F488508
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1026 | 567 | 909 | 85 |
Family's Representative Sequence
| Representative Sequence | 3300005445|Ga0070708_101118284|Ga0070708_1011182842 |
| Length | 92 |
| Sequence | MTGQGTVMIKALSAITAAAFIAAALTVLPGFAPKVEASVPQALAKGDRLDIRTVGKDCSQQAWPNFDASCLRTSGSKSMVRQARLVTADRTP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 4 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 5 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 6 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 7 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 8 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 9 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 10 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 11 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 12 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 13 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 14 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 15 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 16 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 17 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 18 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 19 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 20 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 21 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 22 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 23 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 24 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 25 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 26 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 27 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 28 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 29 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 30 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 31 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 32 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 33 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 34 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 35 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 36 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 37 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 38 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 39 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 40 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 41 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 42 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 43 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 44 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 45 | 2906610324 | |||
| 46 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 47 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 48 | 2922368715 | |||
| 49 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 50 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 51 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 52 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 53 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 54 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 55 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 56 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 57 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 58 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 59 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 60 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 61 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 62 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 63 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 64 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 65 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 66 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 67 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 68 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 69 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 70 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 71 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 72 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 73 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 74 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 75 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 76 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 77 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 78 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 79 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 80 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 81 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 82 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 83 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 84 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 85 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 86 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 87 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 88 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 89 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 90 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 91 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 92 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 93 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 94 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 95 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 96 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 97 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 98 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 99 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 100 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 101 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 104 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 105 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 107 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 109 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 110 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 111 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 113 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 114 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 123 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 125 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 126 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 133 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 134 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 135 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 136 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 137 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 138 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 139 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 143 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 144 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 146 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 147 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 148 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 150 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 151 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 152 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 153 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 154 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 155 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 156 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 157 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 158 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 159 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 160 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 161 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 162 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 163 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 164 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 165 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 166 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 167 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 168 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 169 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 170 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 171 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 172 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 174 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 175 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 176 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 178 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 179 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 180 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 181 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 182 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 183 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 184 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 185 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 186 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 187 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 188 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 189 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 190 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 191 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 192 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 193 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 194 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 195 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 196 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 197 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 198 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 199 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 200 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 201 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 202 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 203 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 204 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 205 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 206 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 207 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 262 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 265 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 266 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 267 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 268 | 3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 269 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 271 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 272 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 273 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 274 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 275 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 276 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 277 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 278 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 279 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 280 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 281 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 282 | 3300031667 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 283 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 284 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 285 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 286 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 287 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 288 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 289 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 290 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 291 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 292 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 293 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 294 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 295 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 296 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 297 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 298 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 299 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 300 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 301 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 302 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 303 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 304 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 305 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 306 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 307 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 308 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 309 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 310 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 311 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 312 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 313 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 314 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 315 | 3300036242 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 316 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 317 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300036458 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 319 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 320 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 321 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 322 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 323 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 324 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 325 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 326 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 327 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 328 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 329 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 330 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 331 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 332 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 333 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 334 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 335 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 336 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 337 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 338 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 339 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 340 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 341 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 342 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 423 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 424 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 425 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 426 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 427 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 428 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 429 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 430 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 431 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 432 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 433 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 434 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 435 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 436 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 437 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 438 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 439 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 440 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 441 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 442 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 443 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 444 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 445 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 446 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 447 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 448 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 451 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 452 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 453 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 454 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 455 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 456 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 457 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 458 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 459 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 460 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 461 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 462 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 465 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 468 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 469 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 470 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 471 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 472 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 473 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 474 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 475 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 476 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 477 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 478 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 479 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 480 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 481 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 482 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 483 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 484 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 485 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 486 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 487 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 488 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 489 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 490 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 491 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 492 