
100 Ga0070662_101202076 3300005457 Bacteria 652
101 Ga0070681_10077064 3300005458 Bacteria 3292
102 Ga0070706_100249699 3300005467 Bacteria 1656
103 Ga0070706_100416666 3300005467 Bacteria 1250
104 Ga0070707_100134318 3300005468 Bacteria 2407
105 Ga0070707_100213622 3300005468 Bacteria 1880
106 Ga0070707_100313425 3300005468 Bacteria 1525
107 Ga0070698_100007601 3300005471 Bacteria 11729
108 Ga0070698_100036763 3300005471 Bacteria 5054
109 Ga0070698_100222323 3300005471 Bacteria 1822
110 Ga0070698_101188844 3300005471 Bacteria 712
111 Ga0070699_100275029 3300005518 Bacteria 1508
112 Ga0070699_100623469 3300005518 Bacteria 984
113 Ga0070679_100553004 3300005530 Bacteria 1095
114 Ga0070679_100638295 3300005530 Bacteria 1008
115 Ga0070697_100154548 3300005536 Bacteria 1936
116 Ga0070697_100162463 3300005536 Bacteria 1887
117 Ga0070697_100337190 3300005536 Bacteria 1301
118 Ga0070686_101653156 3300005544 Bacteria 543
119 Ga0070696_100091053 3300005546 Bacteria 2171
120 Ga0070696_100869725 3300005546 Bacteria 746
121 Ga0070665_100009892 3300005548 Bacteria 9643
122 Ga0070665_100057538 3300005548 Bacteria 3897
123 Ga0070665_100091999 3300005548 Bacteria 3038
124 Ga0070665_100456431 3300005548 Bacteria 1288
125 Ga0068856_100919210 3300005614 Bacteria 894
126 Ga0068851_10009454 3300005834 Bacteria 4534
127 Ga0068863_100927307 3300005841 Bacteria 872
128 Ga0068858_101733721 3300005842 Bacteria 617
129 Ga0068860_100075414 3300005843 Bacteria 3208
130 Ga0068860_101331790 3300005843 Bacteria 739
131 Ga0081540_1007237 3300005983 Bacteria 7954
132 Ga0081539_10001347 3300005985 Bacteria 42775
133 Ga0081539_10003074 3300005985 Bacteria 21503
134 Ga0070717_10011643 3300006028 Bacteria 6690
135 Ga0070717_10972511 3300006028 Bacteria 773
136 Ga0075365_10008693 3300006038 Bacteria 5784
137 Ga0075365_10188935 3300006038 Bacteria 1441
138 Ga0075365_10377729 3300006038 Bacteria 1000
139 Ga0075368_10001043 3300006042 Bacteria 8687
140 Ga0075368_10082371 3300006042 Bacteria 1310
141 Ga0075368_10101613 3300006042 Bacteria 1181
142 Ga0075363_100058317 3300006048 Bacteria 2073
143 Ga0075363_100167378 3300006048 Bacteria 1247
144 Ga0075364_10025987 3300006051 Bacteria 3731
145 Ga0075364_10669240 3300006051 Bacteria 709
146 Ga0070715_10050079 3300006163 Bacteria 1792
147 Ga0070716_100053908 3300006173 Bacteria 2295
148 Ga0070712_100037996 3300006175 Bacteria 3286
149 Ga0070712_100086942 3300006175 Bacteria 2279
150 Ga0075362_10038403 3300006177 Bacteria 2103
151 Ga0075367_10005763 3300006178 Bacteria 6194
152 Ga0075367_10008374 3300006178 Bacteria 5356
153 Ga0075367_10123264 3300006178 Bacteria 1598
154 Ga0075367_10298883 3300006178 Bacteria 1013
155 Ga0075367_10314763 3300006178 Bacteria 986
156 Ga0075367_10880297 3300006178 Bacteria 571
157 Ga0075369_10051390 3300006186 Bacteria 1784
158 Ga0075369_10114456 3300006186 Bacteria 1217
159 Ga0075369_10134397 3300006186 Bacteria 1125
160 Ga0075369_10140244 3300006186 Bacteria 1102
161 Ga0075366_10008598 3300006195 Bacteria 5684
162 Ga0075370_10012538 3300006353 Bacteria 4484
163 Ga0075370_10105679 3300006353 Bacteria 1632
164 Ga0075431_101048177 3300006847 Bacteria 781
165 Ga0075434_100349452 3300006871 Bacteria 1500
166 Ga0099826_10010997 3300006948 Bacteria 6799
167 Ga0099826_10146487 3300006948 Bacteria 1356
168 Ga0099795_10127315 3300007788 Bacteria 1024
169 Ga0105251_10006623 3300009011 Bacteria 7334
170 Ga0105244_10199685 3300009036 Bacteria 943
171 Ga0105250_10019815 3300009092 Bacteria 2721
172 Ga0105240_10000019 3300009093 Bacteria 406211
173 Ga0105240_11271973 3300009093 Bacteria 777
174 Ga0111539_10538857 3300009094 Bacteria 1360
175 Ga0111539_13367151 3300009094 Bacteria 514
176 Ga0105245_12140533 3300009098 Bacteria 613
177 Ga0105247_10514211 3300009101 Bacteria 874
178 Ga0105243_10042736 3300009148 Bacteria 3549
179 Ga0105243_10225889 3300009148 Bacteria 1658
180 Ga0105242_10206966 3300009176 Bacteria 1746
181 Ga0105242_10728847 3300009176 Bacteria 973
182 Ga0105242_10858084 3300009176 Bacteria 904
183 Ga0105248_10145522 3300009177 Bacteria 2674
184 Ga0105237_10000734 3300009545 Bacteria 45223
185 Ga0105237_10912657 3300009545 Bacteria 885
186 Ga0123341_1000014 3300009765 Bacteria 91980
187 Ga0123342_1007767 3300009766 Bacteria 13980
188 Ga0123342_1011573 3300009766 Bacteria 9583
189 Ga0105239_10000574 3300010375 Bacteria 52563
190 Ga0105239_11053138 3300010375 Bacteria 936
191 Ga0105246_10442038 3300011119 Bacteria 1091
192 Ga0157326_1035014 3300012513 Bacteria 682
193 Ga0157373_10003159 3300013100 Bacteria 12444
194 Ga0157373_10160192 3300013100 Bacteria 1583
195 Ga0157371_10000002 3300013102 Bacteria 665040
196 Ga0157371_10007369 3300013102 Bacteria 8914
197 Ga0157370_10000131 3300013104 Bacteria 89805
198 Ga0157370_10001657 3300013104 Bacteria 27460
199 Ga0157370_10088663 3300013104 Bacteria 2905
200 Ga0157369_10056267 3300013105 Bacteria 4244
201 Ga0157369_10370017 3300013105 Bacteria 1488
202 Ga0157374_10292888 3300013296 Bacteria 1609
203 Ga0157374_11346879 3300013296 Bacteria 736
204 Ga0163163_10677139 3300014325 Bacteria 1095
205 Ga0182007_10007300 3300015262 Bacteria 4647
206 Ga0182005_1004391 3300015265 Bacteria 4570
207 Ga0163161_10436236 3300017792 Bacteria 1056
208 Ga0214544_1000893 3300021320 Bacteria 58796
209 Ga0214542_1000115 3300021321 Bacteria 109873
210 Ga0214543_1000098 3300021327 Bacteria 109894
211 Ga0213873_10012897 3300021358 Bacteria 1822
212 Ga0213872_10042449 3300021361 Bacteria 2074
213 Ga0213872_10197844 3300021361 Bacteria 863
214 Ga0213874_10032948 3300021377 Bacteria 1508
215 Ga0213875_10000081 3300021388 Bacteria 114181
216 Ga0213875_10002791 3300021388 Bacteria 10275
217 Ga0213875_10193681 3300021388 Bacteria 956
218 Ga0213871_10073308 3300021441 Bacteria 971
219 Ga0209435_100005 3300025206 Bacteria 573745
220 Ga0209760_102272 3300025207 Bacteria 1820
221 Ga0209436_100023 3300025208 Bacteria 96401
222 Ga0209436_100027 3300025208 Bacteria 87534
223 Ga0209672_108909 3300025228 Bacteria 1450
224 Ga0209437_100058 3300025233 Bacteria 357279
225 Ga0209437_100313 3300025233 Bacteria 64057
226 Ga0207425_1000058 3300025245 Bacteria 149214
227 Ga0207425_1004542 3300025245 Bacteria 4131
228 Ga0207425_1013825 3300025245 Bacteria 1850
229 Ga0207425_1015411 3300025245 Bacteria 1716
230 Ga0209646_1000011 3300025246 Bacteria 573745
231 Ga0209026_1000008 3300025250 Bacteria 573745
232 Ga0209677_100475 3300025253 Bacteria 22964
233 Ga0209148_1010336 3300025254 Bacteria 1777
234 Ga0209759_1000004 3300025256 Bacteria 573745
235 Ga0209129_1000107 3300025258 Bacteria 154705
236 Ga0209129_1000242 3300025258 Bacteria 58534
237 Ga0209129_1002341 3300025258 Bacteria 9380
238 Ga0209129_1003216 3300025258 Bacteria 7288
239 Ga0209129_1003392 3300025258 Bacteria 6988
240 Ga0209129_1003663 3300025258 Bacteria 6542
241 Ga0209129_1005548 3300025258 Bacteria 4416
242 Ga0209129_1006333 3300025258 Bacteria 3864
243 Ga0209129_1019143 3300025258 Bacteria 1300
244 Ga0209233_1000157 3300025261 Bacteria 164269
245 Ga0209233_1000240 3300025261 Bacteria 90758
246 Ga0209233_1000420 3300025261 Bacteria 31894
247 Ga0209455_1017627 3300025272 Bacteria 1491
248 Ga0209673_1000060 3300025273 Bacteria 263602
249 Ga0209673_1000233 3300025273 Bacteria 108504
250 Ga0209673_1000781 3300025273 Bacteria 42606
251 Ga0209673_1001293 3300025273 Bacteria 25567
252 Ga0209673_1001374 3300025273 Bacteria 23942
253 Ga0209673_1005445 3300025273 Bacteria 6391
254 Ga0209673_1008908 3300025273 Bacteria 4413
255 Ga0209673_1011626 3300025273 Bacteria 3614
256 Ga0209673_1068539 3300025273 Bacteria 854
257 Ga0209130_1000083 3300025284 Bacteria 162582
258 Ga0209130_1000173 3300025284 Bacteria 92248
259 Ga0209130_1017818 3300025284 Bacteria 1682
260 Ga0209130_1033521 3300025284 Bacteria 1039
261 Ga0209130_1043556 3300025284 Bacteria 853
262 Ga0209675_1038531 3300025291 Bacteria 1065
263 Ga0209675_1041040 3300025291 Bacteria 1012
264 Ga0209676_1013964 3300025292 Bacteria 3054
265 Ga0209025_1000083 3300025294 Bacteria 265556
266 Ga0209025_1000255 3300025294 Bacteria 125764
267 Ga0209025_1000350 3300025294 Bacteria 99649