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 493 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 494 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 495 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 496 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 497 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 498 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 499 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 500 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 501 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 502 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 503 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 504 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 505 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 506 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 507 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 508 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 509 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 510 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 511 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 512 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 513 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 514 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 515 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 516 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 517 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 518 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 519 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 520 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 521 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 522 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 523 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 524 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 525 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 526 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 527 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 528 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 529 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 530 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 531 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 532 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 533 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 534 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 535 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 536 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 537 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 538 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 539 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 540 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 541 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 542 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 543 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 544 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 545 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 546 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 547 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 548 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 549 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 550 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 551 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 552 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 553 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 554 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 555 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 556 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 557 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 558 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 559 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 560 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 561 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 562 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 563 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 564 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 565 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 566 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 567 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.11 |
| Metatranscriptomes | 5.66 |
| Isolates | 11.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.04 |
| Nodule | 8.28 |
| Rhizoplane | 6.43 |
| Rhizosphere | 61.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1028577 | 3300000549 | Bacteria | 651 |
| 2 | JGI25160J50197_1061223 | 3300003354 | Bacteria | 751 |
| 3 | Ga0007429J51699_1015309 | 3300003579 | Bacteria | 534 |
| 4 | Ga0055543_1063225 | 3300004625 | Bacteria | 591 |
| 5 | Ga0058859_11717512 | 3300004798 | Bacteria | 629 |
| 6 | Ga0058860_12120592 | 3300004801 | Bacteria | 618 |
| 7 | Ga0058860_12138288 | 3300004801 | Bacteria | 555 |
| 8 | Ga0058860_12235858 | 3300004801 | Bacteria | 546 |
| 9 | Ga0065165_1006419 | 3300005262 | Bacteria | 6172 |
| 10 | Ga0070658_10340868 | 3300005327 | Bacteria | 1282 |
| 11 | Ga0070676_10886720 | 3300005328 | Bacteria | 664 |
| 12 | Ga0070683_100137268 | 3300005329 | Bacteria | 2316 |
| 13 | Ga0070683_101765083 | 3300005329 | Bacteria | 595 |
| 14 | Ga0070683_101927706 | 3300005329 | Bacteria | 568 |
| 15 | Ga0070690_100085524 | 3300005330 | Bacteria | 2069 |
| 16 | Ga0070690_101019401 | 3300005330 | Bacteria | 653 |
| 17 | Ga0070670_100569267 | 3300005331 | Bacteria | 1012 |
| 18 | Ga0068869_100109499 | 3300005334 | Bacteria | 2100 |
| 19 | Ga0068869_101968256 | 3300005334 | Bacteria | 524 |
| 20 | Ga0070666_10597901 | 3300005335 | Bacteria | 805 |
| 21 | Ga0070666_11319618 | 3300005335 | Bacteria | 538 |
| 22 | Ga0070680_100025555 | 3300005336 | Bacteria | 4721 |
| 23 | Ga0070682_100279158 | 3300005337 | Bacteria | 1217 |
| 24 | Ga0070682_100835209 | 3300005337 | Bacteria | 751 |
| 25 | Ga0068868_100019111 | 3300005338 | Bacteria | 5131 |
| 26 | Ga0068868_100736188 | 3300005338 | Bacteria | 885 |
| 27 | Ga0070660_101390764 | 3300005339 | Bacteria | 596 |
| 28 | Ga0070689_100410580 | 3300005340 | Bacteria | 1146 |
| 29 | Ga0070691_10147971 | 3300005341 | Bacteria | 1202 |
| 30 | Ga0070661_100307675 | 3300005344 | Bacteria | 1235 |
| 31 | Ga0070661_100388072 | 3300005344 | Bacteria | 1102 |
| 32 | Ga0070668_100056810 | 3300005347 | Bacteria | 3023 |
| 33 | Ga0070668_100760005 | 3300005347 | Bacteria | 859 |
| 34 | Ga0070675_101073644 | 3300005354 | Bacteria | 740 |
| 35 | Ga0070671_100206335 | 3300005355 | Bacteria | 1667 |
| 36 | Ga0070671_100342254 | 3300005355 | Bacteria | 1276 |
| 37 | Ga0070671_100429574 | 3300005355 | Bacteria | 1132 |
| 38 | Ga0070674_100195426 | 3300005356 | Bacteria | 1559 |
| 39 | Ga0070674_100241784 | 3300005356 | Bacteria | 1414 |
| 40 | Ga0070673_100596574 | 3300005364 | Bacteria | 1007 |
| 41 | Ga0070673_100677105 | 3300005364 | Bacteria | 946 |
| 42 | Ga0070673_101095860 | 3300005364 | Bacteria | 744 |
| 43 | Ga0070673_102151676 | 3300005364 | Bacteria | 530 |
| 44 | Ga0070659_100634739 | 3300005366 | Bacteria | 920 |
| 45 | Ga0070659_101313314 | 3300005366 | Bacteria | 642 |
| 46 | Ga0070667_100666729 | 3300005367 | Bacteria | 961 |
| 47 | Ga0070709_11071524 | 3300005434 | Bacteria | 644 |
| 48 | Ga0070714_100141594 | 3300005435 | Bacteria | 2160 |
| 49 | Ga0070713_100446532 | 3300005436 | Bacteria | 1214 |
| 50 | Ga0070713_101976019 | 3300005436 | Bacteria | 566 |
| 51 | Ga0070710_11224279 | 3300005437 | Bacteria | 556 |
| 52 | Ga0070711_100688446 | 3300005439 | Bacteria | 860 |
| 53 | Ga0070711_100944246 | 3300005439 | Bacteria | 738 |
| 54 | Ga0070711_101033454 | 3300005439 | Bacteria | 706 |
| 55 | Ga0070705_100488409 | 3300005440 | Bacteria | 932 |
| 56 | Ga0070708_101118284 | 3300005445 | Bacteria | 738 |
| 57 | Ga0070663_100047420 | 3300005455 | Bacteria | 3043 |
| 58 | Ga0070663_100162595 | 3300005455 | Bacteria | 1719 |
| 59 | Ga0070663_100185926 | 3300005455 | Bacteria | 1614 |
| 60 | Ga0070663_100188065 | 3300005455 | Bacteria | 1606 |
| 61 | Ga0070663_100403292 | 3300005455 | Bacteria | 1118 |
| 62 | Ga0070678_100087645 | 3300005456 | Bacteria | 2378 |
| 63 | Ga0070678_100197035 | 3300005456 | Bacteria | 1660 |
| 64 | Ga0070678_100253765 | 3300005456 | Bacteria | 1476 |
| 65 | Ga0070678_100397541 | 3300005456 | Bacteria | 1196 |
| 66 | Ga0070662_101694056 | 3300005457 | Bacteria | 546 |
| 67 | Ga0070681_10060782 | 3300005458 | Bacteria | 3754 |
| 68 | Ga0070681_10553262 | 3300005458 | Bacteria | 1064 |
| 69 | Ga0070681_11893691 | 3300005458 | Bacteria | 524 |
| 70 | Ga0068867_100732199 | 3300005459 | Bacteria | 876 |
| 71 | Ga0070685_10700413 | 3300005466 | Bacteria | 738 |
| 72 | Ga0070679_100039171 | 3300005530 | Bacteria | 4711 |
| 73 | Ga0070679_100250531 | 3300005530 | Bacteria | 1727 |
| 74 | Ga0070679_100554944 | 3300005530 | Bacteria | 1092 |
| 75 | Ga0070684_100009838 | 3300005535 | Bacteria | 7553 |
| 76 | Ga0070684_100107204 | 3300005535 | Bacteria | 2502 |
| 77 | Ga0070684_101094835 | 3300005535 | Bacteria | 749 |
| 78 | Ga0070684_102109956 | 3300005535 | Bacteria | 532 |
| 79 | Ga0070697_100066932 | 3300005536 | Bacteria | 2937 |
| 80 | Ga0068853_100388284 | 3300005539 | Bacteria | 1305 |
| 81 | Ga0068853_100446152 | 3300005539 | Bacteria | 1216 |
| 82 | Ga0068853_100790886 | 3300005539 | Bacteria | 908 |
| 83 | Ga0070672_101140138 | 3300005543 | Bacteria | 694 |
| 84 | Ga0070672_101520948 | 3300005543 | Bacteria | 600 |
| 85 | Ga0070672_102093248 | 3300005543 | Bacteria | 510 |
| 86 | Ga0070693_101589770 | 3300005547 | Bacteria | 513 |
| 87 | Ga0070665_100011491 | 3300005548 | Bacteria | 8954 |
| 88 | Ga0070665_100042315 | 3300005548 | Bacteria | 4578 |
| 89 | Ga0070665_100850243 | 3300005548 | Bacteria | 925 |
| 90 | Ga0070665_100870382 | 3300005548 | Bacteria | 914 |
| 91 | Ga0070665_100890225 | 3300005548 | Bacteria | 903 |
| 92 | Ga0070665_100969884 | 3300005548 | Bacteria | 862 |
| 93 | Ga0070665_101081343 | 3300005548 | Bacteria | 814 |
| 94 | Ga0070665_101448135 | 3300005548 | Bacteria | 696 |
| 95 | Ga0070704_100737768 | 3300005549 | Bacteria | 876 |
| 96 | Ga0068855_100011695 | 3300005563 | Bacteria | 10605 |
| 97 | Ga0068855_100117917 | 3300005563 | Bacteria | 3040 |
| 98 | Ga0068855_100141459 | 3300005563 | Bacteria | 2742 |
| 99 | Ga0068855_101998876 | 3300005563 | Bacteria | 585 |
| 100 | Ga0068855_102290455 | 3300005563 | Bacteria | 541 |
| 101 | Ga0070664_101005214 | 3300005564 | Bacteria | 784 |
| 102 | Ga0068857_100051462 | 3300005577 | Bacteria | 3654 |
| 103 | Ga0068854_100144116 | 3300005578 | Bacteria | 1831 |
| 104 | Ga0068854_100475680 | 3300005578 | Bacteria | 1048 |
| 105 | Ga0068856_100175881 | 3300005614 | Bacteria | 2153 |
| 106 | Ga0068856_100423804 | 3300005614 | Bacteria | 1351 |
| 107 | Ga0068856_100534318 | 3300005614 | Bacteria | 1194 |
| 108 | Ga0070702_100972572 | 3300005615 | Bacteria | 670 |
| 109 | Ga0068852_100228219 | 3300005616 | Bacteria | 1774 |
| 110 | Ga0068852_100860164 | 3300005616 | Bacteria | 923 |
| 111 | Ga0068852_102054068 | 3300005616 | Unclassified | 593 |
| 112 | Ga0068859_101029638 | 3300005617 | Bacteria | 905 |
| 113 | Ga0068864_100413495 | 3300005618 | Bacteria | 1284 |
| 114 | Ga0068864_100569293 | 3300005618 | Bacteria | 1097 |
| 115 | Ga0068864_101158656 | 3300005618 | Bacteria | 771 |
| 116 | Ga0068861_102063060 | 3300005719 | Bacteria | 570 |
| 117 | Ga0068851_10514720 | 3300005834 | Bacteria | 719 |
| 118 | Ga0068851_10681792 | 3300005834 | Bacteria | 631 |
| 119 | Ga0068851_10998605 | 3300005834 | Bacteria | 528 |
| 120 | Ga0068870_10764208 | 3300005840 | Bacteria | 672 |
| 121 | Ga0068863_100266678 | 3300005841 | Bacteria | 1656 |
| 122 | Ga0068863_100342384 | 3300005841 | Bacteria | 1455 |
| 123 | Ga0068863_100376646 | 3300005841 | Bacteria | 1385 |
| 124 | Ga0068863_101198272 | 3300005841 | Bacteria | 765 |
| 125 | Ga0068858_100296627 | 3300005842 | Bacteria | 1542 |
| 126 | Ga0068858_100650869 | 3300005842 | Bacteria | 1024 |
| 127 | Ga0068860_100722632 | 3300005843 | Bacteria | 1006 |
| 128 | Ga0068862_100933399 | 3300005844 | Bacteria | 855 |
| 129 | Ga0081455_10164221 | 3300005937 | Bacteria | 1698 |
| 130 | Ga0081538_10103418 | 3300005981 | Bacteria | 1425 |
| 131 | Ga0081540_1040042 | 3300005983 | Bacteria | 2448 |
| 132 | Ga0081539_10031363 | 3300005985 | Bacteria | 3277 |
| 133 | Ga0075365_10013809 | 3300006038 | Bacteria | 4845 |
| 134 | Ga0075365_10108867 | 3300006038 | Bacteria | 1903 |
| 135 | Ga0075365_10180008 | 3300006038 | Bacteria | 1478 |
| 136 | Ga0075365_10481332 | 3300006038 | Bacteria | 877 |
| 137 | Ga0075368_10092455 | 3300006042 | Bacteria | 1238 |
| 138 | Ga0075368_10098359 | 3300006042 | Bacteria | 1200 |
| 139 | Ga0075363_100002549 | 3300006048 | Bacteria | 7479 |
| 140 | Ga0075363_100038813 | 3300006048 | Bacteria | 2505 |
| 141 | Ga0075363_100921637 | 3300006048 | Bacteria | 536 |
| 142 | Ga0075364_10932228 | 3300006051 | Bacteria | 591 |
| 143 | Ga0070715_10371455 | 3300006163 | Bacteria | 787 |
| 144 | Ga0070712_100928423 | 3300006175 | Bacteria | 751 |
| 145 | Ga0075367_10056557 | 3300006178 | Bacteria | 2330 |
| 146 | Ga0075367_10435230 | 3300006178 | Bacteria | 831 |
| 147 | Ga0075367_10478421 | 3300006178 | Bacteria | 789 |
| 148 | Ga0075369_10021798 | 3300006186 | Bacteria | 2637 |
| 149 | Ga0075369_10026612 | 3300006186 | Bacteria | 2412 |
| 150 | Ga0075366_10481588 | 3300006195 | Bacteria | 767 |
| 151 | Ga0075366_10894454 | 3300006195 | Bacteria | 553 |
| 152 | Ga0097621_100385326 | 3300006237 | Bacteria | 1253 |
| 153 | Ga0097621_100722979 | 3300006237 | Bacteria | 918 |
| 154 | Ga0097621_101033396 | 3300006237 | Bacteria | 770 |
| 155 | Ga0097621_101862147 | 3300006237 | Bacteria | 574 |
| 156 | Ga0075370_10008373 | 3300006353 | Bacteria | 5320 |
| 157 | Ga0075370_10009299 | 3300006353 | Bacteria | 5100 |
| 158 | Ga0075370_10085642 | 3300006353 | Bacteria | 1814 |
| 159 | Ga0068871_100364893 | 3300006358 | Bacteria | 1280 |
| 160 | Ga0068871_100457514 | 3300006358 | Bacteria | 1145 |
| 161 | Ga0068871_101402810 | 3300006358 | Bacteria | 659 |
| 162 | Ga0068865_100094141 | 3300006881 | Bacteria | 2179 |
| 163 | Ga0068865_100124095 | 3300006881 | Bacteria | 1925 |
| 164 | Ga0068865_100208689 | 3300006881 | Bacteria | 1521 |
| 165 | Ga0068865_100344292 | 3300006881 | Bacteria | 1206 |
| 166 | Ga0068865_101260261 | 3300006881 | Bacteria | 656 |
| 167 | Ga0097620_101029638 | 3300006931 | Bacteria | 905 |
| 168 | Ga0075435_100663332 | 3300007076 | Bacteria | 906 |
| 169 | Ga0099794_10069448 | 3300007265 | Bacteria | 1724 |
| 170 | Ga0099794_10197348 | 3300007265 | Bacteria | 1030 |
| 171 | Ga0099794_10349792 | 3300007265 | Bacteria | 769 |
| 172 | Ga0099795_10113860 | 3300007788 | Bacteria | 1075 |
| 173 | Ga0099795_10419661 | 3300007788 | Bacteria | 611 |
| 174 | Ga0105240_10018404 | 3300009093 | Bacteria | 9380 |
| 175 | Ga0105240_10132174 | 3300009093 | Bacteria | 2993 |
| 176 | Ga0105245_10024626 | 3300009098 | Bacteria | 5287 |
| 177 | Ga0105245_10497410 | 3300009098 | Bacteria | 1235 |
| 178 | Ga0105245_11048984 | 3300009098 | Bacteria | 860 |
| 179 | Ga0105247_10130481 | 3300009101 | Bacteria | 1638 |
| 180 | Ga0105247_10687782 | 3300009101 | Bacteria | 768 |
| 181 | Ga0105247_11407985 | 3300009101 | Bacteria | 564 |
| 182 | Ga0105243_10231613 | 3300009148 | Bacteria | 1639 |
| 183 | Ga0105243_10665145 | 3300009148 | Bacteria | 1011 |
| 184 | Ga0105241_10378005 | 3300009174 | Bacteria | 1237 |
| 185 | Ga0105241_10455368 | 3300009174 | Bacteria | 1133 |
| 186 | Ga0105241_10503413 | 3300009174 | Bacteria | 1080 |
| 187 | Ga0105241_11160216 | 3300009174 | Bacteria | 730 |
| 188 | Ga0105242_10156126 | 3300009176 | Bacteria | 1993 |
| 189 | Ga0105242_10482555 | 3300009176 | Bacteria | 1175 |
| 190 | Ga0105242_11144765 | 3300009176 | Bacteria | 794 |
| 191 | Ga0105242_11301689 | 3300009176 | Bacteria | 750 |
| 192 | Ga0105248_10112722 | 3300009177 | Bacteria | 3067 |
| 193 | Ga0105248_10516191 | 3300009177 | Bacteria | 1347 |
| 194 | Ga0105237_10012739 | 3300009545 | Bacteria | 8846 |
| 195 | Ga0105237_10243938 | 3300009545 | Bacteria | 1798 |
| 196 | Ga0105237_10408829 | 3300009545 | Bacteria | 1362 |
| 197 | Ga0105237_10734363 | 3300009545 | Bacteria | 994 |
| 198 | Ga0105237_11047400 | 3300009545 | Bacteria | 823 |
| 199 | Ga0105237_11393697 | 3300009545 | Bacteria | 707 |
| 200 | Ga0105238_10041149 | 3300009551 | Bacteria | 4681 |
| 201 | Ga0105238_10060230 | 3300009551 | Bacteria | 3801 |
| 202 | Ga0105238_10273122 | 3300009551 | Bacteria | 1671 |
| 203 | Ga0105238_10611943 | 3300009551 | Bacteria | 1098 |
| 204 | Ga0105238_11610176 | 3300009551 | Bacteria | 679 |
| 205 | Ga0105238_12272899 | 3300009551 | Bacteria | 577 |
| 206 | Ga0105238_12796583 | 3300009551 | Bacteria | 524 |
| 207 | Ga0105249_10538166 | 3300009553 | Bacteria | 1217 |
| 208 | Ga0105249_11732636 | 3300009553 | Bacteria | 697 |
| 209 | Ga0105249_12090307 | 3300009553 | Bacteria | 639 |
| 210 | Ga0105239_10070304 | 3300010375 | Bacteria | 3845 |
| 211 | Ga0105239_10272054 | 3300010375 | Bacteria | 1905 |
| 212 | Ga0105239_10286189 | 3300010375 | Bacteria | 1856 |
| 213 | Ga0105239_10416534 | 3300010375 | Bacteria | 1521 |
| 214 | Ga0105239_11856287 | 3300010375 | Bacteria | 699 |
| 215 | Ga0105246_10013250 | 3300011119 | Bacteria | 5164 |
| 216 | Ga0105246_10175355 | 3300011119 | Bacteria | 1646 |
| 217 | Ga0105246_10717719 | 3300011119 | Bacteria | 878 |
| 218 | Ga0105246_11544214 | 3300011119 | Bacteria | 625 |
| 219 | Ga0105246_11913015 | 3300011119 | Bacteria | 570 |
| 220 | Ga0157341_1038858 | 3300012494 | Bacteria | 544 |
| 221 | Ga0157373_10793337 | 3300013100 | Bacteria | 698 |
| 222 | Ga0157370_10035076 | 3300013104 | Bacteria | 4880 |
| 223 | Ga0157370_10807551 | 3300013104 | Bacteria | 853 |
| 224 | Ga0157369_10034915 | 3300013105 | Bacteria | 5515 |
| 225 | Ga0157369_10407198 | 3300013105 | Bacteria | 1411 |
| 226 | Ga0157369_10702505 | 3300013105 | Bacteria | 1041 |
| 227 | Ga0157374_10453952 | 3300013296 | Bacteria | 1283 |
| 228 | Ga0157374_12298788 | 3300013296 | Bacteria | 566 |
| 229 | Ga0157378_10010981 | 3300013297 | Bacteria | 7926 |
| 230 | Ga0157378_10274843 | 3300013297 | Bacteria | 1622 |
| 231 | Ga0157378_10508336 | 3300013297 | Bacteria | 1204 |
| 232 | Ga0157378_10901629 | 3300013297 | Bacteria | 915 |
| 233 | Ga0157378_10970053 | 3300013297 | Bacteria | 883 |
| 234 | Ga0157378_12586777 | 3300013297 | Bacteria | 560 |
| 235 | Ga0163162_10050813 | 3300013306 | Bacteria | 4158 |
| 236 | Ga0163162_10884742 | 3300013306 | Bacteria | 1007 |
| 237 | Ga0163162_11005945 | 3300013306 | Bacteria | 943 |
| 238 | Ga0163162_11524478 | 3300013306 | Bacteria | 762 |
| 239 | Ga0163162_12385246 | 3300013306 | Bacteria | 608 |
| 240 | Ga0157375_10071766 | 3300013308 | Bacteria | 3477 |
| 241 | Ga0157375_10233563 | 3300013308 | Bacteria | 1998 |
| 242 | Ga0157375_10289390 | 3300013308 | Bacteria | 1801 |
| 243 | Ga0157375_10847240 | 3300013308 | Bacteria | 1061 |
| 244 | Ga0157375_11806423 | 3300013308 | Bacteria | 725 |
| 245 | Ga0163163_10029693 | 3300014325 | Bacteria | 5261 |
| 246 | Ga0163163_10129877 | 3300014325 | Bacteria | 2559 |
| 247 | Ga0163163_10466641 | 3300014325 | Bacteria | 1323 |
| 248 | Ga0163163_10678025 | 3300014325 | Bacteria | 1094 |
| 249 | Ga0163163_11242954 | 3300014325 | Bacteria | 807 |
| 250 | Ga0163163_12298040 | 3300014325 | Bacteria | 598 |
| 251 | Ga0163163_12315031 | 3300014325 | Bacteria | 596 |
| 252 | Ga0157380_10594678 | 3300014326 | Bacteria | 1093 |
| 253 | Ga0157380_10768167 | 3300014326 | Bacteria | 977 |
| 254 | Ga0157380_12663067 | 3300014326 | Bacteria | 566 |
| 255 | Ga0157379_10319230 | 3300014968 | Bacteria | 1418 |
| 256 | Ga0157379_10495748 | 3300014968 | Bacteria | 1132 |
| 257 | Ga0157379_11580556 | 3300014968 | Bacteria | 640 |
| 258 | Ga0157379_11718648 | 3300014968 | Bacteria | 615 |
| 259 | Ga0157379_11982230 | 3300014968 | Bacteria | 575 |
| 260 | Ga0157379_12094132 | 3300014968 | Bacteria | 560 |
| 261 | Ga0157376_10014758 | 3300014969 | Bacteria | 5876 |
| 262 | Ga0157376_10100168 | 3300014969 | Bacteria | 2529 |
| 263 | Ga0157376_10419030 | 3300014969 | Bacteria | 1299 |
| 264 | Ga0157376_11996431 | 3300014969 | Bacteria | 618 |
| 265 | Ga0163161_10086127 | 3300017792 | Bacteria | 2319 |
| 266 | Ga0209564_1030145 | 3300025295 | Bacteria | 1687 |
| 267 | Ga0209256_1099404 | 3300025299 | Bacteria | 605 |
| 268 | Ga0207426_1002773 | 3300025302 | Bacteria | 10549 |
| 269 | Ga0207426_1007634 | 3300025302 | Bacteria | 4497 |
| 270 | Ga0207692_10297647 | 3300025898 | Bacteria | 981 |
| 271 | Ga0207710_10746721 | 3300025900 | Bacteria | 514 |
| 272 | Ga0207680_10683545 | 3300025903 | Bacteria | 735 |
| 273 | Ga0207647_10517568 | 3300025904 | Bacteria | 664 |
| 274 | Ga0207643_10270617 | 3300025908 | Bacteria | 1051 |
| 275 | Ga0207705_10156161 | 3300025909 | Bacteria | 1712 |
| 276 | Ga0207684_11030480 | 3300025910 | Bacteria | 687 |
| 277 | Ga0207654_10264258 | 3300025911 | Bacteria | 1158 |
| 278 | Ga0207654_10607996 | 3300025911 | Bacteria | 780 |
| 279 | Ga0207707_10064122 | 3300025912 | Bacteria | 3198 |
| 280 | Ga0207707_10296463 | 3300025912 | Bacteria | 1399 |
| 281 | Ga0207707_10829420 | 3300025912 | Bacteria | 769 |
| 282 | Ga0207671_10070454 | 3300025914 | Bacteria | 2607 |
| 283 | Ga0207671_10351919 | 3300025914 | Bacteria | 1168 |
| 284 | Ga0207671_11238839 | 3300025914 | Bacteria | 583 |
| 285 | Ga0207671_11300282 | 3300025914 | Bacteria | 566 |
| 286 | Ga0207693_10789696 | 3300025915 | Bacteria | 732 |
| 287 | Ga0207663_10229264 | 3300025916 | Bacteria | 1356 |
| 288 | Ga0207663_10488418 | 3300025916 | Bacteria | 955 |
| 289 | Ga0207660_10018427 | 3300025917 | Bacteria | 4653 |
| 290 | Ga0207660_11100922 | 3300025917 | Bacteria | 647 |
| 291 | Ga0207657_10021019 | 3300025919 | Bacteria | 6153 |
| 292 | Ga0207649_10208243 | 3300025920 | Bacteria | 1386 |
| 293 | Ga0207652_10046466 | 3300025921 | Bacteria | 3704 |
| 294 | Ga0207652_10744886 | 3300025921 | Bacteria | 872 |
| 295 | Ga0207652_11210324 | 3300025921 | Bacteria | 657 |
| 296 | Ga0207652_11520710 | 3300025921 | Bacteria | 573 |
| 297 | Ga0207694_10056784 | 3300025924 | Bacteria | 3041 |
| 298 | Ga0207694_10128231 | 3300025924 | Bacteria | 2031 |
| 299 | Ga0207687_10024625 | 3300025927 | Bacteria | 4023 |
| 300 | Ga0207687_10676143 | 3300025927 | Bacteria | 875 |
| 301 | Ga0207687_11484447 | 3300025927 | Bacteria | 582 |
| 302 | Ga0207700_10195699 | 3300025928 | Bacteria | 1701 |
| 303 | Ga0207700_11339459 | 3300025928 | Bacteria | 637 |
| 304 | Ga0207644_10229896 | 3300025931 | Bacteria | 1473 |
| 305 | Ga0207644_10311440 | 3300025931 | Bacteria | 1271 |
| 306 | Ga0207644_11352368 | 3300025931 | Bacteria | 598 |
| 307 | Ga0207690_10961096 | 3300025932 | Bacteria | 710 |
| 308 | Ga0207706_10378444 | 3300025933 | Bacteria | 1229 |
| 309 | Ga0207686_10204516 | 3300025934 | Bacteria | 1416 |
| 310 | Ga0207686_11193854 | 3300025934 | Bacteria | 623 |
| 311 | Ga0207686_11284991 | 3300025934 | Bacteria | 600 |
| 312 | Ga0207709_11196390 | 3300025935 | Bacteria | 626 |
| 313 | Ga0207670_10362810 | 3300025936 | Bacteria | 1150 |
| 314 | Ga0207670_11472910 | 3300025936 | Bacteria | 578 |
| 315 | Ga0207669_10055936 | 3300025937 | Bacteria | 2393 |
| 316 | Ga0207704_10100617 | 3300025938 | Bacteria | 1926 |
| 317 | Ga0207704_10300664 | 3300025938 | Bacteria | 1229 |
| 318 | Ga0207665_10272277 | 3300025939 | Bacteria | 1258 |
| 319 | Ga0207691_11318892 | 3300025940 | Bacteria | 596 |
| 320 | Ga0207691_11668851 | 3300025940 | Bacteria | 516 |
| 321 | Ga0207711_10077644 | 3300025941 | Bacteria | 2895 |
| 322 | Ga0207711_10650076 | 3300025941 | Bacteria | 984 |
| 323 | Ga0207711_10743477 | 3300025941 | Bacteria | 914 |
| 324 | Ga0207711_10983237 | 3300025941 | Bacteria | 783 |
| 325 | Ga0207689_11609039 | 3300025942 | Bacteria | 540 |
| 326 | Ga0207661_10044310 | 3300025944 | Bacteria | 3516 |
| 327 | Ga0207661_10269239 | 3300025944 | Bacteria | 1520 |
| 328 | Ga0207679_10039717 | 3300025945 | Bacteria | 3363 |
| 329 | Ga0207679_10280723 | 3300025945 | Bacteria | 1428 |
| 330 | Ga0207679_10485131 | 3300025945 | Bacteria | 1101 |
| 331 | Ga0207679_11797003 | 3300025945 | Bacteria | 560 |
| 332 | Ga0207679_12008091 | 3300025945 | Bacteria | 526 |
| 333 | Ga0207667_10037598 | 3300025949 | Bacteria | 5173 |
| 334 | Ga0207667_10802129 | 3300025949 | Bacteria | 938 |
| 335 | Ga0207667_11990483 | 3300025949 | Bacteria | 541 |
| 336 | Ga0207651_10365634 | 3300025960 | Bacteria | 1219 |
| 337 | Ga0207651_10612276 | 3300025960 | Bacteria | 953 |
| 338 | Ga0207712_11571164 | 3300025961 | Bacteria | 589 |
| 339 | Ga0207668_10065215 | 3300025972 | Bacteria | 2577 |
| 340 | Ga0207668_10527596 | 3300025972 | Bacteria | 1020 |
| 341 | Ga0207668_11643169 | 3300025972 | Bacteria | 580 |
| 342 | Ga0207668_11713240 | 3300025972 | Bacteria | 567 |
| 343 | Ga0207640_10235065 | 3300025981 | Bacteria | 1412 |
| 344 | Ga0207658_10749478 | 3300025986 | Bacteria | 884 |
| 345 | Ga0207658_11631916 | 3300025986 | Bacteria | 589 |
| 346 | Ga0207677_10032765 | 3300026023 | Bacteria | 3344 |
| 347 | Ga0207677_10329956 | 3300026023 | Bacteria | 1271 |
| 348 | Ga0207703_10352317 | 3300026035 | Bacteria | 1355 |
| 349 | Ga0207639_10031835 | 3300026041 | Bacteria | 3878 |
| 350 | Ga0207639_10337881 | 3300026041 | Bacteria | 1342 |
| 351 | Ga0207639_10700631 | 3300026041 | Bacteria | 939 |
| 352 | Ga0207678_10011180 | 3300026067 | Bacteria | 7883 |
| 353 | Ga0207678_10043207 | 3300026067 | Bacteria | 3901 |
| 354 | Ga0207678_10068408 | 3300026067 | Bacteria | 3047 |
| 355 | Ga0207678_10081377 | 3300026067 | Bacteria | 2772 |
| 356 | Ga0207678_10408032 | 3300026067 | Bacteria | 1177 |
| 357 | Ga0207678_10861223 | 3300026067 | Bacteria | 801 |
| 358 | Ga0207678_10862575 | 3300026067 | Bacteria | 800 |
| 359 | Ga0207708_11272946 | 3300026075 | Bacteria | 644 |
| 360 | Ga0207702_10579547 | 3300026078 | Bacteria | 1100 |
| 361 | Ga0207702_10739716 | 3300026078 | Bacteria | 971 |
| 362 | Ga0207641_10332460 | 3300026088 | Bacteria | 1444 |
| 363 | Ga0207641_10697841 | 3300026088 | Bacteria | 999 |
| 364 | Ga0207641_11502070 | 3300026088 | Bacteria | 675 |
| 365 | Ga0207648_10500479 | 3300026089 | Bacteria | 1112 |
| 366 | Ga0207648_11038522 | 3300026089 | Bacteria | 768 |
| 367 | Ga0207648_11190356 | 3300026089 | Bacteria | 716 |
| 368 | Ga0207676_10109249 | 3300026095 | Bacteria | 2311 |
| 369 | Ga0207676_10908533 | 3300026095 | Bacteria | 864 |
| 370 | Ga0207674_10126828 | 3300026116 | Bacteria | 2518 |
| 371 | Ga0207675_102234416 | 3300026118 | Bacteria | 562 |
| 372 | Ga0207683_10051095 | 3300026121 | Bacteria | 3622 |
| 373 | Ga0207683_10160115 | 3300026121 | Bacteria | 2034 |
| 374 | Ga0207683_10200387 | 3300026121 | Bacteria | 1814 |
| 375 | Ga0207683_10505736 | 3300026121 | Bacteria | 1116 |
| 376 | Ga0207698_10041587 | 3300026142 | Bacteria | 3426 |
| 377 | Ga0207698_10226506 | 3300026142 | Bacteria | 1694 |
| 378 | Ga0207698_11856875 | 3300026142 | Bacteria | 617 |
| 379 | Ga0209588_1038760 | 3300027671 | Bacteria | 1536 |
| 380 | Ga0209813_10041476 | 3300027866 | Bacteria | 1403 |
| 381 | Ga0209813_10225265 | 3300027866 | Bacteria | 703 |
| 382 | Ga0209813_10412780 | 3300027866 | Bacteria | 546 |
| 383 | Ga0268266_10000951 | 3300028379 | Bacteria | 36935 |
| 384 | Ga0268266_10058052 | 3300028379 | Bacteria | 3332 |
| 385 | Ga0268266_10302052 | 3300028379 | Bacteria | 1493 |
| 386 | Ga0268266_10907570 | 3300028379 | Bacteria | 852 |
| 387 | Ga0268264_10000022 | 3300028381 | Bacteria | 476624 |
| 388 | Ga0268264_10970473 | 3300028381 | Bacteria | 855 |
| 389 | Ga0268264_11173148 | 3300028381 | Bacteria | 777 |
| 390 | Ga0268264_11766700 | 3300028381 | Bacteria | 629 |
| 391 | Ga0307515_10049717 | 3300028794 | Bacteria | 6298 |
| 392 | Ga0307515_10260700 | 3300028794 | Bacteria | 1470 |
| 393 | Ga0307515_10714455 | 3300028794 | Bacteria | 619 |
| 394 | Ga0307515_10838904 | 3300028794 | Bacteria | 545 |
| 395 | Ga0307511_10400044 | 3300030521 | Bacteria | 565 |
| 396 | Ga0265763_1009226 | 3300030763 | Bacteria | 893 |
| 397 | Ga0265770_1146598 | 3300030878 | Bacteria | 515 |
| 398 | Ga0265768_104851 | 3300030963 | Bacteria | 768 |
| 399 | Ga0265768_109342 | 3300030963 | Bacteria | 619 |
| 400 | Ga0265773_1037946 | 3300031018 | Bacteria | 542 |
| 401 | Ga0265773_1049542 | 3300031018 | Bacteria | 500 |
| 402 | Ga0265330_10062556 | 3300031235 | Bacteria | 1618 |
| 403 | Ga0265330_10136062 | 3300031235 | Bacteria | 1045 |
| 404 | Ga0265332_10018173 | 3300031238 | Bacteria | 3101 |
| 405 | Ga0265332_10095848 | 3300031238 | Bacteria | 1253 |
| 406 | Ga0265328_10402167 | 3300031239 | Bacteria | 537 |
| 407 | Ga0265329_10222595 | 3300031242 | Bacteria | 625 |
| 408 | Ga0265340_10003276 | 3300031247 | Bacteria | 9176 |
| 409 | Ga0265339_10159146 | 3300031249 | Bacteria | 1137 |
| 410 | Ga0265331_10131128 | 3300031250 | Bacteria | 1143 |
| 411 | Ga0265331_10207500 | 3300031250 | Bacteria | 882 |
| 412 | Ga0265331_10336256 | 3300031250 | Bacteria | 676 |
| 413 | Ga0265316_10553254 | 3300031344 | Bacteria | 819 |
| 414 | Ga0307513_10256828 | 3300031456 | Bacteria | 1540 |
| 415 | Ga0307513_10464086 | 3300031456 | Bacteria | 989 |
| 416 | Ga0307513_10765441 | 3300031456 | Bacteria | 671 |
| 417 | Ga0307509_10321969 | 3300031507 | Bacteria | 1282 |
| 418 | Ga0307509_10337441 | 3300031507 | Bacteria | 1236 |
| 419 | Ga0307408_100488110 | 3300031548 | Bacteria | 1076 |
| 420 | Ga0307508_10000001 | 3300031616 | Bacteria | 553635 |
| 421 | Ga0307508_10035326 | 3300031616 | Bacteria | 4505 |
| 422 | Ga0307508_10066155 | 3300031616 | Bacteria | 3183 |
| 423 | Ga0307508_10114872 | 3300031616 | Bacteria | 2293 |
| 424 | Ga0307508_10235537 | 3300031616 | Bacteria | 1429 |
| 425 | Ga0310111_138504 | 3300031667 | Bacteria | 539 |
| 426 | Ga0265314_10310495 | 3300031711 | Bacteria | 881 |
| 427 | Ga0265342_10116106 | 3300031712 | Bacteria | 1511 |
| 428 | Ga0265342_10534231 | 3300031712 | Bacteria | 596 |
| 429 | Ga0307516_10002141 | 3300031730 | Bacteria | 26772 |
| 430 | Ga0307516_10021175 | 3300031730 | Bacteria | 6701 |
| 431 | Ga0307410_11550232 | 3300031852 | Bacteria | 584 |
| 432 | Ga0307407_10618249 | 3300031903 | Bacteria | 808 |
| 433 | Ga0307416_100328953 | 3300032002 | Bacteria | 1535 |
| 434 | Ga0307414_11905509 | 3300032004 | Bacteria | 555 |
| 435 | Ga0307411_10553621 | 3300032005 | Bacteria | 982 |
| 436 | Ga0307510_10016586 | 3300033180 | Bacteria | 8695 |
| 437 | Ga0307510_10030555 | 3300033180 | Bacteria | 6105 |
| 438 | Ga0307510_10547822 | 3300033180 | Bacteria | 603 |
| 439 | Ga0373930_0005832 | 3300034816 | Bacteria | 2061 |
| 440 | Ga0373938_0078962 | 3300034957 | Bacteria | 798 |
| 441 | Ga0373929_0037615 | 3300035085 | Bacteria | 1062 |
| 442 | Ga0373940_0252916 | 3300035088 | Bacteria | 594 |
| 443 | Ga0373944_0103056 | 3300035089 | Bacteria | 966 |
| 444 | Ga0373949_0109289 | 3300035090 | Bacteria | 766 |
| 445 | Ga0373949_0121359 | 3300035090 | Bacteria | 734 |
| 446 | Ga0373923_0010882 | 3300035111 | Bacteria | 3323 |
| 447 | Ga0373936_0009619 | 3300035113 | Bacteria | 3642 |
| 448 | Ga0373936_0106618 | 3300035113 | Bacteria | 1187 |
| 449 | Ga0373936_0310319 | 3300035113 | Bacteria | 713 |
| 450 | Ga0373941_0081552 | 3300035115 | Bacteria | 1093 |
| 451 | Ga0373945_0180231 | 3300035116 | Bacteria | 869 |
| 452 | Ga0373953_0006214 | 3300035117 | Bacteria | 3922 |
| 453 | Ga0373956_0056474 | 3300035119 | Bacteria | 1772 |
| 454 | Ga0373957_0051852 | 3300035120 | Bacteria | 1570 |
| 455 | Ga0373957_0152860 | 3300035120 | Bacteria | 948 |
| 456 | Ga0373943_0018283 | 3300035170 | Bacteria | 3218 |
| 457 | Ga0373946_0019787 | 3300035171 | Bacteria | 2597 |
| 458 | Ga0373955_0090902 | 3300035172 | Bacteria | 1739 |
| 459 | Ga0373955_0099626 | 3300035172 | Bacteria | 1666 |
| 460 | Ga0373942_0137388 | 3300035207 | Bacteria | 776 |
| 461 | Ga0373962_0126761 | 3300035242 | Bacteria | 819 |
| 462 | Ga0373931_0002926 | 3300035691 | Bacteria | 7619 |
| 463 | Ga0373931_0578857 | 3300035691 | Bacteria | 732 |
| 464 | Ga0373935_0007714 | 3300035692 | Bacteria | 6449 |
| 465 | Ga0373935_0333426 | 3300035692 | Bacteria | 1079 |
| 466 | Ga0373927_0003072 | 3300035695 | Bacteria | 12100 |
| 467 | Ga0373927_0089135 | 3300035695 | Bacteria | 2003 |
| 468 | Ga0373927_0772947 | 3300035695 | Bacteria | 634 |
| 469 | Ga0373933_0018065 | 3300035724 | Bacteria | 3961 |
| 470 | Ga0373947_0001820 | 3300035725 | Bacteria | 13046 |
| 471 | Ga0373947_0445069 | 3300035725 | Bacteria | 877 |
| 472 | Ga0373947_0922944 | 3300035725 | Bacteria | 596 |
| 473 | Ga0310104_06677 | 3300036242 | Bacteria | 976 |
| 474 | Ga0373937_0015418 | 3300036401 | Bacteria | 6757 |
| 475 | Ga0373937_0090156 | 3300036401 | Bacteria | 2839 |
| 476 | Ga0373937_0797502 | 3300036401 | Bacteria | 892 |
| 477 | Ga0265778_036339 | 3300036457 | Bacteria | 649 |
| 478 | Ga0310112_022196 | 3300036458 | Bacteria | 887 |
| 479 | Ga0310112_062193 | 3300036458 | Bacteria | 504 |
| 480 | Ga0372808_013555 | 3300036459 | Bacteria | 1161 |
| 481 | Ga0372808_040196 | 3300036459 | Bacteria | 671 |
| 482 | Ga0310109_026198 | 3300036534 | Bacteria | 780 |
| 483 | Ga0310109_035897 | 3300036534 | Bacteria | 650 |
| 484 | Ga0310109_039782 | 3300036534 | Bacteria | 613 |
| 485 | Ga0373925_0002588 | 3300037068 | Bacteria | 14382 |
| 486 | Ga0373925_0044622 | 3300037068 | Bacteria | 3292 |
| 487 | Ga0373925_0422470 | 3300037068 | Bacteria | 1089 |
| 488 | Ga0373925_0981788 | 3300037068 | Bacteria | 696 |
| 489 | Ga0395905_1417490 | 3300037471 | Bacteria | 599 |
| 490 | Ga0436365_1151076 | 3300039437 | Bacteria | 2391 |
| 491 | Ga0436365_1218047 | 3300039437 | Bacteria | 1524 |
| 492 | Ga0439465_0337197 | 3300041413 | Bacteria | 568 |
| 493 | Ga0451793_0500760 | 3300041452 | Bacteria | 512 |
| 494 | Ga0451807_0231277 | 3300041486 | Bacteria | 633 |
| 495 | Ga0451837_1456358 | 3300041494 | Bacteria | 747 |
| 496 | Ga0451841_0515919 | 3300041498 | Bacteria | 507 |
| 497 | Ga0451845_0877925 | 3300041501 | Bacteria | 502 |
| 498 | Ga0451847_0531047 | 3300041503 | Bacteria | 858 |
| 499 | Ga0451851_0943936 | 3300041507 | Bacteria | 808 |
| 500 | Ga0451843_0094426 | 3300041509 | Bacteria | 558 |
| 501 | Ga0451855_1030746 | 3300041511 | Bacteria | 728 |
| 502 | Ga0451853_2459925 | 3300041512 | Bacteria | 529 |
| 503 | Ga0439432_183807 | 3300042006 | Bacteria | 608 |
| 504 | Ga0439446_0140299 | 3300042156 | Bacteria | 789 |
| 505 | Ga0466972_0002947 | 3300044658 | Bacteria | 8439 |
| 506 | Ga0466972_0287544 | 3300044658 | Bacteria | 768 |
| 507 | Ga0466963_1114300 | 3300044694 | Unclassified | 555 |
| 508 | Ga0466968_0005930 | 3300044735 | Bacteria | 4584 |
| 509 | Ga0466960_0003317 | 3300044901 | Bacteria | 6179 |
| 510 | Ga0466967_0533577 | 3300045976 | Bacteria | 1154 |
| 511 | Ga0466967_0978674 | 3300045976 | Bacteria | 842 |
| 512 | Ga0495617_011960 | 3300046452 | Bacteria | 2960 |
| 513 | Ga0495592_0004679 | 3300046454 | Bacteria | 10030 |
| 514 | Ga0495592_0010679 | 3300046454 | Bacteria | 6924 |
| 515 | Ga0495592_0184866 | 3300046454 | Bacteria | 1417 |
| 516 | Ga0495592_0812336 | 3300046454 | Bacteria | 555 |
| 517 | Ga0495603_0000067 | 3300046455 | Bacteria | 45466 |
| 518 | Ga0495603_0060084 | 3300046455 | Bacteria | 2246 |
| 519 | Ga0495590_0021201 | 3300046457 | Bacteria | 2305 |
| 520 | Ga0495629_0001667 | 3300046459 | Bacteria | 17433 |
| 521 | Ga0495629_0017434 | 3300046459 | Bacteria | 5146 |
| 522 | Ga0495638_0055502 | 3300046460 | Bacteria | 2459 |
| 523 | Ga0495638_0188705 | 3300046460 | Bacteria | 1171 |
| 524 | Ga0495638_0211886 | 3300046460 | Bacteria | 1088 |
| 525 | Ga0495638_0515833 | 3300046460 | Bacteria | 599 |
| 526 | Ga0495641_0003314 | 3300046461 | Bacteria | 12135 |
| 527 | Ga0495651_0002792 | 3300046462 | Bacteria | 13540 |
| 528 | Ga0495653_0003251 | 3300046463 | Bacteria | 13038 |
| 529 | Ga0495653_0441776 | 3300046463 | Bacteria | 820 |
| 530 | Ga0495580_0031815 | 3300046472 | Bacteria | 3810 |
| 531 | Ga0495582_0000744 | 3300046473 | Bacteria | 18014 |
| 532 | Ga0495605_0383069 | 3300046474 | Bacteria | 587 |
| 533 | Ga0495605_0482429 | 3300046474 | Bacteria | 508 |
| 534 | Ga0495639_0001360 | 3300046475 | Bacteria | 10978 |
| 535 | Ga0495639_0303232 | 3300046475 | Bacteria | 797 |
| 536 | Ga0495639_0638141 | 3300046475 | Bacteria | 549 |
| 537 | Ga0495662_0007547 | 3300046476 | Bacteria | 5368 |
| 538 | Ga0495664_0777338 | 3300046477 | Bacteria | 564 |
| 539 | Ga0495584_0337987 | 3300046491 | Bacteria | 765 |
| 540 | Ga0495585_0033897 | 3300046492 | Bacteria | 2888 |
| 541 | Ga0495585_0106773 | 3300046492 | Bacteria | 1492 |
| 542 | Ga0495594_0009145 | 3300046499 | Bacteria | 5112 |
| 543 | Ga0495583_0117389 | 3300046506 | Bacteria | 1123 |
| 544 | Ga0495583_0134729 | 3300046506 | Bacteria | 1032 |
| 545 | Ga0495606_0275850 | 3300046507 | Bacteria | 921 |
| 546 | Ga0495606_0331037 | 3300046507 | Bacteria | 815 |
| 547 | Ga0495608_0003162 | 3300046511 | Bacteria | 11774 |
| 548 | Ga0495608_0549210 | 3300046511 | Bacteria | 696 |
| 549 | Ga0495610_0039045 | 3300046512 | Bacteria | 2404 |
| 550 | Ga0495610_0118425 | 3300046512 | Bacteria | 1164 |
| 551 | Ga0495610_0142481 | 3300046512 | Bacteria | 1030 |
| 552 | Ga0495616_0138805 | 3300046513 | Bacteria | 1108 |
| 553 | Ga0495616_0219399 | 3300046513 | Bacteria | 829 |