268 Ga0209025_1004537 3300025294 Bacteria 11972
269 Ga0209025_1016347 3300025294 Bacteria 4388
270 Ga0209025_1019949 3300025294 Bacteria 3697
271 Ga0209025_1022224 3300025294 Bacteria 3375
272 Ga0209025_1027211 3300025294 Bacteria 2843
273 Ga0209025_1053610 3300025294 Bacteria 1579
274 Ga0209564_1000116 3300025295 Bacteria 207889
275 Ga0209564_1000125 3300025295 Bacteria 201709
276 Ga0209564_1001273 3300025295 Bacteria 27736
277 Ga0209564_1006616 3300025295 Bacteria 6198
278 Ga0209564_1012066 3300025295 Bacteria 3803
279 Ga0209564_1058417 3300025295 Bacteria 881
280 Ga0209758_1000090 3300025297 Bacteria 246564
281 Ga0209758_1000928 3300025297 Bacteria 39646
282 Ga0209758_1001022 3300025297 Bacteria 36959
283 Ga0209758_1001059 3300025297 Bacteria 35937
284 Ga0209758_1011649 3300025297 Bacteria 5058
285 Ga0209758_1026467 3300025297 Bacteria 2508
286 Ga0209050_1008219 3300025298 Bacteria 5632
287 Ga0209256_1000302 3300025299 Bacteria 86634
288 Ga0209256_1001684 3300025299 Bacteria 21424
289 Ga0209256_1001891 3300025299 Bacteria 19189
290 Ga0209256_1002912 3300025299 Bacteria 12900
291 Ga0209256_1009155 3300025299 Bacteria 4403
292 Ga0209256_1014436 3300025299 Bacteria 2842
293 Ga0209256_1058557 3300025299 Bacteria 905
294 Ga0207426_1000047 3300025302 Bacteria 417011
295 Ga0207426_1000173 3300025302 Bacteria 162697
296 Ga0207426_1000276 3300025302 Bacteria 106148
297 Ga0207426_1005686 3300025302 Bacteria 5630
298 Ga0209051_1000217 3300025303 Bacteria 97218
299 Ga0209051_1002526 3300025303 Bacteria 12962
300 Ga0209051_1004173 3300025303 Bacteria 9029
301 Ga0209051_1006675 3300025303 Bacteria 6456
302 Ga0209051_1101529 3300025303 Bacteria 772
303 Ga0209257_1003206 3300025304 Bacteria 14477
304 Ga0209257_1015357 3300025304 Bacteria 3195
305 Ga0207656_10020336 3300025321 Bacteria 2637
306 Ga0207696_1045172 3300025711 Bacteria 1275
307 Ga0207692_10058840 3300025898 Bacteria 1982
308 Ga0207692_10200248 3300025898 Bacteria 1173
309 Ga0207647_10158152 3300025904 Bacteria 1322
310 Ga0207685_10231152 3300025905 Bacteria 885
311 Ga0207699_10096059 3300025906 Bacteria 1870
312 Ga0207699_10134107 3300025906 Bacteria 1619
313 Ga0207645_10024258 3300025907 Bacteria 3934
314 Ga0207684_10314775 3300025910 Bacteria 1349
315 Ga0207684_10410950 3300025910 Bacteria 1163
316 Ga0207707_10135259 3300025912 Bacteria 2155
317 Ga0207695_10000049 3300025913 Bacteria 406233
318 Ga0207671_10000423 3300025914 Bacteria 58526
319 Ga0207693_10026518 3300025915 Bacteria 4586
320 Ga0207693_10084309 3300025915 Bacteria 2490
321 Ga0207693_10243154 3300025915 Bacteria 1413
322 Ga0207663_10126383 3300025916 Bacteria 1759
323 Ga0207663_10157492 3300025916 Bacteria 1599
324 Ga0207660_10241263 3300025917 Bacteria 1424
325 Ga0207657_10628970 3300025919 Bacteria 836
326 Ga0207652_10088171 3300025921 Bacteria 2722
327 Ga0207646_10104933 3300025922 Bacteria 2534
328 Ga0207646_10269021 3300025922 Bacteria 1540
329 Ga0207646_10309012 3300025922 Bacteria 1428
330 Ga0207681_10220415 3300025923 Bacteria 1467
331 Ga0207681_10271618 3300025923 Bacteria 1331
332 Ga0207681_11113453 3300025923 Bacteria 663
333 Ga0207650_10209302 3300025925 Bacteria 1566
334 Ga0207700_10095361 3300025928 Bacteria 2360
335 Ga0207700_10220149 3300025928 Bacteria 1609
336 Ga0207700_10262556 3300025928 Bacteria 1479
337 Ga0207664_10060003 3300025929 Bacteria 3031
338 Ga0207664_10224567 3300025929 Bacteria 1630
339 Ga0207644_10264130 3300025931 Bacteria 1377
340 Ga0207644_10582514 3300025931 Unclassified 928
341 Ga0207706_10230873 3300025933 Bacteria 1619
342 Ga0207686_10132070 3300025934 Bacteria 1714
343 Ga0207686_10200592 3300025934 Bacteria 1429
344 Ga0207709_10099678 3300025935 Bacteria 1918
345 Ga0207665_10250916 3300025939 Bacteria 1307
346 Ga0207711_10756856 3300025941 Bacteria 905
347 Ga0207667_10347574 3300025949 Bacteria 1513
348 Ga0207651_10767345 3300025960 Bacteria 853
349 Ga0207712_10570095 3300025961 Bacteria 976
350 Ga0207668_10103324 3300025972 Bacteria 2122
351 Ga0207640_10464383 3300025981 Bacteria 1046
352 Ga0207658_10481082 3300025986 Bacteria 1103
353 Ga0207678_10580893 3300026067 Bacteria 982
354 Ga0207702_10149237 3300026078 Bacteria 2125
355 Ga0207702_11618146 3300026078 Bacteria 641
356 Ga0207683_10622710 3300026121 Bacteria 999
357 Ga0207698_10293101 3300026142 Bacteria 1511
358 Ga0209371_1000003 3300027312 Bacteria 1122971
359 Ga0209371_1000754 3300027312 Bacteria 26969
360 Ga0209371_1003973 3300027312 Bacteria 6754
361 Ga0209282_1006950 3300027666 Bacteria 7059
362 Ga0209813_10002417 3300027866 Bacteria 4274
363 Ga0209813_10103431 3300027866 Bacteria 972
364 Ga0209813_10314468 3300027866 Bacteria 612
365 Ga0268266_10011981 3300028379 Bacteria 7507
366 Ga0268266_10034631 3300028379 Bacteria 4295
367 Ga0268266_10072880 3300028379 Bacteria 2979
368 Ga0268266_10156848 3300028379 Bacteria 2057
369 Ga0268266_10224045 3300028379 Bacteria 1730
370 Ga0268266_10467900 3300028379 Bacteria 1200
371 Ga0268264_10094983 3300028381 Bacteria 2579
372 Ga0268264_10439188 3300028381 Bacteria 1262
373 Ga0307515_10009463 3300028794 Bacteria 18831
374 Ga0307515_10402070 3300028794 Bacteria 995
375 Ga0265338_10028832 3300028800 Bacteria 5524
376 Ga0268256_1000004 3300030500 Bacteria 1122967
377 Ga0268256_1001045 3300030500 Bacteria 18558
378 Ga0316181_1090172 3300030744 Bacteria 1313
379 Ga0265330_10057623 3300031235 Bacteria 1694
380 Ga0265330_10123026 3300031235 Bacteria 1105
381 Ga0265332_10001314 3300031238 Bacteria 14137
382 Ga0265325_10101459 3300031241 Bacteria 1408
383 Ga0265340_10003433 3300031247 Bacteria 8948
384 Ga0265339_10253329 3300031249 Bacteria 851
385 Ga0265331_10016539 3300031250 Bacteria 3869
386 Ga0265327_10001582 3300031251 Bacteria 27746
387 Ga0265327_10009688 3300031251 Bacteria 6905
388 Ga0307408_100063599 3300031548 Bacteria 2700
389 Ga0265313_10000071 3300031595 Bacteria 99087
390 Ga0265313_10075417 3300031595 Bacteria 1543
391 Ga0265314_10189503 3300031711 Bacteria 1225
392 Ga0265342_10000109 3300031712 Bacteria 91321
393 Ga0307405_10002195 3300031731 Bacteria 8532
394 Ga0307413_10956764 3300031824 Bacteria 731
395 Ga0307410_10602775 3300031852 Bacteria 916
396 Ga0307410_10676225 3300031852 Bacteria 868
397 Ga0307406_10121004 3300031901 Bacteria 1820
398 Ga0307412_10005299 3300031911 Bacteria 7239
399 Ga0307409_100507465 3300031995 Bacteria 1176
400 Ga0307416_102086984 3300032002 Bacteria 669
401 Ga0307414_10032062 3300032004 Bacteria 3455
402 Ga0373929_0064916 3300035085 Bacteria 862
403 Ga0373923_0174135 3300035111 Bacteria 986
404 Ga0373957_0112151 3300035120 Bacteria 1099
405 Ga0373946_0669765 3300035171 Bacteria 541
406 Ga0373955_0094364 3300035172 Bacteria 1710
407 Ga0373955_0180582 3300035172 Bacteria 1252
408 Ga0373931_0133046 3300035691 Bacteria 1433
409 Ga0373947_0185292 3300035725 Bacteria 1357
410 Ga0373937_0014776 3300036401 Bacteria 6893
411 Ga0373937_0019324 3300036401 Bacteria 6097
412 Ga0373937_0533418 3300036401 Bacteria 1115
413 Ga0436364_0081849 3300037853 Bacteria 1665
414 Ga0436364_0618716 3300037853 Bacteria 33597
415 Ga0436365_0542479 3300039437 Bacteria 736
416 Ga0436365_1508083 3300039437 Bacteria 723
417 Ga0436360_0019517 3300039438 Bacteria 768
418 Ga0436360_0231176 3300039438 Bacteria 1519
419 Ga0436360_0516963 3300039438 Bacteria 676
420 Ga0436360_0895959 3300039438 Bacteria 3054
421 Ga0436360_1289660 3300039438 Bacteria 907
422 Ga0436361_0143170 3300039447 Bacteria 2466
423 Ga0436361_0532911 3300039447 Bacteria 646
424 Ga0436361_0534853 3300039447 Bacteria 1525
425 Ga0436361_1100919 3300039447 Bacteria 2723
426 Ga0436363_0654601 3300039450 Bacteria 2189
427 Ga0436363_0880344 3300039450 Bacteria 807
428 Ga0436363_1100880 3300039450 Bacteria 1222
429 Ga0436363_1366878 3300039450 Bacteria 1009
430 Ga0436362_0094502 3300039453 Bacteria 1019
431 Ga0436362_0158312 3300039453 Bacteria 550
432 Ga0436362_0257070 3300039453 Bacteria 609
433 Ga0436362_0466020 3300039453 Bacteria 1306
434 Ga0436362_0623315 3300039453 Bacteria 1063
435 Ga0436362_0669034 3300039453 Bacteria 3213
436 Ga0436362_0823420 3300039453 Bacteria 1534