| 554 | Ga0495618_0041879 | 3300046514 | Bacteria | 2885 |
| 555 | Ga0495628_0083080 | 3300046516 | Bacteria | 2487 |
| 556 | Ga0495628_0197939 | 3300046516 | Bacteria | 1515 |
| 557 | Ga0495630_0019651 | 3300046517 | Bacteria | 4968 |
| 558 | Ga0495630_0403692 | 3300046517 | Bacteria | 1047 |
| 559 | Ga0495630_1139896 | 3300046517 | Bacteria | 591 |
| 560 | Ga0495631_0022504 | 3300046518 | Bacteria | 2930 |
| 561 | Ga0495637_0092270 | 3300046520 | Bacteria | 1193 |
| 562 | Ga0495643_0168676 | 3300046522 | Bacteria | 1072 |
| 563 | Ga0495648_0080224 | 3300046524 | Bacteria | 1860 |
| 564 | Ga0495648_0102525 | 3300046524 | Bacteria | 1576 |
| 565 | Ga0495666_0081025 | 3300046526 | Bacteria | 1536 |
| 566 | Ga0495666_0084345 | 3300046526 | Bacteria | 1501 |
| 567 | Ga0495652_0063052 | 3300046529 | Bacteria | 3122 |
| 568 | Ga0495652_0082595 | 3300046529 | Bacteria | 2647 |
| 569 | Ga0495652_0316973 | 3300046529 | Bacteria | 1128 |
| 570 | Ga0495652_0366519 | 3300046529 | Bacteria | 1028 |
| 571 | Ga0495654_0071733 | 3300046530 | Bacteria | 1640 |
| 572 | Ga0495665_0000307 | 3300046531 | Bacteria | 24786 |
| 573 | Ga0495640_0016203 | 3300046533 | Bacteria | 5580 |
| 574 | Ga0495640_0216997 | 3300046533 | Bacteria | 1207 |
| 575 | Ga0495586_0923680 | 3300046535 | Bacteria | 503 |
| 576 | Ga0495587_0182478 | 3300046536 | Bacteria | 1189 |
| 577 | Ga0495587_0503169 | 3300046536 | Bacteria | 670 |
| 578 | Ga0495597_0112347 | 3300046542 | Bacteria | 1141 |
| 579 | Ga0495597_0185613 | 3300046542 | Bacteria | 838 |
| 580 | Ga0495645_0287622 | 3300046543 | Bacteria | 1079 |
| 581 | Ga0495645_0359043 | 3300046543 | Bacteria | 937 |
| 582 | Ga0495622_0025886 | 3300046557 | Bacteria | 2741 |
| 583 | Ga0495622_0096124 | 3300046557 | Bacteria | 1359 |
| 584 | Ga0495667_0037917 | 3300046559 | Bacteria | 3211 |
| 585 | Ga0495656_0153373 | 3300046615 | Bacteria | 1114 |
| 586 | Ga0495656_0669689 | 3300046615 | Bacteria | 557 |
| 587 | Ga0495668_0031702 | 3300046616 | Bacteria | 2979 |
| 588 | Ga0495668_0162698 | 3300046616 | Bacteria | 1222 |
| 589 | Ga0495668_0251904 | 3300046616 | Bacteria | 967 |
| 590 | Ga0495668_0865044 | 3300046616 | Bacteria | 501 |
| 591 | Ga0495634_0005834 | 3300046642 | Bacteria | 9398 |
| 592 | Ga0495634_0012063 | 3300046642 | Bacteria | 6264 |
| 593 | Ga0495611_0182619 | 3300046648 | Bacteria | 980 |
| 594 | Ga0495611_0540167 | 3300046648 | Bacteria | 528 |
| 595 | Ga0495625_0110684 | 3300046660 | Bacteria | 1877 |
| 596 | Ga0495625_0155073 | 3300046660 | Bacteria | 1537 |
| 597 | Ga0495625_0274308 | 3300046660 | Bacteria | 1087 |
| 598 | Ga0495625_0742793 | 3300046660 | Bacteria | 576 |
| 599 | Ga0495635_0000230 | 3300046663 | Bacteria | 35642 |
| 600 | Ga0495635_0001592 | 3300046663 | Bacteria | 15276 |
| 601 | Ga0495635_0730470 | 3300046663 | Bacteria | 641 |
| 602 | Ga0495635_0806027 | 3300046663 | Bacteria | 605 |
| 603 | Ga0495635_1075107 | 3300046663 | Bacteria | 510 |
| 604 | Ga0495659_0006340 | 3300046664 | Bacteria | 3738 |
| 605 | Ga0495588_0093733 | 3300046674 | Bacteria | 1574 |
| 606 | Ga0495588_0141359 | 3300046674 | Bacteria | 1272 |
| 607 | Ga0495588_0284579 | 3300046674 | Bacteria | 871 |
| 608 | Ga0495657_0019646 | 3300046675 | Bacteria | 4871 |
| 609 | Ga0495599_0003970 | 3300046678 | Bacteria | 8710 |
| 610 | Ga0495599_0034785 | 3300046678 | Bacteria | 3164 |
| 611 | Ga0495623_0626562 | 3300046679 | Bacteria | 556 |
| 612 | Ga0495646_0011572 | 3300046680 | Bacteria | 5603 |
| 613 | Ga0495646_0185581 | 3300046680 | Bacteria | 1139 |
| 614 | Ga0495647_0001173 | 3300046681 | Bacteria | 8061 |
| 615 | Ga0495647_0145903 | 3300046681 | Bacteria | 1012 |
| 616 | Ga0495658_0000520 | 3300046683 | Bacteria | 21077 |
| 617 | Ga0495669_0157650 | 3300046684 | Bacteria | 1076 |
| 618 | Ga0495613_0038005 | 3300046689 | Bacteria | 3568 |
| 619 | Ga0495613_0097036 | 3300046689 | Bacteria | 2131 |
| 620 | Ga0495613_0448507 | 3300046689 | Bacteria | 874 |
| 621 | Ga0495624_0020438 | 3300046690 | Bacteria | 4406 |
| 622 | Ga0495670_0003109 | 3300046691 | Bacteria | 8182 |
| 623 | Ga0495671_0093738 | 3300046692 | Bacteria | 1469 |
| 624 | Ga0495649_0566949 | 3300046694 | Bacteria | 561 |
| 625 | Ga0495649_0588446 | 3300046694 | Bacteria | 549 |
| 626 | Ga0495589_0112151 | 3300046794 | Bacteria | 1316 |
| 627 | Ga0495600_0004716 | 3300046809 | Bacteria | 8181 |
| 628 | Ga0495600_0245468 | 3300046809 | Bacteria | 1140 |
| 629 | Ga0495600_0923392 | 3300046809 | Bacteria | 514 |
| 630 | Ga0495581_0000022 | 3300047315 | Bacteria | 56149 |
| 631 | Ga0495581_0206596 | 3300047315 | Bacteria | 1149 |
| 632 | Ga0495581_0261632 | 3300047315 | Bacteria | 1012 |
| 633 | Ga0495604_0004194 | 3300047317 | Bacteria | 11424 |
| 634 | Ga0495674_0001816 | 3300047319 | Bacteria | 21040 |
| 635 | Ga0495674_0008381 | 3300047319 | Bacteria | 9849 |
| 636 | Ga0495674_0240261 | 3300047319 | Bacteria | 1493 |
| 637 | Ga0495672_0023877 | 3300047320 | Bacteria | 3950 |
| 638 | Ga0495672_0024111 | 3300047320 | Bacteria | 3926 |
| 639 | Ga0495672_0126330 | 3300047320 | Bacteria | 1352 |
| 640 | Ga0495676_0123031 | 3300047321 | Bacteria | 1884 |
| 641 | Ga0495676_0174994 | 3300047321 | Bacteria | 1508 |
| 642 | Ga0495680_0011451 | 3300047322 | Bacteria | 7852 |
| 643 | Ga0495680_0363979 | 3300047322 | Bacteria | 1004 |
| 644 | Ga0495683_0051610 | 3300047323 | Bacteria | 2055 |
| 645 | Ga0495675_0001005 | 3300047444 | Bacteria | 17160 |
| 646 | Ga0495679_115800 | 3300047446 | Bacteria | 736 |
| 647 | Ga0495685_037620 | 3300047447 | Bacteria | 1659 |
| 648 | Ga0495673_0086629 | 3300047469 | Bacteria | 1287 |
| 649 | Ga0495673_0099576 | 3300047469 | Bacteria | 1177 |
| 650 | Ga0495681_0388230 | 3300047470 | Bacteria | 524 |
| 651 | Ga0495684_0078668 | 3300047471 | Bacteria | 2503 |
| 652 | Ga0495593_0000016 | 3300047673 | Bacteria | 80178 |
| 653 | Ga0495593_0002243 | 3300047673 | Bacteria | 11592 |
| 654 | Ga0495602_0023393 | 3300048088 | Bacteria | 6021 |
| 655 | Ga0495602_1015168 | 3300048088 | Bacteria | 547 |
| 656 | Ga0495614_0024357 | 3300048089 | Bacteria | 2613 |
| 657 | Ga0495626_0093542 | 3300048091 | Bacteria | 1319 |
| 658 | Ga0496100_0014273 | 3300048903 | Bacteria | 4609 |
| 659 | Ga0496100_0044857 | 3300048903 | Bacteria | 2834 |
| 660 | Ga0496100_0061540 | 3300048903 | Bacteria | 2474 |
| 661 | Ga0496101_0036493 | 3300048904 | Bacteria | 3482 |
| 662 | Ga0496101_0201852 | 3300048904 | Bacteria | 1537 |
| 663 | Ga0496101_0267419 | 3300048904 | Bacteria | 1334 |
| 664 | Ga0496102_0047584 | 3300048905 | Bacteria | 3899 |
| 665 | Ga0496102_0055990 | 3300048905 | Bacteria | 3596 |
| 666 | Ga0496102_0165484 | 3300048905 | Bacteria | 2081 |
| 667 | Ga0496102_0495915 | 3300048905 | Bacteria | 1143 |
| 668 | Ga0496102_0741326 | 3300048905 | Bacteria | 905 |
| 669 | Ga0496102_1066581 | 3300048905 | Bacteria | 728 |
| 670 | Ga0496102_1392180 | 3300048905 | Bacteria | 620 |
| 671 | Ga0496102_1738578 | 3300048905 | Bacteria | 541 |
| 672 | Ga0496103_0116937 | 3300048906 | Bacteria | 1697 |
| 673 | Ga0496103_0791906 | 3300048906 | Bacteria | 598 |
| 674 | Ga0496103_0954574 | 3300048906 | Bacteria | 535 |
| 675 | Ga0496104_0031531 | 3300048907 | Bacteria | 4929 |
| 676 | Ga0496104_0032314 | 3300048907 | Bacteria | 4870 |
| 677 | Ga0496104_0056952 | 3300048907 | Bacteria | 3698 |
| 678 | Ga0496104_0253277 | 3300048907 | Bacteria | 1673 |
| 679 | Ga0496104_1568453 | 3300048907 | Bacteria | 561 |
| 680 | Ga0496105_0011247 | 3300048908 | Bacteria | 7062 |
| 681 | Ga0496105_0020951 | 3300048908 | Bacteria | 5287 |
| 682 | Ga0496105_0389856 | 3300048908 | Bacteria | 1107 |
| 683 | Ga0496106_0026827 | 3300048909 | Bacteria | 4290 |
| 684 | Ga0496106_0031902 | 3300048909 | Bacteria | 3926 |
| 685 | Ga0496106_0046979 | 3300048909 | Bacteria | 3247 |
| 686 | Ga0496106_0435018 | 3300048909 | Bacteria | 1054 |
| 687 | Ga0496107_0014561 | 3300048910 | Bacteria | 5505 |
| 688 | Ga0496107_0169046 | 3300048910 | Bacteria | 1622 |
| 689 | Ga0496108_0043218 | 3300048911 | Bacteria | 3764 |
| 690 | Ga0496108_0094038 | 3300048911 | Bacteria | 2551 |
| 691 | Ga0496108_0490131 | 3300048911 | Bacteria | 1073 |
| 692 | Ga0496108_0615137 | 3300048911 | Bacteria | 946 |
| 693 | Ga0496109_0028587 | 3300048912 | Bacteria | 4987 |
| 694 | Ga0496109_0038696 | 3300048912 | Bacteria | 4313 |
| 695 | Ga0496109_0161278 | 3300048912 | Bacteria | 2101 |
| 696 | Ga0496109_0570771 | 3300048912 | Bacteria | 1066 |
| 697 | Ga0496110_0053465 | 3300048913 | Bacteria | 3551 |
| 698 | Ga0496110_0088670 | 3300048913 | Bacteria | 2763 |
| 699 | Ga0496110_1504467 | 3300048913 | Bacteria | 583 |
| 700 | Ga0496111_0099650 | 3300048914 | Bacteria | 2134 |
| 701 | Ga0496111_0130090 | 3300048914 | Bacteria | 1862 |
| 702 | Ga0496111_0276131 | 3300048914 | Bacteria | 1247 |
| 703 | Ga0496111_0299562 | 3300048914 | Bacteria | 1192 |
| 704 | Ga0496111_0344774 | 3300048914 | Bacteria | 1103 |
| 705 | Ga0496111_0718387 | 3300048914 | Bacteria | 726 |
| 706 | Ga0496112_0010586 | 3300048915 | Bacteria | 8378 |
| 707 | Ga0496112_0068948 | 3300048915 | Bacteria | 3493 |
| 708 | Ga0496112_0559267 | 3300048915 | Bacteria | 1077 |
| 709 | Ga0496112_0603281 | 3300048915 | Bacteria | 1030 |
| 710 | Ga0496113_0033763 | 3300048916 | Bacteria | 3728 |
| 711 | Ga0496113_0430197 | 3300048916 | Bacteria | 1060 |
| 712 | Ga0496113_0489284 | 3300048916 | Bacteria | 988 |
| 713 | Ga0496114_0024702 | 3300048917 | Bacteria | 4906 |
| 714 | Ga0496114_0054153 | 3300048917 | Bacteria | 3346 |
| 715 | Ga0496114_0141757 | 3300048917 | Bacteria | 2081 |
| 716 | Ga0496114_0374728 | 3300048917 | Bacteria | 1260 |
| 717 | Ga0496114_0481440 | 3300048917 | Bacteria | 1098 |
| 718 | Ga0496115_0006501 | 3300048918 | Bacteria | 8570 |
| 719 | Ga0496115_0017237 | 3300048918 | Bacteria | 5515 |
| 720 | Ga0496115_0132938 | 3300048918 | Bacteria | 2051 |
| 721 | Ga0496116_0001852 | 3300048919 | Bacteria | 22894 |
| 722 | Ga0496116_0064344 | 3300048919 | Bacteria | 2358 |
| 723 | Ga0496117_0248623 | 3300048920 | Bacteria | 971 |
| 724 | Ga0496117_0541241 | 3300048920 | Bacteria | 556 |
| 725 | Ga0496118_0142205 | 3300048921 | Bacteria | 1518 |
| 726 | Ga0496119_0091208 | 3300048922 | Bacteria | 1731 |
| 727 | Ga0496120_0061040 | 3300048923 | Bacteria | 2106 |
| 728 | Ga0496121_0003622 | 3300048924 | Bacteria | 21784 |
| 729 | Ga0496121_0021812 | 3300048924 | Bacteria | 6254 |
| 730 | Ga0496121_0058140 | 3300048924 | Bacteria | 3199 |
| 731 | Ga0496121_0079072 | 3300048924 | Bacteria | 2612 |
| 732 | Ga0496121_0123652 | 3300048924 | Bacteria | 1949 |
| 733 | Ga0496121_0257078 | 3300048924 | Bacteria | 1208 |
| 734 | Ga0496122_0232375 | 3300048925 | Bacteria | 1047 |
| 735 | Ga0496123_0164615 | 3300048926 | Bacteria | 1178 |
| 736 | Ga0496123_0477315 | 3300048926 | Bacteria | 549 |
| 737 | Ga0496125_0013225 | 3300048928 | Bacteria | 8126 |
| 738 | Ga0496125_0059958 | 3300048928 | Bacteria | 3062 |
| 739 | Ga0496125_0390002 | 3300048928 | Bacteria | 818 |
| 740 | Ga0496126_0003918 | 3300048929 | Bacteria | 18248 |
| 741 | Ga0496126_0022867 | 3300048929 | Bacteria | 6070 |
| 742 | Ga0496126_0162705 | 3300048929 | Bacteria | 1906 |
| 743 | Ga0496126_0191243 | 3300048929 | Bacteria | 1733 |
| 744 | Ga0496126_0206267 | 3300048929 | Bacteria | 1657 |
| 745 | Ga0496126_0282016 | 3300048929 | Bacteria | 1376 |
| 746 | Ga0496126_0421113 | 3300048929 | Bacteria | 1079 |
| 747 | Ga0496126_1038807 | 3300048929 | Bacteria | 612 |
| 748 | Ga0495678_067495 | 3300049459 | Bacteria | 1321 |
| 749 | Ga0495682_0185262 | 3300049460 | Bacteria | 739 |
| 750 | Ga0501315_060822 | 3300049531 | Bacteria | 611 |
| 751 | nmdc:mga03683_311918_c1 | 3300050489 | Bacteria | 739 |
| 752 | nmdc:mga03n38_30616_c2 | 3300050490 | Bacteria | 586 |
| 753 | nmdc:mga03n38_4045_c1 | 3300050490 | Bacteria | 4800 |
| 754 | nmdc:mga03n38_41091_c1 | 3300050490 | Bacteria | 2013 |
| 755 | nmdc:mga03n38_856146_c1 | 3300050490 | Bacteria | 532 |
| 756 | nmdc:mga03n38_904321_c1 | 3300050490 | Bacteria | 519 |
| 757 | nmdc:mga00v17_19275_c1 | 3300050491 | Bacteria | 3893 |
| 758 | nmdc:mga00v17_458905_c1 | 3300050491 | Bacteria | 827 |
| 759 | nmdc:mga00v17_916149_c1 | 3300050491 | Bacteria | 554 |
| 760 | nmdc:mga0yw44_147071_c1 | 3300050492 | Bacteria | 1535 |
| 761 | nmdc:mga0yw44_167125_c1 | 3300050492 | Bacteria | 1443 |
| 762 | nmdc:mga0yw44_189271_c1 | 3300050492 | Bacteria | 1357 |
| 763 | nmdc:mga0yw44_343682_c1 | 3300050492 | Bacteria | 1004 |
| 764 | nmdc:mga0yw44_36131_c1 | 3300050492 | Bacteria | 2909 |
| 765 | nmdc:mga0k408_118194_c1 | 3300050493 | Bacteria | 1569 |
| 766 | nmdc:mga0k408_382734_c1 | 3300050493 | Bacteria | 838 |
| 767 | nmdc:mga06z11_120038_c1 | 3300050494 | Bacteria | 1466 |
| 768 | nmdc:mga06z11_471347_c1 | 3300050494 | Bacteria | 760 |
| 769 | nmdc:mga06z11_62524_c1 | 3300050494 | Bacteria | 1945 |
| 770 | nmdc:mga06z11_92545_c1 | 3300050494 | Bacteria | 1644 |
| 771 | nmdc:mga06z11_986522_c1 | 3300050494 | Bacteria | 513 |
| 772 | nmdc:mga04h51_216478_c1 | 3300050495 | Bacteria | 757 |
| 773 | nmdc:mga04h51_231998_c1 | 3300050495 | Bacteria | 734 |
| 774 | nmdc:mga04h51_23622_c1 | 3300050495 | Bacteria | 1873 |
| 775 | nmdc:mga04h51_269530_c1 | 3300050495 | Bacteria | 687 |
| 776 | nmdc:mga07m45_3883_c1 | 3300050496 | Bacteria | 7254 |
| 777 | nmdc:mga07m45_447027_c1 | 3300050496 | Bacteria | 749 |
| 778 | nmdc:mga07m45_53804_c1 | 3300050496 | Bacteria | 2275 |
| 779 | nmdc:mga07m45_86964_c1 | 3300050496 | Bacteria | 1788 |
| 780 | nmdc:mga0rr50_720424_c1 | 3300050513 | Bacteria | 851 |
| 781 | nmdc:mga08x19_992255_c1 | 3300050514 | Unclassified | 596 |
| 782 | nmdc:mga0sz30_27759_c1 | 3300050516 | Bacteria | 2326 |
| 783 | nmdc:mga0sz30_593296_c1 | 3300050516 | Bacteria | 501 |
| 784 | nmdc:mga0sz30_59677_c1 | 3300050516 | Bacteria | 1628 |
| 785 | Ga0495601_0210254 | 3300053077 | Bacteria | 1271 |
| 786 | Ga0495612_0093779 | 3300053078 | Bacteria | 1274 |
| 787 | Ga0500635_0099609 | 3300053080 | Bacteria | 1067 |
| 788 | Ga0495595_0001042 | 3300053084 | Bacteria | 10677 |
| 789 | Ga0495595_0036630 | 3300053084 | Bacteria | 2227 |
| 790 | Ga0495595_0060983 | 3300053084 | Bacteria | 1766 |
| 791 | Ga0495619_0002925 | 3300053085 | Bacteria | 11103 |
| 792 | Ga0495619_0069905 | 3300053085 | Bacteria | 2347 |
| 793 | Ga0500643_012153 | 3300053087 | Bacteria | 3096 |
| 794 | Ga0500644_0151700 | 3300053088 | Bacteria | 929 |
| 795 | Ga0500646_0078978 | 3300053090 | Bacteria | 1001 |
| 796 | Ga0500647_0197851 | 3300053091 | Bacteria | 913 |
| 797 | Ga0500583_0111877 | 3300053092 | Bacteria | 1345 |
| 798 | Ga0500651_0703078 | 3300053093 | Bacteria | 540 |
| 799 | Ga0500566_0000047 | 3300053094 | Bacteria | 58577 |
| 800 | Ga0500566_0000930 | 3300053094 | Bacteria | 16751 |
| 801 | Ga0500566_0002386 | 3300053094 | Bacteria | 11113 |
| 802 | Ga0500566_0095747 | 3300053094 | Bacteria | 1635 |
| 803 | Ga0500640_001486 | 3300053095 | Bacteria | 7161 |
| 804 | Ga0500641_0004333 | 3300053096 | Bacteria | 5007 |
| 805 | Ga0500641_0014253 | 3300053096 | Bacteria | 2932 |
| 806 | Ga0500650_0276304 | 3300053098 | Bacteria | 748 |
| 807 | Ga0500650_0440191 | 3300053098 | Bacteria | 560 |
| 808 | Ga0500554_073118 | 3300053102 | Bacteria | 1119 |
| 809 | Ga0500555_090523 | 3300053103 | Bacteria | 786 |
| 810 | Ga0500556_0000002 | 3300053104 | Bacteria | 773626 |
| 811 | Ga0500556_0005914 | 3300053104 | Bacteria | 3465 |
| 812 | Ga0500556_0424974 | 3300053104 | Bacteria | 507 |
| 813 | Ga0500557_145960 | 3300053105 | Bacteria | 780 |
| 814 | Ga0500562_050532 | 3300053108 | Bacteria | 1111 |
| 815 | Ga0500562_132380 | 3300053108 | Bacteria | 680 |
| 816 | Ga0500569_186771 | 3300053109 | Bacteria | 704 |
| 817 | Ga0500572_000071 | 3300053111 | Bacteria | 32122 |
| 818 | Ga0500591_034835 | 3300053115 | Bacteria | 2418 |
| 819 | Ga0500592_024109 | 3300053116 | Bacteria | 980 |
| 820 | Ga0500594_0035706 | 3300053118 | Bacteria | 1334 |
| 821 | Ga0500595_007366 | 3300053119 | Bacteria | 4570 |
| 822 | Ga0500595_020065 | 3300053119 | Bacteria | 2412 |
| 823 | Ga0500607_115404 | 3300053121 | Bacteria | 1309 |
| 824 | Ga0500608_014864 | 3300053122 | Bacteria | 3483 |
| 825 | Ga0500614_000552 | 3300053123 | Bacteria | 9634 |
| 826 | Ga0500621_268059 | 3300053126 | Bacteria | 564 |
| 827 | Ga0500642_0000010 | 3300053130 | Bacteria | 272552 |
| 828 | Ga0500642_0464607 | 3300053130 | Bacteria | 541 |
| 829 | Ga0500652_000511 | 3300053131 | Bacteria | 13661 |
| 830 | Ga0500655_052599 | 3300053133 | Bacteria | 813 |
| 831 | Ga0500655_080920 | 3300053133 | Bacteria | 668 |
| 832 | Ga0500658_0204496 | 3300053134 | Bacteria | 903 |
| 833 | Ga0500559_0000919 | 3300053136 | Bacteria | 18725 |
| 834 | Ga0500559_0005925 | 3300053136 | Bacteria | 5559 |
| 835 | Ga0500559_0239828 | 3300053136 | Bacteria | 854 |
| 836 | Ga0500564_254083 | 3300053138 | Bacteria | 695 |
| 837 | Ga0500568_0000680 | 3300053139 | Bacteria | 24548 |
| 838 | Ga0500568_0034974 | 3300053139 | Bacteria | 2052 |
| 839 | Ga0500568_0053267 | 3300053139 | Bacteria | 1587 |
| 840 | Ga0500568_0288571 | 3300053139 | Bacteria | 596 |
| 841 | Ga0500577_0078346 | 3300053142 | Bacteria | 1312 |
| 842 | Ga0500579_279576 | 3300053143 | Bacteria | 512 |
| 843 | Ga0500588_0377568 | 3300053146 | Bacteria | 539 |
| 844 | Ga0500588_0396907 | 3300053146 | Bacteria | 525 |
| 845 | Ga0500589_112624 | 3300053147 | Bacteria | 1165 |
| 846 | Ga0500590_172573 | 3300053148 | Bacteria | 949 |
| 847 | Ga0500590_173935 | 3300053148 | Bacteria | 943 |
| 848 | Ga0500590_232649 | 3300053148 | Bacteria | 749 |
| 849 | Ga0500603_000190 | 3300053150 | Bacteria | 15991 |
| 850 | Ga0500604_0009645 | 3300053151 | Bacteria | 2573 |
| 851 | Ga0500604_0183312 | 3300053151 | Bacteria | 718 |
| 852 | Ga0500622_0001697 | 3300053156 | Bacteria | 17095 |
| 853 | Ga0500627_0057763 | 3300053158 | Bacteria | 1702 |
| 854 | Ga0500627_0174424 | 3300053158 | Bacteria | 968 |
| 855 | Ga0500627_0495969 | 3300053158 | Bacteria | 509 |
| 856 | Ga0500630_001753 | 3300053159 | Bacteria | 10386 |
| 857 | Ga0500633_0043029 | 3300053160 | Bacteria | 1527 |
| 858 | Ga0500633_0260601 | 3300053160 | Bacteria | 643 |
| 859 | Ga0500634_0168913 | 3300053161 | Bacteria | 999 |
| 860 | Ga0500634_0352715 | 3300053161 | Bacteria | 561 |
| 861 | Ga0500638_050493 | 3300053162 | Bacteria | 2011 |
| 862 | Ga0500639_000087 | 3300053163 | Bacteria | 43854 |
| 863 | Ga0500639_180715 | 3300053163 | Bacteria | 933 |
| 864 | Ga0500636_0026370 | 3300053177 | Bacteria | 3433 |
| 865 | Ga0500637_0139935 | 3300053178 | Bacteria | 1401 |
| 866 | Ga0500637_0159095 | 3300053178 | Bacteria | 1302 |
| 867 | Ga0500576_210813 | 3300053725 | Bacteria | 649 |
| 868 | Ga0500657_177386 | 3300053728 | Bacteria | 745 |
| 869 | Ga0500645_031958 | 3300053730 | Bacteria | 1580 |
| 870 | Ga0500609_006198 | 3300053731 | Bacteria | 1630 |
| 871 | Ga0500596_000958 | 3300053735 | Bacteria | 5747 |
| 872 | Ga0500601_023501 | 3300053737 | Bacteria | 716 |
| 873 | Ga0500661_034556 | 3300055283 | Bacteria | 893 |
| 874 | Ga0587084_114439 | 3300059477 | Bacteria | 561 |
| 875 | Ga0587066_179457 | 3300059490 | Bacteria | 544 |
| 876 | Ga0587070_122016 | 3300059491 | Bacteria | 624 |
| 877 | Ga0587083_0161347 | 3300059505 | Bacteria | 613 |
| 878 | Ga0587083_0189321 | 3300059505 | Bacteria | 581 |
| 879 | Ga0587085_168268 | 3300059506 | Bacteria | 517 |
| 880 | Ga0587088_164094 | 3300059508 | Bacteria | 546 |
| 881 | Ga0587090_115060 | 3300059510 | Bacteria | 578 |
| 882 | Ga0587090_148626 | 3300059510 | Bacteria | 529 |
| 883 | Ga0587090_173321 | 3300059510 | Unclassified | 502 |
| 884 | Ga0587091_240738 | 3300059511 | Bacteria | 503 |
| 885 | Ga0587092_112323 | 3300059512 | Bacteria | 573 |
| 886 | Ga0587094_131233 | 3300059513 | Bacteria | 510 |
| 887 | Ga0587101_069978 | 3300059623 | Bacteria | 644 |
| 888 | Ga0587101_112396 | 3300059623 | Bacteria | 554 |
| 889 | Ga0587109_074498 | 3300059624 | Bacteria | 740 |
| 890 | Ga0587117_133487 | 3300059627 | Bacteria | 502 |
| 891 | Ga0587068_163424 | 3300059641 | Bacteria | 511 |
| 892 | Ga0587069_122407 | 3300059642 | Bacteria | 553 |
| 893 | Ga0587069_129982 | 3300059642 | Bacteria | 542 |
| 894 | Ga0587075_066830 | 3300059644 | Bacteria | 660 |
| 895 | Ga0587075_082130 | 3300059644 | Bacteria | 616 |
| 896 | Ga0587076_107565 | 3300059645 | Bacteria | 631 |
| 897 | Ga0587076_208143 | 3300059645 | Bacteria | 506 |
| 898 | Ga0587078_064624 | 3300059646 | Bacteria | 561 |
| 899 | Ga0587079_092162 | 3300059647 | Bacteria | 711 |
| 900 | Ga0587079_099550 | 3300059647 | Bacteria | 692 |
| 901 | Ga0587079_128464 | 3300059647 | Bacteria | 634 |
| 902 | Ga0587079_200664 | 3300059647 | Bacteria | 544 |
| 903 | Ga0587102_041714 | 3300059649 | Bacteria | 594 |
| 904 | Ga0587071_077994 | 3300060344 | Bacteria | 733 |
| 905 | Ga0587071_182294 | 3300060344 | Bacteria | 540 |
| 906 | Ga0587111_0047675 | 3300060346 | Bacteria | 936 |
| 907 | Ga0587111_0088831 | 3300060346 | Bacteria | 751 |
| 908 | Ga0587111_0162230 | 3300060346 | Bacteria | 608 |
| 909 | Ga0587111_0167082 | 3300060346 | Bacteria | 602 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025921 | Ga0207652_10744886 | Ga0207652_107448863 | 65 |
| 2 | 3300059505 | Ga0587083_0161347 | Ga0587083_0161347_91_300 | 69 |
| 3 | 3300059510 | Ga0587090_148626 | Ga0587090_148626_239_448 | 69 |
| 4 | 3300059642 | Ga0587069_122407 | Ga0587069_122407_260_469 | 69 |
| 5 | 3300059645 | Ga0587076_107565 | Ga0587076_107565_334_543 | 69 |
| 6 | 3300059647 | Ga0587079_128464 | Ga0587079_128464_344_553 | 69 |
| 7 | 3300060344 | Ga0587071_182294 | Ga0587071_182294_82_291 | 69 |
| 8 | 3300031239 | Ga0265328_10402167 | Ga0265328_104021672 | 70 |
| 9 | 3300031249 | Ga0265339_10159146 | Ga0265339_101591462 | 70 |
| 10 | 3300044694 | Ga0466963_1114300 | Ga0466963_1114300_186_443 | 75 |
| 11 | 3300045976 | Ga0466967_0533577 | Ga0466967_0533577_246_503 | 75 |
| 12 | 3300030963 | Ga0265768_109342 | Ga0265768_1093421 | 78 |
| 13 | 3300009551 | Ga0105238_12272899 | Ga0105238_122728991 | 79 |
| 14 | 3300044658 | Ga0466972_0287544 | Ga0466972_0287544_280_519 | 79 |
| 15 | 3300006237 | Ga0097621_101862147 | Ga0097621_1018621472 | 80 |
| 16 | 3300011119 | Ga0105246_11544214 | Ga0105246_115442141 | 80 |
| 17 | iso_pu_bacteria | 2508501128 | 2509147490 | 80 |
| 18 | iso_pu_bacteria | 2513237141 | 2513892884 | 80 |
| 19 | iso_pu_bacteria | 2602042107 | 2603859023 | 80 |
| 20 | iso_pu_bacteria | 2857524615 | 2857527874 | 80 |
| 21 | iso_pu_bacteria | 2893066018 | 2893068236 | 80 |
| 22 | iso_pu_bacteria | 2919073203 | 2919075274 | 80 |
| 23 | 3300005616 | Ga0068852_102054068 | Ga0068852_1020540682 | 81 |
| 24 | iso_pu_bacteria | 2507262055 | 2507509152 | 81 |
| 25 | iso_pu_bacteria | 2508501009 | 2508543217 | 81 |
| 26 | iso_pu_bacteria | 2513237102 | 2513704148 | 81 |
| 27 | iso_pu_bacteria | 2515154112 | 2515626562 | 81 |
| 28 | iso_pu_bacteria | 2524023205 | 2524436801 | 81 |
| 29 | iso_pu_bacteria | 2528768022 | 2528857097 | 81 |
| 30 | iso_pu_bacteria | 2617270741 | 2617376250 | 81 |
| 31 | iso_pu_bacteria | 2728368998 | 2728750538 | 81 |
| 32 | iso_pu_bacteria | 2824600985 | 2824605040 | 81 |
| 33 | iso_pu_bacteria | 2824609381 | 2824613916 | 81 |
| 34 | iso_pu_bacteria | 2824617872 | 2824623461 | 81 |
| 35 | iso_pu_bacteria | 2824626560 | 2824631366 | 81 |
| 36 | iso_pu_bacteria | 2824635225 | 2824639652 | 81 |
| 37 | iso_pu_bacteria | 2824644064 | 2824646658 | 81 |
| 38 | iso_pu_bacteria | 2824661429 | 2824665087 | 81 |
| 39 | iso_pu_bacteria | 2824704595 | 2824709559 | 81 |
| 40 | iso_pu_bacteria | 2824714736 | 2824719634 | 81 |
| 41 | iso_pu_bacteria | 2824723954 | 2824726465 | 81 |
| 42 | iso_pu_bacteria | 2824732956 | 2824735450 | 81 |
| 43 | iso_pu_bacteria | 2824746037 | 2824750054 | 81 |
| 44 | iso_pu_bacteria | 2824753945 | 2824760058 | 81 |
| 45 | iso_pu_bacteria | 2824763712 | 2824770507 | 81 |
| 46 | iso_pu_bacteria | 2847930680 | 2847935521 | 81 |
| 47 | iso_pu_bacteria | 2874590934 | 2874597268 | 81 |
| 48 | iso_pu_bacteria | 2874620515 | 2874626842 | 81 |
| 49 | iso_pu_bacteria | 2874645413 | 2874649399 | 81 |
| 50 | iso_pu_bacteria | 2876761206 | 2876770477 | 81 |
| 51 | iso_pu_bacteria | 2876771140 | 2876777935 | 81 |
| 52 | iso_pu_bacteria | 2876818435 | 2876823044 | 81 |
| 53 | iso_pu_bacteria | 2879074833 | 2879078692 | 81 |
| 54 | iso_pu_bacteria | 2879083081 | 2879090751 | 81 |
| 55 | iso_pu_bacteria | 2879099564 | 2879108207 | 81 |
| 56 | iso_pu_bacteria | 2879127579 | 2879132830 | 81 |
| 57 | iso_pu_bacteria | 2879142872 | 2879148630 | 81 |
| 58 | iso_pu_bacteria | 2885409591 | 2885411032 | 81 |
| 59 | iso_pu_bacteria | 2888388044 | 2888394403 | 81 |
| 60 | iso_pu_bacteria | 2888419890 | 2888423978 | 81 |
| 61 | iso_pu_bacteria | 2904666416 | 2904668420 | 81 |
| 62 | iso_pu_bacteria | 2904711408 | 2904717388 | 81 |
| 63 | iso_pu_bacteria | 2906610324 | 2906618369 | 81 |
| 64 | iso_pu_bacteria | 2908775508 | 2908779626 | 81 |
| 65 | iso_pu_bacteria | 2922368715 | 2922373774 | 81 |
| 66 | iso_pu_bacteria | 2929615660 | 2929617482 | 81 |
| 67 | iso_pu_bacteria | 2929624759 | 2929627187 | 81 |
| 68 | iso_pu_bacteria | 2932784394 | 2932787472 | 81 |
| 69 | iso_pu_bacteria | 2932809354 | 2932815072 | 81 |
| 70 | iso_pu_bacteria | 2932818245 | 2932820731 | 81 |
| 71 | iso_pu_bacteria | 2932828146 | 2932831779 | 81 |
| 72 | iso_pu_bacteria | 2933577622 | 2933579438 | 81 |
| 73 | iso_pu_bacteria | 2935608549 | 2935611964 | 81 |
| 74 | iso_pu_bacteria | 2935616580 | 2935621859 | 81 |
| 75 | iso_pu_bacteria | 2935638405 | 2935642804 | 81 |
| 76 | iso_pu_bacteria | 2935665750 | 2935667906 | 81 |
| 77 | iso_pu_bacteria | 2935675223 | 2935679044 | 81 |
| 78 | iso_pu_bacteria | 2935684952 | 2935688656 | 81 |
| 79 | iso_pu_bacteria | 2935694250 | 2935696008 | 81 |
| 80 | iso_pu_bacteria | 2935703347 | 2935706747 | 81 |
| 81 | iso_pu_bacteria | 2935713505 | 2935715675 | 81 |
| 82 | iso_pu_bacteria | 2935722832 | 2935725761 | 81 |
| 83 | iso_pu_bacteria | 2935732158 | 2935737960 | 81 |
| 84 | iso_pu_bacteria | 2935741537 | 2935747335 | 81 |
| 85 | iso_pu_bacteria | 2935750917 | 2935754090 | 81 |
| 86 | iso_pu_bacteria | 2935760218 | 2935763127 | 81 |
| 87 | iso_pu_bacteria | 2935801545 | 2935808426 | 81 |
| 88 | iso_pu_bacteria | 2935810662 | 2935812879 | 81 |
| 89 | iso_pu_bacteria | 2935819856 | 2935821444 | 81 |
| 90 | iso_pu_bacteria | 2935827899 | 2935830531 | 81 |
| 91 | iso_pu_bacteria | 2935837841 | 2935840560 | 81 |
| 92 | iso_pu_bacteria | 2935847175 | 2935850297 | 81 |
| 93 | iso_pu_bacteria | 2935855204 | 2935860106 | 81 |
| 94 | iso_pu_bacteria | 2935864058 | 2935869243 | 81 |
| 95 | iso_pu_bacteria | 2935873716 | 2935880580 | 81 |
| 96 | iso_pu_bacteria | 2935908558 | 2935914343 | 81 |
| 97 | iso_pu_bacteria | 2935916978 | 2935921057 | 81 |
| 98 | iso_pu_bacteria | 2935926038 | 2935931999 | 81 |
| 99 | iso_pu_bacteria | 2935934488 | 2935940596 | 81 |
| 100 | iso_pu_bacteria | 2935942939 | 2935948539 | 81 |
| 101 | iso_pu_bacteria | 2935951376 | 2935956990 | 81 |
| 102 | iso_pu_bacteria | 2935959822 | 2935960231 | 81 |
| 103 | iso_pu_bacteria | 2935967501 | 2935973588 | 81 |
| 104 | iso_pu_bacteria | 2935975950 | 2935977464 | 81 |
| 105 | iso_pu_bacteria | 2935992306 | 2935996252 | 81 |
| 106 | iso_pu_bacteria | 2936002035 | 2936006386 | 81 |
| 107 | iso_pu_bacteria | 2936037263 | 2936041467 | 81 |
| 108 | iso_pu_bacteria | 2940556831 | 2940560534 | 81 |
| 109 | iso_pu_bacteria | 2941538514 | 2941541309 | 81 |
| 110 | iso_pu_bacteria | 3005506211 | 3005509878 | 81 |
| 111 | iso_pu_bacteria | 8006933436 | 8006941163 | 81 |
| 112 | iso_pu_bacteria | 8006973647 | 8006980631 | 81 |
| 113 | iso_pu_bacteria | 8006984368 | 8006985766 | 81 |
| 114 | iso_pu_bacteria | 8016511872 | 8016513912 | 81 |
| 115 | iso_pu_bacteria | 8016522445 | 8016530161 | 81 |
| 116 | iso_pu_bacteria | 8016530956 | 8016535408 | 81 |
| 117 | iso_pu_bacteria | 8016539877 | 8016548611 | 81 |
| 118 | iso_pu_bacteria | 8016548790 | 8016553518 | 81 |
| 119 | iso_pu_bacteria | 8016557553 | 8016561901 | 81 |
| 120 | iso_pu_bacteria | 8016566248 | 8016573743 | 81 |
| 121 | iso_pu_bacteria | 8016575299 | 8016577867 | 81 |
| 122 | iso_pu_bacteria | 8016595262 | 8016599728 | 81 |
| 123 | iso_pu_bacteria | 8016630954 | 8016631555 | 81 |
| 124 | iso_pu_bacteria | 8017057580 | 8017062563 | 81 |
| 125 | iso_pu_bacteria | 8019530166 | 8019535151 | 81 |
| 126 | iso_pu_bacteria | 8019576017 | 8019581958 | 81 |
| 127 | iso_pu_bacteria | 8019586578 | 8019589640 | 81 |
| 128 | iso_pu_bacteria | 8019597564 | 8019601630 | 81 |
| 129 | iso_pu_bacteria | 8019608314 | 8019616922 | 81 |
| 130 | iso_pu_bacteria | 8019638758 | 8019644709 | 81 |
| 131 | iso_pu_bacteria | 8019659431 | 8019662852 | 81 |
| 132 | iso_pu_bacteria | 8019668869 | 8019672459 | 81 |
| 133 | iso_pu_bacteria | 8019687851 | 8019689451 | 81 |
| 134 | iso_pu_bacteria | 8055742211 | 8055746903 | 81 |
| 135 | 3300048929 | Ga0496126_0022867 | Ga0496126_0022867_5013_5261 | 82 |
| 136 | 3300030878 | Ga0265770_1146598 | Ga0265770_11465981 | 83 |
| 137 | 3300036457 | Ga0265778_036339 | Ga0265778_036339_121_372 | 83 |
| 138 | 3300041486 | Ga0451807_0231277 | Ga0451807_0231277_363_617 | 83 |
| 139 | 3300005458 | Ga0070681_10060782 | Ga0070681_100607822 | 84 |
| 140 | 3300005530 | Ga0070679_100039171 | Ga0070679_1000391715 | 84 |
| 141 | 3300005563 | Ga0068855_100117917 | Ga0068855_1001179173 | 84 |
| 142 | 3300005614 | Ga0068856_100423804 | Ga0068856_1004238042 | 84 |
| 143 | 3300005981 | Ga0081538_10103418 | Ga0081538_101034182 | 84 |
| 144 | 3300007265 | Ga0099794_10069448 | Ga0099794_100694481 | 84 |
| 145 | 3300009174 | Ga0105241_10455368 | Ga0105241_104553682 | 84 |
| 146 | 3300009545 | Ga0105237_10734363 | Ga0105237_107343632 | 84 |
| 147 | 3300009551 | Ga0105238_10273122 | Ga0105238_102731222 | 84 |
| 148 | 3300013104 | Ga0157370_10035076 | Ga0157370_100350764 | 84 |
| 149 | 3300013297 | Ga0157378_10010981 | Ga0157378_100109817 | 84 |
| 150 | 3300025295 | Ga0209564_1030145 | Ga0209564_10301451 | 84 |
| 151 | 3300025299 | Ga0209256_1099404 | Ga0209256_10994041 | 84 |
| 152 | 3300025912 | Ga0207707_10296463 | Ga0207707_102964631 | 84 |
| 153 | 3300025914 | Ga0207671_11238839 | Ga0207671_112388391 | 84 |
| 154 | 3300025921 | Ga0207652_11520710 | Ga0207652_115207102 | 84 |
| 155 | 3300025939 | Ga0207665_10272277 | Ga0207665_102722771 | 84 |
| 156 | 3300025949 | Ga0207667_10802129 | Ga0207667_108021292 | 84 |
| 157 | 3300025986 | Ga0207658_11631916 | Ga0207658_116319161 | 84 |
| 158 | 3300026041 | Ga0207639_10700631 | Ga0207639_107006311 | 84 |
| 159 | 3300026067 | Ga0207678_10081377 | Ga0207678_100813772 | 84 |
| 160 | 3300027866 | Ga0209813_10412780 | Ga0209813_104127801 | 84 |
| 161 | 3300028794 | Ga0307515_10260700 | Ga0307515_102607002 | 84 |
| 162 | 3300031250 | Ga0265331_10336256 | Ga0265331_103362561 | 84 |
| 163 | 3300031711 | Ga0265314_10310495 | Ga0265314_103104951 | 84 |
| 164 | 3300035089 | Ga0373944_0103056 | Ga0373944_0103056_440_700 | 84 |
| 165 | 3300035111 | Ga0373923_0010882 | Ga0373923_0010882_1324_1584 | 84 |
| 166 | 3300035113 | Ga0373936_0009619 | Ga0373936_0009619_807_1067 | 84 |
| 167 | 3300035116 | Ga0373945_0180231 | Ga0373945_0180231_475_735 | 84 |
| 168 | 3300035120 | Ga0373957_0152860 | Ga0373957_0152860_341_601 | 84 |
| 169 | 3300035170 | Ga0373943_0018283 | Ga0373943_0018283_2540_2800 | 84 |
| 170 | 3300035171 | Ga0373946_0019787 | Ga0373946_0019787_1483_1743 | 84 |
| 171 | 3300035172 | Ga0373955_0099626 | Ga0373955_0099626_154_414 | 84 |
| 172 | 3300035692 | Ga0373935_0007714 | Ga0373935_0007714_3112_3372 | 84 |
| 173 | 3300035695 | Ga0373927_0003072 | Ga0373927_0003072_3774_4034 | 84 |
| 174 | 3300035725 | Ga0373947_0001820 | Ga0373947_0001820_7888_8148 | 84 |
| 175 | 3300036401 | Ga0373937_0015418 | Ga0373937_0015418_3429_3689 | 84 |
| 176 | 3300037068 | Ga0373925_0002588 | Ga0373925_0002588_10961_11221 | 84 |
| 177 | 3300046454 | Ga0495592_0004679 | Ga0495592_0004679_2249_2509 | 84 |
| 178 | 3300046455 | Ga0495603_0000067 | Ga0495603_0000067_3810_4070 | 84 |
| 179 | 3300046459 | Ga0495629_0001667 | Ga0495629_0001667_13093_13353 | 84 |
| 180 | 3300046460 | Ga0495638_0055502 | Ga0495638_0055502_1633_1890 | 84 |
| 181 | 3300046461 | Ga0495641_0003314 | Ga0495641_0003314_567_827 | 84 |
| 182 | 3300046463 | Ga0495653_0441776 | Ga0495653_0441776_47_307 | 84 |
| 183 | 3300046472 | Ga0495580_0031815 | Ga0495580_0031815_470_730 | 84 |
| 184 | 3300046473 | Ga0495582_0000744 | Ga0495582_0000744_13671_13931 | 84 |
| 185 | 3300046475 | Ga0495639_0001360 | Ga0495639_0001360_6567_6827 | 84 |
| 186 | 3300046476 | Ga0495662_0007547 | Ga0495662_0007547_3974_4234 | 84 |
| 187 | 3300046491 | Ga0495584_0337987 | Ga0495584_0337987_139_396 | 84 |
| 188 | 3300046499 | Ga0495594_0009145 | Ga0495594_0009145_723_983 | 84 |
| 189 | 3300046506 | Ga0495583_0134729 | Ga0495583_0134729_695_952 | 84 |
| 190 | 3300046512 | Ga0495610_0039045 | Ga0495610_0039045_620_877 | 84 |
| 191 | 3300046517 | Ga0495630_0019651 | Ga0495630_0019651_3909_4169 | 84 |
| 192 | 3300046518 | Ga0495631_0022504 | Ga0495631_0022504_2313_2570 | 84 |
| 193 | 3300046520 | Ga0495637_0092270 | Ga0495637_0092270_526_783 | 84 |
| 194 | 3300046522 | Ga0495643_0168676 | Ga0495643_0168676_637_894 | 84 |
| 195 | 3300046526 | Ga0495666_0084345 | Ga0495666_0084345_398_658 | 84 |
| 196 | 3300046529 | Ga0495652_0082595 | Ga0495652_0082595_2236_2496 | 84 |
| 197 | 3300046529 | Ga0495652_0316973 | Ga0495652_0316973_103_363 | 84 |
| 198 | 3300046530 | Ga0495654_0071733 | Ga0495654_0071733_651_908 | 84 |
| 199 | 3300046531 | Ga0495665_0000307 | Ga0495665_0000307_4064_4324 | 84 |
| 200 | 3300046533 | Ga0495640_0016203 | Ga0495640_0016203_1246_1506 | 84 |
| 201 | 3300046536 | Ga0495587_0503169 | Ga0495587_0503169_58_318 | 84 |
| 202 | 3300046542 | Ga0495597_0185613 | Ga0495597_0185613_57_314 | 84 |
| 203 | 3300046557 | Ga0495622_0025886 | Ga0495622_0025886_2217_2477 | 84 |
| 204 | 3300046559 | Ga0495667_0037917 | Ga0495667_0037917_2067_2327 | 84 |
| 205 | 3300046642 | Ga0495634_0005834 | Ga0495634_0005834_4052_4312 | 84 |
| 206 | 3300046660 | Ga0495625_0110684 | Ga0495625_0110684_569_826 | 84 |
| 207 | 3300046663 | Ga0495635_0001592 | Ga0495635_0001592_10992_11252 | 84 |
| 208 | 3300046674 | Ga0495588_0093733 | Ga0495588_0093733_11_268 | 84 |
| 209 | 3300046678 | Ga0495599_0034785 | Ga0495599_0034785_1604_1864 | 84 |
| 210 | 3300046680 | Ga0495646_0185581 | Ga0495646_0185581_782_1042 | 84 |
| 211 | 3300046681 | Ga0495647_0001173 | Ga0495647_0001173_4055_4315 | 84 |
| 212 | 3300046683 | Ga0495658_0000520 | Ga0495658_0000520_4233_4493 | 84 |
| 213 | 3300046689 | Ga0495613_0038005 | Ga0495613_0038005_1427_1687 | 84 |
| 214 | 3300046690 | Ga0495624_0020438 | Ga0495624_0020438_139_399 | 84 |
| 215 | 3300046691 | Ga0495670_0003109 | Ga0495670_0003109_7432_7689 | 84 |
| 216 | 3300046692 | Ga0495671_0093738 | Ga0495671_0093738_1153_1410 | 84 |
| 217 | 3300046809 | Ga0495600_0923392 | Ga0495600_0923392_181_441 | 84 |
| 218 | 3300047315 | Ga0495581_0000022 | Ga0495581_0000022_3781_4041 | 84 |
| 219 | 3300047319 | Ga0495674_0001816 | Ga0495674_0001816_16599_16859 | 84 |
| 220 | 3300047321 | Ga0495676_0123031 | Ga0495676_0123031_644_904 | 84 |
| 221 | 3300047322 | Ga0495680_0363979 | Ga0495680_0363979_159_419 | 84 |
| 222 | 3300047471 | Ga0495684_0078668 | Ga0495684_0078668_812_1072 | 84 |
| 223 | 3300047673 | Ga0495593_0000016 | Ga0495593_0000016_75305_75565 | 84 |
| 224 | 3300048089 | Ga0495614_0024357 | Ga0495614_0024357_1176_1436 | 84 |
| 225 | 3300048905 | Ga0496102_1066581 | Ga0496102_1066581_266_523 | 84 |
| 226 | 3300048909 | Ga0496106_0435018 | Ga0496106_0435018_562_819 | 84 |
| 227 | 3300048919 | Ga0496116_0001852 | Ga0496116_0001852_10227_10484 | 84 |
| 228 | 3300048920 | Ga0496117_0248623 | Ga0496117_0248623_603_860 | 84 |
| 229 | 3300048920 | Ga0496117_0541241 | Ga0496117_0541241_233_490 | 84 |
| 230 | 3300048921 | Ga0496118_0142205 | Ga0496118_0142205_141_398 | 84 |
| 231 | 3300048922 | Ga0496119_0091208 | Ga0496119_0091208_763_1020 | 84 |
| 232 | 3300048923 | Ga0496120_0061040 | Ga0496120_0061040_1549_1806 | 84 |
| 233 | 3300048924 | Ga0496121_0123652 | Ga0496121_0123652_201_458 | 84 |
| 234 | 3300048925 | Ga0496122_0232375 | Ga0496122_0232375_705_962 | 84 |
| 235 | 3300048926 | Ga0496123_0477315 | Ga0496123_0477315_17_274 | 84 |
| 236 | 3300048928 | Ga0496125_0013225 | Ga0496125_0013225_6544_6801 | 84 |
| 237 | 3300048928 | Ga0496125_0059958 | Ga0496125_0059958_1769_2026 | 84 |
| 238 | 3300048928 | Ga0496125_0390002 | Ga0496125_0390002_38_295 | 84 |
| 239 | 3300048929 | Ga0496126_0206267 | Ga0496126_0206267_934_1191 | 84 |
| 240 | 3300048929 | Ga0496126_0282016 | Ga0496126_0282016_1056_1316 | 84 |
| 241 | 3300048929 | Ga0496126_1038807 | Ga0496126_1038807_237_494 | 84 |
| 242 | 3300050490 | nmdc:mga03n38_856146_c1 | nmdc:mga03n38_856146_c1_27_284 | 84 |
| 243 | 3300050491 | nmdc:mga00v17_19275_c1 | nmdc:mga00v17_19275_c1_2224_2481 | 84 |
| 244 | 3300050495 | nmdc:mga04h51_269530_c1 | nmdc:mga04h51_269530_c1_256_513 | 84 |
| 245 | 3300050496 | nmdc:mga07m45_53804_c1 | nmdc:mga07m45_53804_c1_331_588 | 84 |
| 246 | 3300050516 | nmdc:mga0sz30_27759_c1 | nmdc:mga0sz30_27759_c1_1306_1563 | 84 |
| 247 | 3300053077 | Ga0495601_0210254 | Ga0495601_0210254_704_964 | 84 |
| 248 | 3300053087 | Ga0500643_012153 | Ga0500643_012153_198_455 | 84 |
| 249 | 3300053088 | Ga0500644_0151700 | Ga0500644_0151700_416_673 | 84 |