437 Ga0436362_0845409 3300039453 Bacteria 3478
438 Ga0436362_0995597 3300039453 Bacteria 1375
439 Ga0439436_0016885 3300041404 Bacteria 2187
440 Ga0439438_055219 3300041405 Bacteria 1002
441 Ga0439447_050665 3300041407 Bacteria 992
442 Ga0439465_0006574 3300041413 Bacteria 3692
443 Ga0451787_407566 3300041441 Bacteria 713
444 Ga0451789_0208705 3300041443 Bacteria 1004
445 Ga0451791_1709245 3300041451 Bacteria 1061
446 Ga0451795_0214798 3300041456 Bacteria 1132
447 Ga0451804_0302100 3300041463 Bacteria 1294
448 Ga0451807_0031448 3300041486 Bacteria 658
449 Ga0451833_0843237 3300041491 Bacteria 805
450 Ga0451837_1541397 3300041494 Bacteria 2545
451 Ga0451839_0859990 3300041496 Bacteria 1533
452 Ga0451840_09647 3300041497 Bacteria 928
453 Ga0451847_0364609 3300041503 Bacteria 2954
454 Ga0451847_0587092 3300041503 Bacteria 3106
455 Ga0451850_46590 3300041506 Bacteria 540
456 Ga0451851_1065096 3300041507 Bacteria 533
457 Ga0451843_0075634 3300041509 Bacteria 741
458 Ga0451855_0104832 3300041511 Bacteria 1183
459 Ga0451853_3873447 3300041512 Bacteria 3104
460 Ga0452268_49458 3300041907 Bacteria 1129
461 Ga0452271_19773 3300041916 Bacteria 828
462 Ga0439445_0022617 3300042004 Bacteria 1587
463 Ga0439432_042481 3300042006 Bacteria 1437
464 Ga0439449_0039594 3300042007 Bacteria 1753
465 Ga0439457_019057 3300042014 Bacteria 1524
466 Ga0439462_0008102 3300042015 Bacteria 2644
467 Ga0450919_020089 3300042121 Bacteria 754
468 Ga0450920_008995 3300042122 Bacteria 1836
469 Ga0450923_099404 3300042125 Bacteria 670
470 Ga0450907_011757 3300042146 Bacteria 1453
471 Ga0439434_0004563 3300042435 Bacteria 4051
472 Ga0439435_0004996 3300042436 Bacteria 2891
473 Ga0439459_0016619 3300042438 Bacteria 1362
474 Ga0439464_0063294 3300042439 Bacteria 1085
475 Ga0450918_001934 3300042531 Bacteria 3996
476 Ga0466965_0723203 3300044683 Bacteria 572
477 Ga0466966_0194733 3300044684 Bacteria 1227
478 Ga0466961_0473358 3300044693 Bacteria 757
479 Ga0466963_0030718 3300044694 Bacteria 3468
480 Ga0466963_0032214 3300044694 Bacteria 3393
481 Ga0466971_0060999 3300044719 Bacteria 1705
482 Ga0466970_0019852 3300044765 Bacteria 3487
483 Ga0466957_0019798 3300044842 Bacteria 3961
484 Ga0466957_0056491 3300044842 Bacteria 2401
485 Ga0466960_0019997 3300044901 Bacteria 2959
486 Ga0466959_0141396 3300045049 Bacteria 1701
487 Ga0466959_0261923 3300045049 Bacteria 1190
488 Ga0466958_0505015 3300045836 Bacteria 785
489 Ga0466967_0349614 3300045976 Bacteria 1431
490 Ga0495617_062497 3300046452 Bacteria 1230
491 Ga0495592_0086233 3300046454 Bacteria 2262
492 Ga0495592_0319433 3300046454 Bacteria 1004
493 Ga0495629_0039582 3300046459 Bacteria 3317
494 Ga0495638_0000309 3300046460 Bacteria 62979
495 Ga0495638_0069479 3300046460 Bacteria 2159
496 Ga0495605_0037531 3300046474 Bacteria 2436
497 Ga0495639_0065864 3300046475 Bacteria 1667
498 Ga0495607_0021181 3300046501 Bacteria 4093
499 Ga0495607_0226959 3300046501 Bacteria 910
500 Ga0495583_0078743 3300046506 Bacteria 1435
501 Ga0495583_0133004 3300046506 Bacteria 1040
502 Ga0495606_0012844 3300046507 Bacteria 6673
503 Ga0495606_0042743 3300046507 Bacteria 3028
504 Ga0495606_0058480 3300046507 Bacteria 2477
505 Ga0495608_0170311 3300046511 Bacteria 1381
506 Ga0495610_0031433 3300046512 Bacteria 2769
507 Ga0495618_0242727 3300046514 Bacteria 1132
508 Ga0495618_0361185 3300046514 Bacteria 894
509 Ga0495620_0040469 3300046515 Bacteria 2050
510 Ga0495628_0180517 3300046516 Bacteria 1597
511 Ga0495628_0261403 3300046516 Bacteria 1290
512 Ga0495631_0001992 3300046518 Bacteria 11939
513 Ga0495632_0025059 3300046519 Bacteria 3159
514 Ga0495632_0087348 3300046519 Bacteria 1482
515 Ga0495643_0067987 3300046522 Bacteria 1875
516 Ga0495643_0123527 3300046522 Bacteria 1306
517 Ga0495652_0284336 3300046529 Bacteria 1210
518 Ga0495652_0294827 3300046529 Bacteria 1182
519 Ga0495654_0041574 3300046530 Bacteria 2286
520 Ga0495609_0347151 3300046538 Bacteria 599
521 Ga0495597_0193825 3300046542 Bacteria 816
522 Ga0495633_0502749 3300046558 Bacteria 546
523 Ga0495667_0065733 3300046559 Bacteria 2372
524 Ga0495668_0011139 3300046616 Bacteria 5402
525 Ga0495668_0079944 3300046616 Bacteria 1794
526 Ga0495611_0045098 3300046648 Bacteria 1974
527 Ga0495625_0004853 3300046660 Bacteria 12545
528 Ga0495625_0121777 3300046660 Bacteria 1774
529 Ga0495625_0221920 3300046660 Bacteria 1238
530 Ga0495635_0378240 3300046663 Bacteria 942
531 Ga0495657_0040710 3300046675 Bacteria 3185
532 Ga0495658_0263988 3300046683 Bacteria 1084
533 Ga0495624_0091043 3300046690 Bacteria 1882
534 Ga0495670_0019978 3300046691 Bacteria 3301
535 Ga0495649_0112677 3300046694 Bacteria 1442
536 Ga0495649_0365141 3300046694 Bacteria 728
537 Ga0495600_0258948 3300046809 Bacteria 1105
538 Ga0495660_0016850 3300046810 Bacteria 4210
539 Ga0495660_0060357 3300046810 Bacteria 2037
540 Ga0495604_0075272 3300047317 Bacteria 2542
541 Ga0495604_0567360 3300047317 Bacteria 730
542 Ga0495604_0735940 3300047317 Bacteria 624
543 Ga0495674_0087909 3300047319 Bacteria 2659
544 Ga0495672_0350130 3300047320 Bacteria 686
545 Ga0495675_0123565 3300047444 Bacteria 1611
546 Ga0495684_0009627 3300047471 Bacteria 7453
547 Ga0495686_0017503 3300047472 Bacteria 4824
548 Ga0495686_0067652 3300047472 Bacteria 2205
549 Ga0495686_0173679 3300047472 Bacteria 1252
550 Ga0495593_0340664 3300047673 Bacteria 749
551 Ga0495602_0416384 3300048088 Bacteria 955
552 Ga0496100_0153409 3300048903 Bacteria 1645
553 Ga0496100_0303130 3300048903 Bacteria 1196
554 Ga0496100_0453006 3300048903 Bacteria 984
555 Ga0496101_0462676 3300048904 Bacteria 1001
556 Ga0496101_0516930 3300048904 Bacteria 943
557 Ga0496101_0674307 3300048904 Bacteria 817
558 Ga0496102_0067664 3300048905 Bacteria 3276
559 Ga0496102_0511969 3300048905 Bacteria 1123
560 Ga0496103_0016713 3300048906 Bacteria 4382
561 Ga0496104_0687987 3300048907 Bacteria 931
562 Ga0496106_0020408 3300048909 Bacteria 4917
563 Ga0496106_0276639 3300048909 Bacteria 1344
564 Ga0496107_0657807 3300048910 Bacteria 772
565 Ga0496111_0474809 3300048914 Bacteria 922
566 Ga0496113_0379032 3300048916 Bacteria 1135
567 Ga0496114_0556786 3300048917 Bacteria 1013
568 Ga0496116_0000471 3300048919 Bacteria 55687
569 Ga0496116_0009680 3300048919 Bacteria 8194
570 Ga0496116_0244430 3300048919 Bacteria 898
571 Ga0496116_0284390 3300048919 Bacteria 798
572 Ga0496116_0400494 3300048919 Bacteria 607
573 Ga0496117_0000926 3300048920 Bacteria 44886
574 Ga0496117_0185065 3300048920 Bacteria 1193
575 Ga0496117_0318204 3300048920 Bacteria 816
576 Ga0496118_0004170 3300048921 Bacteria 17423
577 Ga0496118_0141697 3300048921 Bacteria 1522
578 Ga0496118_0145749 3300048921 Bacteria 1491
579 Ga0496118_0250429 3300048921 Bacteria 1007
580 Ga0496118_0253836 3300048921 Bacteria 997
581 Ga0496118_0302711 3300048921 Bacteria 877
582 Ga0496118_0413769 3300048921 Bacteria 696
583 Ga0496119_0039986 3300048922 Bacteria 3006
584 Ga0496119_0116439 3300048922 Bacteria 1475
585 Ga0496120_0005399 3300048923 Bacteria 10212
586 Ga0496120_0007027 3300048923 Bacteria 8459
587 Ga0496121_0000003 3300048924 Bacteria 1191431
588 Ga0496121_0005102 3300048924 Bacteria 17115
589 Ga0496121_0009341 3300048924 Bacteria 11300
590 Ga0496121_0053078 3300048924 Bacteria 3398
591 Ga0496121_0069691 3300048924 Bacteria 2836
592 Ga0496121_0084335 3300048924 Bacteria 2505
593 Ga0496121_0130329 3300048924 Bacteria 1883
594 Ga0496121_0476070 3300048924 Bacteria 798
595 Ga0496121_0768433 3300048924 Bacteria 570
596 Ga0496122_0009597 3300048925 Bacteria 10139
597 Ga0496122_0037476 3300048925 Bacteria 3902
598 Ga0496122_0060029 3300048925 Bacteria 2804
599 Ga0496122_0067451 3300048925 Bacteria 2577
600 Ga0496122_0094425 3300048925 Bacteria 2024
601 Ga0496122_0140257 3300048925 Bacteria 1513
602 Ga0496122_0141207 3300048925 Bacteria 1506
603 Ga0496123_0023449 3300048926 Bacteria 4722
604 Ga0496123_0024629 3300048926 Bacteria 4567
605 Ga0496123_0038048 3300048926 Bacteria 3387
606 Ga0496123_0050894 3300048926 Bacteria 2764
607 Ga0496123_0131757 3300048926 Bacteria 1383
608 Ga0496124_0009174 3300048927 Bacteria 10216
609 Ga0496124_0049503 3300048927 Bacteria 3585