| 250 | 3300053094 | Ga0500566_0000930 | Ga0500566_0000930_1088_1345 | 84 |
| 251 | 3300053096 | Ga0500641_0014253 | Ga0500641_0014253_837_1094 | 84 |
| 252 | 3300053102 | Ga0500554_073118 | Ga0500554_073118_732_989 | 84 |
| 253 | 3300053103 | Ga0500555_090523 | Ga0500555_090523_426_683 | 84 |
| 254 | 3300053104 | Ga0500556_0000002 | Ga0500556_0000002_729396_729653 | 84 |
| 255 | 3300053105 | Ga0500557_145960 | Ga0500557_145960_163_420 | 84 |
| 256 | 3300053108 | Ga0500562_050532 | Ga0500562_050532_736_993 | 84 |
| 257 | 3300053116 | Ga0500592_024109 | Ga0500592_024109_451_708 | 84 |
| 258 | 3300053118 | Ga0500594_0035706 | Ga0500594_0035706_1019_1276 | 84 |
| 259 | 3300053121 | Ga0500607_115404 | Ga0500607_115404_701_958 | 84 |
| 260 | 3300053122 | Ga0500608_014864 | Ga0500608_014864_795_1052 | 84 |
| 261 | 3300053130 | Ga0500642_0000010 | Ga0500642_0000010_47768_48025 | 84 |
| 262 | 3300053131 | Ga0500652_000511 | Ga0500652_000511_1785_2042 | 84 |
| 263 | 3300053136 | Ga0500559_0000919 | Ga0500559_0000919_7799_8056 | 84 |
| 264 | 3300053138 | Ga0500564_254083 | Ga0500564_254083_288_545 | 84 |
| 265 | 3300053139 | Ga0500568_0000680 | Ga0500568_0000680_8044_8301 | 84 |
| 266 | 3300053146 | Ga0500588_0396907 | Ga0500588_0396907_119_376 | 84 |
| 267 | 3300053148 | Ga0500590_173935 | Ga0500590_173935_366_623 | 84 |
| 268 | 3300053151 | Ga0500604_0009645 | Ga0500604_0009645_573_830 | 84 |
| 269 | 3300053156 | Ga0500622_0001697 | Ga0500622_0001697_7825_8082 | 84 |
| 270 | 3300053158 | Ga0500627_0057763 | Ga0500627_0057763_1270_1527 | 84 |
| 271 | 3300053160 | Ga0500633_0043029 | Ga0500633_0043029_749_1006 | 84 |
| 272 | 3300053177 | Ga0500636_0026370 | Ga0500636_0026370_2933_3190 | 84 |
| 273 | 3300053730 | Ga0500645_031958 | Ga0500645_031958_759_1016 | 84 |
| 274 | 3300059510 | Ga0587090_173321 | Ga0587090_173321_186_443 | 84 |
| 275 | 3300060346 | Ga0587111_0047675 | Ga0587111_0047675_26_286 | 84 |
| 276 | 3300000549 | LJQas_1028577 | LJQas_10285772 | 85 |
| 277 | 3300003354 | JGI25160J50197_1061223 | JGI25160J50197_10612231 | 85 |
| 278 | 3300003579 | Ga0007429J51699_1015309 | Ga0007429J51699_10153092 | 85 |
| 279 | 3300004625 | Ga0055543_1063225 | Ga0055543_10632251 | 85 |
| 280 | 3300004798 | Ga0058859_11717512 | Ga0058859_117175121 | 85 |
| 281 | 3300004801 | Ga0058860_12120592 | Ga0058860_121205922 | 85 |
| 282 | 3300004801 | Ga0058860_12138288 | Ga0058860_121382881 | 85 |
| 283 | 3300004801 | Ga0058860_12235858 | Ga0058860_122358581 | 85 |
| 284 | 3300005262 | Ga0065165_1006419 | Ga0065165_10064193 | 85 |
| 285 | 3300005327 | Ga0070658_10340868 | Ga0070658_103408682 | 85 |
| 286 | 3300005328 | Ga0070676_10886720 | Ga0070676_108867201 | 85 |
| 287 | 3300005329 | Ga0070683_100137268 | Ga0070683_1001372682 | 85 |
| 288 | 3300005329 | Ga0070683_101765083 | Ga0070683_1017650832 | 85 |
| 289 | 3300005329 | Ga0070683_101927706 | Ga0070683_1019277061 | 85 |
| 290 | 3300005330 | Ga0070690_100085524 | Ga0070690_1000855242 | 85 |
| 291 | 3300005330 | Ga0070690_101019401 | Ga0070690_1010194011 | 85 |
| 292 | 3300005331 | Ga0070670_100569267 | Ga0070670_1005692672 | 85 |
| 293 | 3300005334 | Ga0068869_100109499 | Ga0068869_1001094992 | 85 |
| 294 | 3300005334 | Ga0068869_101968256 | Ga0068869_1019682561 | 85 |
| 295 | 3300005335 | Ga0070666_10597901 | Ga0070666_105979011 | 85 |
| 296 | 3300005335 | Ga0070666_11319618 | Ga0070666_113196181 | 85 |
| 297 | 3300005336 | Ga0070680_100025555 | Ga0070680_1000255552 | 85 |
| 298 | 3300005337 | Ga0070682_100279158 | Ga0070682_1002791582 | 85 |
| 299 | 3300005337 | Ga0070682_100835209 | Ga0070682_1008352092 | 85 |
| 300 | 3300005338 | Ga0068868_100019111 | Ga0068868_1000191114 | 85 |
| 301 | 3300005338 | Ga0068868_100736188 | Ga0068868_1007361882 | 85 |
| 302 | 3300005339 | Ga0070660_101390764 | Ga0070660_1013907642 | 85 |
| 303 | 3300005340 | Ga0070689_100410580 | Ga0070689_1004105802 | 85 |
| 304 | 3300005341 | Ga0070691_10147971 | Ga0070691_101479712 | 85 |
| 305 | 3300005344 | Ga0070661_100307675 | Ga0070661_1003076752 | 85 |
| 306 | 3300005344 | Ga0070661_100388072 | Ga0070661_1003880721 | 85 |
| 307 | 3300005347 | Ga0070668_100056810 | Ga0070668_1000568102 | 85 |
| 308 | 3300005347 | Ga0070668_100760005 | Ga0070668_1007600052 | 85 |
| 309 | 3300005354 | Ga0070675_101073644 | Ga0070675_1010736442 | 85 |
| 310 | 3300005355 | Ga0070671_100206335 | Ga0070671_1002063352 | 85 |
| 311 | 3300005355 | Ga0070671_100342254 | Ga0070671_1003422542 | 85 |
| 312 | 3300005355 | Ga0070671_100429574 | Ga0070671_1004295742 | 85 |
| 313 | 3300005356 | Ga0070674_100195426 | Ga0070674_1001954262 | 85 |
| 314 | 3300005356 | Ga0070674_100241784 | Ga0070674_1002417842 | 85 |
| 315 | 3300005364 | Ga0070673_100596574 | Ga0070673_1005965741 | 85 |
| 316 | 3300005364 | Ga0070673_100677105 | Ga0070673_1006771052 | 85 |
| 317 | 3300005364 | Ga0070673_101095860 | Ga0070673_1010958602 | 85 |
| 318 | 3300005364 | Ga0070673_102151676 | Ga0070673_1021516761 | 85 |
| 319 | 3300005366 | Ga0070659_100634739 | Ga0070659_1006347392 | 85 |
| 320 | 3300005366 | Ga0070659_101313314 | Ga0070659_1013133141 | 85 |
| 321 | 3300005367 | Ga0070667_100666729 | Ga0070667_1006667292 | 85 |
| 322 | 3300005434 | Ga0070709_11071524 | Ga0070709_110715242 | 85 |
| 323 | 3300005435 | Ga0070714_100141594 | Ga0070714_1001415942 | 85 |
| 324 | 3300005436 | Ga0070713_100446532 | Ga0070713_1004465322 | 85 |
| 325 | 3300005436 | Ga0070713_101976019 | Ga0070713_1019760191 | 85 |
| 326 | 3300005437 | Ga0070710_11224279 | Ga0070710_112242791 | 85 |
| 327 | 3300005439 | Ga0070711_100688446 | Ga0070711_1006884462 | 85 |
| 328 | 3300005439 | Ga0070711_100944246 | Ga0070711_1009442461 | 85 |
| 329 | 3300005439 | Ga0070711_101033454 | Ga0070711_1010334541 | 85 |
| 330 | 3300005440 | Ga0070705_100488409 | Ga0070705_1004884091 | 85 |
| 331 | 3300005445 | Ga0070708_101118284 | Ga0070708_1011182842 | 85 |
| 332 | 3300005455 | Ga0070663_100047420 | Ga0070663_1000474203 | 85 |
| 333 | 3300005455 | Ga0070663_100162595 | Ga0070663_1001625952 | 85 |
| 334 | 3300005455 | Ga0070663_100185926 | Ga0070663_1001859262 | 85 |
| 335 | 3300005455 | Ga0070663_100188065 | Ga0070663_1001880651 | 85 |
| 336 | 3300005455 | Ga0070663_100403292 | Ga0070663_1004032922 | 85 |
| 337 | 3300005456 | Ga0070678_100087645 | Ga0070678_1000876454 | 85 |
| 338 | 3300005456 | Ga0070678_100197035 | Ga0070678_1001970352 | 85 |
| 339 | 3300005456 | Ga0070678_100253765 | Ga0070678_1002537652 | 85 |
| 340 | 3300005456 | Ga0070678_100397541 | Ga0070678_1003975412 | 85 |
| 341 | 3300005457 | Ga0070662_101694056 | Ga0070662_1016940562 | 85 |
| 342 | 3300005458 | Ga0070681_10553262 | Ga0070681_105532621 | 85 |
| 343 | 3300005458 | Ga0070681_11893691 | Ga0070681_118936911 | 85 |
| 344 | 3300005459 | Ga0068867_100732199 | Ga0068867_1007321992 | 85 |
| 345 | 3300005466 | Ga0070685_10700413 | Ga0070685_107004132 | 85 |
| 346 | 3300005530 | Ga0070679_100250531 | Ga0070679_1002505313 | 85 |
| 347 | 3300005530 | Ga0070679_100554944 | Ga0070679_1005549441 | 85 |
| 348 | 3300005535 | Ga0070684_100009838 | Ga0070684_1000098383 | 85 |
| 349 | 3300005535 | Ga0070684_100107204 | Ga0070684_1001072042 | 85 |
| 350 | 3300005535 | Ga0070684_101094835 | Ga0070684_1010948351 | 85 |
| 351 | 3300005535 | Ga0070684_102109956 | Ga0070684_1021099561 | 85 |
| 352 | 3300005536 | Ga0070697_100066932 | Ga0070697_1000669322 | 85 |
| 353 | 3300005539 | Ga0068853_100388284 | Ga0068853_1003882841 | 85 |
| 354 | 3300005539 | Ga0068853_100446152 | Ga0068853_1004461521 | 85 |
| 355 | 3300005539 | Ga0068853_100790886 | Ga0068853_1007908862 | 85 |
| 356 | 3300005543 | Ga0070672_101140138 | Ga0070672_1011401381 | 85 |
| 357 | 3300005543 | Ga0070672_101520948 | Ga0070672_1015209481 | 85 |
| 358 | 3300005543 | Ga0070672_102093248 | Ga0070672_1020932481 | 85 |
| 359 | 3300005547 | Ga0070693_101589770 | Ga0070693_1015897701 | 85 |
| 360 | 3300005548 | Ga0070665_100011491 | Ga0070665_1000114914 | 85 |
| 361 | 3300005548 | Ga0070665_100042315 | Ga0070665_1000423152 | 85 |
| 362 | 3300005548 | Ga0070665_100850243 | Ga0070665_1008502432 | 85 |
| 363 | 3300005548 | Ga0070665_100870382 | Ga0070665_1008703822 | 85 |
| 364 | 3300005548 | Ga0070665_100890225 | Ga0070665_1008902251 | 85 |
| 365 | 3300005548 | Ga0070665_100969884 | Ga0070665_1009698843 | 85 |
| 366 | 3300005548 | Ga0070665_101081343 | Ga0070665_1010813431 | 85 |
| 367 | 3300005548 | Ga0070665_101448135 | Ga0070665_1014481352 | 85 |
| 368 | 3300005549 | Ga0070704_100737768 | Ga0070704_1007377681 | 85 |
| 369 | 3300005563 | Ga0068855_100011695 | Ga0068855_10001169519 | 85 |
| 370 | 3300005563 | Ga0068855_100141459 | Ga0068855_1001414595 | 85 |
| 371 | 3300005563 | Ga0068855_101998876 | Ga0068855_1019988762 | 85 |
| 372 | 3300005563 | Ga0068855_102290455 | Ga0068855_1022904551 | 85 |
| 373 | 3300005564 | Ga0070664_101005214 | Ga0070664_1010052142 | 85 |
| 374 | 3300005577 | Ga0068857_100051462 | Ga0068857_1000514622 | 85 |
| 375 | 3300005578 | Ga0068854_100144116 | Ga0068854_1001441163 | 85 |
| 376 | 3300005578 | Ga0068854_100475680 | Ga0068854_1004756802 | 85 |
| 377 | 3300005614 | Ga0068856_100175881 | Ga0068856_1001758812 | 85 |
| 378 | 3300005614 | Ga0068856_100534318 | Ga0068856_1005343182 | 85 |
| 379 | 3300005615 | Ga0070702_100972572 | Ga0070702_1009725721 | 85 |
| 380 | 3300005616 | Ga0068852_100228219 | Ga0068852_1002282191 | 85 |
| 381 | 3300005616 | Ga0068852_100860164 | Ga0068852_1008601641 | 85 |
| 382 | 3300005617 | Ga0068859_101029638 | Ga0068859_1010296382 | 85 |
| 383 | 3300005618 | Ga0068864_100413495 | Ga0068864_1004134952 | 85 |
| 384 | 3300005618 | Ga0068864_100569293 | Ga0068864_1005692932 | 85 |
| 385 | 3300005618 | Ga0068864_101158656 | Ga0068864_1011586562 | 85 |
| 386 | 3300005719 | Ga0068861_102063060 | Ga0068861_1020630602 | 85 |
| 387 | 3300005834 | Ga0068851_10514720 | Ga0068851_105147203 | 85 |
| 388 | 3300005834 | Ga0068851_10681792 | Ga0068851_106817922 | 85 |
| 389 | 3300005834 | Ga0068851_10998605 | Ga0068851_109986052 | 85 |
| 390 | 3300005840 | Ga0068870_10764208 | Ga0068870_107642082 | 85 |
| 391 | 3300005841 | Ga0068863_100266678 | Ga0068863_1002666783 | 85 |
| 392 | 3300005841 | Ga0068863_100342384 | Ga0068863_1003423841 | 85 |
| 393 | 3300005841 | Ga0068863_100376646 | Ga0068863_1003766461 | 85 |
| 394 | 3300005841 | Ga0068863_101198272 | Ga0068863_1011982722 | 85 |
| 395 | 3300005842 | Ga0068858_100296627 | Ga0068858_1002966271 | 85 |
| 396 | 3300005842 | Ga0068858_100650869 | Ga0068858_1006508691 | 85 |
| 397 | 3300005843 | Ga0068860_100722632 | Ga0068860_1007226322 | 85 |
| 398 | 3300005844 | Ga0068862_100933399 | Ga0068862_1009333992 | 85 |
| 399 | 3300005937 | Ga0081455_10164221 | Ga0081455_101642212 | 85 |
| 400 | 3300005983 | Ga0081540_1040042 | Ga0081540_10400422 | 85 |
| 401 | 3300005985 | Ga0081539_10031363 | Ga0081539_100313633 | 85 |
| 402 | 3300006038 | Ga0075365_10013809 | Ga0075365_100138096 | 85 |
| 403 | 3300006038 | Ga0075365_10108867 | Ga0075365_101088672 | 85 |
| 404 | 3300006038 | Ga0075365_10180008 | Ga0075365_101800082 | 85 |
| 405 | 3300006038 | Ga0075365_10481332 | Ga0075365_104813321 | 85 |
| 406 | 3300006042 | Ga0075368_10092455 | Ga0075368_100924551 | 85 |
| 407 | 3300006042 | Ga0075368_10098359 | Ga0075368_100983592 | 85 |
| 408 | 3300006048 | Ga0075363_100002549 | Ga0075363_1000025496 | 85 |
| 409 | 3300006048 | Ga0075363_100038813 | Ga0075363_1000388132 | 85 |
| 410 | 3300006048 | Ga0075363_100921637 | Ga0075363_1009216371 | 85 |
| 411 | 3300006051 | Ga0075364_10932228 | Ga0075364_109322282 | 85 |
| 412 | 3300006163 | Ga0070715_10371455 | Ga0070715_103714552 | 85 |
| 413 | 3300006175 | Ga0070712_100928423 | Ga0070712_1009284231 | 85 |
| 414 | 3300006178 | Ga0075367_10056557 | Ga0075367_100565572 | 85 |
| 415 | 3300006178 | Ga0075367_10435230 | Ga0075367_104352302 | 85 |
| 416 | 3300006178 | Ga0075367_10478421 | Ga0075367_104784212 | 85 |
| 417 | 3300006186 | Ga0075369_10021798 | Ga0075369_100217981 | 85 |
| 418 | 3300006186 | Ga0075369_10026612 | Ga0075369_100266122 | 85 |
| 419 | 3300006195 | Ga0075366_10481588 | Ga0075366_104815882 | 85 |
| 420 | 3300006195 | Ga0075366_10894454 | Ga0075366_108944541 | 85 |
| 421 | 3300006237 | Ga0097621_100385326 | Ga0097621_1003853262 | 85 |
| 422 | 3300006237 | Ga0097621_100722979 | Ga0097621_1007229791 | 85 |
| 423 | 3300006237 | Ga0097621_101033396 | Ga0097621_1010333962 | 85 |
| 424 | 3300006353 | Ga0075370_10008373 | Ga0075370_100083732 | 85 |
| 425 | 3300006353 | Ga0075370_10009299 | Ga0075370_100092994 | 85 |
| 426 | 3300006353 | Ga0075370_10085642 | Ga0075370_100856422 | 85 |
| 427 | 3300006358 | Ga0068871_100364893 | Ga0068871_1003648932 | 85 |
| 428 | 3300006358 | Ga0068871_100457514 | Ga0068871_1004575142 | 85 |
| 429 | 3300006358 | Ga0068871_101402810 | Ga0068871_1014028102 | 85 |
| 430 | 3300006881 | Ga0068865_100094141 | Ga0068865_1000941412 | 85 |
| 431 | 3300006881 | Ga0068865_100124095 | Ga0068865_1001240952 | 85 |
| 432 | 3300006881 | Ga0068865_100208689 | Ga0068865_1002086891 | 85 |
| 433 | 3300006881 | Ga0068865_100344292 | Ga0068865_1003442922 | 85 |
| 434 | 3300006881 | Ga0068865_101260261 | Ga0068865_1012602612 | 85 |
| 435 | 3300006931 | Ga0097620_101029638 | Ga0097620_1010296382 | 85 |
| 436 | 3300007076 | Ga0075435_100663332 | Ga0075435_1006633321 | 85 |
| 437 | 3300007265 | Ga0099794_10197348 | Ga0099794_101973482 | 85 |
| 438 | 3300007265 | Ga0099794_10349792 | Ga0099794_103497921 | 85 |
| 439 | 3300007788 | Ga0099795_10113860 | Ga0099795_101138602 | 85 |
| 440 | 3300007788 | Ga0099795_10419661 | Ga0099795_104196612 | 85 |
| 441 | 3300009093 | Ga0105240_10018404 | Ga0105240_100184049 | 85 |
| 442 | 3300009093 | Ga0105240_10132174 | Ga0105240_101321742 | 85 |
| 443 | 3300009098 | Ga0105245_10024626 | Ga0105245_100246262 | 85 |
| 444 | 3300009098 | Ga0105245_10497410 | Ga0105245_104974102 | 85 |
| 445 | 3300009098 | Ga0105245_11048984 | Ga0105245_110489841 | 85 |
| 446 | 3300009101 | Ga0105247_10130481 | Ga0105247_101304813 | 85 |
| 447 | 3300009101 | Ga0105247_10687782 | Ga0105247_106877821 | 85 |
| 448 | 3300009101 | Ga0105247_11407985 | Ga0105247_114079851 | 85 |
| 449 | 3300009148 | Ga0105243_10231613 | Ga0105243_102316133 | 85 |
| 450 | 3300009148 | Ga0105243_10665145 | Ga0105243_106651452 | 85 |
| 451 | 3300009174 | Ga0105241_10378005 | Ga0105241_103780052 | 85 |
| 452 | 3300009174 | Ga0105241_10503413 | Ga0105241_105034131 | 85 |
| 453 | 3300009174 | Ga0105241_11160216 | Ga0105241_111602161 | 85 |
| 454 | 3300009176 | Ga0105242_10156126 | Ga0105242_101561262 | 85 |
| 455 | 3300009176 | Ga0105242_10482555 | Ga0105242_104825552 | 85 |
| 456 | 3300009176 | Ga0105242_11144765 | Ga0105242_111447651 | 85 |
| 457 | 3300009176 | Ga0105242_11301689 | Ga0105242_113016892 | 85 |
| 458 | 3300009177 | Ga0105248_10112722 | Ga0105248_101127222 | 85 |
| 459 | 3300009177 | Ga0105248_10516191 | Ga0105248_105161912 | 85 |
| 460 | 3300009545 | Ga0105237_10012739 | Ga0105237_100127393 | 85 |
| 461 | 3300009545 | Ga0105237_10243938 | Ga0105237_102439383 | 85 |
| 462 | 3300009545 | Ga0105237_10408829 | Ga0105237_104088292 | 85 |
| 463 | 3300009545 | Ga0105237_11047400 | Ga0105237_110474001 | 85 |
| 464 | 3300009545 | Ga0105237_11393697 | Ga0105237_113936972 | 85 |
| 465 | 3300009551 | Ga0105238_10041149 | Ga0105238_100411492 | 85 |
| 466 | 3300009551 | Ga0105238_10060230 | Ga0105238_100602302 | 85 |
| 467 | 3300009551 | Ga0105238_10611943 | Ga0105238_106119432 | 85 |
| 468 | 3300009551 | Ga0105238_11610176 | Ga0105238_116101761 | 85 |
| 469 | 3300009551 | Ga0105238_12796583 | Ga0105238_127965831 | 85 |
| 470 | 3300009553 | Ga0105249_10538166 | Ga0105249_105381662 | 85 |
| 471 | 3300009553 | Ga0105249_11732636 | Ga0105249_117326361 | 85 |
| 472 | 3300009553 | Ga0105249_12090307 | Ga0105249_120903071 | 85 |
| 473 | 3300010375 | Ga0105239_10070304 | Ga0105239_100703043 | 85 |
| 474 | 3300010375 | Ga0105239_10272054 | Ga0105239_102720542 | 85 |
| 475 | 3300010375 | Ga0105239_10286189 | Ga0105239_102861892 | 85 |
| 476 | 3300010375 | Ga0105239_10416534 | Ga0105239_104165342 | 85 |
| 477 | 3300010375 | Ga0105239_11856287 | Ga0105239_118562872 | 85 |
| 478 | 3300011119 | Ga0105246_10013250 | Ga0105246_100132504 | 85 |
| 479 | 3300011119 | Ga0105246_10175355 | Ga0105246_101753553 | 85 |
| 480 | 3300011119 | Ga0105246_10717719 | Ga0105246_107177192 | 85 |
| 481 | 3300011119 | Ga0105246_11913015 | Ga0105246_119130152 | 85 |
| 482 | 3300012494 | Ga0157341_1038858 | Ga0157341_10388581 | 85 |
| 483 | 3300013100 | Ga0157373_10793337 | Ga0157373_107933371 | 85 |
| 484 | 3300013104 | Ga0157370_10807551 | Ga0157370_108075512 | 85 |
| 485 | 3300013105 | Ga0157369_10034915 | Ga0157369_100349156 | 85 |
| 486 | 3300013105 | Ga0157369_10407198 | Ga0157369_104071982 | 85 |
| 487 | 3300013105 | Ga0157369_10702505 | Ga0157369_107025052 | 85 |
| 488 | 3300013296 | Ga0157374_10453952 | Ga0157374_104539521 | 85 |
| 489 | 3300013296 | Ga0157374_12298788 | Ga0157374_122987882 | 85 |
| 490 | 3300013297 | Ga0157378_10274843 | Ga0157378_102748433 | 85 |
| 491 | 3300013297 | Ga0157378_10508336 | Ga0157378_105083361 | 85 |
| 492 | 3300013297 | Ga0157378_10901629 | Ga0157378_109016293 | 85 |
| 493 | 3300013297 | Ga0157378_10970053 | Ga0157378_109700531 | 85 |
| 494 | 3300013297 | Ga0157378_12586777 | Ga0157378_125867771 | 85 |
| 495 | 3300013306 | Ga0163162_10050813 | Ga0163162_100508133 | 85 |
| 496 | 3300013306 | Ga0163162_10884742 | Ga0163162_108847422 | 85 |
| 497 | 3300013306 | Ga0163162_11005945 | Ga0163162_110059451 | 85 |
| 498 | 3300013306 | Ga0163162_11524478 | Ga0163162_115244782 | 85 |
| 499 | 3300013306 | Ga0163162_12385246 | Ga0163162_123852461 | 85 |
| 500 | 3300013308 | Ga0157375_10071766 | Ga0157375_100717663 | 85 |
| 501 | 3300013308 | Ga0157375_10233563 | Ga0157375_102335632 | 85 |
| 502 | 3300013308 | Ga0157375_10289390 | Ga0157375_102893902 | 85 |
| 503 | 3300013308 | Ga0157375_10847240 | Ga0157375_108472401 | 85 |
| 504 | 3300013308 | Ga0157375_11806423 | Ga0157375_118064231 | 85 |
| 505 | 3300014325 | Ga0163163_10029693 | Ga0163163_100296932 | 85 |
| 506 | 3300014325 | Ga0163163_10129877 | Ga0163163_101298773 | 85 |
| 507 | 3300014325 | Ga0163163_10466641 | Ga0163163_104666411 | 85 |
| 508 | 3300014325 | Ga0163163_10678025 | Ga0163163_106780252 | 85 |
| 509 | 3300014325 | Ga0163163_11242954 | Ga0163163_112429542 | 85 |
| 510 | 3300014325 | Ga0163163_12298040 | Ga0163163_122980402 | 85 |
| 511 | 3300014325 | Ga0163163_12315031 | Ga0163163_123150312 | 85 |
| 512 | 3300014326 | Ga0157380_10594678 | Ga0157380_105946781 | 85 |
| 513 | 3300014326 | Ga0157380_10768167 | Ga0157380_107681672 | 85 |
| 514 | 3300014326 | Ga0157380_12663067 | Ga0157380_126630672 | 85 |
| 515 | 3300014968 | Ga0157379_10319230 | Ga0157379_103192302 | 85 |
| 516 | 3300014968 | Ga0157379_10495748 | Ga0157379_104957483 | 85 |
| 517 | 3300014968 | Ga0157379_11580556 | Ga0157379_115805561 | 85 |
| 518 | 3300014968 | Ga0157379_11718648 | Ga0157379_117186481 | 85 |
| 519 | 3300014968 | Ga0157379_11982230 | Ga0157379_119822301 | 85 |
| 520 | 3300014968 | Ga0157379_12094132 | Ga0157379_120941321 | 85 |
| 521 | 3300014969 | Ga0157376_10014758 | Ga0157376_100147582 | 85 |
| 522 | 3300014969 | Ga0157376_10100168 | Ga0157376_101001683 | 85 |
| 523 | 3300014969 | Ga0157376_10419030 | Ga0157376_104190302 | 85 |
| 524 | 3300014969 | Ga0157376_11996431 | Ga0157376_119964311 | 85 |
| 525 | 3300017792 | Ga0163161_10086127 | Ga0163161_100861272 | 85 |
| 526 | 3300025302 | Ga0207426_1002773 | Ga0207426_10027739 | 85 |
| 527 | 3300025302 | Ga0207426_1007634 | Ga0207426_10076342 | 85 |
| 528 | 3300025898 | Ga0207692_10297647 | Ga0207692_102976472 | 85 |
| 529 | 3300025900 | Ga0207710_10746721 | Ga0207710_107467211 | 85 |
| 530 | 3300025903 | Ga0207680_10683545 | Ga0207680_106835452 | 85 |
| 531 | 3300025904 | Ga0207647_10517568 | Ga0207647_105175681 | 85 |
| 532 | 3300025908 | Ga0207643_10270617 | Ga0207643_102706172 | 85 |
| 533 | 3300025909 | Ga0207705_10156161 | Ga0207705_101561611 | 85 |
| 534 | 3300025910 | Ga0207684_11030480 | Ga0207684_110304802 | 85 |
| 535 | 3300025911 | Ga0207654_10264258 | Ga0207654_102642581 | 85 |
| 536 | 3300025911 | Ga0207654_10607996 | Ga0207654_106079962 | 85 |
| 537 | 3300025912 | Ga0207707_10064122 | Ga0207707_100641226 | 85 |
| 538 | 3300025912 | Ga0207707_10829420 | Ga0207707_108294201 | 85 |
| 539 | 3300025914 | Ga0207671_10070454 | Ga0207671_100704542 | 85 |
| 540 | 3300025914 | Ga0207671_10351919 | Ga0207671_103519192 | 85 |
| 541 | 3300025914 | Ga0207671_11300282 | Ga0207671_113002821 | 85 |
| 542 | 3300025915 | Ga0207693_10789696 | Ga0207693_107896961 | 85 |
| 543 | 3300025916 | Ga0207663_10229264 | Ga0207663_102292642 | 85 |
| 544 | 3300025916 | Ga0207663_10488418 | Ga0207663_104884182 | 85 |
| 545 | 3300025917 | Ga0207660_10018427 | Ga0207660_100184277 | 85 |
| 546 | 3300025917 | Ga0207660_11100922 | Ga0207660_111009222 | 85 |
| 547 | 3300025919 | Ga0207657_10021019 | Ga0207657_100210197 | 85 |
| 548 | 3300025920 | Ga0207649_10208243 | Ga0207649_102082433 | 85 |
| 549 | 3300025921 | Ga0207652_10046466 | Ga0207652_100464662 | 85 |
| 550 | 3300025921 | Ga0207652_11210324 | Ga0207652_112103242 | 85 |
| 551 | 3300025924 | Ga0207694_10056784 | Ga0207694_100567845 | 85 |
| 552 | 3300025924 | Ga0207694_10128231 | Ga0207694_101282312 | 85 |
| 553 | 3300025927 | Ga0207687_10024625 | Ga0207687_100246252 | 85 |
| 554 | 3300025927 | Ga0207687_10676143 | Ga0207687_106761431 | 85 |
| 555 | 3300025927 | Ga0207687_11484447 | Ga0207687_114844471 | 85 |
| 556 | 3300025928 | Ga0207700_10195699 | Ga0207700_101956991 | 85 |
| 557 | 3300025928 | Ga0207700_11339459 | Ga0207700_113394591 | 85 |
| 558 | 3300025931 | Ga0207644_10229896 | Ga0207644_102298962 | 85 |
| 559 | 3300025931 | Ga0207644_10311440 | Ga0207644_103114401 | 85 |
| 560 | 3300025931 | Ga0207644_11352368 | Ga0207644_113523681 | 85 |
| 561 | 3300025932 | Ga0207690_10961096 | Ga0207690_109610961 | 85 |
| 562 | 3300025933 | Ga0207706_10378444 | Ga0207706_103784442 | 85 |
| 563 | 3300025934 | Ga0207686_10204516 | Ga0207686_102045163 | 85 |
| 564 | 3300025934 | Ga0207686_11193854 | Ga0207686_111938541 | 85 |
| 565 | 3300025934 | Ga0207686_11284991 | Ga0207686_112849912 | 85 |
| 566 | 3300025935 | Ga0207709_11196390 | Ga0207709_111963901 | 85 |
| 567 | 3300025936 | Ga0207670_10362810 | Ga0207670_103628102 | 85 |
| 568 | 3300025936 | Ga0207670_11472910 | Ga0207670_114729101 | 85 |
| 569 | 3300025937 | Ga0207669_10055936 | Ga0207669_100559361 | 85 |
| 570 | 3300025938 | Ga0207704_10100617 | Ga0207704_101006172 | 85 |
| 571 | 3300025938 | Ga0207704_10300664 | Ga0207704_103006641 | 85 |
| 572 | 3300025940 | Ga0207691_11318892 | Ga0207691_113188921 | 85 |
| 573 | 3300025940 | Ga0207691_11668851 | Ga0207691_116688512 | 85 |
| 574 | 3300025941 | Ga0207711_10077644 | Ga0207711_100776443 | 85 |
| 575 | 3300025941 | Ga0207711_10650076 | Ga0207711_106500761 | 85 |
| 576 | 3300025941 | Ga0207711_10743477 | Ga0207711_107434772 | 85 |
| 577 | 3300025941 | Ga0207711_10983237 | Ga0207711_109832371 | 85 |
| 578 | 3300025942 | Ga0207689_11609039 | Ga0207689_116090391 | 85 |
| 579 | 3300025944 | Ga0207661_10044310 | Ga0207661_100443105 | 85 |
| 580 | 3300025944 | Ga0207661_10269239 | Ga0207661_102692392 | 85 |
| 581 | 3300025945 | Ga0207679_10039717 | Ga0207679_100397171 | 85 |
| 582 | 3300025945 | Ga0207679_10280723 | Ga0207679_102807232 | 85 |
| 583 | 3300025945 | Ga0207679_10485131 | Ga0207679_104851312 | 85 |
| 584 | 3300025945 | Ga0207679_11797003 | Ga0207679_117970031 | 85 |
| 585 | 3300025945 | Ga0207679_12008091 | Ga0207679_120080912 | 85 |
| 586 | 3300025949 | Ga0207667_10037598 | Ga0207667_100375987 | 85 |
| 587 | 3300025949 | Ga0207667_11990483 | Ga0207667_119904831 | 85 |
| 588 | 3300025960 | Ga0207651_10365634 | Ga0207651_103656341 | 85 |
| 589 | 3300025960 | Ga0207651_10612276 | Ga0207651_106122761 | 85 |
| 590 | 3300025961 | Ga0207712_11571164 | Ga0207712_115711641 | 85 |
| 591 | 3300025972 | Ga0207668_10065215 | Ga0207668_100652152 | 85 |
| 592 | 3300025972 | Ga0207668_10527596 | Ga0207668_105275961 | 85 |
| 593 | 3300025972 | Ga0207668_11643169 | Ga0207668_116431692 | 85 |
| 594 | 3300025972 | Ga0207668_11713240 | Ga0207668_117132401 | 85 |
| 595 | 3300025981 | Ga0207640_10235065 | Ga0207640_102350653 | 85 |
| 596 | 3300025986 | Ga0207658_10749478 | Ga0207658_107494781 | 85 |
| 597 | 3300026023 | Ga0207677_10032765 | Ga0207677_100327654 | 85 |
| 598 | 3300026023 | Ga0207677_10329956 | Ga0207677_103299562 | 85 |
| 599 | 3300026035 | Ga0207703_10352317 | Ga0207703_103523172 | 85 |
| 600 | 3300026041 | Ga0207639_10031835 | Ga0207639_100318352 | 85 |
| 601 | 3300026041 | Ga0207639_10337881 | Ga0207639_103378811 | 85 |
| 602 | 3300026067 | Ga0207678_10011180 | Ga0207678_100111803 | 85 |
| 603 | 3300026067 | Ga0207678_10043207 | Ga0207678_100432072 | 85 |
| 604 | 3300026067 | Ga0207678_10068408 | Ga0207678_100684082 | 85 |
| 605 | 3300026067 | Ga0207678_10408032 | Ga0207678_104080322 | 85 |
| 606 | 3300026067 | Ga0207678_10861223 | Ga0207678_108612231 | 85 |
| 607 | 3300026067 | Ga0207678_10862575 | Ga0207678_108625752 | 85 |
| 608 | 3300026075 | Ga0207708_11272946 | Ga0207708_112729461 | 85 |
| 609 | 3300026078 | Ga0207702_10579547 | Ga0207702_105795472 | 85 |
| 610 | 3300026078 | Ga0207702_10739716 | Ga0207702_107397162 | 85 |
| 611 | 3300026088 | Ga0207641_10332460 | Ga0207641_103324603 | 85 |
| 612 | 3300026088 | Ga0207641_10697841 | Ga0207641_106978412 | 85 |
| 613 | 3300026088 | Ga0207641_11502070 | Ga0207641_115020701 | 85 |
| 614 | 3300026089 | Ga0207648_10500479 | Ga0207648_105004792 | 85 |
| 615 | 3300026089 | Ga0207648_11038522 | Ga0207648_110385222 | 85 |
| 616 | 3300026089 | Ga0207648_11190356 | Ga0207648_111903561 | 85 |
| 617 | 3300026095 | Ga0207676_10109249 | Ga0207676_101092492 | 85 |
| 618 | 3300026095 | Ga0207676_10908533 | Ga0207676_109085332 | 85 |
| 619 | 3300026116 | Ga0207674_10126828 | Ga0207674_101268284 | 85 |
| 620 | 3300026118 | Ga0207675_102234416 | Ga0207675_1022344161 | 85 |
| 621 | 3300026121 | Ga0207683_10051095 | Ga0207683_100510955 | 85 |
| 622 | 3300026121 | Ga0207683_10160115 | Ga0207683_101601152 | 85 |
| 623 | 3300026121 | Ga0207683_10200387 | Ga0207683_102003872 | 85 |
| 624 | 3300026121 | Ga0207683_10505736 | Ga0207683_105057361 | 85 |
| 625 | 3300026142 | Ga0207698_10041587 | Ga0207698_100415874 | 85 |
| 626 | 3300026142 | Ga0207698_10226506 | Ga0207698_102265061 | 85 |
| 627 | 3300026142 | Ga0207698_11856875 | Ga0207698_118568752 | 85 |
| 628 | 3300027671 | Ga0209588_1038760 | Ga0209588_10387602 | 85 |
| 629 | 3300027866 | Ga0209813_10041476 | Ga0209813_100414762 | 85 |
| 630 | 3300027866 | Ga0209813_10225265 | Ga0209813_102252651 | 85 |
| 631 | 3300028379 | Ga0268266_10000951 | Ga0268266_1000095116 | 85 |
| 632 | 3300028379 | Ga0268266_10058052 | Ga0268266_100580523 | 85 |
| 633 | 3300028379 | Ga0268266_10302052 | Ga0268266_103020522 | 85 |
| 634 | 3300028379 | Ga0268266_10907570 | Ga0268266_109075702 | 85 |
| 635 | 3300028381 | Ga0268264_10000022 | Ga0268264_1000002236 | 85 |
| 636 | 3300028381 | Ga0268264_10970473 | Ga0268264_109704732 | 85 |
| 637 | 3300028381 | Ga0268264_11173148 | Ga0268264_111731482 | 85 |
| 638 | 3300028381 | Ga0268264_11766700 | Ga0268264_117667002 | 85 |
| 639 | 3300028794 | Ga0307515_10049717 | Ga0307515_100497175 | 85 |
| 640 | 3300028794 | Ga0307515_10714455 | Ga0307515_107144551 | 85 |
| 641 | 3300028794 | Ga0307515_10838904 | Ga0307515_108389042 | 85 |
| 642 | 3300030521 | Ga0307511_10400044 | Ga0307511_104000441 | 85 |
| 643 | 3300030763 | Ga0265763_1009226 | Ga0265763_10092261 | 85 |
| 644 | 3300030963 | Ga0265768_104851 | Ga0265768_1048511 | 85 |
| 645 | 3300031018 | Ga0265773_1037946 | Ga0265773_10379461 | 85 |
| 646 | 3300031018 | Ga0265773_1049542 | Ga0265773_10495421 | 85 |
| 647 | 3300031235 | Ga0265330_10062556 | Ga0265330_100625562 | 85 |
| 648 | 3300031235 | Ga0265330_10136062 | Ga0265330_101360622 | 85 |
| 649 | 3300031238 | Ga0265332_10018173 | Ga0265332_100181732 | 85 |
| 650 | 3300031238 | Ga0265332_10095848 | Ga0265332_100958481 | 85 |
| 651 | 3300031242 | Ga0265329_10222595 | Ga0265329_102225951 | 85 |
| 652 | 3300031247 | Ga0265340_10003276 | Ga0265340_100032766 | 85 |
| 653 | 3300031250 | Ga0265331_10131128 | Ga0265331_101311282 | 85 |
| 654 | 3300031250 | Ga0265331_10207500 | Ga0265331_102075002 | 85 |
| 655 | 3300031344 | Ga0265316_10553254 | Ga0265316_105532542 | 85 |
| 656 | 3300031456 | Ga0307513_10256828 | Ga0307513_102568283 | 85 |
| 657 | 3300031456 | Ga0307513_10464086 | Ga0307513_104640861 | 85 |
| 658 | 3300031456 | Ga0307513_10765441 | Ga0307513_107654411 | 85 |
| 659 | 3300031507 | Ga0307509_10321969 | Ga0307509_103219692 | 85 |
| 660 | 3300031507 | Ga0307509_10337441 | Ga0307509_103374412 | 85 |
| 661 | 3300031548 | Ga0307408_100488110 | Ga0307408_1004881101 | 85 |
| 662 | 3300031616 | Ga0307508_10000001 | Ga0307508_10000001105 | 85 |
| 663 | 3300031616 | Ga0307508_10035326 | Ga0307508_100353262 | 85 |
| 664 | 3300031616 | Ga0307508_10066155 | Ga0307508_100661552 | 85 |
| 665 | 3300031616 | Ga0307508_10114872 | Ga0307508_101148722 | 85 |
| 666 | 3300031616 | Ga0307508_10235537 | Ga0307508_102355371 | 85 |
| 667 | 3300031667 | Ga0310111_138504 | Ga0310111_1385042 | 85 |
| 668 | 3300031712 | Ga0265342_10116106 | Ga0265342_101161062 | 85 |
| 669 | 3300031712 | Ga0265342_10534231 | Ga0265342_105342312 | 85 |
| 670 | 3300031730 | Ga0307516_10002141 | Ga0307516_1000214115 | 85 |
| 671 | 3300031730 | Ga0307516_10021175 | Ga0307516_100211758 | 85 |
| 672 | 3300031852 | Ga0307410_11550232 | Ga0307410_115502321 | 85 |
| 673 | 3300031903 | Ga0307407_10618249 | Ga0307407_106182491 | 85 |
| 674 | 3300032002 | Ga0307416_100328953 | Ga0307416_1003289531 | 85 |
| 675 | 3300032004 | Ga0307414_11905509 | Ga0307414_119055091 | 85 |
| 676 | 3300032005 | Ga0307411_10553621 | Ga0307411_105536211 | 85 |
| 677 | 3300033180 | Ga0307510_10016586 | Ga0307510_100165866 | 85 |
| 678 | 3300033180 | Ga0307510_10030555 | Ga0307510_100305554 | 85 |
| 679 | 3300033180 | Ga0307510_10547822 | Ga0307510_105478221 | 85 |
| 680 | 3300034816 | Ga0373930_0005832 | Ga0373930_0005832_1576_1845 | 85 |
| 681 | 3300034957 | Ga0373938_0078962 | Ga0373938_0078962_151_420 | 85 |
| 682 | 3300035085 | Ga0373929_0037615 | Ga0373929_0037615_460_729 | 85 |
| 683 | 3300035088 | Ga0373940_0252916 | Ga0373940_0252916_131_400 | 85 |
| 684 | 3300035090 | Ga0373949_0109289 | Ga0373949_0109289_333_602 | 85 |
| 685 | 3300035090 | Ga0373949_0121359 | Ga0373949_0121359_22_279 | 85 |
| 686 | 3300035113 | Ga0373936_0106618 | Ga0373936_0106618_386_643 | 85 |
| 687 | 3300035113 | Ga0373936_0310319 | Ga0373936_0310319_316_573 | 85 |
| 688 | 3300035115 | Ga0373941_0081552 | Ga0373941_0081552_181_450 | 85 |
| 689 | 3300035117 | Ga0373953_0006214 | Ga0373953_0006214_3485_3745 | 85 |
| 690 | 3300035119 | Ga0373956_0056474 | Ga0373956_0056474_350_610 | 85 |
| 691 | 3300035120 | Ga0373957_0051852 | Ga0373957_0051852_1128_1388 | 85 |
| 692 | 3300035172 | Ga0373955_0090902 | Ga0373955_0090902_36_296 | 85 |
| 693 | 3300035207 | Ga0373942_0137388 | Ga0373942_0137388_238_507 | 85 |
| 694 | 3300035242 | Ga0373962_0126761 | Ga0373962_0126761_226_495 | 85 |
| 695 | 3300035691 | Ga0373931_0002926 | Ga0373931_0002926_1998_2267 | 85 |
| 696 | 3300035691 | Ga0373931_0578857 | Ga0373931_0578857_38_295 | 85 |
| 697 | 3300035692 | Ga0373935_0333426 | Ga0373935_0333426_681_938 | 85 |
| 698 | 3300035695 | Ga0373927_0089135 | Ga0373927_0089135_1698_1967 | 85 |
| 699 | 3300035695 | Ga0373927_0772947 | Ga0373927_0772947_95_352 | 85 |
| 700 | 3300035724 | Ga0373933_0018065 | Ga0373933_0018065_1307_1567 | 85 |
| 701 | 3300035725 | Ga0373947_0445069 | Ga0373947_0445069_278_547 | 85 |
| 702 | 3300035725 | Ga0373947_0922944 | Ga0373947_0922944_87_344 | 85 |
| 703 | 3300036242 | Ga0310104_06677 | Ga0310104_06677_34_291 | 85 |
| 704 | 3300036401 | Ga0373937_0090156 | Ga0373937_0090156_653_913 | 85 |
| 705 | 3300036401 | Ga0373937_0797502 | Ga0373937_0797502_375_644 | 85 |
| 706 | 3300036458 | Ga0310112_022196 | Ga0310112_022196_68_325 | 85 |
| 707 | 3300036458 | Ga0310112_062193 | Ga0310112_062193_216_473 | 85 |
| 708 | 3300036459 | Ga0372808_013555 | Ga0372808_013555_874_1131 | 85 |
| 709 | 3300036459 | Ga0372808_040196 | Ga0372808_040196_26_283 | 85 |
| 710 | 3300036534 | Ga0310109_026198 | Ga0310109_026198_19_276 | 85 |
| 711 | 3300036534 | Ga0310109_035897 | Ga0310109_035897_29_286 | 85 |
| 712 | 3300036534 | Ga0310109_039782 | Ga0310109_039782_326_583 | 85 |
| 713 | 3300037068 | Ga0373925_0044622 | Ga0373925_0044622_338_607 | 85 |
| 714 | 3300037068 | Ga0373925_0422470 | Ga0373925_0422470_260_517 | 85 |
| 715 | 3300037068 | Ga0373925_0981788 | Ga0373925_0981788_425_682 | 85 |
| 716 | 3300037471 | Ga0395905_1417490 | Ga0395905_1417490_133_390 | 85 |
| 717 | 3300039437 | Ga0436365_1151076 | Ga0436365_1151076_86_346 | 85 |
| 718 | 3300039437 | Ga0436365_1218047 | Ga0436365_1218047_658_918 | 85 |
| 719 | 3300041413 | Ga0439465_0337197 | Ga0439465_0337197_27_284 | 85 |
| 720 | 3300041452 | Ga0451793_0500760 | Ga0451793_0500760_134_403 | 85 |
| 721 | 3300041494 | Ga0451837_1456358 | Ga0451837_1456358_264_521 | 85 |
| 722 | 3300041498 | Ga0451841_0515919 | Ga0451841_0515919_11_268 | 85 |
| 723 | 3300041501 | Ga0451845_0877925 | Ga0451845_0877925_53_322 | 85 |
| 724 | 3300041503 | Ga0451847_0531047 | Ga0451847_0531047_301_558 | 85 |
| 725 | 3300041507 | Ga0451851_0943936 | Ga0451851_0943936_431_688 | 85 |
| 726 | 3300041509 | Ga0451843_0094426 | Ga0451843_0094426_25_282 | 85 |
| 727 | 3300041511 | Ga0451855_1030746 | Ga0451855_1030746_194_463 | 85 |
| 728 | 3300041512 | Ga0451853_2459925 | Ga0451853_2459925_27_284 | 85 |
| 729 | 3300042006 | Ga0439432_183807 | Ga0439432_183807_236_493 | 85 |
| 730 | 3300042156 | Ga0439446_0140299 | Ga0439446_0140299_176_433 | 85 |
| 731 | 3300044658 | Ga0466972_0002947 | Ga0466972_0002947_7965_8222 | 85 |
| 732 | 3300044735 | Ga0466968_0005930 | Ga0466968_0005930_2520_2777 | 85 |
| 733 | 3300044901 | Ga0466960_0003317 | Ga0466960_0003317_5803_6060 | 85 |
| 734 | 3300045976 | Ga0466967_0978674 | Ga0466967_0978674_174_431 | 85 |
| 735 | 3300046452 | Ga0495617_011960 | Ga0495617_011960_50_307 | 85 |
| 736 | 3300046454 | Ga0495592_0010679 | Ga0495592_0010679_3277_3537 | 85 |
| 737 | 3300046454 | Ga0495592_0184866 | Ga0495592_0184866_809_1078 | 85 |
| 738 | 3300046454 | Ga0495592_0812336 | Ga0495592_0812336_23_280 | 85 |
| 739 | 3300046455 | Ga0495603_0060084 | Ga0495603_0060084_1377_1634 | 85 |
| 740 | 3300046457 | Ga0495590_0021201 | Ga0495590_0021201_1283_1540 | 85 |
| 741 | 3300046459 | Ga0495629_0017434 | Ga0495629_0017434_1246_1506 | 85 |
| 742 | 3300046460 | Ga0495638_0188705 | Ga0495638_0188705_506_763 | 85 |
| 743 | 3300046460 | Ga0495638_0211886 | Ga0495638_0211886_636_893 | 85 |
| 744 | 3300046460 | Ga0495638_0515833 | Ga0495638_0515833_220_477 | 85 |
| 745 | 3300046462 | Ga0495651_0002792 | Ga0495651_0002792_3839_4099 | 85 |
| 746 | 3300046463 | Ga0495653_0003251 | Ga0495653_0003251_3176_3436 | 85 |
| 747 | 3300046474 | Ga0495605_0383069 | Ga0495605_0383069_294_551 | 85 |
| 748 | 3300046474 | Ga0495605_0482429 | Ga0495605_0482429_50_307 | 85 |
| 749 | 3300046475 | Ga0495639_0303232 | Ga0495639_0303232_105_362 | 85 |
| 750 | 3300046475 | Ga0495639_0638141 | Ga0495639_0638141_14_271 | 85 |
| 751 | 3300046477 | Ga0495664_0777338 | Ga0495664_0777338_101_370 | 85 |
| 752 | 3300046492 | Ga0495585_0033897 | Ga0495585_0033897_850_1107 | 85 |
| 753 | 3300046492 | Ga0495585_0106773 | Ga0495585_0106773_1087_1344 | 85 |
| 754 | 3300046506 | Ga0495583_0117389 | Ga0495583_0117389_817_1074 | 85 |
| 755 | 3300046507 | Ga0495606_0275850 | Ga0495606_0275850_37_294 | 85 |
| 756 | 3300046507 | Ga0495606_0331037 | Ga0495606_0331037_175_432 | 85 |
| 757 | 3300046511 | Ga0495608_0003162 | Ga0495608_0003162_653_913 | 85 |
| 758 | 3300046511 | Ga0495608_0549210 | Ga0495608_0549210_272_541 | 85 |
| 759 | 3300046512 | Ga0495610_0118425 | Ga0495610_0118425_409_666 | 85 |
| 760 | 3300046512 | Ga0495610_0142481 | Ga0495610_0142481_109_366 | 85 |
| 761 | 3300046513 | Ga0495616_0138805 | Ga0495616_0138805_401_658 | 85 |
| 762 | 3300046513 | Ga0495616_0219399 | Ga0495616_0219399_420_677 | 85 |
| 763 | 3300046514 | Ga0495618_0041879 | Ga0495618_0041879_1128_1388 | 85 |
| 764 | 3300046516 | Ga0495628_0083080 | Ga0495628_0083080_2054_2314 | 85 |
| 765 | 3300046516 | Ga0495628_0197939 | Ga0495628_0197939_326_595 | 85 |
| 766 | 3300046517 | Ga0495630_0403692 | Ga0495630_0403692_383_652 | 85 |
| 767 | 3300046517 | Ga0495630_1139896 | Ga0495630_1139896_284_547 | 85 |
| 768 | 3300046524 | Ga0495648_0080224 | Ga0495648_0080224_1516_1773 | 85 |
| 769 | 3300046524 | Ga0495648_0102525 | Ga0495648_0102525_241_498 | 85 |
| 770 | 3300046526 | Ga0495666_0081025 | Ga0495666_0081025_1233_1490 | 85 |
| 771 | 3300046529 | Ga0495652_0063052 | Ga0495652_0063052_344_604 | 85 |
| 772 | 3300046529 | Ga0495652_0366519 | Ga0495652_0366519_323_592 | 85 |
| 773 | 3300046533 | Ga0495640_0216997 | Ga0495640_0216997_931_1191 | 85 |
| 774 | 3300046535 | Ga0495586_0923680 | Ga0495586_0923680_196_465 | 85 |
| 775 | 3300046536 | Ga0495587_0182478 | Ga0495587_0182478_255_515 | 85 |
| 776 | 3300046542 | Ga0495597_0112347 | Ga0495597_0112347_89_346 | 85 |
| 777 | 3300046543 | Ga0495645_0287622 | Ga0495645_0287622_246_515 | 85 |
| 778 | 3300046543 | Ga0495645_0359043 | Ga0495645_0359043_81_338 | 85 |
| 779 | 3300046557 | Ga0495622_0096124 | Ga0495622_0096124_994_1251 | 85 |