610 Ga0496124_0064523 3300048927 Bacteria 3056
611 Ga0496124_0102607 3300048927 Bacteria 2314
612 Ga0496124_0197531 3300048927 Bacteria 1533
613 Ga0496124_0587103 3300048927 Bacteria 727
614 Ga0496124_0901395 3300048927 Bacteria 536
615 Ga0496125_0000170 3300048928 Bacteria 145369
616 Ga0496125_0009728 3300048928 Bacteria 9817
617 Ga0496125_0035928 3300048928 Bacteria 4335
618 Ga0496125_0102245 3300048928 Bacteria 2106
619 Ga0496125_0148216 3300048928 Bacteria 1617
620 Ga0496125_0246914 3300048928 Bacteria 1129
621 Ga0496125_0355911 3300048928 Bacteria 872
622 Ga0496126_0002372 3300048929 Bacteria 25676
623 Ga0496126_0037624 3300048929 Bacteria 4513
624 Ga0496126_0084180 3300048929 Bacteria 2805
625 Ga0496126_0789363 3300048929 Bacteria 729
626 Ga0495678_006657 3300049459 Bacteria 6113
627 Ga0495678_111890 3300049459 Bacteria 930
628 Ga0501031_0310817 3300049568 Bacteria 1021
629 Ga0501032_0578350 3300049569 Bacteria 715
630 Ga0501034_0251502 3300049571 Bacteria 1712
631 Ga0501034_1687434 3300049571 Bacteria 506
632 Ga0501038_0011417 3300049574 Bacteria 8107
633 Ga0501039_0105975 3300049575 Bacteria 2195
634 Ga0501040_0003607 3300049576 Bacteria 10012
635 Ga0501041_0010663 3300049577 Bacteria 5421
636 Ga0501042_0068196 3300049578 Bacteria 2543
637 Ga0501068_0268456 3300049584 Bacteria 1089
638 Ga0501072_0018494 3300049588 Bacteria 5368
639 Ga0501073_0134883 3300049589 Bacteria 1711
640 Ga0501074_0195330 3300049590 Bacteria 1442
641 Ga0501075_0001615 3300049591 Bacteria 14766
642 Ga0501076_0633112 3300049592 Bacteria 882
643 Ga0501077_0028042 3300049593 Bacteria 3578
644 Ga0501079_0001635 3300049741 Bacteria 15962
645 Ga0501079_0666567 3300049741 Bacteria 819
646 Ga0501081_0008108 3300049743 Bacteria 6817
647 Ga0501083_0038421 3300049744 Bacteria 3254
648 Ga0501083_0046964 3300049744 Bacteria 2919
649 Ga0501280_001681 3300049776 Bacteria 3938
650 Ga0501045_0006414 3300049824 Bacteria 8147
651 nmdc:mga03683_32348_c1 3300050489 Bacteria 2104
652 nmdc:mga03n38_449728_c1 3300050490 Bacteria 716
653 nmdc:mga00v17_346_c1 3300050491 Bacteria 10246
654 nmdc:mga00v17_53948_c1 3300050491 Bacteria 2452
655 nmdc:mga0yw44_237894_c1 3300050492 Bacteria 1210
656 nmdc:mga0yw44_548944_c1 3300050492 Bacteria 785
657 nmdc:mga07m45_647116_c1 3300050496 Bacteria 609
658 Ga0495601_0176866 3300053077 Bacteria 1395
659 Ga0495601_0729615 3300053077 Bacteria 631
660 Ga0495601_0743062 3300053077 Bacteria 625
661 Ga0495612_0125200 3300053078 Bacteria 1107
662 Ga0500610_0208561 3300053079 Bacteria 935
663 Ga0495595_0172407 3300053084 Bacteria 1071
664 Ga0495619_0000134 3300053085 Bacteria 54869
665 Ga0495619_0060815 3300053085 Bacteria 2512
666 Ga0495619_0732190 3300053085 Bacteria 671
667 Ga0500578_0029910 3300053086 Bacteria 3499
668 Ga0500578_0137565 3300053086 Bacteria 1528
669 Ga0500569_004245 3300053109 Bacteria 3002
670 Ga0500658_0001711 3300053134 Bacteria 8677
671 Ga0500559_0254685 3300053136 Bacteria 827
672 Ga0500568_0002138 3300053139 Bacteria 11923
673 Ga0500573_0094131 3300053140 Bacteria 1690
674 Ga0500590_012886 3300053148 Bacteria 4277
675 Ga0500616_0000980 3300053153 Bacteria 30834
676 Ga0500616_0034036 3300053153 Bacteria 2777
677 Ga0500620_307035 3300053155 Bacteria 512
678 Ga0500622_0023736 3300053156 Bacteria 3247
679 Ga0500636_0000245 3300053177 Bacteria 29922
680 Ga0500636_0003701 3300053177 Bacteria 8626
681 Ga0501084_0000335 3300054114 Bacteria 35922
682 Ga0587066_003650 3300059490 Bacteria 1828
683 Ga0587083_0028683 3300059505 Bacteria 1091
684 Ga0587088_012580 3300059508 Bacteria 1283
685 Ga0587098_006236 3300059604 Bacteria 1201
686 Ga0587106_040908 3300059605 Bacteria 786
687 Ga0587101_036989 3300059623 Bacteria 789
688 Ga0587128_028793 3300059630 Bacteria 906
689 Ga0587067_070377 3300059640 Bacteria 754
690 Ga0587068_004192 3300059641 Bacteria 1893
691 Ga0501082_0115600 3300060353 Bacteria 2323
692 Ga0501082_0123434 3300060353 Bacteria 2245
693 Ga0501082_0458561 3300060353 Bacteria 1114
694 Ga0530510_0525812 3300061734 Bacteria 897
695 Ga0530510_0998545 3300061734 Bacteria 640
696 2509389990 2509276021 Bacteria 7634384
697 2509447773 2509276033 Bacteria 7180565
698 2510134687 2510065019 Bacteria 6903379
699 2510896038 2510461076 Bacteria 8618824
700 2511137312 2510917022 Bacteria 6504556
701 2511175184 2510917026 Bacteria 7046020
702 2511200445 2510917030 Bacteria 7460662
703 2512974039 2512875026 Bacteria 6861065
704 2513573261 2513237084 Bacteria 7231967
705 2513578488 2513237085 Bacteria 7695351
706 2513600730 2513237088 Bacteria 6927906
707 2513602244 2513237089 Bacteria 6553624
708 2513631474 2513237093 Bacteria 7545552
709 2513710593 2513237103 Bacteria 7647401
710 2513867585 2513237138 Bacteria 7368160
711 2513926814 2513237146 Bacteria 7166346
712 2513985474 2513237156 Bacteria 6402557
713 2513997972 2513237159 Bacteria 6810126
714 2514003887 2513237160 Bacteria 6650282
715 2514023424 2513237162 Bacteria 7468464
716 2515113778 2515075009 Bacteria 7288508
717 2515634641 2515154113 Bacteria 7807172
718 2515645315 2515154114 Bacteria 7848616
719 2515660880 2515154116 Bacteria 7552979
720 2515743500 2515154134 Bacteria 7220242
721 2517037389 2516653077 Bacteria 7555578
722 2517077689 2516653085 Bacteria 7346596
723 2517096488 2517093000 Bacteria 7412387
724 2517410584 2517287029 Bacteria 6905599
725 2517570897 2517487022 Bacteria 7227575
726 2520378260 2519899620 Bacteria 6499161
727 2523470077 2523231067 Bacteria 5230452
728 2524462051 2524023209 Bacteria 6679728
729 2530646805 2529292951 Bacteria 6916614
730 2535519588 2534681796 Bacteria 7146037
731 2537876453 2537561587 Bacteria 5425293
732 2554245242 2554235003 Bacteria 5877155
733 2559296928 2558860242 Bacteria 5568029
734 2585167893 2582581283 Bacteria 6030556
735 2585204866 2582581294 Bacteria 6626667
736 2585224949 2582581298 Bacteria 7315509
737 2585227637 2582581299 Bacteria 6518058
738 2585257649 2582581304 Bacteria 5831370
739 2585265491 2582581306 Bacteria 6450535
740 2585274140 2582581307 Bacteria 6597605
741 2585280450 2582581308 Bacteria 7413247
742 2585322723 2582581315 Bacteria 7318924
743 2585330842 2582581316 Bacteria 7774528
744 2585388408 2582581865 Bacteria 6644329
745 2585392305 2582581866 Bacteria 6859583
746 2585403390 2582581867 Bacteria 7184437
747 2585529599 2585427526 Bacteria 7258840
748 2585532678 2585427527 Bacteria 7273426
749 2585541167 2585427528 Bacteria 6842387
750 2585547505 2585427529 Bacteria 7395659
751 2585554306 2585427530 Bacteria 7383882
752 2585560589 2585427531 Bacteria 6992870
753 2585823686 2585427590 Bacteria 6824633
754 2585839930 2585427593 Bacteria 7141551
755 2585845167 2585427594 Bacteria 6180594
756 2585898799 2585427608 Bacteria 6544331
757 2585903613 2585427609 Bacteria 6667127
758 2585997010 2585427633 Bacteria 6413184
759 2586001609 2585427634 Bacteria 6455027
760 2587981267 2585428125 Bacteria 6662905
761 2599420693 2599185170 Bacteria 7295545
762 2599604616 2599185210 Bacteria 5624189
763 2599722478 2599185236 Bacteria 6875203
764 2600373776 2600254933 Bacteria 4750527
765 2601611225 2600255279 Bacteria 5605316
766 2601747998 2600255308 Bacteria 5611129
767 2616295410 2615840624 Bacteria 6557588
768 2616307251 2615840626 Bacteria 7921970
769 2616554794 2615840698 Bacteria 7319877
770 2617383475 2617270742 Bacteria 6808054
771 2643858269 2643221568 Bacteria 5187270
772 2644006253 2643221599 Bacteria 6292121
773 2644050957 2643221607 Bacteria 6314006
774 2644191545 2643221634 Bacteria 6705461
775 2644205460 2643221636 Bacteria 6583769
776 2644209968 2643221637 Bacteria 5345260
777 2644241703 2643221643 Bacteria 5749658
778 2644299135 2643221653 Bacteria 4569637
779 2644483861 2643221686 Bacteria 6310811
780 2644496260 2643221688 Bacteria 5260751
781 2644500332 2643221689 Bacteria 6042950
782 2644521170 2643221693 Bacteria 5513853
783 2644653519 2643221718 Bacteria 5345506
784 2644657363 2643221719 Bacteria 4568197
785 2671112048 2667528174 Bacteria 6435400
786 2719182458 2718217882 Bacteria 6556348
787 2719387115 2718217927 Bacteria 6972593
788 2719666761 2718217997 Bacteria 6740740
789 2719733177 2718218009 Bacteria 6478651
790 2720493181 2718218199 Bacteria 6740745
791 2720614658 2718218232 Bacteria 6720332
792 2720621431 2718218233 Bacteria 6662049
793 2720632759 2718218235 Bacteria 6630699
794 2720776483 2718218269 Bacteria 6906114
795 2721148571 2718218363 Bacteria 6524337
796 2721159957 2718218365 Bacteria 6274507
797 2721165385 2718218366 Bacteria 6425255
798 2721400750 2718218423 Bacteria 6438183
799 2722841555 2721755514 Bacteria 6424414
800 2723028071 2721755556 Bacteria 6745503
801 2723561702 2721755684 Bacteria 6859907
802 2723568331 2721755685 Bacteria 6704835
803 2724039563 2721755809 Bacteria 6438790
804 2724045933 2721755810 Bacteria 6479005
805 2724091090 2721755819 Bacteria 6906405
806 2724105596 2721755822 Bacteria 6726041
807 2724111422 2721755823 Bacteria 6752556
808 2725947674 2724679232 Bacteria 7646494
809 2730109007 2728369352 Bacteria 6745171
810 2730165693 2728369365 Bacteria 6555560
811 2730299589 2728369397 Bacteria 6274511
812 2738800615 2738541293 Bacteria 7065685
813 2739035719 2738541333 Bacteria 7106503
814 2739350824 2738543031 Bacteria 5769731
815 2766065480 2765235942 Bacteria 7445910
816 2778175868 2775507266 Bacteria 7392367
817 2793293790 2791355256 Bacteria 6798008
818 2793313208 2791355259 Bacteria 7254731
819 2793319868 2791355260 Bacteria 6598818
820 2793328128 2791355261 Bacteria 6661293
821 2793333225 2791355262 Bacteria 6774204
822 2793343828 2791355263 Bacteria 6872478
823 2793347228 2791355264 Bacteria 6429314
824 2793356636 2791355265 Bacteria 6539969
825 2793362904 2791355266 Bacteria 7116587
826 2793370069 2791355267 Bacteria 7222458
827 2802718013 2802428858 Bacteria 6636079
828 2802725136 2802428859 Bacteria 6667919
829 2802730740 2802428860 Bacteria 6525526
830 2802738087 2802428861 Bacteria 6534206
831 2802744043 2802428862 Bacteria 6633353
832 2802750922 2802428863 Bacteria 6410669
833 2805930696 2802429605 Bacteria 6875453
834 2805934169 2802429606 Bacteria 6346811
835 2806044706 2802429633 Bacteria 7341974
836 2806052906 2802429634 Bacteria 7083200
837 2806059206 2802429635 Bacteria 7650140
838 2806068131 2802429636 Bacteria 7597525
839 2806074251 2802429637 Bacteria 7067217
840 2808987444 2808606387 Bacteria 5697198
841 2819243706 2818991272 Bacteria 4622173
842 2819557237 2818991439 Bacteria 6907412
843 2819609748 2818991448 Bacteria 6772224
844 2819639847 2818991453 Bacteria 7181617
845 2838018958 2838016132 Bacteria 6577831
846 2838024442 2838022645 Bacteria 6494267
847 2838032987 2838029111 Bacteria 6603031
848 2838040633 2838035591 Bacteria 7166484
849 2838046399 2838042994 Bacteria 6046894
850 2838051326 2838048938 Bacteria 6044578
851 2838063696 2838061910 Bacteria 6794874
852 2838074267 2838068647 Bacteria 6208656
853 2838664979 2838661181 Bacteria 7385261
854 2838671300 2838668709 Bacteria 6671819
855 2838678221 2838675328 Bacteria 4909118
856 2838685110 2838680041 Bacteria 6545511
857 2838699053 2838694306 Bacteria 6853137
858 2838703519 2838701080 Bacteria 6669771
859 2838712534 2838707686 Bacteria 6619912
860 2838716873 2838714209 Bacteria 5525906
861 2838722517 2838719591 Bacteria 5523910
862 2838727622 2838724970 Bacteria 4908691
863 2841849228 2841846520 Bacteria 5345850
864 2841853704 2841851746 Bacteria 7532261
865 2841861701 2841859092 Bacteria 5436171
866 2842082011 2842077413 Bacteria 6508645
867 2842113595 2842110456 Bacteria 7656360
868 2842122933 2842118031 Bacteria 7033875
869 2842128023 2842124991 Bacteria 5346824
870 2842133114 2842130223 Bacteria 4909145
871 2842149479 2842146304 Bacteria 5957337
872 2842155108 2842152218 Bacteria 4908957
873 2842169845 2842163707 Bacteria 6916235
874 2842173607 2842170452 Bacteria 5525737
875 2842178729 2842175837 Bacteria 4908771
876 2842189980 2842187318 Bacteria 5524014
877 2842199985 2842198810 Bacteria 6608673
878 2842208155 2842205361 Bacteria 6340321
879 2842214294 2842211629 Bacteria 5523832
880 2842220232 2842217011 Bacteria 7497767
881 2842227013 2842224351 Bacteria 5524473
882 2842242164 2842237096 Bacteria 6620661
883 2842253883 2842250916 Bacteria 6579627
884 2842266464 2842264693 Bacteria 6472963
885 2842281836 2842278818 Bacteria 6340002
886 2842288940 2842285085 Bacteria 6011953
887 2842296011 2842291075 Bacteria 7076806
888 2842298550 2842298080 Bacteria 6123127
889 2842308065 2842304105 Bacteria 7023636
890 2842316157 2842311132 Bacteria 6616990
891 2842321552 2842317721 Bacteria 6793725
892 2842362402 2842357229 Bacteria 6485165
893 2842377177 2842370503 Bacteria 7038661
894 2842382410 2842377471 Bacteria 7140707
895 2842389811 2842384541 Bacteria 7057858
896 2842398679 2842395702 Bacteria 6780583
897 2842406393 2842402390 Bacteria 6681310
898 2842413180 2842409023 Bacteria 6687331
899 2842419823 2842415677 Bacteria 6596907
900 2842427891 2842422224 Bacteria 6239196
901 2842429783 2842428310 Bacteria 6767288
902 2842436557 2842434925 Bacteria 6502746
903 2842446806 2842441272 Bacteria 6769273
904 2842450879 2842447887 Bacteria 6754142
905 2842464204 2842462802 Bacteria 6588055
906 2842470886 2842469257 Bacteria 6752936
907 2842479720 2842475841 Bacteria 6603183
908 2842483536 2842482326 Bacteria 7212537
909 2842493112 2842489311 Bacteria 6620893
910 2842499318 2842495871 Bacteria 6820686
911 2842506896 2842502639 Bacteria 6604161
912 2842510580 2842509118 Bacteria 6850950
913 2842518033 2842515876 Bacteria 5436280
914 2842523076 2842521101 Bacteria 6569494
915 2842776119 2842775625 Bacteria 5587290
916 2844002443 2844002411 Bacteria 7168230
917 2852391032 2852387548 Bacteria 8025568
918 2854900376 2854896431 Bacteria 5869725
919 2854920207 2854916844 Bacteria 5725939
920 2871467003 2871466892 Bacteria 6923287
921 2883296039 2883291878 Bacteria 5894118
922 2883358795 2883354860 Bacteria 5865246
923 2889793249 2889790730 Bacteria 5689708
924 2899792787 2899792073 Bacteria 4926588
925 2899845474 2899845264 Bacteria 5672268
926 2906384376 2906378014 Bacteria 6911440
927 2913299734 2913295892 Bacteria 6333755
928 2915980444 2915980308 Bacteria 6624279
929 2916067022 2916061851 Bacteria 6737736
930 2919104399 2919100787 Bacteria 7710546
931 2919117064 2919114240 Bacteria 5700270
932 2919169764 2919166419 Bacteria 4952238
933 2919173254 2919171160 Bacteria 6499771
934 2919410532 2919408235 Bacteria 6149349
935 2921252262 2921250672 Bacteria 6677771
936 2923558931 2923556063 Bacteria 6793593
937 2926758577 2926754445 Bacteria 5964435
938 2926763891 2926760298 Bacteria 5505990
939 2929141283 2929138655 Bacteria 5810547
940 2929205085 2929199973 Bacteria 7260745
941 2933009513 2933006813 Bacteria 4912075
942 2933013662 2933011516 Bacteria 5439334
943 2933018165 2933016740 Bacteria 6355406
944 2933574514 2933570622 Bacteria 7023390
945 2933589115 2933586486 Bacteria 7667493
946 2933598096 2933594066 Bacteria 5594265
947 2933604722 2933599457 Bacteria 5858799
948 2935899885 2935894831 Bacteria 6620579
949 2935907054 2935901341 Bacteria 7341747
950 2936375023 2936367885 Bacteria 7324495
951 2936380714 2936375103 Bacteria 6652732
952 2936382117 2936381700 Bacteria 7006523
953 2937033115 2937029754 Bacteria 6424026
954 2937036617 2937036028 Bacteria 6846469
955 2937078510 2937078374 Bacteria 6610289
956 2937089790 2937084907 Bacteria 6618516
957 2957377559 2957375807 Bacteria 6425588
958 2957437268 2957437181 Bacteria 6568994
959 2960591158 2960591022 Bacteria 6622873
960 2960636536 2960631154 Bacteria 6732508
961 2960682526 2960680706 Bacteria 6624464
962 2960696887 2960693952 Bacteria 6749742
963 2967690489 2967686174 Bacteria 6678622
964 2967729625 2967728569 Bacteria 6641507
965 2970028184 2970026789 Bacteria 6785236
966 2970126050 2970122695 Bacteria 6625855
967 2970146512 2970143518 Bacteria 6446480
968 2977534235 2977530762 Bacteria 6951399
969 2978972183 2978969890 Bacteria 5400756
970 2979091011 2979089926 Bacteria 5670289
971 2979096537 2979095461 Bacteria 5669583
972 2979102269 2979100975 Bacteria 5423623
973 2984509783 2984509177 Bacteria 5274802
974 2984519520 2984518228 Bacteria 5277463
975 2984538121 2984537506 Bacteria 5277481
976 2984590409 2984587000 Bacteria 5263363
977 2984604873 2984601300 Bacteria 5455244
978 2989779707 2989776772 Bacteria 4843317
979 2996890101 2996887358 Bacteria 5795980
980 2996895891 2996893221 Bacteria 5823108
981 3005415640 3005409236 Bacteria 7188837
982 3005418632 3005416602 Bacteria 7064308
983 3005449117 3005445848 Bacteria 6906074
984 3005455396 3005452660 Bacteria 5889319
985 639649852 639633055 Bacteria 7751309
986 650843349 650716007 Bacteria 5573770
987 8004002612 8003999396 Bacteria 7063185
988 8005262178 8005258706 Bacteria 6184835
989 8005281842 8005275841 Bacteria 6929066
990 8005288837 8005282627 Bacteria 6675747
991 8005294443 8005289223 Bacteria 6634003
992 8005306827 8005301065 Bacteria 6614431
993 8005310803 8005307578 Bacteria 7395396
994 8005318476 8005314921 Bacteria 7072929
995 8005324628 8005321885 Bacteria 5795980
996 8005378346 8005376324 Bacteria 6590079
997 8005385707 8005382845 Bacteria 6732062
998 8005401318 8005395548 Bacteria 6806915
999 8005434272 8005430974 Bacteria 6689030
1000 8005464465 8005460587 Bacteria 7157962
1001 8005488643 8005484373 Bacteria 6297373
1002 8005501508 8005497431 Bacteria 6477605
1003 8005547285 8005542996 Bacteria 7077758
1004 8005558537 8005556819 Bacteria 6908598
1005 8005566619 8005563573 Bacteria 7153261
1006 8005575092 8005570704 Bacteria 6957481
1007 8005622870 8005619151 Bacteria 7030230
1008 8005631830 8005626139 Bacteria 6534237
1009 8005649110 8005645114 Bacteria 6950293
1010 8005672929 8005668836 Bacteria 6953162
1011 8005682349 8005682033 Bacteria 6726518
1012 8005693476 8005688590 Bacteria 6610080
1013 8005700696 8005695170 Bacteria 6912330
1014 8018133764 8018127388 Bacteria 7351159
1015 8018153311 8018150411 Bacteria 5549903
1016 8018170062 8018163183 Bacteria 7277977
1017 8018178612 8018176218 Bacteria 6896178
1018 8023687708 8023680758 Bacteria 7729763
1019 8024481629 8024479707 Bacteria 6954785
1020 8024487857 8024486573 Bacteria 6540512
1021 8024506103 8024501048 Bacteria 6427847
1022 8045867508 8045864390 Bacteria 5043873
1023 8046772052 8046767195 Bacteria 7547379
1024 8055916205 8055909800 Bacteria 7278581
1025 8056381433 8056375014 Bacteria 7006639
1026 8056386876 8056382006 Bacteria 6408074
1027 8057577546 8057575449 Bacteria 7367519
1028 8057876666 8057874678 Bacteria 7494653
1029 Ga0070709_10002600
1030 JGI24740J21852_10018463
1031 JGI25155J39150_1000007
1032 JGI25156J39149_1000050
1033 JGI25156J39149_1000066
1034 JGI25162J39368_1001208
1035 JGI25162J39368_1001635
1036 JGI25154J39366_1000035
1037 JGI25158J39367_1000176
1038 JGI25157J39369_1000036
1039 JGI25152J39213_1001421
1040 JGI25152J39213_1001960
1041 JGI25152J39213_1002918
1042 JGI25152J39213_1014438
1043 JGI25152J39213_1014547
1044 JGI25152J39213_1018482
1045 JGI25150J39212_1000456
1046 JGI25150J39212_1002289
1047 JGI25159J45721_1000463
1048 JGI25159J45721_1016251
1049 JGI25151J46595_10000366
1050 JGI25151J46595_10000704
1051 JGI25151J46595_10006064
1052 JGI25151J46595_10012330
1053 JGI25151J46595_10012743
1054 JGI25151J46595_10038691
1055 JGI25151J46595_10059751
1056 JGI25406J46586_10001353
1057 JGI25165J46597_1001243
1058 JGI25165J46597_1003093
1059 JGI25153J46596_10003590
1060 JGI25153J46596_10034233
1061 JGI25153J46596_10036047
1062 JGI25153J46596_10046137
1063 JGI25160J50197_1000100
1064 JGI25160J50197_1009462
1065 JGI25160J50197_1013020
1066 JGI25160J50197_1014109
1067 JGI25161J50226_1000072
1068 JGI25161J50226_1000104
1069 JGI25161J50226_1001812
1070 Ga0006562J51391_1019493
1071 Ga0006562J51391_1020249
1072 Ga0055526_1001175
1073 Ga0055526_1003037
1074 Ga0055526_1006773
1075 Ga0055526_1013615
1076 Ga0055524_1003691
1077 Ga0055524_1005994
1078 Ga0055524_1006649
1079 Ga0055524_1024505
1080 Ga0055524_1035902
1081 Ga0055528_1000176
1082 Ga0055528_1001761
1083 Ga0055528_1002040
1084 Ga0055528_1007044
1085 Ga0055528_1010817
1086 Ga0055528_1020949
1087 Ga0055528_1043308
1088 Ga0055540_1020237
1089 Ga0055531_10026148
1090 Ga0058692_1003196
1091 Ga0058692_1008998
1092 Ga0058692_1033150
1093 Ga0055543_1000078
1094 Ga0055543_1000280
1095 Ga0055543_1001074
1096 Ga0065165_1000623
1097 Ga0065165_1021414
1098 Ga0065707_10838875
1099 Ga0070658_10093266
1100 Ga0070676_10194263
1101 Ga0070670_100221076
1102 Ga0070666_10075280
1103 Ga0070682_100895558
1104 Ga0070660_100300132
1105 Ga0070660_100609608
1106 Ga0070668_100037516
1107 Ga0070668_100167526
1108 Ga0070668_100423107
1109 Ga0070668_100504190
1110 Ga0070669_100267646
1111 Ga0070669_100549601
1112 Ga0070669_100651171
1113 Ga0070671_100133503
1114 Ga0070659_100258328
1115 Ga0070667_100061891
1116 Ga0070709_10088334
1117 Ga0070714_100316852
1118 Ga0070713_100006254
1119 Ga0070713_100049034
1120 Ga0070710_10005366
1121 Ga0070711_100467737
1122 Ga0070708_100159086
1123 Ga0070708_100184987
1124 Ga0070708_100503869
1125 Ga0070708_100739910
1126 Ga0070663_100500606
1127 Ga0070678_100466078
1128 Ga0070662_101202076
1129 Ga0070681_10077064
1130 Ga0070706_100249699
1131 Ga0070706_100416666
1132 Ga0070707_100134318
1133 Ga0070707_100213622
1134 Ga0070707_100313425
1135 Ga0070698_100007601
1136 Ga0070698_100036763
1137 Ga0070698_100222323
1138 Ga0070698_101188844
1139 Ga0070699_100275029
1140 Ga0070699_100623469
1141 Ga0070679_100553004
1142 Ga0070679_100638295
1143 Ga0070697_100154548
1144 Ga0070697_100162463
1145 Ga0070697_100337190
1146 Ga0070686_101653156
1147 Ga0070696_100091053
1148 Ga0070696_100869725
1149 Ga0070665_100009892
1150 Ga0070665_100057538
1151 Ga0070665_100091999
1152 Ga0070665_100456431
1153 Ga0068856_100919210
1154 Ga0068851_10009454
1155 Ga0068863_100927307
1156 Ga0068858_101733721
1157 Ga0068860_100075414
1158 Ga0068860_101331790
1159 Ga0081540_1007237
1160 Ga0081539_10001347
1161 Ga0081539_10003074
1162 Ga0070717_10011643
1163 Ga0070717_10972511
1164 Ga0075365_10008693
1165 Ga0075365_10188935
1166 Ga0075365_10377729
1167 Ga0075368_10001043
1168 Ga0075368_10082371
1169 Ga0075368_10101613
1170 Ga0075363_100058317
1171 Ga0075363_100167378
1172 Ga0075364_10025987
1173 Ga0075364_10669240
1174 Ga0070715_10050079
1175 Ga0070716_100053908
1176 Ga0070712_100037996
1177 Ga0070712_100086942
1178 Ga0075362_10038403
1179 Ga0075367_10005763
1180 Ga0075367_10008374
1181 Ga0075367_10123264
1182 Ga0075367_10298883
1183 Ga0075367_10314763
1184 Ga0075367_10880297
1185 Ga0075369_10051390
1186 Ga0075369_10114456
1187 Ga0075369_10134397
1188 Ga0075369_10140244
1189 Ga0075366_10008598
1190 Ga0075370_10012538
1191 Ga0075370_10105679
1192 Ga0075431_101048177
1193 Ga0075434_100349452
1194 Ga0099826_10010997
1195 Ga0099826_10146487
1196 Ga0099795_10127315
1197 Ga0105251_10006623
1198 Ga0105244_10199685
1199 Ga0105250_10019815
1200 Ga0105240_10000019
1201 Ga0105240_11271973
1202 Ga0111539_10538857
1203 Ga0111539_13367151
1204 Ga0105245_12140533
1205 Ga0105247_10514211
1206 Ga0105243_10042736
1207 Ga0105243_10225889
1208 Ga0105242_10206966
1209 Ga0105242_10728847
1210 Ga0105242_10858084
1211 Ga0105248_10145522
1212 Ga0105237_10000734
1213 Ga0105237_10912657
1214 Ga0123341_1000014
1215 Ga0123342_1007767
1216 Ga0123342_1011573
1217 Ga0105239_10000574
1218 Ga0105239_11053138
1219 Ga0105246_10442038
1220 Ga0157326_1035014
1221 Ga0157373_10003159
1222 Ga0157373_10160192
1223 Ga0157371_10000002
1224 Ga0157371_10007369
1225 Ga0157370_10000131
1226 Ga0157370_10001657
1227 Ga0157370_10088663
1228 Ga0157369_10056267
1229 Ga0157369_10370017
1230 Ga0157374_10292888
1231 Ga0157374_11346879
1232 Ga0163163_10677139
1233 Ga0182007_10007300
1234 Ga0182005_1004391
1235 Ga0163161_10436236
1236 Ga0214544_1000893
1237 Ga0214542_1000115
1238 Ga0214543_1000098
1239 Ga0213873_10012897
1240 Ga0213872_10042449
1241 Ga0213872_10197844
1242 Ga0213874_10032948
1243 Ga0213875_10000081
1244 Ga0213875_10002791
1245 Ga0213875_10193681
1246 Ga0213871_10073308
1247 Ga0209435_100005
1248 Ga0209760_102272
1249 Ga0209436_100023
1250 Ga0209436_100027
1251 Ga0209672_108909
1252 Ga0209437_100058
1253 Ga0209437_100313
1254 Ga0207425_1000058
1255 Ga0207425_1004542
1256 Ga0207425_1013825
1257 Ga0207425_1015411
1258 Ga0209646_1000011
1259 Ga0209026_1000008
1260 Ga0209677_100475
1261 Ga0209148_1010336
1262 Ga0209759_1000004
1263 Ga0209129_1000107
1264 Ga0209129_1000242
1265 Ga0209129_1002341
1266 Ga0209129_1003216
1267 Ga0209129_1003392
1268 Ga0209129_1003663
1269 Ga0209129_1005548
1270 Ga0209129_1006333
1271 Ga0209129_1019143
1272 Ga0209233_1000157
1273 Ga0209233_1000240
1274 Ga0209233_1000420
1275 Ga0209455_1017627
1276 Ga0209673_1000060
1277 Ga0209673_1000233
1278 Ga0209673_1000781
1279 Ga0209673_1001293
1280 Ga0209673_1001374
1281 Ga0209673_1005445
1282 Ga0209673_1008908
1283 Ga0209673_1011626
1284 Ga0209673_1068539
1285 Ga0209130_1000083
1286 Ga0209130_1000173
1287 Ga0209130_1017818
1288 Ga0209130_1033521
1289 Ga0209130_1043556
1290 Ga0209675_1038531
1291 Ga0209675_1041040
1292 Ga0209676_1013964
1293 Ga0209025_1000083
1294 Ga0209025_1000255
1295 Ga0209025_1000350
1296 Ga0209025_1004537
1297 Ga0209025_1016347
1298 Ga0209025_1019949
1299 Ga0209025_1022224
1300 Ga0209025_1027211
1301 Ga0209025_1053610
1302 Ga0209564_1000116
1303 Ga0209564_1000125
1304 Ga0209564_1001273
1305 Ga0209564_1006616
1306 Ga0209564_1012066
1307 Ga0209564_1058417
1308 Ga0209758_1000090
1309 Ga0209758_1000928
1310 Ga0209758_1001022
1311 Ga0209758_1001059
1312 Ga0209758_1011649
1313 Ga0209758_1026467
1314 Ga0209050_1008219
1315 Ga0209256_1000302
1316 Ga0209256_1001684
1317 Ga0209256_1001891
1318 Ga0209256_1002912
1319 Ga0209256_1009155
1320 Ga0209256_1014436
1321 Ga0209256_1058557
1322 Ga0207426_1000047
1323 Ga0207426_1000173
1324 Ga0207426_1000276
1325 Ga0207426_1005686
1326 Ga0209051_1000217
1327 Ga0209051_1002526
1328 Ga0209051_1004173
1329 Ga0209051_1006675
1330 Ga0209051_1101529
1331 Ga0209257_1003206
1332 Ga0209257_1015357
1333 Ga0207656_10020336
1334 Ga0207696_1045172
1335 Ga0207692_10058840
1336 Ga0207692_10200248
1337 Ga0207647_10158152
1338 Ga0207685_10231152
1339 Ga0207699_10096059
1340 Ga0207699_10134107
1341 Ga0207645_10024258
1342 Ga0207684_10314775
1343 Ga0207684_10410950
1344 Ga0207707_10135259
1345 Ga0207695_10000049
1346 Ga0207671_10000423
1347 Ga0207693_10026518
1348 Ga0207693_10084309
1349 Ga0207693_10243154
1350 Ga0207663_10126383
1351 Ga0207663_10157492
1352 Ga0207660_10241263
1353 Ga0207657_10628970
1354 Ga0207652_10088171
1355 Ga0207646_10104933
1356 Ga0207646_10269021
1357 Ga0207646_10309012
1358 Ga0207681_10220415
1359 Ga0207681_10271618
1360 Ga0207681_11113453
1361 Ga0207650_10209302
1362 Ga0207700_10095361
1363 Ga0207700_10220149
1364 Ga0207700_10262556
1365 Ga0207664_10060003
1366 Ga0207664_10224567
1367 Ga0207644_10264130
1368 Ga0207644_10582514
1369 Ga0207706_10230873
1370 Ga0207686_10132070
1371 Ga0207686_10200592
1372 Ga0207709_10099678
1373 Ga0207665_10250916
1374 Ga0207711_10756856
1375 Ga0207667_10347574
1376 Ga0207651_10767345
1377 Ga0207712_10570095
1378 Ga0207668_10103324
1379 Ga0207640_10464383
1380 Ga0207658_10481082
1381 Ga0207678_10580893
1382 Ga0207702_10149237
1383 Ga0207702_11618146
1384 Ga0207683_10622710
1385 Ga0207698_10293101
1386 Ga0209371_1000003
1387 Ga0209371_1000754
1388 Ga0209371_1003973
1389 Ga0209282_1006950
1390 Ga0209813_10002417
1391 Ga0209813_10103431
1392 Ga0209813_10314468
1393 Ga0268266_10011981
1394 Ga0268266_10034631
1395 Ga0268266_10072880
1396 Ga0268266_10156848
1397 Ga0268266_10224045
1398 Ga0268266_10467900
1399 Ga0268264_10094983
1400 Ga0268264_10439188
1401 Ga0307515_10009463
1402 Ga0307515_10402070
1403 Ga0265338_10028832
1404 Ga0268256_1000004
1405 Ga0268256_1001045
1406 Ga0316181_1090172
1407 Ga0265330_10057623
1408 Ga0265330_10123026
1409 Ga0265332_10001314
1410 Ga0265325_10101459
1411 Ga0265340_10003433
1412 Ga0265339_10253329
1413 Ga0265331_10016539
1414 Ga0265327_10001582
1415 Ga0265327_10009688
1416 Ga0307408_100063599
1417 Ga0265313_10000071
1418 Ga0265313_10075417
1419 Ga0265314_10189503
1420 Ga0265342_10000109
1421 Ga0307405_10002195
1422 Ga0307413_10956764
1423 Ga0307410_10602775
1424 Ga0307410_10676225
1425 Ga0307406_10121004
1426 Ga0307412_10005299
1427 Ga0307409_100507465
1428 Ga0307416_102086984
1429 Ga0307414_10032062
1430 Ga0373929_0064916
1431 Ga0373923_0174135
1432 Ga0373957_0112151
1433 Ga0373946_0669765
1434 Ga0373955_0094364
1435 Ga0373955_0180582
1436 Ga0373931_0133046
1437 Ga0373947_0185292
1438 Ga0373937_0014776
1439 Ga0373937_0019324
1440 Ga0373937_0533418
1441 Ga0436364_0081849
1442 Ga0436364_0618716
1443 Ga0436365_0542479
1444 Ga0436365_1508083
1445 Ga0436360_0019517
1446 Ga0436360_0231176
1447 Ga0436360_0516963
1448 Ga0436360_0895959
1449 Ga0436360_1289660
1450 Ga0436361_0143170
1451 Ga0436361_0532911
1452 Ga0436361_0534853
1453 Ga0436361_1100919
1454 Ga0436363_0654601
1455 Ga0436363_0880344
1456 Ga0436363_1100880
1457 Ga0436363_1366878
1458 Ga0436362_0094502
1459 Ga0436362_0158312
1460 Ga0436362_0257070
1461 Ga0436362_0466020
1462 Ga0436362_0623315
1463 Ga0436362_0669034
1464 Ga0436362_0823420
1465 Ga0436362_0845409
1466 Ga0436362_0995597
1467 Ga0439436_0016885
1468 Ga0439438_055219
1469 Ga0439447_050665
1470 Ga0439465_0006574
1471 Ga0451787_407566
1472 Ga0451789_0208705
1473 Ga0451791_1709245
1474 Ga0451795_0214798
1475 Ga0451804_0302100
1476 Ga0451807_0031448
1477 Ga0451833_0843237
1478 Ga0451837_1541397
1479 Ga0451839_0859990
1480 Ga0451840_09647
1481 Ga0451847_0364609
1482 Ga0451847_0587092
1483 Ga0451850_46590
1484 Ga0451851_1065096
1485 Ga0451843_0075634
1486 Ga0451855_0104832
1487 Ga0451853_3873447
1488 Ga0452268_49458
1489 Ga0452271_19773
1490 Ga0439445_0022617
1491 Ga0439432_042481
1492 Ga0439449_0039594
1493 Ga0439457_019057
1494 Ga0439462_0008102
1495 Ga0450919_020089
1496 Ga0450920_008995
1497 Ga0450923_099404
1498 Ga0450907_011757
1499 Ga0439434_0004563
1500 Ga0439435_0004996
1501 Ga0439459_0016619
1502 Ga0439464_0063294
1503 Ga0450918_001934
1504 Ga0466965_0723203
1505 Ga0466966_0194733
1506 Ga0466961_0473358
1507 Ga0466963_0030718
1508 Ga0466963_0032214
1509 Ga0466971_0060999
1510 Ga0466970_0019852
1511 Ga0466957_0019798
1512 Ga0466957_0056491
1513 Ga0466960_0019997
1514 Ga0466959_0141396
1515 Ga0466959_0261923
1516 Ga0466958_0505015
1517 Ga0466967_0349614
1518 Ga0495617_062497
1519 Ga0495592_0086233
1520 Ga0495592_0319433
1521 Ga0495629_0039582
1522 Ga0495638_0000309
1523 Ga0495638_0069479
1524 Ga0495605_0037531
1525 Ga0495639_0065864
1526 Ga0495607_0021181
1527 Ga0495607_0226959
1528 Ga0495583_0078743
1529 Ga0495583_0133004
1530 Ga0495606_0012844
1531 Ga0495606_0042743
1532 Ga0495606_0058480
1533 Ga0495608_0170311
1534 Ga0495610_0031433
1535 Ga0495618_0242727
1536 Ga0495618_0361185
1537 Ga0495620_0040469
1538 Ga0495628_0180517
1539 Ga0495628_0261403
1540 Ga0495631_0001992
1541 Ga0495632_0025059
1542 Ga0495632_0087348
1543 Ga0495643_0067987
1544 Ga0495643_0123527
1545 Ga0495652_0284336
1546 Ga0495652_0294827
1547 Ga0495654_0041574
1548 Ga0495609_0347151
1549 Ga0495597_0193825
1550 Ga0495633_0502749
1551 Ga0495667_0065733
1552 Ga0495668_0011139
1553 Ga0495668_0079944
1554 Ga0495611_0045098
1555 Ga0495625_0004853
1556 Ga0495625_0121777
1557 Ga0495625_0221920
1558 Ga0495635_0378240
1559 Ga0495657_0040710
1560 Ga0495658_0263988
1561 Ga0495624_0091043
1562 Ga0495670_0019978
1563 Ga0495649_0112677
1564 Ga0495649_0365141
1565 Ga0495600_0258948
1566 Ga0495660_0016850
1567 Ga0495660_0060357
1568 Ga0495604_0075272
1569 Ga0495604_0567360
1570 Ga0495604_0735940
1571 Ga0495674_0087909
1572 Ga0495672_0350130
1573 Ga0495675_0123565
1574 Ga0495684_0009627
1575 Ga0495686_0017503
1576 Ga0495686_0067652
1577 Ga0495686_0173679
1578 Ga0495593_0340664
1579 Ga0495602_0416384
1580 Ga0496100_0153409
1581 Ga0496100_0303130
1582 Ga0496100_0453006
1583 Ga0496101_0462676
1584 Ga0496101_0516930
1585 Ga0496101_0674307
1586 Ga0496102_0067664
1587 Ga0496102_0511969
1588 Ga0496103_0016713
1589 Ga0496104_0687987
1590 Ga0496106_0020408
1591 Ga0496106_0276639
1592 Ga0496107_0657807
1593 Ga0496111_0474809
1594 Ga0496113_0379032
1595 Ga0496114_0556786
1596 Ga0496116_0000471
1597 Ga0496116_0009680
1598 Ga0496116_0244430
1599 Ga0496116_0284390
1600 Ga0496116_0400494
1601 Ga0496117_0000926
1602 Ga0496117_0185065
1603 Ga0496117_0318204
1604 Ga0496118_0004170
1605 Ga0496118_0141697
1606 Ga0496118_0145749
1607 Ga0496118_0250429
1608 Ga0496118_0253836
1609 Ga0496118_0302711
1610 Ga0496118_0413769
1611 Ga0496119_0039986
1612 Ga0496119_0116439
1613 Ga0496120_0005399
1614 Ga0496120_0007027
1615 Ga0496121_0000003
1616 Ga0496121_0005102
1617 Ga0496121_0009341
1618 Ga0496121_0053078
1619 Ga0496121_0069691
1620 Ga0496121_0084335
1621 Ga0496121_0130329
1622 Ga0496121_0476070
1623 Ga0496121_0768433
1624 Ga0496122_0009597
1625 Ga0496122_0037476
1626 Ga0496122_0060029
1627 Ga0496122_0067451
1628 Ga0496122_0094425
1629 Ga0496122_0140257
1630 Ga0496122_0141207
1631 Ga0496123_0023449
1632 Ga0496123_0024629
1633 Ga0496123_0038048
1634 Ga0496123_0050894
1635 Ga0496123_0131757
1636 Ga0496124_0009174
1637 Ga0496124_0049503
1638 Ga0496124_0064523
1639 Ga0496124_0102607
1640 Ga0496124_0197531
1641 Ga0496124_0587103
1642 Ga0496124_0901395
1643 Ga0496125_0000170
1644 Ga0496125_0009728
1645 Ga0496125_0035928
1646 Ga0496125_0102245
1647 Ga0496125_0148216
1648 Ga0496125_0246914
1649 Ga0496125_0355911
1650 Ga0496126_0002372
1651 Ga0496126_0037624
1652 Ga0496126_0084180
1653 Ga0496126_0789363
1654 Ga0495678_006657
1655 Ga0495678_111890
1656 Ga0501031_0310817
1657 Ga0501032_0578350
1658 Ga0501034_0251502
1659 Ga0501034_1687434
1660 Ga0501038_0011417
1661 Ga0501039_0105975
1662 Ga0501040_0003607
1663 Ga0501041_0010663
1664 Ga0501042_0068196
1665 Ga0501068_0268456
1666 Ga0501072_0018494
1667 Ga0501073_0134883
1668 Ga0501074_0195330
1669 Ga0501075_0001615
1670 Ga0501076_0633112
1671 Ga0501077_0028042
1672 Ga0501079_0001635
1673 Ga0501079_0666567
1674 Ga0501081_0008108
1675 Ga0501083_0038421
1676 Ga0501083_0046964
1677 Ga0501280_001681
1678 Ga0501045_0006414
1679 nmdc:mga03683_32348_c1
1680 nmdc:mga03n38_449728_c1
1681 nmdc:mga00v17_346_c1
1682 nmdc:mga00v17_53948_c1
1683 nmdc:mga0yw44_237894_c1
1684 nmdc:mga0yw44_548944_c1
1685 nmdc:mga07m45_647116_c1
1686 Ga0495601_0176866
1687 Ga0495601_0729615
1688 Ga0495601_0743062
1689 Ga0495612_0125200
1690 Ga0500610_0208561
1691 Ga0495595_0172407
1692 Ga0495619_0000134
1693 Ga0495619_0060815
1694 Ga0495619_0732190
1695 Ga0500578_0029910
1696 Ga0500578_0137565
1697 Ga0500569_004245
1698 Ga0500658_0001711
1699 Ga0500559_0254685
1700 Ga0500568_0002138
1701 Ga0500573_0094131
1702 Ga0500590_012886
1703 Ga0500616_0000980
1704 Ga0500616_0034036
1705 Ga0500620_307035
1706 Ga0500622_0023736
1707 Ga0500636_0000245
1708 Ga0500636_0003701
1709 Ga0501084_0000335
1710 Ga0587066_003650
1711 Ga0587083_0028683
1712 Ga0587088_012580
1713 Ga0587098_006236
1714 Ga0587106_040908
1715 Ga0587101_036989
1716 Ga0587128_028793
1717 Ga0587067_070377
1718 Ga0587068_004192
1719 Ga0501082_0115600
1720 Ga0501082_0123434
1721 Ga0501082_0458561
1722 Ga0530510_0525812
1723 Ga0530510_0998545
1724 2509389990
1725 2509447773
1726 2510134687
1727 2510896038
1728 2511137312
1729 2511175184
1730 2511200445
1731 2512974039
1732 2513573261
1733 2513578488
1734 2513600730
1735 2513602244
1736 2513631474
1737 2513710593
1738 2513867585
1739 2513926814
1740 2513985474
1741 2513997972
1742 2514003887
1743 2514023424
1744 2515113778
1745 2515634641
1746 2515645315
1747 2515660880
1748 2515743500
1749 2517037389
1750 2517077689
1751 2517096488
1752 2517410584
1753 2517570897
1754 2520378260
1755 2523470077
1756 2524462051
1757 2530646805
1758 2535519588
1759 2537876453
1760 2554245242
1761 2559296928
1762 2585167893
1763 2585204866
1764 2585224949
1765 2585227637
1766 2585257649
1767 2585265491
1768 2585274140
1769 2585280450
1770 2585322723
1771 2585330842
1772 2585388408
1773 2585392305
1774 2585403390
1775 2585529599
1776 2585532678
1777 2585541167
1778 2585547505
1779 2585554306
1780 2585560589
1781 2585823686
1782 2585839930
1783 2585845167
1784 2585898799
1785 2585903613
1786 2585997010
1787 2586001609
1788 2587981267
1789 2599420693
1790 2599604616
1791 2599722478
1792 2600373776
1793 2601611225
1794 2601747998
1795 2616295410
1796 2616307251
1797 2616554794
1798 2617383475
1799 2643858269
1800 2644006253
1801 2644050957
1802 2644191545
1803 2644205460
1804 2644209968
1805 2644241703
1806 2644299135
1807 2644483861
1808 2644496260
1809 2644500332
1810 2644521170
1811 2644653519
1812 2644657363
1813 2671112048
1814 2719182458
1815 2719387115
1816 2719666761
1817 2719733177
1818 2720493181
1819 2720614658
1820 2720621431
1821 2720632759
1822 2720776483
1823 2721148571
1824 2721159957
1825 2721165385
1826 2721400750
1827 2722841555
1828 2723028071
1829 2723561702
1830 2723568331
1831 2724039563
1832 2724045933
1833 2724091090
1834 2724105596
1835 2724111422
1836 2725947674
1837 2730109007
1838 2730165693
1839 2730299589
1840 2738800615
1841 2739035719
1842 2739350824
1843 2766065480
1844 2778175868
1845 2793293790
1846 2793313208
1847 2793319868
1848 2793328128
1849 2793333225
1850 2793343828
1851 2793347228
1852 2793356636
1853 2793362904
1854 2793370069
1855 2802718013
1856 2802725136
1857 2802730740
1858 2802738087
1859 2802744043
1860 2802750922
1861 2805930696
1862 2805934169
1863 2806044706
1864 2806052906
1865 2806059206
1866 2806068131
1867 2806074251
1868 2808987444
1869 2819243706
1870 2819557237
1871 2819609748
1872 2819639847
1873 2838018958
1874 2838024442
1875 2838032987
1876 2838040633
1877 2838046399
1878 2838051326
1879 2838063696
1880 2838074267
1881 2838664979
1882 2838671300
1883 2838678221
1884 2838685110
1885 2838699053
1886 2838703519
1887 2838712534
1888 2838716873
1889 2838722517
1890 2838727622
1891 2841849228
1892 2841853704
1893 2841861701
1894 2842082011
1895 2842113595
1896 2842122933
1897 2842128023
1898 2842133114
1899 2842149479
1900 2842155108
1901 2842169845
1902 2842173607
1903 2842178729
1904 2842189980
1905 2842199985
1906 2842208155
1907 2842214294
1908 2842220232
1909 2842227013
1910 2842242164
1911 2842253883
1912 2842266464
1913 2842281836
1914 2842288940
1915 2842296011
1916 2842298550
1917 2842308065
1918 2842316157
1919 2842321552
1920 2842362402
1921 2842377177
1922 2842382410
1923 2842389811
1924 2842398679
1925 2842406393
1926 2842413180
1927 2842419823
1928 2842427891
1929 2842429783
1930 2842436557
1931 2842446806
1932 2842450879
1933 2842464204
1934 2842470886
1935 2842479720
1936 2842483536
1937 2842493112
1938 2842499318
1939 2842506896
1940 2842510580
1941 2842518033
1942 2842523076
1943 2842776119
1944 2844002443
1945 2852391032
1946 2854900376
1947 2854920207
1948 2871467003
1949 2883296039
1950 2883358795
1951 2889793249
1952 2899792787
1953 2899845474
1954 2906384376
1955 2913299734
1956 2915980444
1957 2916067022
1958 2919104399
1959 2919117064
1960 2919169764
1961 2919173254
1962 2919410532
1963 2921252262
1964 2923558931
1965 2926758577
1966 2926763891
1967 2929141283
1968 2929205085
1969 2933009513
1970 2933013662
1971 2933018165
1972 2933574514
1973 2933589115
1974 2933598096
1975 2933604722
1976 2935899885
1977 2935907054
1978 2936375023
1979 2936380714
1980 2936382117
1981 2937033115
1982 2937036617
1983 2937078510
1984 2937089790
1985 2957377559
1986 2957437268
1987 2960591158
1988 2960636536
1989 2960682526
1990 2960696887
1991 2967690489
1992 2967729625
1993 2970028184
1994 2970126050
1995 2970146512
1996 2977534235
1997 2978972183
1998 2979091011
1999 2979096537
2000 2979102269
2001 2984509783
2002 2984519520
2003 2984538121
2004 2984590409
2005 2984604873
2006 2989779707
2007 2996890101
2008 2996895891
2009 3005415640
2010 3005418632
2011 3005449117
2012 3005455396
2013 639649852
2014 650843349
2015 8004002612
2016 8005262178
2017 8005281842
2018 8005288837
2019 8005294443
2020 8005306827
2021 8005310803
2022 8005318476
2023 8005324628
2024 8005378346
2025 8005385707
2026 8005401318
2027 8005434272
2028 8005464465
2029 8005488643
2030 8005501508
2031 8005547285
2032 8005558537
2033 8005566619
2034 8005575092
2035 8005622870
2036 8005631830
2037 8005649110
2038 8005672929
2039 8005682349
2040 8005693476
2041 8005700696
2042 8018133764
2043 8018153311
2044 8018170062
2045 8018178612
2046 8023687708
2047 8024481629
2048 8024487857
2049 8024506103
2050 8045867508
2051 8046772052
2052 8055916205
2053 8056381433
2054 8056386876
2055 8057577546
2056 8057876666

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

16

141

0.97

Map