| 780 | 3300046615 | Ga0495656_0153373 | Ga0495656_0153373_564_821 | 85 |
| 781 | 3300046615 | Ga0495656_0669689 | Ga0495656_0669689_259_516 | 85 |
| 782 | 3300046616 | Ga0495668_0031702 | Ga0495668_0031702_2107_2364 | 85 |
| 783 | 3300046616 | Ga0495668_0162698 | Ga0495668_0162698_851_1108 | 85 |
| 784 | 3300046616 | Ga0495668_0251904 | Ga0495668_0251904_464_721 | 85 |
| 785 | 3300046616 | Ga0495668_0865044 | Ga0495668_0865044_147_404 | 85 |
| 786 | 3300046642 | Ga0495634_0012063 | Ga0495634_0012063_5870_6130 | 85 |
| 787 | 3300046648 | Ga0495611_0182619 | Ga0495611_0182619_553_810 | 85 |
| 788 | 3300046648 | Ga0495611_0540167 | Ga0495611_0540167_258_515 | 85 |
| 789 | 3300046660 | Ga0495625_0155073 | Ga0495625_0155073_805_1062 | 85 |
| 790 | 3300046660 | Ga0495625_0274308 | Ga0495625_0274308_468_737 | 85 |
| 791 | 3300046660 | Ga0495625_0742793 | Ga0495625_0742793_303_560 | 85 |
| 792 | 3300046663 | Ga0495635_0000230 | Ga0495635_0000230_25377_25637 | 85 |
| 793 | 3300046663 | Ga0495635_0730470 | Ga0495635_0730470_109_378 | 85 |
| 794 | 3300046663 | Ga0495635_0806027 | Ga0495635_0806027_159_416 | 85 |
| 795 | 3300046663 | Ga0495635_1075107 | Ga0495635_1075107_149_406 | 85 |
| 796 | 3300046664 | Ga0495659_0006340 | Ga0495659_0006340_1130_1387 | 85 |
| 797 | 3300046674 | Ga0495588_0141359 | Ga0495588_0141359_935_1204 | 85 |
| 798 | 3300046674 | Ga0495588_0284579 | Ga0495588_0284579_257_514 | 85 |
| 799 | 3300046675 | Ga0495657_0019646 | Ga0495657_0019646_63_323 | 85 |
| 800 | 3300046678 | Ga0495599_0003970 | Ga0495599_0003970_7268_7528 | 85 |
| 801 | 3300046679 | Ga0495623_0626562 | Ga0495623_0626562_157_417 | 85 |
| 802 | 3300046680 | Ga0495646_0011572 | Ga0495646_0011572_1502_1762 | 85 |
| 803 | 3300046681 | Ga0495647_0145903 | Ga0495647_0145903_716_973 | 85 |
| 804 | 3300046684 | Ga0495669_0157650 | Ga0495669_0157650_398_655 | 85 |
| 805 | 3300046689 | Ga0495613_0097036 | Ga0495613_0097036_1307_1567 | 85 |
| 806 | 3300046689 | Ga0495613_0448507 | Ga0495613_0448507_209_478 | 85 |
| 807 | 3300046694 | Ga0495649_0566949 | Ga0495649_0566949_71_328 | 85 |
| 808 | 3300046694 | Ga0495649_0588446 | Ga0495649_0588446_50_307 | 85 |
| 809 | 3300046794 | Ga0495589_0112151 | Ga0495589_0112151_177_434 | 85 |
| 810 | 3300046809 | Ga0495600_0004716 | Ga0495600_0004716_3967_4227 | 85 |
| 811 | 3300046809 | Ga0495600_0245468 | Ga0495600_0245468_578_847 | 85 |
| 812 | 3300047315 | Ga0495581_0206596 | Ga0495581_0206596_767_1024 | 85 |
| 813 | 3300047315 | Ga0495581_0261632 | Ga0495581_0261632_514_774 | 85 |
| 814 | 3300047317 | Ga0495604_0004194 | Ga0495604_0004194_10910_11170 | 85 |
| 815 | 3300047319 | Ga0495674_0008381 | Ga0495674_0008381_4190_4450 | 85 |
| 816 | 3300047319 | Ga0495674_0240261 | Ga0495674_0240261_415_684 | 85 |
| 817 | 3300047320 | Ga0495672_0023877 | Ga0495672_0023877_1227_1484 | 85 |
| 818 | 3300047320 | Ga0495672_0024111 | Ga0495672_0024111_130_387 | 85 |
| 819 | 3300047320 | Ga0495672_0126330 | Ga0495672_0126330_965_1222 | 85 |
| 820 | 3300047321 | Ga0495676_0174994 | Ga0495676_0174994_1027_1284 | 85 |
| 821 | 3300047322 | Ga0495680_0011451 | Ga0495680_0011451_3802_4062 | 85 |
| 822 | 3300047323 | Ga0495683_0051610 | Ga0495683_0051610_843_1100 | 85 |
| 823 | 3300047444 | Ga0495675_0001005 | Ga0495675_0001005_3811_4071 | 85 |
| 824 | 3300047446 | Ga0495679_115800 | Ga0495679_115800_93_350 | 85 |
| 825 | 3300047447 | Ga0495685_037620 | Ga0495685_037620_364_621 | 85 |
| 826 | 3300047469 | Ga0495673_0086629 | Ga0495673_0086629_284_541 | 85 |
| 827 | 3300047469 | Ga0495673_0099576 | Ga0495673_0099576_50_307 | 85 |
| 828 | 3300047470 | Ga0495681_0388230 | Ga0495681_0388230_69_326 | 85 |
| 829 | 3300047673 | Ga0495593_0002243 | Ga0495593_0002243_2883_3143 | 85 |
| 830 | 3300048088 | Ga0495602_0023393 | Ga0495602_0023393_1928_2188 | 85 |
| 831 | 3300048088 | Ga0495602_1015168 | Ga0495602_1015168_149_406 | 85 |
| 832 | 3300048091 | Ga0495626_0093542 | Ga0495626_0093542_994_1251 | 85 |
| 833 | 3300048903 | Ga0496100_0014273 | Ga0496100_0014273_118_375 | 85 |
| 834 | 3300048903 | Ga0496100_0044857 | Ga0496100_0044857_729_986 | 85 |
| 835 | 3300048903 | Ga0496100_0061540 | Ga0496100_0061540_939_1208 | 85 |
| 836 | 3300048904 | Ga0496101_0036493 | Ga0496101_0036493_1585_1854 | 85 |
| 837 | 3300048904 | Ga0496101_0201852 | Ga0496101_0201852_1175_1432 | 85 |
| 838 | 3300048904 | Ga0496101_0267419 | Ga0496101_0267419_453_716 | 85 |
| 839 | 3300048905 | Ga0496102_0047584 | Ga0496102_0047584_341_604 | 85 |
| 840 | 3300048905 | Ga0496102_0055990 | Ga0496102_0055990_1512_1769 | 85 |
| 841 | 3300048905 | Ga0496102_0165484 | Ga0496102_0165484_1542_1799 | 85 |
| 842 | 3300048905 | Ga0496102_0495915 | Ga0496102_0495915_162_419 | 85 |
| 843 | 3300048905 | Ga0496102_0741326 | Ga0496102_0741326_233_502 | 85 |
| 844 | 3300048905 | Ga0496102_1392180 | Ga0496102_1392180_275_532 | 85 |
| 845 | 3300048905 | Ga0496102_1738578 | Ga0496102_1738578_248_508 | 85 |
| 846 | 3300048906 | Ga0496103_0116937 | Ga0496103_0116937_720_977 | 85 |
| 847 | 3300048906 | Ga0496103_0791906 | Ga0496103_0791906_171_428 | 85 |
| 848 | 3300048906 | Ga0496103_0954574 | Ga0496103_0954574_254_517 | 85 |
| 849 | 3300048907 | Ga0496104_0031531 | Ga0496104_0031531_1469_1726 | 85 |
| 850 | 3300048907 | Ga0496104_0032314 | Ga0496104_0032314_3688_3951 | 85 |
| 851 | 3300048907 | Ga0496104_0056952 | Ga0496104_0056952_2250_2519 | 85 |
| 852 | 3300048907 | Ga0496104_0253277 | Ga0496104_0253277_459_716 | 85 |
| 853 | 3300048907 | Ga0496104_1568453 | Ga0496104_1568453_289_546 | 85 |
| 854 | 3300048908 | Ga0496105_0011247 | Ga0496105_0011247_2667_2936 | 85 |
| 855 | 3300048908 | Ga0496105_0020951 | Ga0496105_0020951_2871_3128 | 85 |
| 856 | 3300048908 | Ga0496105_0389856 | Ga0496105_0389856_787_1044 | 85 |
| 857 | 3300048909 | Ga0496106_0026827 | Ga0496106_0026827_3286_3549 | 85 |
| 858 | 3300048909 | Ga0496106_0031902 | Ga0496106_0031902_1193_1450 | 85 |
| 859 | 3300048909 | Ga0496106_0046979 | Ga0496106_0046979_1048_1317 | 85 |
| 860 | 3300048910 | Ga0496107_0014561 | Ga0496107_0014561_82_339 | 85 |
| 861 | 3300048910 | Ga0496107_0169046 | Ga0496107_0169046_453_716 | 85 |
| 862 | 3300048911 | Ga0496108_0043218 | Ga0496108_0043218_2800_3069 | 85 |
| 863 | 3300048911 | Ga0496108_0094038 | Ga0496108_0094038_535_798 | 85 |
| 864 | 3300048911 | Ga0496108_0490131 | Ga0496108_0490131_787_1044 | 85 |
| 865 | 3300048911 | Ga0496108_0615137 | Ga0496108_0615137_95_355 | 85 |
| 866 | 3300048912 | Ga0496109_0028587 | Ga0496109_0028587_107_364 | 85 |
| 867 | 3300048912 | Ga0496109_0038696 | Ga0496109_0038696_231_500 | 85 |
| 868 | 3300048912 | Ga0496109_0161278 | Ga0496109_0161278_1742_2002 | 85 |
| 869 | 3300048912 | Ga0496109_0570771 | Ga0496109_0570771_16_279 | 85 |
| 870 | 3300048913 | Ga0496110_0053465 | Ga0496110_0053465_652_909 | 85 |
| 871 | 3300048913 | Ga0496110_0088670 | Ga0496110_0088670_226_495 | 85 |
| 872 | 3300048913 | Ga0496110_1504467 | Ga0496110_1504467_184_441 | 85 |
| 873 | 3300048914 | Ga0496111_0099650 | Ga0496111_0099650_940_1197 | 85 |
| 874 | 3300048914 | Ga0496111_0130090 | Ga0496111_0130090_1507_1764 | 85 |
| 875 | 3300048914 | Ga0496111_0276131 | Ga0496111_0276131_970_1230 | 85 |
| 876 | 3300048914 | Ga0496111_0299562 | Ga0496111_0299562_165_428 | 85 |
| 877 | 3300048914 | Ga0496111_0344774 | Ga0496111_0344774_284_541 | 85 |
| 878 | 3300048914 | Ga0496111_0718387 | Ga0496111_0718387_388_645 | 85 |
| 879 | 3300048915 | Ga0496112_0010586 | Ga0496112_0010586_6413_6676 | 85 |
| 880 | 3300048915 | Ga0496112_0068948 | Ga0496112_0068948_2250_2519 | 85 |
| 881 | 3300048915 | Ga0496112_0559267 | Ga0496112_0559267_223_480 | 85 |
| 882 | 3300048915 | Ga0496112_0603281 | Ga0496112_0603281_743_1000 | 85 |
| 883 | 3300048916 | Ga0496113_0033763 | Ga0496113_0033763_71_340 | 85 |
| 884 | 3300048916 | Ga0496113_0430197 | Ga0496113_0430197_661_918 | 85 |
| 885 | 3300048916 | Ga0496113_0489284 | Ga0496113_0489284_697_960 | 85 |
| 886 | 3300048917 | Ga0496114_0024702 | Ga0496114_0024702_2933_3190 | 85 |
| 887 | 3300048917 | Ga0496114_0054153 | Ga0496114_0054153_64_321 | 85 |
| 888 | 3300048917 | Ga0496114_0141757 | Ga0496114_0141757_1024_1293 | 85 |
| 889 | 3300048917 | Ga0496114_0374728 | Ga0496114_0374728_953_1210 | 85 |
| 890 | 3300048917 | Ga0496114_0481440 | Ga0496114_0481440_216_485 | 85 |
| 891 | 3300048918 | Ga0496115_0006501 | Ga0496115_0006501_5528_5785 | 85 |
| 892 | 3300048918 | Ga0496115_0017237 | Ga0496115_0017237_4601_4870 | 85 |
| 893 | 3300048918 | Ga0496115_0132938 | Ga0496115_0132938_271_531 | 85 |
| 894 | 3300048919 | Ga0496116_0064344 | Ga0496116_0064344_656_913 | 85 |
| 895 | 3300048924 | Ga0496121_0003622 | Ga0496121_0003622_7248_7505 | 85 |
| 896 | 3300048924 | Ga0496121_0021812 | Ga0496121_0021812_4613_4870 | 85 |
| 897 | 3300048924 | Ga0496121_0058140 | Ga0496121_0058140_2312_2569 | 85 |
| 898 | 3300048924 | Ga0496121_0079072 | Ga0496121_0079072_1008_1265 | 85 |
| 899 | 3300048924 | Ga0496121_0257078 | Ga0496121_0257078_446_703 | 85 |
| 900 | 3300048926 | Ga0496123_0164615 | Ga0496123_0164615_650_907 | 85 |
| 901 | 3300048929 | Ga0496126_0003918 | Ga0496126_0003918_3591_3848 | 85 |
| 902 | 3300048929 | Ga0496126_0162705 | Ga0496126_0162705_59_316 | 85 |
| 903 | 3300048929 | Ga0496126_0191243 | Ga0496126_0191243_479_736 | 85 |
| 904 | 3300048929 | Ga0496126_0421113 | Ga0496126_0421113_79_336 | 85 |
| 905 | 3300049459 | Ga0495678_067495 | Ga0495678_067495_852_1109 | 85 |
| 906 | 3300049460 | Ga0495682_0185262 | Ga0495682_0185262_50_307 | 85 |
| 907 | 3300049531 | Ga0501315_060822 | Ga0501315_060822_37_306 | 85 |
| 908 | 3300050489 | nmdc:mga03683_311918_c1 | nmdc:mga03683_311918_c1_39_296 | 85 |
| 909 | 3300050490 | nmdc:mga03n38_30616_c2 | nmdc:mga03n38_30616_c2_263_523 | 85 |
| 910 | 3300050490 | nmdc:mga03n38_4045_c1 | nmdc:mga03n38_4045_c1_907_1164 | 85 |
| 911 | 3300050490 | nmdc:mga03n38_41091_c1 | nmdc:mga03n38_41091_c1_793_1050 | 85 |
| 912 | 3300050490 | nmdc:mga03n38_904321_c1 | nmdc:mga03n38_904321_c1_104_361 | 85 |
| 913 | 3300050491 | nmdc:mga00v17_458905_c1 | nmdc:mga00v17_458905_c1_35_295 | 85 |
| 914 | 3300050491 | nmdc:mga00v17_916149_c1 | nmdc:mga00v17_916149_c1_20_277 | 85 |
| 915 | 3300050492 | nmdc:mga0yw44_147071_c1 | nmdc:mga0yw44_147071_c1_667_924 | 85 |
| 916 | 3300050492 | nmdc:mga0yw44_167125_c1 | nmdc:mga0yw44_167125_c1_863_1120 | 85 |
| 917 | 3300050492 | nmdc:mga0yw44_189271_c1 | nmdc:mga0yw44_189271_c1_974_1231 | 85 |
| 918 | 3300050492 | nmdc:mga0yw44_343682_c1 | nmdc:mga0yw44_343682_c1_437_697 | 85 |
| 919 | 3300050492 | nmdc:mga0yw44_36131_c1 | nmdc:mga0yw44_36131_c1_760_1017 | 85 |
| 920 | 3300050493 | nmdc:mga0k408_118194_c1 | nmdc:mga0k408_118194_c1_394_651 | 85 |
| 921 | 3300050493 | nmdc:mga0k408_382734_c1 | nmdc:mga0k408_382734_c1_437_694 | 85 |
| 922 | 3300050494 | nmdc:mga06z11_120038_c1 | nmdc:mga06z11_120038_c1_654_911 | 85 |
| 923 | 3300050494 | nmdc:mga06z11_471347_c1 | nmdc:mga06z11_471347_c1_216_473 | 85 |
| 924 | 3300050494 | nmdc:mga06z11_62524_c1 | nmdc:mga06z11_62524_c1_379_636 | 85 |
| 925 | 3300050494 | nmdc:mga06z11_92545_c1 | nmdc:mga06z11_92545_c1_632_889 | 85 |
| 926 | 3300050494 | nmdc:mga06z11_986522_c1 | nmdc:mga06z11_986522_c1_200_460 | 85 |
| 927 | 3300050495 | nmdc:mga04h51_216478_c1 | nmdc:mga04h51_216478_c1_148_405 | 85 |
| 928 | 3300050495 | nmdc:mga04h51_231998_c1 | nmdc:mga04h51_231998_c1_150_407 | 85 |
| 929 | 3300050495 | nmdc:mga04h51_23622_c1 | nmdc:mga04h51_23622_c1_659_916 | 85 |
| 930 | 3300050496 | nmdc:mga07m45_3883_c1 | nmdc:mga07m45_3883_c1_6051_6308 | 85 |
| 931 | 3300050496 | nmdc:mga07m45_447027_c1 | nmdc:mga07m45_447027_c1_309_566 | 85 |
| 932 | 3300050496 | nmdc:mga07m45_86964_c1 | nmdc:mga07m45_86964_c1_1216_1473 | 85 |
| 933 | 3300050513 | nmdc:mga0rr50_720424_c1 | nmdc:mga0rr50_720424_c1_477_734 | 85 |
| 934 | 3300050514 | nmdc:mga08x19_992255_c1 | nmdc:mga08x19_992255_c1_192_449 | 85 |
| 935 | 3300050516 | nmdc:mga0sz30_593296_c1 | nmdc:mga0sz30_593296_c1_191_448 | 85 |
| 936 | 3300050516 | nmdc:mga0sz30_59677_c1 | nmdc:mga0sz30_59677_c1_1089_1346 | 85 |
| 937 | 3300053078 | Ga0495612_0093779 | Ga0495612_0093779_773_1030 | 85 |
| 938 | 3300053080 | Ga0500635_0099609 | Ga0500635_0099609_228_485 | 85 |
| 939 | 3300053084 | Ga0495595_0001042 | Ga0495595_0001042_1057_1317 | 85 |
| 940 | 3300053084 | Ga0495595_0036630 | Ga0495595_0036630_229_498 | 85 |
| 941 | 3300053084 | Ga0495595_0060983 | Ga0495595_0060983_1276_1545 | 85 |
| 942 | 3300053085 | Ga0495619_0002925 | Ga0495619_0002925_7196_7456 | 85 |
| 943 | 3300053085 | Ga0495619_0069905 | Ga0495619_0069905_1749_2018 | 85 |
| 944 | 3300053090 | Ga0500646_0078978 | Ga0500646_0078978_254_511 | 85 |
| 945 | 3300053091 | Ga0500647_0197851 | Ga0500647_0197851_83_340 | 85 |
| 946 | 3300053092 | Ga0500583_0111877 | Ga0500583_0111877_76_333 | 85 |
| 947 | 3300053093 | Ga0500651_0703078 | Ga0500651_0703078_67_324 | 85 |
| 948 | 3300053094 | Ga0500566_0000047 | Ga0500566_0000047_42944_43201 | 85 |
| 949 | 3300053094 | Ga0500566_0002386 | Ga0500566_0002386_2777_3034 | 85 |
| 950 | 3300053094 | Ga0500566_0095747 | Ga0500566_0095747_906_1166 | 85 |
| 951 | 3300053095 | Ga0500640_001486 | Ga0500640_001486_6197_6454 | 85 |
| 952 | 3300053096 | Ga0500641_0004333 | Ga0500641_0004333_1963_2220 | 85 |
| 953 | 3300053098 | Ga0500650_0276304 | Ga0500650_0276304_404_661 | 85 |
| 954 | 3300053098 | Ga0500650_0440191 | Ga0500650_0440191_217_474 | 85 |
| 955 | 3300053104 | Ga0500556_0005914 | Ga0500556_0005914_418_675 | 85 |
| 956 | 3300053104 | Ga0500556_0424974 | Ga0500556_0424974_61_318 | 85 |
| 957 | 3300053108 | Ga0500562_132380 | Ga0500562_132380_53_310 | 85 |
| 958 | 3300053109 | Ga0500569_186771 | Ga0500569_186771_88_345 | 85 |
| 959 | 3300053111 | Ga0500572_000071 | Ga0500572_000071_13797_14054 | 85 |
| 960 | 3300053115 | Ga0500591_034835 | Ga0500591_034835_2105_2362 | 85 |
| 961 | 3300053119 | Ga0500595_007366 | Ga0500595_007366_3419_3676 | 85 |
| 962 | 3300053119 | Ga0500595_020065 | Ga0500595_020065_1989_2246 | 85 |
| 963 | 3300053123 | Ga0500614_000552 | Ga0500614_000552_3816_4073 | 85 |
| 964 | 3300053126 | Ga0500621_268059 | Ga0500621_268059_238_495 | 85 |
| 965 | 3300053130 | Ga0500642_0464607 | Ga0500642_0464607_237_494 | 85 |
| 966 | 3300053133 | Ga0500655_052599 | Ga0500655_052599_110_367 | 85 |
| 967 | 3300053133 | Ga0500655_080920 | Ga0500655_080920_167_427 | 85 |
| 968 | 3300053134 | Ga0500658_0204496 | Ga0500658_0204496_422_679 | 85 |
| 969 | 3300053136 | Ga0500559_0005925 | Ga0500559_0005925_2483_2740 | 85 |
| 970 | 3300053136 | Ga0500559_0239828 | Ga0500559_0239828_511_768 | 85 |
| 971 | 3300053139 | Ga0500568_0034974 | Ga0500568_0034974_932_1189 | 85 |
| 972 | 3300053139 | Ga0500568_0053267 | Ga0500568_0053267_20_277 | 85 |
| 973 | 3300053139 | Ga0500568_0288571 | Ga0500568_0288571_103_360 | 85 |
| 974 | 3300053142 | Ga0500577_0078346 | Ga0500577_0078346_612_869 | 85 |
| 975 | 3300053143 | Ga0500579_279576 | Ga0500579_279576_235_492 | 85 |
| 976 | 3300053146 | Ga0500588_0377568 | Ga0500588_0377568_184_441 | 85 |
| 977 | 3300053147 | Ga0500589_112624 | Ga0500589_112624_53_310 | 85 |
| 978 | 3300053148 | Ga0500590_172573 | Ga0500590_172573_543_800 | 85 |
| 979 | 3300053148 | Ga0500590_232649 | Ga0500590_232649_345_605 | 85 |
| 980 | 3300053150 | Ga0500603_000190 | Ga0500603_000190_7919_8176 | 85 |
| 981 | 3300053151 | Ga0500604_0183312 | Ga0500604_0183312_265_522 | 85 |
| 982 | 3300053158 | Ga0500627_0174424 | Ga0500627_0174424_383_640 | 85 |
| 983 | 3300053158 | Ga0500627_0495969 | Ga0500627_0495969_50_307 | 85 |
| 984 | 3300053159 | Ga0500630_001753 | Ga0500630_001753_1365_1622 | 85 |
| 985 | 3300053160 | Ga0500633_0260601 | Ga0500633_0260601_354_611 | 85 |
| 986 | 3300053161 | Ga0500634_0168913 | Ga0500634_0168913_682_939 | 85 |
| 987 | 3300053161 | Ga0500634_0352715 | Ga0500634_0352715_35_292 | 85 |
| 988 | 3300053162 | Ga0500638_050493 | Ga0500638_050493_1317_1574 | 85 |
| 989 | 3300053163 | Ga0500639_000087 | Ga0500639_000087_17306_17563 | 85 |
| 990 | 3300053163 | Ga0500639_180715 | Ga0500639_180715_504_761 | 85 |
| 991 | 3300053178 | Ga0500637_0139935 | Ga0500637_0139935_846_1103 | 85 |
| 992 | 3300053178 | Ga0500637_0159095 | Ga0500637_0159095_739_996 | 85 |
| 993 | 3300053725 | Ga0500576_210813 | Ga0500576_210813_179_436 | 85 |
| 994 | 3300053728 | Ga0500657_177386 | Ga0500657_177386_363_620 | 85 |
| 995 | 3300053731 | Ga0500609_006198 | Ga0500609_006198_249_506 | 85 |
| 996 | 3300053735 | Ga0500596_000958 | Ga0500596_000958_4412_4669 | 85 |
| 997 | 3300053737 | Ga0500601_023501 | Ga0500601_023501_32_289 | 85 |
| 998 | 3300055283 | Ga0500661_034556 | Ga0500661_034556_70_327 | 85 |
| 999 | 3300059477 | Ga0587084_114439 | Ga0587084_114439_80_337 | 85 |
| 1000 | 3300059490 | Ga0587066_179457 | Ga0587066_179457_140_397 | 85 |
| 1001 | 3300059491 | Ga0587070_122016 | Ga0587070_122016_146_403 | 85 |
| 1002 | 3300059505 | Ga0587083_0189321 | Ga0587083_0189321_174_431 | 85 |
| 1003 | 3300059506 | Ga0587085_168268 | Ga0587085_168268_145_414 | 85 |
| 1004 | 3300059508 | Ga0587088_164094 | Ga0587088_164094_138_395 | 85 |
| 1005 | 3300059510 | Ga0587090_115060 | Ga0587090_115060_292_549 | 85 |
| 1006 | 3300059511 | Ga0587091_240738 | Ga0587091_240738_218_475 | 85 |
| 1007 | 3300059512 | Ga0587092_112323 | Ga0587092_112323_273_530 | 85 |
| 1008 | 3300059513 | Ga0587094_131233 | Ga0587094_131233_28_285 | 85 |
| 1009 | 3300059623 | Ga0587101_069978 | Ga0587101_069978_44_301 | 85 |
| 1010 | 3300059623 | Ga0587101_112396 | Ga0587101_112396_151_408 | 85 |
| 1011 | 3300059624 | Ga0587109_074498 | Ga0587109_074498_339_596 | 85 |
| 1012 | 3300059627 | Ga0587117_133487 | Ga0587117_133487_28_285 | 85 |
| 1013 | 3300059641 | Ga0587068_163424 | Ga0587068_163424_28_285 | 85 |
| 1014 | 3300059642 | Ga0587069_129982 | Ga0587069_129982_222_479 | 85 |
| 1015 | 3300059644 | Ga0587075_066830 | Ga0587075_066830_127_384 | 85 |
| 1016 | 3300059644 | Ga0587075_082130 | Ga0587075_082130_214_471 | 85 |
| 1017 | 3300059645 | Ga0587076_208143 | Ga0587076_208143_28_285 | 85 |
| 1018 | 3300059646 | Ga0587078_064624 | Ga0587078_064624_28_285 | 85 |
| 1019 | 3300059647 | Ga0587079_092162 | Ga0587079_092162_318_575 | 85 |
| 1020 | 3300059647 | Ga0587079_099550 | Ga0587079_099550_128_385 | 85 |
| 1021 | 3300059647 | Ga0587079_200664 | Ga0587079_200664_248_505 | 85 |
| 1022 | 3300059649 | Ga0587102_041714 | Ga0587102_041714_223_483 | 85 |
| 1023 | 3300060344 | Ga0587071_077994 | Ga0587071_077994_117_374 | 85 |
| 1024 | 3300060346 | Ga0587111_0088831 | Ga0587111_0088831_349_606 | 85 |
| 1025 | 3300060346 | Ga0587111_0162230 | Ga0587111_0162230_306_563 | 85 |
| 1026 | 3300060346 | Ga0587111_0167082 | Ga0587111_0167082_137_394 | 85 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar