F488508

General Info

Members Datasets Scaffolds Average Seq Length
1026 567 909 85

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_101118284|Ga0070708_1011182842
Length 92
Sequence MTGQGTVMIKALSAITAAAFIAAALTVLPGFAPKVEASVPQALAKGDRLDIRTVGKDCSQQAWPNFDASCLRTSGSKSMVRQARLVTADRTP

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
4 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
5 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
6 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
7 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
8 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
9 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
10 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
11 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
12 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
13 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
14 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
15 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
16 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
17 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
18 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
19 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
20 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
21 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
22 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
23 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
24 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
25 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
26 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
27 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
28 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
29 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
30 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
31 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
32 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
33 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
34 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
35 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
36 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
37 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
38 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
39 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
40 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
41 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
42 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
43 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
44 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
45 2906610324
46 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
47 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
48 2922368715
49 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
50 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
51 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
52 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
53 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
54 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
55 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
56 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
57 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
58 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
59 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
60 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
61 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
62 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
63 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
64 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
65 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
66 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
67 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
68 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
69 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
70 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
71 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
72 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
73 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
74 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
75 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
76 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
77 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
78 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
79 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
80 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
81 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
82 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
83 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
84 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
85 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
86 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
87 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
88 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
89 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
90 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
91 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
92 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
93 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
94 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
95 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
96 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
97 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
98 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
99 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
100 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
101 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
102 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
103 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
104 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
105 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
106 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
107 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
108 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
109 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
110 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
111 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
112 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
113 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
114 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
115 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
116 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
117 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
118 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
119 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
120 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
121 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
122 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
123 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
124 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
125 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
126 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
127 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
128 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
129 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
130 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
131 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
132 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
133 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
134 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
135 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
136 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
137 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
138 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
139 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
140 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
141 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
142 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
143 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
144 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
145 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
146 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
147 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
148 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
149 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
150 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
151 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
152 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
153 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
154 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
155 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
156 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
157 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
158 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
159 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
160 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
161 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
162 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
163 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
164 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
165 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
166 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
167 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
168 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
169 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
170 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
171 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
172 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
173 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
174 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
175 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
176 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
177 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
178 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
179 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
180 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
181 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
182 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
183 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
184 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
185 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
186 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
187 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
188 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
189 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
190 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
191 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
192 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
193 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
194 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
195 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
196 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
197 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
198 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
199 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
200 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
201 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
202 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
203 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
204 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
205 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
206 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
207 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
208 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
262 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
265 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
266 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
271 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
272 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
273 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
274 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
275 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
276 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
277 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
278 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
279 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
280 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
281 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
282 3300031667 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
283 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
284 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
285 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
286 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
287 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
288 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
289 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
290 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
291 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
292 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
293 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
294 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
295 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
296 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
297 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
298 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
299 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
300 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
301 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
302 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
303 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
304 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
305 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
306 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
307 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
308 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
309 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
310 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
311 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
312 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
313 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
314 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
315 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
316 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
317 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
319 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
320 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
321 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
322 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
323 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
324 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
325 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
326 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
327 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
328 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
329 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
330 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
331 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
332 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
333 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
334 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
335 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
336 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
337 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
338 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
339 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
340 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
341 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
342 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
343 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
344 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
345 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
346 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
347 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
348 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
349 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
350 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
351 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
352 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
353 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
354 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
355 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
356 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
357 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
358 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
359 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
360 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
361 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
362 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
363 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
364 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
365 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
366 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
367 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
368 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
369 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
370 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
371 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
372 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
373 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
374 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
375 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
376 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
377 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
378 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
379 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
380 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
381 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
382 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
383 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
384 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
385 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
386 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
387 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
388 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
389 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
390 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
391 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
392 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
393 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
394 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
395 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
396 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
397 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
398 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
399 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
400 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
401 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
402 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
403 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
404 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
405 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
406 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
407 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
408 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
409 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
410 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
411 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
412 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
413 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
414 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
415 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
416 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
417 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
418 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
419 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
420 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
421 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
422 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
423 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
424 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
425 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
426 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
427 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
428 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
429 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
430 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
431 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
432 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
433 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
434 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
435 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
436 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
437 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
438 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
439 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
440 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
441 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
442 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
443 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
444 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
445 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
446 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
447 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
448 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
449 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
450 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
452 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
453 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
454 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
455 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
456 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
457 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
458 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
459 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
460 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
461 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
462 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
463 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
464 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
465 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
466 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
467 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
468 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
469 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
470 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
471 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
472 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
473 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
474 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
475 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
476 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
477 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
478 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
479 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
480 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
481 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
482 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
483 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
484 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
485 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
486 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
487 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
488 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
489 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
490 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
491 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
492 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
493 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
494 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
495 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
496 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
497 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
498 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
499 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
500 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
501 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
502 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
503 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
504 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
505 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
506 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
507 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
508 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
509 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
510 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
511 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
512 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
513 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
514 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
515 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
516 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
517 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
518 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
519 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
520 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
521 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
522 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
523 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
524 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
525 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
526 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
527 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
528 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
529 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
530 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
531 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
532 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
533 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
534 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
535 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
536 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
537 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
538 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
539 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
540 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
541 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
542 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
543 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
544 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
545 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
546 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
547 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
548 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
549 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
550 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
551 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
552 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
553 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
554 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
555 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
556 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
557 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
558 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
559 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
560 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
561 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
562 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
563 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
564 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
565 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
566 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
567 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.11
Metatranscriptomes 5.66
Isolates 11.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.04
Nodule 8.28
Rhizoplane 6.43
Rhizosphere 61.4
Stem 0
Stem Tuber 0
Unclassified 9.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1028577 3300000549 Bacteria 651
2 JGI25160J50197_1061223 3300003354 Bacteria 751
3 Ga0007429J51699_1015309 3300003579 Bacteria 534
4 Ga0055543_1063225 3300004625 Bacteria 591
5 Ga0058859_11717512 3300004798 Bacteria 629
6 Ga0058860_12120592 3300004801 Bacteria 618
7 Ga0058860_12138288 3300004801 Bacteria 555
8 Ga0058860_12235858 3300004801 Bacteria 546
9 Ga0065165_1006419 3300005262 Bacteria 6172
10 Ga0070658_10340868 3300005327 Bacteria 1282
11 Ga0070676_10886720 3300005328 Bacteria 664
12 Ga0070683_100137268 3300005329 Bacteria 2316
13 Ga0070683_101765083 3300005329 Bacteria 595
14 Ga0070683_101927706 3300005329 Bacteria 568
15 Ga0070690_100085524 3300005330 Bacteria 2069
16 Ga0070690_101019401 3300005330 Bacteria 653
17 Ga0070670_100569267 3300005331 Bacteria 1012
18 Ga0068869_100109499 3300005334 Bacteria 2100
19 Ga0068869_101968256 3300005334 Bacteria 524
20 Ga0070666_10597901 3300005335 Bacteria 805
21 Ga0070666_11319618 3300005335 Bacteria 538
22 Ga0070680_100025555 3300005336 Bacteria 4721
23 Ga0070682_100279158 3300005337 Bacteria 1217
24 Ga0070682_100835209 3300005337 Bacteria 751
25 Ga0068868_100019111 3300005338 Bacteria 5131
26 Ga0068868_100736188 3300005338 Bacteria 885
27 Ga0070660_101390764 3300005339 Bacteria 596
28 Ga0070689_100410580 3300005340 Bacteria 1146
29 Ga0070691_10147971 3300005341 Bacteria 1202
30 Ga0070661_100307675 3300005344 Bacteria 1235
31 Ga0070661_100388072 3300005344 Bacteria 1102
32 Ga0070668_100056810 3300005347 Bacteria 3023
33 Ga0070668_100760005 3300005347 Bacteria 859
34 Ga0070675_101073644 3300005354 Bacteria 740
35 Ga0070671_100206335 3300005355 Bacteria 1667
36 Ga0070671_100342254 3300005355 Bacteria 1276
37 Ga0070671_100429574 3300005355 Bacteria 1132
38 Ga0070674_100195426 3300005356 Bacteria 1559
39 Ga0070674_100241784 3300005356 Bacteria 1414
40 Ga0070673_100596574 3300005364 Bacteria 1007
41 Ga0070673_100677105 3300005364 Bacteria 946
42 Ga0070673_101095860 3300005364 Bacteria 744
43 Ga0070673_102151676 3300005364 Bacteria 530
44 Ga0070659_100634739 3300005366 Bacteria 920
45 Ga0070659_101313314 3300005366 Bacteria 642
46 Ga0070667_100666729 3300005367 Bacteria 961
47 Ga0070709_11071524 3300005434 Bacteria 644
48 Ga0070714_100141594 3300005435 Bacteria 2160
49 Ga0070713_100446532 3300005436 Bacteria 1214
50 Ga0070713_101976019 3300005436 Bacteria 566
51 Ga0070710_11224279 3300005437 Bacteria 556
52 Ga0070711_100688446 3300005439 Bacteria 860
53 Ga0070711_100944246 3300005439 Bacteria 738
54 Ga0070711_101033454 3300005439 Bacteria 706
55 Ga0070705_100488409 3300005440 Bacteria 932
56 Ga0070708_101118284 3300005445 Bacteria 738
57 Ga0070663_100047420 3300005455 Bacteria 3043
58 Ga0070663_100162595 3300005455 Bacteria 1719
59 Ga0070663_100185926 3300005455 Bacteria 1614
60 Ga0070663_100188065 3300005455 Bacteria 1606
61 Ga0070663_100403292 3300005455 Bacteria 1118
62 Ga0070678_100087645 3300005456 Bacteria 2378
63 Ga0070678_100197035 3300005456 Bacteria 1660
64 Ga0070678_100253765 3300005456 Bacteria 1476
65 Ga0070678_100397541 3300005456 Bacteria 1196
66 Ga0070662_101694056 3300005457 Bacteria 546
67 Ga0070681_10060782 3300005458 Bacteria 3754
68 Ga0070681_10553262 3300005458 Bacteria 1064
69 Ga0070681_11893691 3300005458 Bacteria 524
70 Ga0068867_100732199 3300005459 Bacteria 876
71 Ga0070685_10700413 3300005466 Bacteria 738
72 Ga0070679_100039171 3300005530 Bacteria 4711
73 Ga0070679_100250531 3300005530 Bacteria 1727
74 Ga0070679_100554944 3300005530 Bacteria 1092
75 Ga0070684_100009838 3300005535 Bacteria 7553
76 Ga0070684_100107204 3300005535 Bacteria 2502
77 Ga0070684_101094835 3300005535 Bacteria 749
78 Ga0070684_102109956 3300005535 Bacteria 532
79 Ga0070697_100066932 3300005536 Bacteria 2937
80 Ga0068853_100388284 3300005539 Bacteria 1305
81 Ga0068853_100446152 3300005539 Bacteria 1216
82 Ga0068853_100790886 3300005539 Bacteria 908
83 Ga0070672_101140138 3300005543 Bacteria 694
84 Ga0070672_101520948 3300005543 Bacteria 600
85 Ga0070672_102093248 3300005543 Bacteria 510
86 Ga0070693_101589770 3300005547 Bacteria 513
87 Ga0070665_100011491 3300005548 Bacteria 8954
88 Ga0070665_100042315 3300005548 Bacteria 4578
89 Ga0070665_100850243 3300005548 Bacteria 925
90 Ga0070665_100870382 3300005548 Bacteria 914
91 Ga0070665_100890225 3300005548 Bacteria 903
92 Ga0070665_100969884 3300005548 Bacteria 862
93 Ga0070665_101081343 3300005548 Bacteria 814
94 Ga0070665_101448135 3300005548 Bacteria 696
95 Ga0070704_100737768 3300005549 Bacteria 876
96 Ga0068855_100011695 3300005563 Bacteria 10605
97 Ga0068855_100117917 3300005563 Bacteria 3040
98 Ga0068855_100141459 3300005563 Bacteria 2742
99 Ga0068855_101998876 3300005563 Bacteria 585
100 Ga0068855_102290455 3300005563 Bacteria 541
101 Ga0070664_101005214 3300005564 Bacteria 784
102 Ga0068857_100051462 3300005577 Bacteria 3654
103 Ga0068854_100144116 3300005578 Bacteria 1831
104 Ga0068854_100475680 3300005578 Bacteria 1048
105 Ga0068856_100175881 3300005614 Bacteria 2153
106 Ga0068856_100423804 3300005614 Bacteria 1351
107 Ga0068856_100534318 3300005614 Bacteria 1194
108 Ga0070702_100972572 3300005615 Bacteria 670
109 Ga0068852_100228219 3300005616 Bacteria 1774
110 Ga0068852_100860164 3300005616 Bacteria 923
111 Ga0068852_102054068 3300005616 Unclassified 593
112 Ga0068859_101029638 3300005617 Bacteria 905
113 Ga0068864_100413495 3300005618 Bacteria 1284
114 Ga0068864_100569293 3300005618 Bacteria 1097
115 Ga0068864_101158656 3300005618 Bacteria 771
116 Ga0068861_102063060 3300005719 Bacteria 570
117 Ga0068851_10514720 3300005834 Bacteria 719
118 Ga0068851_10681792 3300005834 Bacteria 631
119 Ga0068851_10998605 3300005834 Bacteria 528
120 Ga0068870_10764208 3300005840 Bacteria 672
121 Ga0068863_100266678 3300005841 Bacteria 1656
122 Ga0068863_100342384 3300005841 Bacteria 1455
123 Ga0068863_100376646 3300005841 Bacteria 1385
124 Ga0068863_101198272 3300005841 Bacteria 765
125 Ga0068858_100296627 3300005842 Bacteria 1542
126 Ga0068858_100650869 3300005842 Bacteria 1024
127 Ga0068860_100722632 3300005843 Bacteria 1006
128 Ga0068862_100933399 3300005844 Bacteria 855
129 Ga0081455_10164221 3300005937 Bacteria 1698
130 Ga0081538_10103418 3300005981 Bacteria 1425
131 Ga0081540_1040042 3300005983 Bacteria 2448
132 Ga0081539_10031363 3300005985 Bacteria 3277
133 Ga0075365_10013809 3300006038 Bacteria 4845
134 Ga0075365_10108867 3300006038 Bacteria 1903
135 Ga0075365_10180008 3300006038 Bacteria 1478
136 Ga0075365_10481332 3300006038 Bacteria 877
137 Ga0075368_10092455 3300006042 Bacteria 1238
138 Ga0075368_10098359 3300006042 Bacteria 1200
139 Ga0075363_100002549 3300006048 Bacteria 7479
140 Ga0075363_100038813 3300006048 Bacteria 2505
141 Ga0075363_100921637 3300006048 Bacteria 536
142 Ga0075364_10932228 3300006051 Bacteria 591
143 Ga0070715_10371455 3300006163 Bacteria 787
144 Ga0070712_100928423 3300006175 Bacteria 751
145 Ga0075367_10056557 3300006178 Bacteria 2330
146 Ga0075367_10435230 3300006178 Bacteria 831
147 Ga0075367_10478421 3300006178 Bacteria 789
148 Ga0075369_10021798 3300006186 Bacteria 2637
149 Ga0075369_10026612 3300006186 Bacteria 2412
150 Ga0075366_10481588 3300006195 Bacteria 767
151 Ga0075366_10894454 3300006195 Bacteria 553
152 Ga0097621_100385326 3300006237 Bacteria 1253
153 Ga0097621_100722979 3300006237 Bacteria 918
154 Ga0097621_101033396 3300006237 Bacteria 770
155 Ga0097621_101862147 3300006237 Bacteria 574
156 Ga0075370_10008373 3300006353 Bacteria 5320
157 Ga0075370_10009299 3300006353 Bacteria 5100
158 Ga0075370_10085642 3300006353 Bacteria 1814
159 Ga0068871_100364893 3300006358 Bacteria 1280
160 Ga0068871_100457514 3300006358 Bacteria 1145
161 Ga0068871_101402810 3300006358 Bacteria 659
162 Ga0068865_100094141 3300006881 Bacteria 2179
163 Ga0068865_100124095 3300006881 Bacteria 1925
164 Ga0068865_100208689 3300006881 Bacteria 1521
165 Ga0068865_100344292 3300006881 Bacteria 1206
166 Ga0068865_101260261 3300006881 Bacteria 656
167 Ga0097620_101029638 3300006931 Bacteria 905
168 Ga0075435_100663332 3300007076 Bacteria 906
169 Ga0099794_10069448 3300007265 Bacteria 1724
170 Ga0099794_10197348 3300007265 Bacteria 1030
171 Ga0099794_10349792 3300007265 Bacteria 769
172 Ga0099795_10113860 3300007788 Bacteria 1075
173 Ga0099795_10419661 3300007788 Bacteria 611
174 Ga0105240_10018404 3300009093 Bacteria 9380
175 Ga0105240_10132174 3300009093 Bacteria 2993
176 Ga0105245_10024626 3300009098 Bacteria 5287
177 Ga0105245_10497410 3300009098 Bacteria 1235
178 Ga0105245_11048984 3300009098 Bacteria 860
179 Ga0105247_10130481 3300009101 Bacteria 1638
180 Ga0105247_10687782 3300009101 Bacteria 768
181 Ga0105247_11407985 3300009101 Bacteria 564
182 Ga0105243_10231613 3300009148 Bacteria 1639
183 Ga0105243_10665145 3300009148 Bacteria 1011
184 Ga0105241_10378005 3300009174 Bacteria 1237
185 Ga0105241_10455368 3300009174 Bacteria 1133
186 Ga0105241_10503413 3300009174 Bacteria 1080
187 Ga0105241_11160216 3300009174 Bacteria 730
188 Ga0105242_10156126 3300009176 Bacteria 1993
189 Ga0105242_10482555 3300009176 Bacteria 1175
190 Ga0105242_11144765 3300009176 Bacteria 794
191 Ga0105242_11301689 3300009176 Bacteria 750
192 Ga0105248_10112722 3300009177 Bacteria 3067
193 Ga0105248_10516191 3300009177 Bacteria 1347
194 Ga0105237_10012739 3300009545 Bacteria 8846
195 Ga0105237_10243938 3300009545 Bacteria 1798
196 Ga0105237_10408829 3300009545 Bacteria 1362
197 Ga0105237_10734363 3300009545 Bacteria 994
198 Ga0105237_11047400 3300009545 Bacteria 823
199 Ga0105237_11393697 3300009545 Bacteria 707
200 Ga0105238_10041149 3300009551 Bacteria 4681
201 Ga0105238_10060230 3300009551 Bacteria 3801
202 Ga0105238_10273122 3300009551 Bacteria 1671
203 Ga0105238_10611943 3300009551 Bacteria 1098
204 Ga0105238_11610176 3300009551 Bacteria 679
205 Ga0105238_12272899 3300009551 Bacteria 577
206 Ga0105238_12796583 3300009551 Bacteria 524
207 Ga0105249_10538166 3300009553 Bacteria 1217
208 Ga0105249_11732636 3300009553 Bacteria 697
209 Ga0105249_12090307 3300009553 Bacteria 639
210 Ga0105239_10070304 3300010375 Bacteria 3845
211 Ga0105239_10272054 3300010375 Bacteria 1905
212 Ga0105239_10286189 3300010375 Bacteria 1856
213 Ga0105239_10416534 3300010375 Bacteria 1521
214 Ga0105239_11856287 3300010375 Bacteria 699
215 Ga0105246_10013250 3300011119 Bacteria 5164
216 Ga0105246_10175355 3300011119 Bacteria 1646
217 Ga0105246_10717719 3300011119 Bacteria 878
218 Ga0105246_11544214 3300011119 Bacteria 625
219 Ga0105246_11913015 3300011119 Bacteria 570
220 Ga0157341_1038858 3300012494 Bacteria 544
221 Ga0157373_10793337 3300013100 Bacteria 698
222 Ga0157370_10035076 3300013104 Bacteria 4880
223 Ga0157370_10807551 3300013104 Bacteria 853
224 Ga0157369_10034915 3300013105 Bacteria 5515
225 Ga0157369_10407198 3300013105 Bacteria 1411
226 Ga0157369_10702505 3300013105 Bacteria 1041
227 Ga0157374_10453952 3300013296 Bacteria 1283
228 Ga0157374_12298788 3300013296 Bacteria 566
229 Ga0157378_10010981 3300013297 Bacteria 7926
230 Ga0157378_10274843 3300013297 Bacteria 1622
231 Ga0157378_10508336 3300013297 Bacteria 1204
232 Ga0157378_10901629 3300013297 Bacteria 915
233 Ga0157378_10970053 3300013297 Bacteria 883
234 Ga0157378_12586777 3300013297 Bacteria 560
235 Ga0163162_10050813 3300013306 Bacteria 4158
236 Ga0163162_10884742 3300013306 Bacteria 1007
237 Ga0163162_11005945 3300013306 Bacteria 943
238 Ga0163162_11524478 3300013306 Bacteria 762
239 Ga0163162_12385246 3300013306 Bacteria 608
240 Ga0157375_10071766 3300013308 Bacteria 3477
241 Ga0157375_10233563 3300013308 Bacteria 1998
242 Ga0157375_10289390 3300013308 Bacteria 1801
243 Ga0157375_10847240 3300013308 Bacteria 1061
244 Ga0157375_11806423 3300013308 Bacteria 725
245 Ga0163163_10029693 3300014325 Bacteria 5261
246 Ga0163163_10129877 3300014325 Bacteria 2559
247 Ga0163163_10466641 3300014325 Bacteria 1323
248 Ga0163163_10678025 3300014325 Bacteria 1094
249 Ga0163163_11242954 3300014325 Bacteria 807
250 Ga0163163_12298040 3300014325 Bacteria 598
251 Ga0163163_12315031 3300014325 Bacteria 596
252 Ga0157380_10594678 3300014326 Bacteria 1093
253 Ga0157380_10768167 3300014326 Bacteria 977
254 Ga0157380_12663067 3300014326 Bacteria 566
255 Ga0157379_10319230 3300014968 Bacteria 1418
256 Ga0157379_10495748 3300014968 Bacteria 1132
257 Ga0157379_11580556 3300014968 Bacteria 640
258 Ga0157379_11718648 3300014968 Bacteria 615
259 Ga0157379_11982230 3300014968 Bacteria 575
260 Ga0157379_12094132 3300014968 Bacteria 560
261 Ga0157376_10014758 3300014969 Bacteria 5876
262 Ga0157376_10100168 3300014969 Bacteria 2529
263 Ga0157376_10419030 3300014969 Bacteria 1299
264 Ga0157376_11996431 3300014969 Bacteria 618
265 Ga0163161_10086127 3300017792 Bacteria 2319
266 Ga0209564_1030145 3300025295 Bacteria 1687
267 Ga0209256_1099404 3300025299 Bacteria 605
268 Ga0207426_1002773 3300025302 Bacteria 10549
269 Ga0207426_1007634 3300025302 Bacteria 4497
270 Ga0207692_10297647 3300025898 Bacteria 981
271 Ga0207710_10746721 3300025900 Bacteria 514
272 Ga0207680_10683545 3300025903 Bacteria 735
273 Ga0207647_10517568 3300025904 Bacteria 664
274 Ga0207643_10270617 3300025908 Bacteria 1051
275 Ga0207705_10156161 3300025909 Bacteria 1712
276 Ga0207684_11030480 3300025910 Bacteria 687
277 Ga0207654_10264258 3300025911 Bacteria 1158
278 Ga0207654_10607996 3300025911 Bacteria 780
279 Ga0207707_10064122 3300025912 Bacteria 3198
280 Ga0207707_10296463 3300025912 Bacteria 1399
281 Ga0207707_10829420 3300025912 Bacteria 769
282 Ga0207671_10070454 3300025914 Bacteria 2607
283 Ga0207671_10351919 3300025914 Bacteria 1168
284 Ga0207671_11238839 3300025914 Bacteria 583
285 Ga0207671_11300282 3300025914 Bacteria 566
286 Ga0207693_10789696 3300025915 Bacteria 732
287 Ga0207663_10229264 3300025916 Bacteria 1356
288 Ga0207663_10488418 3300025916 Bacteria 955
289 Ga0207660_10018427 3300025917 Bacteria 4653
290 Ga0207660_11100922 3300025917 Bacteria 647
291 Ga0207657_10021019 3300025919 Bacteria 6153
292 Ga0207649_10208243 3300025920 Bacteria 1386
293 Ga0207652_10046466 3300025921 Bacteria 3704
294 Ga0207652_10744886 3300025921 Bacteria 872
295 Ga0207652_11210324 3300025921 Bacteria 657
296 Ga0207652_11520710 3300025921 Bacteria 573
297 Ga0207694_10056784 3300025924 Bacteria 3041
298 Ga0207694_10128231 3300025924 Bacteria 2031
299 Ga0207687_10024625 3300025927 Bacteria 4023
300 Ga0207687_10676143 3300025927 Bacteria 875
301 Ga0207687_11484447 3300025927 Bacteria 582
302 Ga0207700_10195699 3300025928 Bacteria 1701
303 Ga0207700_11339459 3300025928 Bacteria 637
304 Ga0207644_10229896 3300025931 Bacteria 1473
305 Ga0207644_10311440 3300025931 Bacteria 1271
306 Ga0207644_11352368 3300025931 Bacteria 598
307 Ga0207690_10961096 3300025932 Bacteria 710
308 Ga0207706_10378444 3300025933 Bacteria 1229
309 Ga0207686_10204516 3300025934 Bacteria 1416
310 Ga0207686_11193854 3300025934 Bacteria 623
311 Ga0207686_11284991 3300025934 Bacteria 600
312 Ga0207709_11196390 3300025935 Bacteria 626
313 Ga0207670_10362810 3300025936 Bacteria 1150
314 Ga0207670_11472910 3300025936 Bacteria 578
315 Ga0207669_10055936 3300025937 Bacteria 2393
316 Ga0207704_10100617 3300025938 Bacteria 1926
317 Ga0207704_10300664 3300025938 Bacteria 1229
318 Ga0207665_10272277 3300025939 Bacteria 1258
319 Ga0207691_11318892 3300025940 Bacteria 596
320 Ga0207691_11668851 3300025940 Bacteria 516
321 Ga0207711_10077644 3300025941 Bacteria 2895
322 Ga0207711_10650076 3300025941 Bacteria 984
323 Ga0207711_10743477 3300025941 Bacteria 914
324 Ga0207711_10983237 3300025941 Bacteria 783
325 Ga0207689_11609039 3300025942 Bacteria 540
326 Ga0207661_10044310 3300025944 Bacteria 3516
327 Ga0207661_10269239 3300025944 Bacteria 1520
328 Ga0207679_10039717 3300025945 Bacteria 3363
329 Ga0207679_10280723 3300025945 Bacteria 1428
330 Ga0207679_10485131 3300025945 Bacteria 1101
331 Ga0207679_11797003 3300025945 Bacteria 560
332 Ga0207679_12008091 3300025945 Bacteria 526
333 Ga0207667_10037598 3300025949 Bacteria 5173
334 Ga0207667_10802129 3300025949 Bacteria 938
335 Ga0207667_11990483 3300025949 Bacteria 541
336 Ga0207651_10365634 3300025960 Bacteria 1219
337 Ga0207651_10612276 3300025960 Bacteria 953
338 Ga0207712_11571164 3300025961 Bacteria 589
339 Ga0207668_10065215 3300025972 Bacteria 2577
340 Ga0207668_10527596 3300025972 Bacteria 1020
341 Ga0207668_11643169 3300025972 Bacteria 580
342 Ga0207668_11713240 3300025972 Bacteria 567
343 Ga0207640_10235065 3300025981 Bacteria 1412
344 Ga0207658_10749478 3300025986 Bacteria 884
345 Ga0207658_11631916 3300025986 Bacteria 589
346 Ga0207677_10032765 3300026023 Bacteria 3344
347 Ga0207677_10329956 3300026023 Bacteria 1271
348 Ga0207703_10352317 3300026035 Bacteria 1355
349 Ga0207639_10031835 3300026041 Bacteria 3878
350 Ga0207639_10337881 3300026041 Bacteria 1342
351 Ga0207639_10700631 3300026041 Bacteria 939
352 Ga0207678_10011180 3300026067 Bacteria 7883
353 Ga0207678_10043207 3300026067 Bacteria 3901
354 Ga0207678_10068408 3300026067 Bacteria 3047
355 Ga0207678_10081377 3300026067 Bacteria 2772
356 Ga0207678_10408032 3300026067 Bacteria 1177
357 Ga0207678_10861223 3300026067 Bacteria 801
358 Ga0207678_10862575 3300026067 Bacteria 800
359 Ga0207708_11272946 3300026075 Bacteria 644
360 Ga0207702_10579547 3300026078 Bacteria 1100
361 Ga0207702_10739716 3300026078 Bacteria 971
362 Ga0207641_10332460 3300026088 Bacteria 1444
363 Ga0207641_10697841 3300026088 Bacteria 999
364 Ga0207641_11502070 3300026088 Bacteria 675
365 Ga0207648_10500479 3300026089 Bacteria 1112
366 Ga0207648_11038522 3300026089 Bacteria 768
367 Ga0207648_11190356 3300026089 Bacteria 716
368 Ga0207676_10109249 3300026095 Bacteria 2311
369 Ga0207676_10908533 3300026095 Bacteria 864
370 Ga0207674_10126828 3300026116 Bacteria 2518
371 Ga0207675_102234416 3300026118 Bacteria 562
372 Ga0207683_10051095 3300026121 Bacteria 3622
373 Ga0207683_10160115 3300026121 Bacteria 2034
374 Ga0207683_10200387 3300026121 Bacteria 1814
375 Ga0207683_10505736 3300026121 Bacteria 1116
376 Ga0207698_10041587 3300026142 Bacteria 3426
377 Ga0207698_10226506 3300026142 Bacteria 1694
378 Ga0207698_11856875 3300026142 Bacteria 617
379 Ga0209588_1038760 3300027671 Bacteria 1536
380 Ga0209813_10041476 3300027866 Bacteria 1403
381 Ga0209813_10225265 3300027866 Bacteria 703
382 Ga0209813_10412780 3300027866 Bacteria 546
383 Ga0268266_10000951 3300028379 Bacteria 36935
384 Ga0268266_10058052 3300028379 Bacteria 3332
385 Ga0268266_10302052 3300028379 Bacteria 1493
386 Ga0268266_10907570 3300028379 Bacteria 852
387 Ga0268264_10000022 3300028381 Bacteria 476624
388 Ga0268264_10970473 3300028381 Bacteria 855
389 Ga0268264_11173148 3300028381 Bacteria 777
390 Ga0268264_11766700 3300028381 Bacteria 629
391 Ga0307515_10049717 3300028794 Bacteria 6298
392 Ga0307515_10260700 3300028794 Bacteria 1470
393 Ga0307515_10714455 3300028794 Bacteria 619
394 Ga0307515_10838904 3300028794 Bacteria 545
395 Ga0307511_10400044 3300030521 Bacteria 565
396 Ga0265763_1009226 3300030763 Bacteria 893
397 Ga0265770_1146598 3300030878 Bacteria 515
398 Ga0265768_104851 3300030963 Bacteria 768
399 Ga0265768_109342 3300030963 Bacteria 619
400 Ga0265773_1037946 3300031018 Bacteria 542
401 Ga0265773_1049542 3300031018 Bacteria 500
402 Ga0265330_10062556 3300031235 Bacteria 1618
403 Ga0265330_10136062 3300031235 Bacteria 1045
404 Ga0265332_10018173 3300031238 Bacteria 3101
405 Ga0265332_10095848 3300031238 Bacteria 1253
406 Ga0265328_10402167 3300031239 Bacteria 537
407 Ga0265329_10222595 3300031242 Bacteria 625
408 Ga0265340_10003276 3300031247 Bacteria 9176
409 Ga0265339_10159146 3300031249 Bacteria 1137
410 Ga0265331_10131128 3300031250 Bacteria 1143
411 Ga0265331_10207500 3300031250 Bacteria 882
412 Ga0265331_10336256 3300031250 Bacteria 676
413 Ga0265316_10553254 3300031344 Bacteria 819
414 Ga0307513_10256828 3300031456 Bacteria 1540
415 Ga0307513_10464086 3300031456 Bacteria 989
416 Ga0307513_10765441 3300031456 Bacteria 671
417 Ga0307509_10321969 3300031507 Bacteria 1282
418 Ga0307509_10337441 3300031507 Bacteria 1236
419 Ga0307408_100488110 3300031548 Bacteria 1076
420 Ga0307508_10000001 3300031616 Bacteria 553635
421 Ga0307508_10035326 3300031616 Bacteria 4505
422 Ga0307508_10066155 3300031616 Bacteria 3183
423 Ga0307508_10114872 3300031616 Bacteria 2293
424 Ga0307508_10235537 3300031616 Bacteria 1429
425 Ga0310111_138504 3300031667 Bacteria 539
426 Ga0265314_10310495 3300031711 Bacteria 881
427 Ga0265342_10116106 3300031712 Bacteria 1511
428 Ga0265342_10534231 3300031712 Bacteria 596
429 Ga0307516_10002141 3300031730 Bacteria 26772
430 Ga0307516_10021175 3300031730 Bacteria 6701
431 Ga0307410_11550232 3300031852 Bacteria 584
432 Ga0307407_10618249 3300031903 Bacteria 808
433 Ga0307416_100328953 3300032002 Bacteria 1535
434 Ga0307414_11905509 3300032004 Bacteria 555
435 Ga0307411_10553621 3300032005 Bacteria 982
436 Ga0307510_10016586 3300033180 Bacteria 8695
437 Ga0307510_10030555 3300033180 Bacteria 6105
438 Ga0307510_10547822 3300033180 Bacteria 603
439 Ga0373930_0005832 3300034816 Bacteria 2061
440 Ga0373938_0078962 3300034957 Bacteria 798
441 Ga0373929_0037615 3300035085 Bacteria 1062
442 Ga0373940_0252916 3300035088 Bacteria 594
443 Ga0373944_0103056 3300035089 Bacteria 966
444 Ga0373949_0109289 3300035090 Bacteria 766
445 Ga0373949_0121359 3300035090 Bacteria 734
446 Ga0373923_0010882 3300035111 Bacteria 3323
447 Ga0373936_0009619 3300035113 Bacteria 3642
448 Ga0373936_0106618 3300035113 Bacteria 1187
449 Ga0373936_0310319 3300035113 Bacteria 713
450 Ga0373941_0081552 3300035115 Bacteria 1093
451 Ga0373945_0180231 3300035116 Bacteria 869
452 Ga0373953_0006214 3300035117 Bacteria 3922
453 Ga0373956_0056474 3300035119 Bacteria 1772
454 Ga0373957_0051852 3300035120 Bacteria 1570
455 Ga0373957_0152860 3300035120 Bacteria 948
456 Ga0373943_0018283 3300035170 Bacteria 3218
457 Ga0373946_0019787 3300035171 Bacteria 2597
458 Ga0373955_0090902 3300035172 Bacteria 1739
459 Ga0373955_0099626 3300035172 Bacteria 1666
460 Ga0373942_0137388 3300035207 Bacteria 776
461 Ga0373962_0126761 3300035242 Bacteria 819
462 Ga0373931_0002926 3300035691 Bacteria 7619
463 Ga0373931_0578857 3300035691 Bacteria 732
464 Ga0373935_0007714 3300035692 Bacteria 6449
465 Ga0373935_0333426 3300035692 Bacteria 1079
466 Ga0373927_0003072 3300035695 Bacteria 12100
467 Ga0373927_0089135 3300035695 Bacteria 2003
468 Ga0373927_0772947 3300035695 Bacteria 634
469 Ga0373933_0018065 3300035724 Bacteria 3961
470 Ga0373947_0001820 3300035725 Bacteria 13046
471 Ga0373947_0445069 3300035725 Bacteria 877
472 Ga0373947_0922944 3300035725 Bacteria 596
473 Ga0310104_06677 3300036242 Bacteria 976
474 Ga0373937_0015418 3300036401 Bacteria 6757
475 Ga0373937_0090156 3300036401 Bacteria 2839
476 Ga0373937_0797502 3300036401 Bacteria 892
477 Ga0265778_036339 3300036457 Bacteria 649
478 Ga0310112_022196 3300036458 Bacteria 887
479 Ga0310112_062193 3300036458 Bacteria 504
480 Ga0372808_013555 3300036459 Bacteria 1161
481 Ga0372808_040196 3300036459 Bacteria 671
482 Ga0310109_026198 3300036534 Bacteria 780
483 Ga0310109_035897 3300036534 Bacteria 650
484 Ga0310109_039782 3300036534 Bacteria 613
485 Ga0373925_0002588 3300037068 Bacteria 14382
486 Ga0373925_0044622 3300037068 Bacteria 3292
487 Ga0373925_0422470 3300037068 Bacteria 1089
488 Ga0373925_0981788 3300037068 Bacteria 696
489 Ga0395905_1417490 3300037471 Bacteria 599
490 Ga0436365_1151076 3300039437 Bacteria 2391
491 Ga0436365_1218047 3300039437 Bacteria 1524
492 Ga0439465_0337197 3300041413 Bacteria 568
493 Ga0451793_0500760 3300041452 Bacteria 512
494 Ga0451807_0231277 3300041486 Bacteria 633
495 Ga0451837_1456358 3300041494 Bacteria 747
496 Ga0451841_0515919 3300041498 Bacteria 507
497 Ga0451845_0877925 3300041501 Bacteria 502
498 Ga0451847_0531047 3300041503 Bacteria 858
499 Ga0451851_0943936 3300041507 Bacteria 808
500 Ga0451843_0094426 3300041509 Bacteria 558
501 Ga0451855_1030746 3300041511 Bacteria 728
502 Ga0451853_2459925 3300041512 Bacteria 529
503 Ga0439432_183807 3300042006 Bacteria 608
504 Ga0439446_0140299 3300042156 Bacteria 789
505 Ga0466972_0002947 3300044658 Bacteria 8439
506 Ga0466972_0287544 3300044658 Bacteria 768
507 Ga0466963_1114300 3300044694 Unclassified 555
508 Ga0466968_0005930 3300044735 Bacteria 4584
509 Ga0466960_0003317 3300044901 Bacteria 6179
510 Ga0466967_0533577 3300045976 Bacteria 1154
511 Ga0466967_0978674 3300045976 Bacteria 842
512 Ga0495617_011960 3300046452 Bacteria 2960
513 Ga0495592_0004679 3300046454 Bacteria 10030
514 Ga0495592_0010679 3300046454 Bacteria 6924
515 Ga0495592_0184866 3300046454 Bacteria 1417
516 Ga0495592_0812336 3300046454 Bacteria 555
517 Ga0495603_0000067 3300046455 Bacteria 45466
518 Ga0495603_0060084 3300046455 Bacteria 2246
519 Ga0495590_0021201 3300046457 Bacteria 2305
520 Ga0495629_0001667 3300046459 Bacteria 17433
521 Ga0495629_0017434 3300046459 Bacteria 5146
522 Ga0495638_0055502 3300046460 Bacteria 2459
523 Ga0495638_0188705 3300046460 Bacteria 1171
524 Ga0495638_0211886 3300046460 Bacteria 1088
525 Ga0495638_0515833 3300046460 Bacteria 599
526 Ga0495641_0003314 3300046461 Bacteria 12135
527 Ga0495651_0002792 3300046462 Bacteria 13540
528 Ga0495653_0003251 3300046463 Bacteria 13038
529 Ga0495653_0441776 3300046463 Bacteria 820
530 Ga0495580_0031815 3300046472 Bacteria 3810
531 Ga0495582_0000744 3300046473 Bacteria 18014
532 Ga0495605_0383069 3300046474 Bacteria 587
533 Ga0495605_0482429 3300046474 Bacteria 508
534 Ga0495639_0001360 3300046475 Bacteria 10978
535 Ga0495639_0303232 3300046475 Bacteria 797
536 Ga0495639_0638141 3300046475 Bacteria 549
537 Ga0495662_0007547 3300046476 Bacteria 5368
538 Ga0495664_0777338 3300046477 Bacteria 564
539 Ga0495584_0337987 3300046491 Bacteria 765
540 Ga0495585_0033897 3300046492 Bacteria 2888
541 Ga0495585_0106773 3300046492 Bacteria 1492
542 Ga0495594_0009145 3300046499 Bacteria 5112
543 Ga0495583_0117389 3300046506 Bacteria 1123
544 Ga0495583_0134729 3300046506 Bacteria 1032
545 Ga0495606_0275850 3300046507 Bacteria 921
546 Ga0495606_0331037 3300046507 Bacteria 815
547 Ga0495608_0003162 3300046511 Bacteria 11774
548 Ga0495608_0549210 3300046511 Bacteria 696
549 Ga0495610_0039045 3300046512 Bacteria 2404
550 Ga0495610_0118425 3300046512 Bacteria 1164
551 Ga0495610_0142481 3300046512 Bacteria 1030
552 Ga0495616_0138805 3300046513 Bacteria 1108
553 Ga0495616_0219399 3300046513 Bacteria 829
554 Ga0495618_0041879 3300046514 Bacteria 2885
555 Ga0495628_0083080 3300046516 Bacteria 2487
556 Ga0495628_0197939 3300046516 Bacteria 1515
557 Ga0495630_0019651 3300046517 Bacteria 4968
558 Ga0495630_0403692 3300046517 Bacteria 1047
559 Ga0495630_1139896 3300046517 Bacteria 591
560 Ga0495631_0022504 3300046518 Bacteria 2930
561 Ga0495637_0092270 3300046520 Bacteria 1193
562 Ga0495643_0168676 3300046522 Bacteria 1072
563 Ga0495648_0080224 3300046524 Bacteria 1860
564 Ga0495648_0102525 3300046524 Bacteria 1576
565 Ga0495666_0081025 3300046526 Bacteria 1536
566 Ga0495666_0084345 3300046526 Bacteria 1501
567 Ga0495652_0063052 3300046529 Bacteria 3122
568 Ga0495652_0082595 3300046529 Bacteria 2647
569 Ga0495652_0316973 3300046529 Bacteria 1128
570 Ga0495652_0366519 3300046529 Bacteria 1028
571 Ga0495654_0071733 3300046530 Bacteria 1640
572 Ga0495665_0000307 3300046531 Bacteria 24786
573 Ga0495640_0016203 3300046533 Bacteria 5580
574 Ga0495640_0216997 3300046533 Bacteria 1207
575 Ga0495586_0923680 3300046535 Bacteria 503
576 Ga0495587_0182478 3300046536 Bacteria 1189
577 Ga0495587_0503169 3300046536 Bacteria 670
578 Ga0495597_0112347 3300046542 Bacteria 1141
579 Ga0495597_0185613 3300046542 Bacteria 838
580 Ga0495645_0287622 3300046543 Bacteria 1079
581 Ga0495645_0359043 3300046543 Bacteria 937
582 Ga0495622_0025886 3300046557 Bacteria 2741
583 Ga0495622_0096124 3300046557 Bacteria 1359
584 Ga0495667_0037917 3300046559 Bacteria 3211
585 Ga0495656_0153373 3300046615 Bacteria 1114
586 Ga0495656_0669689 3300046615 Bacteria 557
587 Ga0495668_0031702 3300046616 Bacteria 2979
588 Ga0495668_0162698 3300046616 Bacteria 1222
589 Ga0495668_0251904 3300046616 Bacteria 967
590 Ga0495668_0865044 3300046616 Bacteria 501
591 Ga0495634_0005834 3300046642 Bacteria 9398
592 Ga0495634_0012063 3300046642 Bacteria 6264
593 Ga0495611_0182619 3300046648 Bacteria 980
594 Ga0495611_0540167 3300046648 Bacteria 528
595 Ga0495625_0110684 3300046660 Bacteria 1877
596 Ga0495625_0155073 3300046660 Bacteria 1537
597 Ga0495625_0274308 3300046660 Bacteria 1087
598 Ga0495625_0742793 3300046660 Bacteria 576
599 Ga0495635_0000230 3300046663 Bacteria 35642
600 Ga0495635_0001592 3300046663 Bacteria 15276
601 Ga0495635_0730470 3300046663 Bacteria 641
602 Ga0495635_0806027 3300046663 Bacteria 605
603 Ga0495635_1075107 3300046663 Bacteria 510
604 Ga0495659_0006340 3300046664 Bacteria 3738
605 Ga0495588_0093733 3300046674 Bacteria 1574
606 Ga0495588_0141359 3300046674 Bacteria 1272
607 Ga0495588_0284579 3300046674 Bacteria 871
608 Ga0495657_0019646 3300046675 Bacteria 4871
609 Ga0495599_0003970 3300046678 Bacteria 8710
610 Ga0495599_0034785 3300046678 Bacteria 3164
611 Ga0495623_0626562 3300046679 Bacteria 556
612 Ga0495646_0011572 3300046680 Bacteria 5603
613 Ga0495646_0185581 3300046680 Bacteria 1139
614 Ga0495647_0001173 3300046681 Bacteria 8061
615 Ga0495647_0145903 3300046681 Bacteria 1012
616 Ga0495658_0000520 3300046683 Bacteria 21077
617 Ga0495669_0157650 3300046684 Bacteria 1076
618 Ga0495613_0038005 3300046689 Bacteria 3568
619 Ga0495613_0097036 3300046689 Bacteria 2131
620 Ga0495613_0448507 3300046689 Bacteria 874
621 Ga0495624_0020438 3300046690 Bacteria 4406
622 Ga0495670_0003109 3300046691 Bacteria 8182
623 Ga0495671_0093738 3300046692 Bacteria 1469
624 Ga0495649_0566949 3300046694 Bacteria 561
625 Ga0495649_0588446 3300046694 Bacteria 549
626 Ga0495589_0112151 3300046794 Bacteria 1316
627 Ga0495600_0004716 3300046809 Bacteria 8181
628 Ga0495600_0245468 3300046809 Bacteria 1140
629 Ga0495600_0923392 3300046809 Bacteria 514
630 Ga0495581_0000022 3300047315 Bacteria 56149
631 Ga0495581_0206596 3300047315 Bacteria 1149
632 Ga0495581_0261632 3300047315 Bacteria 1012
633 Ga0495604_0004194 3300047317 Bacteria 11424
634 Ga0495674_0001816 3300047319 Bacteria 21040
635 Ga0495674_0008381 3300047319 Bacteria 9849
636 Ga0495674_0240261 3300047319 Bacteria 1493
637 Ga0495672_0023877 3300047320 Bacteria 3950
638 Ga0495672_0024111 3300047320 Bacteria 3926
639 Ga0495672_0126330 3300047320 Bacteria 1352
640 Ga0495676_0123031 3300047321 Bacteria 1884
641 Ga0495676_0174994 3300047321 Bacteria 1508
642 Ga0495680_0011451 3300047322 Bacteria 7852
643 Ga0495680_0363979 3300047322 Bacteria 1004
644 Ga0495683_0051610 3300047323 Bacteria 2055
645 Ga0495675_0001005 3300047444 Bacteria 17160
646 Ga0495679_115800 3300047446 Bacteria 736
647 Ga0495685_037620 3300047447 Bacteria 1659
648 Ga0495673_0086629 3300047469 Bacteria 1287
649 Ga0495673_0099576 3300047469 Bacteria 1177
650 Ga0495681_0388230 3300047470 Bacteria 524
651 Ga0495684_0078668 3300047471 Bacteria 2503
652 Ga0495593_0000016 3300047673 Bacteria 80178
653 Ga0495593_0002243 3300047673 Bacteria 11592
654 Ga0495602_0023393 3300048088 Bacteria 6021
655 Ga0495602_1015168 3300048088 Bacteria 547
656 Ga0495614_0024357 3300048089 Bacteria 2613
657 Ga0495626_0093542 3300048091 Bacteria 1319
658 Ga0496100_0014273 3300048903 Bacteria 4609
659 Ga0496100_0044857 3300048903 Bacteria 2834
660 Ga0496100_0061540 3300048903 Bacteria 2474
661 Ga0496101_0036493 3300048904 Bacteria 3482
662 Ga0496101_0201852 3300048904 Bacteria 1537
663 Ga0496101_0267419 3300048904 Bacteria 1334
664 Ga0496102_0047584 3300048905 Bacteria 3899
665 Ga0496102_0055990 3300048905 Bacteria 3596
666 Ga0496102_0165484 3300048905 Bacteria 2081
667 Ga0496102_0495915 3300048905 Bacteria 1143
668 Ga0496102_0741326 3300048905 Bacteria 905
669 Ga0496102_1066581 3300048905 Bacteria 728
670 Ga0496102_1392180 3300048905 Bacteria 620
671 Ga0496102_1738578 3300048905 Bacteria 541
672 Ga0496103_0116937 3300048906 Bacteria 1697
673 Ga0496103_0791906 3300048906 Bacteria 598
674 Ga0496103_0954574 3300048906 Bacteria 535
675 Ga0496104_0031531 3300048907 Bacteria 4929
676 Ga0496104_0032314 3300048907 Bacteria 4870
677 Ga0496104_0056952 3300048907 Bacteria 3698
678 Ga0496104_0253277 3300048907 Bacteria 1673
679 Ga0496104_1568453 3300048907 Bacteria 561
680 Ga0496105_0011247 3300048908 Bacteria 7062
681 Ga0496105_0020951 3300048908 Bacteria 5287
682 Ga0496105_0389856 3300048908 Bacteria 1107
683 Ga0496106_0026827 3300048909 Bacteria 4290
684 Ga0496106_0031902 3300048909 Bacteria 3926
685 Ga0496106_0046979 3300048909 Bacteria 3247
686 Ga0496106_0435018 3300048909 Bacteria 1054
687 Ga0496107_0014561 3300048910 Bacteria 5505
688 Ga0496107_0169046 3300048910 Bacteria 1622
689 Ga0496108_0043218 3300048911 Bacteria 3764
690 Ga0496108_0094038 3300048911 Bacteria 2551
691 Ga0496108_0490131 3300048911 Bacteria 1073
692 Ga0496108_0615137 3300048911 Bacteria 946
693 Ga0496109_0028587 3300048912 Bacteria 4987
694 Ga0496109_0038696 3300048912 Bacteria 4313
695 Ga0496109_0161278 3300048912 Bacteria 2101
696 Ga0496109_0570771 3300048912 Bacteria 1066
697 Ga0496110_0053465 3300048913 Bacteria 3551
698 Ga0496110_0088670 3300048913 Bacteria 2763
699 Ga0496110_1504467 3300048913 Bacteria 583
700 Ga0496111_0099650 3300048914 Bacteria 2134
701 Ga0496111_0130090 3300048914 Bacteria 1862
702 Ga0496111_0276131 3300048914 Bacteria 1247
703 Ga0496111_0299562 3300048914 Bacteria 1192
704 Ga0496111_0344774 3300048914 Bacteria 1103
705 Ga0496111_0718387 3300048914 Bacteria 726
706 Ga0496112_0010586 3300048915 Bacteria 8378
707 Ga0496112_0068948 3300048915 Bacteria 3493
708 Ga0496112_0559267 3300048915 Bacteria 1077
709 Ga0496112_0603281 3300048915 Bacteria 1030
710 Ga0496113_0033763 3300048916 Bacteria 3728
711 Ga0496113_0430197 3300048916 Bacteria 1060
712 Ga0496113_0489284 3300048916 Bacteria 988
713 Ga0496114_0024702 3300048917 Bacteria 4906
714 Ga0496114_0054153 3300048917 Bacteria 3346
715 Ga0496114_0141757 3300048917 Bacteria 2081
716 Ga0496114_0374728 3300048917 Bacteria 1260
717 Ga0496114_0481440 3300048917 Bacteria 1098
718 Ga0496115_0006501 3300048918 Bacteria 8570
719 Ga0496115_0017237 3300048918 Bacteria 5515
720 Ga0496115_0132938 3300048918 Bacteria 2051
721 Ga0496116_0001852 3300048919 Bacteria 22894
722 Ga0496116_0064344 3300048919 Bacteria 2358
723 Ga0496117_0248623 3300048920 Bacteria 971
724 Ga0496117_0541241 3300048920 Bacteria 556
725 Ga0496118_0142205 3300048921 Bacteria 1518
726 Ga0496119_0091208 3300048922 Bacteria 1731
727 Ga0496120_0061040 3300048923 Bacteria 2106
728 Ga0496121_0003622 3300048924 Bacteria 21784
729 Ga0496121_0021812 3300048924 Bacteria 6254
730 Ga0496121_0058140 3300048924 Bacteria 3199
731 Ga0496121_0079072 3300048924 Bacteria 2612
732 Ga0496121_0123652 3300048924 Bacteria 1949
733 Ga0496121_0257078 3300048924 Bacteria 1208
734 Ga0496122_0232375 3300048925 Bacteria 1047
735 Ga0496123_0164615 3300048926 Bacteria 1178
736 Ga0496123_0477315 3300048926 Bacteria 549
737 Ga0496125_0013225 3300048928 Bacteria 8126
738 Ga0496125_0059958 3300048928 Bacteria 3062
739 Ga0496125_0390002 3300048928 Bacteria 818
740 Ga0496126_0003918 3300048929 Bacteria 18248
741 Ga0496126_0022867 3300048929 Bacteria 6070
742 Ga0496126_0162705 3300048929 Bacteria 1906
743 Ga0496126_0191243 3300048929 Bacteria 1733
744 Ga0496126_0206267 3300048929 Bacteria 1657
745 Ga0496126_0282016 3300048929 Bacteria 1376
746 Ga0496126_0421113 3300048929 Bacteria 1079
747 Ga0496126_1038807 3300048929 Bacteria 612
748 Ga0495678_067495 3300049459 Bacteria 1321
749 Ga0495682_0185262 3300049460 Bacteria 739
750 Ga0501315_060822 3300049531 Bacteria 611
751 nmdc:mga03683_311918_c1 3300050489 Bacteria 739
752 nmdc:mga03n38_30616_c2 3300050490 Bacteria 586
753 nmdc:mga03n38_4045_c1 3300050490 Bacteria 4800
754 nmdc:mga03n38_41091_c1 3300050490 Bacteria 2013
755 nmdc:mga03n38_856146_c1 3300050490 Bacteria 532
756 nmdc:mga03n38_904321_c1 3300050490 Bacteria 519
757 nmdc:mga00v17_19275_c1 3300050491 Bacteria 3893
758 nmdc:mga00v17_458905_c1 3300050491 Bacteria 827
759 nmdc:mga00v17_916149_c1 3300050491 Bacteria 554
760 nmdc:mga0yw44_147071_c1 3300050492 Bacteria 1535
761 nmdc:mga0yw44_167125_c1 3300050492 Bacteria 1443
762 nmdc:mga0yw44_189271_c1 3300050492 Bacteria 1357
763 nmdc:mga0yw44_343682_c1 3300050492 Bacteria 1004
764 nmdc:mga0yw44_36131_c1 3300050492 Bacteria 2909
765 nmdc:mga0k408_118194_c1 3300050493 Bacteria 1569
766 nmdc:mga0k408_382734_c1 3300050493 Bacteria 838
767 nmdc:mga06z11_120038_c1 3300050494 Bacteria 1466
768 nmdc:mga06z11_471347_c1 3300050494 Bacteria 760
769 nmdc:mga06z11_62524_c1 3300050494 Bacteria 1945
770 nmdc:mga06z11_92545_c1 3300050494 Bacteria 1644
771 nmdc:mga06z11_986522_c1 3300050494 Bacteria 513
772 nmdc:mga04h51_216478_c1 3300050495 Bacteria 757
773 nmdc:mga04h51_231998_c1 3300050495 Bacteria 734
774 nmdc:mga04h51_23622_c1 3300050495 Bacteria 1873
775 nmdc:mga04h51_269530_c1 3300050495 Bacteria 687
776 nmdc:mga07m45_3883_c1 3300050496 Bacteria 7254
777 nmdc:mga07m45_447027_c1 3300050496 Bacteria 749
778 nmdc:mga07m45_53804_c1 3300050496 Bacteria 2275
779 nmdc:mga07m45_86964_c1 3300050496 Bacteria 1788
780 nmdc:mga0rr50_720424_c1 3300050513 Bacteria 851
781 nmdc:mga08x19_992255_c1 3300050514 Unclassified 596
782 nmdc:mga0sz30_27759_c1 3300050516 Bacteria 2326
783 nmdc:mga0sz30_593296_c1 3300050516 Bacteria 501
784 nmdc:mga0sz30_59677_c1 3300050516 Bacteria 1628
785 Ga0495601_0210254 3300053077 Bacteria 1271
786 Ga0495612_0093779 3300053078 Bacteria 1274
787 Ga0500635_0099609 3300053080 Bacteria 1067
788 Ga0495595_0001042 3300053084 Bacteria 10677
789 Ga0495595_0036630 3300053084 Bacteria 2227
790 Ga0495595_0060983 3300053084 Bacteria 1766
791 Ga0495619_0002925 3300053085 Bacteria 11103
792 Ga0495619_0069905 3300053085 Bacteria 2347
793 Ga0500643_012153 3300053087 Bacteria 3096
794 Ga0500644_0151700 3300053088 Bacteria 929
795 Ga0500646_0078978 3300053090 Bacteria 1001
796 Ga0500647_0197851 3300053091 Bacteria 913
797 Ga0500583_0111877 3300053092 Bacteria 1345
798 Ga0500651_0703078 3300053093 Bacteria 540
799 Ga0500566_0000047 3300053094 Bacteria 58577
800 Ga0500566_0000930 3300053094 Bacteria 16751
801 Ga0500566_0002386 3300053094 Bacteria 11113
802 Ga0500566_0095747 3300053094 Bacteria 1635
803 Ga0500640_001486 3300053095 Bacteria 7161
804 Ga0500641_0004333 3300053096 Bacteria 5007
805 Ga0500641_0014253 3300053096 Bacteria 2932
806 Ga0500650_0276304 3300053098 Bacteria 748
807 Ga0500650_0440191 3300053098 Bacteria 560
808 Ga0500554_073118 3300053102 Bacteria 1119
809 Ga0500555_090523 3300053103 Bacteria 786
810 Ga0500556_0000002 3300053104 Bacteria 773626
811 Ga0500556_0005914 3300053104 Bacteria 3465
812 Ga0500556_0424974 3300053104 Bacteria 507
813 Ga0500557_145960 3300053105 Bacteria 780
814 Ga0500562_050532 3300053108 Bacteria 1111
815 Ga0500562_132380 3300053108 Bacteria 680
816 Ga0500569_186771 3300053109 Bacteria 704
817 Ga0500572_000071 3300053111 Bacteria 32122
818 Ga0500591_034835 3300053115 Bacteria 2418
819 Ga0500592_024109 3300053116 Bacteria 980
820 Ga0500594_0035706 3300053118 Bacteria 1334
821 Ga0500595_007366 3300053119 Bacteria 4570
822 Ga0500595_020065 3300053119 Bacteria 2412
823 Ga0500607_115404 3300053121 Bacteria 1309
824 Ga0500608_014864 3300053122 Bacteria 3483
825 Ga0500614_000552 3300053123 Bacteria 9634
826 Ga0500621_268059 3300053126 Bacteria 564
827 Ga0500642_0000010 3300053130 Bacteria 272552
828 Ga0500642_0464607 3300053130 Bacteria 541
829 Ga0500652_000511 3300053131 Bacteria 13661
830 Ga0500655_052599 3300053133 Bacteria 813
831 Ga0500655_080920 3300053133 Bacteria 668
832 Ga0500658_0204496 3300053134 Bacteria 903
833 Ga0500559_0000919 3300053136 Bacteria 18725
834 Ga0500559_0005925 3300053136 Bacteria 5559
835 Ga0500559_0239828 3300053136 Bacteria 854
836 Ga0500564_254083 3300053138 Bacteria 695
837 Ga0500568_0000680 3300053139 Bacteria 24548
838 Ga0500568_0034974 3300053139 Bacteria 2052
839 Ga0500568_0053267 3300053139 Bacteria 1587
840 Ga0500568_0288571 3300053139 Bacteria 596
841 Ga0500577_0078346 3300053142 Bacteria 1312
842 Ga0500579_279576 3300053143 Bacteria 512
843 Ga0500588_0377568 3300053146 Bacteria 539
844 Ga0500588_0396907 3300053146 Bacteria 525
845 Ga0500589_112624 3300053147 Bacteria 1165
846 Ga0500590_172573 3300053148 Bacteria 949
847 Ga0500590_173935 3300053148 Bacteria 943
848 Ga0500590_232649 3300053148 Bacteria 749
849 Ga0500603_000190 3300053150 Bacteria 15991
850 Ga0500604_0009645 3300053151 Bacteria 2573
851 Ga0500604_0183312 3300053151 Bacteria 718
852 Ga0500622_0001697 3300053156 Bacteria 17095
853 Ga0500627_0057763 3300053158 Bacteria 1702
854 Ga0500627_0174424 3300053158 Bacteria 968
855 Ga0500627_0495969 3300053158 Bacteria 509
856 Ga0500630_001753 3300053159 Bacteria 10386
857 Ga0500633_0043029 3300053160 Bacteria 1527
858 Ga0500633_0260601 3300053160 Bacteria 643
859 Ga0500634_0168913 3300053161 Bacteria 999
860 Ga0500634_0352715 3300053161 Bacteria 561
861 Ga0500638_050493 3300053162 Bacteria 2011
862 Ga0500639_000087 3300053163 Bacteria 43854
863 Ga0500639_180715 3300053163 Bacteria 933
864 Ga0500636_0026370 3300053177 Bacteria 3433
865 Ga0500637_0139935 3300053178 Bacteria 1401
866 Ga0500637_0159095 3300053178 Bacteria 1302
867 Ga0500576_210813 3300053725 Bacteria 649
868 Ga0500657_177386 3300053728 Bacteria 745
869 Ga0500645_031958 3300053730 Bacteria 1580
870 Ga0500609_006198 3300053731 Bacteria 1630
871 Ga0500596_000958 3300053735 Bacteria 5747
872 Ga0500601_023501 3300053737 Bacteria 716
873 Ga0500661_034556 3300055283 Bacteria 893
874 Ga0587084_114439 3300059477 Bacteria 561
875 Ga0587066_179457 3300059490 Bacteria 544
876 Ga0587070_122016 3300059491 Bacteria 624
877 Ga0587083_0161347 3300059505 Bacteria 613
878 Ga0587083_0189321 3300059505 Bacteria 581
879 Ga0587085_168268 3300059506 Bacteria 517
880 Ga0587088_164094 3300059508 Bacteria 546
881 Ga0587090_115060 3300059510 Bacteria 578
882 Ga0587090_148626 3300059510 Bacteria 529
883 Ga0587090_173321 3300059510 Unclassified 502
884 Ga0587091_240738 3300059511 Bacteria 503
885 Ga0587092_112323 3300059512 Bacteria 573
886 Ga0587094_131233 3300059513 Bacteria 510
887 Ga0587101_069978 3300059623 Bacteria 644
888 Ga0587101_112396 3300059623 Bacteria 554
889 Ga0587109_074498 3300059624 Bacteria 740
890 Ga0587117_133487 3300059627 Bacteria 502
891 Ga0587068_163424 3300059641 Bacteria 511
892 Ga0587069_122407 3300059642 Bacteria 553
893 Ga0587069_129982 3300059642 Bacteria 542
894 Ga0587075_066830 3300059644 Bacteria 660
895 Ga0587075_082130 3300059644 Bacteria 616
896 Ga0587076_107565 3300059645 Bacteria 631
897 Ga0587076_208143 3300059645 Bacteria 506
898 Ga0587078_064624 3300059646 Bacteria 561
899 Ga0587079_092162 3300059647 Bacteria 711
900 Ga0587079_099550 3300059647 Bacteria 692
901 Ga0587079_128464 3300059647 Bacteria 634
902 Ga0587079_200664 3300059647 Bacteria 544
903 Ga0587102_041714 3300059649 Bacteria 594
904 Ga0587071_077994 3300060344 Bacteria 733
905 Ga0587071_182294 3300060344 Bacteria 540
906 Ga0587111_0047675 3300060346 Bacteria 936
907 Ga0587111_0088831 3300060346 Bacteria 751
908 Ga0587111_0162230 3300060346 Bacteria 608
909 Ga0587111_0167082 3300060346 Bacteria 602

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025921 Ga0207652_10744886 Ga0207652_107448863 65
2 3300059505 Ga0587083_0161347 Ga0587083_0161347_91_300 69
3 3300059510 Ga0587090_148626 Ga0587090_148626_239_448 69
4 3300059642 Ga0587069_122407 Ga0587069_122407_260_469 69
5 3300059645 Ga0587076_107565 Ga0587076_107565_334_543 69
6 3300059647 Ga0587079_128464 Ga0587079_128464_344_553 69
7 3300060344 Ga0587071_182294 Ga0587071_182294_82_291 69
8 3300031239 Ga0265328_10402167 Ga0265328_104021672 70
9 3300031249 Ga0265339_10159146 Ga0265339_101591462 70
10 3300044694 Ga0466963_1114300 Ga0466963_1114300_186_443 75
11 3300045976 Ga0466967_0533577 Ga0466967_0533577_246_503 75
12 3300030963 Ga0265768_109342 Ga0265768_1093421 78
13 3300009551 Ga0105238_12272899 Ga0105238_122728991 79
14 3300044658 Ga0466972_0287544 Ga0466972_0287544_280_519 79
15 3300006237 Ga0097621_101862147 Ga0097621_1018621472 80
16 3300011119 Ga0105246_11544214 Ga0105246_115442141 80
17 iso_pu_bacteria 2508501128 2509147490 80
18 iso_pu_bacteria 2513237141 2513892884 80
19 iso_pu_bacteria 2602042107 2603859023 80
20 iso_pu_bacteria 2857524615 2857527874 80
21 iso_pu_bacteria 2893066018 2893068236 80
22 iso_pu_bacteria 2919073203 2919075274 80
23 3300005616 Ga0068852_102054068 Ga0068852_1020540682 81
24 iso_pu_bacteria 2507262055 2507509152 81
25 iso_pu_bacteria 2508501009 2508543217 81
26 iso_pu_bacteria 2513237102 2513704148 81
27 iso_pu_bacteria 2515154112 2515626562 81
28 iso_pu_bacteria 2524023205 2524436801 81
29 iso_pu_bacteria 2528768022 2528857097 81
30 iso_pu_bacteria 2617270741 2617376250 81
31 iso_pu_bacteria 2728368998 2728750538 81
32 iso_pu_bacteria 2824600985 2824605040 81
33 iso_pu_bacteria 2824609381 2824613916 81
34 iso_pu_bacteria 2824617872 2824623461 81
35 iso_pu_bacteria 2824626560 2824631366 81
36 iso_pu_bacteria 2824635225 2824639652 81
37 iso_pu_bacteria 2824644064 2824646658 81
38 iso_pu_bacteria 2824661429 2824665087 81
39 iso_pu_bacteria 2824704595 2824709559 81
40 iso_pu_bacteria 2824714736 2824719634 81
41 iso_pu_bacteria 2824723954 2824726465 81
42 iso_pu_bacteria 2824732956 2824735450 81
43 iso_pu_bacteria 2824746037 2824750054 81
44 iso_pu_bacteria 2824753945 2824760058 81
45 iso_pu_bacteria 2824763712 2824770507 81
46 iso_pu_bacteria 2847930680 2847935521 81
47 iso_pu_bacteria 2874590934 2874597268 81
48 iso_pu_bacteria 2874620515 2874626842 81
49 iso_pu_bacteria 2874645413 2874649399 81
50 iso_pu_bacteria 2876761206 2876770477 81
51 iso_pu_bacteria 2876771140 2876777935 81
52 iso_pu_bacteria 2876818435 2876823044 81
53 iso_pu_bacteria 2879074833 2879078692 81
54 iso_pu_bacteria 2879083081 2879090751 81
55 iso_pu_bacteria 2879099564 2879108207 81
56 iso_pu_bacteria 2879127579 2879132830 81
57 iso_pu_bacteria 2879142872 2879148630 81
58 iso_pu_bacteria 2885409591 2885411032 81
59 iso_pu_bacteria 2888388044 2888394403 81
60 iso_pu_bacteria 2888419890 2888423978 81
61 iso_pu_bacteria 2904666416 2904668420 81
62 iso_pu_bacteria 2904711408 2904717388 81
63 iso_pu_bacteria 2906610324 2906618369 81
64 iso_pu_bacteria 2908775508 2908779626 81
65 iso_pu_bacteria 2922368715 2922373774 81
66 iso_pu_bacteria 2929615660 2929617482 81
67 iso_pu_bacteria 2929624759 2929627187 81
68 iso_pu_bacteria 2932784394 2932787472 81
69 iso_pu_bacteria 2932809354 2932815072 81
70 iso_pu_bacteria 2932818245 2932820731 81
71 iso_pu_bacteria 2932828146 2932831779 81
72 iso_pu_bacteria 2933577622 2933579438 81
73 iso_pu_bacteria 2935608549 2935611964 81
74 iso_pu_bacteria 2935616580 2935621859 81
75 iso_pu_bacteria 2935638405 2935642804 81
76 iso_pu_bacteria 2935665750 2935667906 81
77 iso_pu_bacteria 2935675223 2935679044 81
78 iso_pu_bacteria 2935684952 2935688656 81
79 iso_pu_bacteria 2935694250 2935696008 81
80 iso_pu_bacteria 2935703347 2935706747 81
81 iso_pu_bacteria 2935713505 2935715675 81
82 iso_pu_bacteria 2935722832 2935725761 81
83 iso_pu_bacteria 2935732158 2935737960 81
84 iso_pu_bacteria 2935741537 2935747335 81
85 iso_pu_bacteria 2935750917 2935754090 81
86 iso_pu_bacteria 2935760218 2935763127 81
87 iso_pu_bacteria 2935801545 2935808426 81
88 iso_pu_bacteria 2935810662 2935812879 81
89 iso_pu_bacteria 2935819856 2935821444 81
90 iso_pu_bacteria 2935827899 2935830531 81
91 iso_pu_bacteria 2935837841 2935840560 81
92 iso_pu_bacteria 2935847175 2935850297 81
93 iso_pu_bacteria 2935855204 2935860106 81
94 iso_pu_bacteria 2935864058 2935869243 81
95 iso_pu_bacteria 2935873716 2935880580 81
96 iso_pu_bacteria 2935908558 2935914343 81
97 iso_pu_bacteria 2935916978 2935921057 81
98 iso_pu_bacteria 2935926038 2935931999 81
99 iso_pu_bacteria 2935934488 2935940596 81
100 iso_pu_bacteria 2935942939 2935948539 81
101 iso_pu_bacteria 2935951376 2935956990 81
102 iso_pu_bacteria 2935959822 2935960231 81
103 iso_pu_bacteria 2935967501 2935973588 81
104 iso_pu_bacteria 2935975950 2935977464 81
105 iso_pu_bacteria 2935992306 2935996252 81
106 iso_pu_bacteria 2936002035 2936006386 81
107 iso_pu_bacteria 2936037263 2936041467 81
108 iso_pu_bacteria 2940556831 2940560534 81
109 iso_pu_bacteria 2941538514 2941541309 81
110 iso_pu_bacteria 3005506211 3005509878 81
111 iso_pu_bacteria 8006933436 8006941163 81
112 iso_pu_bacteria 8006973647 8006980631 81
113 iso_pu_bacteria 8006984368 8006985766 81
114 iso_pu_bacteria 8016511872 8016513912 81
115 iso_pu_bacteria 8016522445 8016530161 81
116 iso_pu_bacteria 8016530956 8016535408 81
117 iso_pu_bacteria 8016539877 8016548611 81
118 iso_pu_bacteria 8016548790 8016553518 81
119 iso_pu_bacteria 8016557553 8016561901 81
120 iso_pu_bacteria 8016566248 8016573743 81
121 iso_pu_bacteria 8016575299 8016577867 81
122 iso_pu_bacteria 8016595262 8016599728 81
123 iso_pu_bacteria 8016630954 8016631555 81
124 iso_pu_bacteria 8017057580 8017062563 81
125 iso_pu_bacteria 8019530166 8019535151 81
126 iso_pu_bacteria 8019576017 8019581958 81
127 iso_pu_bacteria 8019586578 8019589640 81
128 iso_pu_bacteria 8019597564 8019601630 81
129 iso_pu_bacteria 8019608314 8019616922 81
130 iso_pu_bacteria 8019638758 8019644709 81
131 iso_pu_bacteria 8019659431 8019662852 81
132 iso_pu_bacteria 8019668869 8019672459 81
133 iso_pu_bacteria 8019687851 8019689451 81
134 iso_pu_bacteria 8055742211 8055746903 81
135 3300048929 Ga0496126_0022867 Ga0496126_0022867_5013_5261 82
136 3300030878 Ga0265770_1146598 Ga0265770_11465981 83
137 3300036457 Ga0265778_036339 Ga0265778_036339_121_372 83
138 3300041486 Ga0451807_0231277 Ga0451807_0231277_363_617 83
139 3300005458 Ga0070681_10060782 Ga0070681_100607822 84
140 3300005530 Ga0070679_100039171 Ga0070679_1000391715 84
141 3300005563 Ga0068855_100117917 Ga0068855_1001179173 84
142 3300005614 Ga0068856_100423804 Ga0068856_1004238042 84
143 3300005981 Ga0081538_10103418 Ga0081538_101034182 84
144 3300007265 Ga0099794_10069448 Ga0099794_100694481 84
145 3300009174 Ga0105241_10455368 Ga0105241_104553682 84
146 3300009545 Ga0105237_10734363 Ga0105237_107343632 84
147 3300009551 Ga0105238_10273122 Ga0105238_102731222 84
148 3300013104 Ga0157370_10035076 Ga0157370_100350764 84
149 3300013297 Ga0157378_10010981 Ga0157378_100109817 84
150 3300025295 Ga0209564_1030145 Ga0209564_10301451 84
151 3300025299 Ga0209256_1099404 Ga0209256_10994041 84
152 3300025912 Ga0207707_10296463 Ga0207707_102964631 84
153 3300025914 Ga0207671_11238839 Ga0207671_112388391 84
154 3300025921 Ga0207652_11520710 Ga0207652_115207102 84
155 3300025939 Ga0207665_10272277 Ga0207665_102722771 84
156 3300025949 Ga0207667_10802129 Ga0207667_108021292 84
157 3300025986 Ga0207658_11631916 Ga0207658_116319161 84
158 3300026041 Ga0207639_10700631 Ga0207639_107006311 84
159 3300026067 Ga0207678_10081377 Ga0207678_100813772 84
160 3300027866 Ga0209813_10412780 Ga0209813_104127801 84
161 3300028794 Ga0307515_10260700 Ga0307515_102607002 84
162 3300031250 Ga0265331_10336256 Ga0265331_103362561 84
163 3300031711 Ga0265314_10310495 Ga0265314_103104951 84
164 3300035089 Ga0373944_0103056 Ga0373944_0103056_440_700 84
165 3300035111 Ga0373923_0010882 Ga0373923_0010882_1324_1584 84
166 3300035113 Ga0373936_0009619 Ga0373936_0009619_807_1067 84
167 3300035116 Ga0373945_0180231 Ga0373945_0180231_475_735 84
168 3300035120 Ga0373957_0152860 Ga0373957_0152860_341_601 84
169 3300035170 Ga0373943_0018283 Ga0373943_0018283_2540_2800 84
170 3300035171 Ga0373946_0019787 Ga0373946_0019787_1483_1743 84
171 3300035172 Ga0373955_0099626 Ga0373955_0099626_154_414 84
172 3300035692 Ga0373935_0007714 Ga0373935_0007714_3112_3372 84
173 3300035695 Ga0373927_0003072 Ga0373927_0003072_3774_4034 84
174 3300035725 Ga0373947_0001820 Ga0373947_0001820_7888_8148 84
175 3300036401 Ga0373937_0015418 Ga0373937_0015418_3429_3689 84
176 3300037068 Ga0373925_0002588 Ga0373925_0002588_10961_11221 84
177 3300046454 Ga0495592_0004679 Ga0495592_0004679_2249_2509 84
178 3300046455 Ga0495603_0000067 Ga0495603_0000067_3810_4070 84
179 3300046459 Ga0495629_0001667 Ga0495629_0001667_13093_13353 84
180 3300046460 Ga0495638_0055502 Ga0495638_0055502_1633_1890 84
181 3300046461 Ga0495641_0003314 Ga0495641_0003314_567_827 84
182 3300046463 Ga0495653_0441776 Ga0495653_0441776_47_307 84
183 3300046472 Ga0495580_0031815 Ga0495580_0031815_470_730 84
184 3300046473 Ga0495582_0000744 Ga0495582_0000744_13671_13931 84
185 3300046475 Ga0495639_0001360 Ga0495639_0001360_6567_6827 84
186 3300046476 Ga0495662_0007547 Ga0495662_0007547_3974_4234 84
187 3300046491 Ga0495584_0337987 Ga0495584_0337987_139_396 84
188 3300046499 Ga0495594_0009145 Ga0495594_0009145_723_983 84
189 3300046506 Ga0495583_0134729 Ga0495583_0134729_695_952 84
190 3300046512 Ga0495610_0039045 Ga0495610_0039045_620_877 84
191 3300046517 Ga0495630_0019651 Ga0495630_0019651_3909_4169 84
192 3300046518 Ga0495631_0022504 Ga0495631_0022504_2313_2570 84
193 3300046520 Ga0495637_0092270 Ga0495637_0092270_526_783 84
194 3300046522 Ga0495643_0168676 Ga0495643_0168676_637_894 84
195 3300046526 Ga0495666_0084345 Ga0495666_0084345_398_658 84
196 3300046529 Ga0495652_0082595 Ga0495652_0082595_2236_2496 84
197 3300046529 Ga0495652_0316973 Ga0495652_0316973_103_363 84
198 3300046530 Ga0495654_0071733 Ga0495654_0071733_651_908 84
199 3300046531 Ga0495665_0000307 Ga0495665_0000307_4064_4324 84
200 3300046533 Ga0495640_0016203 Ga0495640_0016203_1246_1506 84
201 3300046536 Ga0495587_0503169 Ga0495587_0503169_58_318 84
202 3300046542 Ga0495597_0185613 Ga0495597_0185613_57_314 84
203 3300046557 Ga0495622_0025886 Ga0495622_0025886_2217_2477 84
204 3300046559 Ga0495667_0037917 Ga0495667_0037917_2067_2327 84
205 3300046642 Ga0495634_0005834 Ga0495634_0005834_4052_4312 84
206 3300046660 Ga0495625_0110684 Ga0495625_0110684_569_826 84
207 3300046663 Ga0495635_0001592 Ga0495635_0001592_10992_11252 84
208 3300046674 Ga0495588_0093733 Ga0495588_0093733_11_268 84
209 3300046678 Ga0495599_0034785 Ga0495599_0034785_1604_1864 84
210 3300046680 Ga0495646_0185581 Ga0495646_0185581_782_1042 84
211 3300046681 Ga0495647_0001173 Ga0495647_0001173_4055_4315 84
212 3300046683 Ga0495658_0000520 Ga0495658_0000520_4233_4493 84
213 3300046689 Ga0495613_0038005 Ga0495613_0038005_1427_1687 84
214 3300046690 Ga0495624_0020438 Ga0495624_0020438_139_399 84
215 3300046691 Ga0495670_0003109 Ga0495670_0003109_7432_7689 84
216 3300046692 Ga0495671_0093738 Ga0495671_0093738_1153_1410 84
217 3300046809 Ga0495600_0923392 Ga0495600_0923392_181_441 84
218 3300047315 Ga0495581_0000022 Ga0495581_0000022_3781_4041 84
219 3300047319 Ga0495674_0001816 Ga0495674_0001816_16599_16859 84
220 3300047321 Ga0495676_0123031 Ga0495676_0123031_644_904 84
221 3300047322 Ga0495680_0363979 Ga0495680_0363979_159_419 84
222 3300047471 Ga0495684_0078668 Ga0495684_0078668_812_1072 84
223 3300047673 Ga0495593_0000016 Ga0495593_0000016_75305_75565 84
224 3300048089 Ga0495614_0024357 Ga0495614_0024357_1176_1436 84
225 3300048905 Ga0496102_1066581 Ga0496102_1066581_266_523 84
226 3300048909 Ga0496106_0435018 Ga0496106_0435018_562_819 84
227 3300048919 Ga0496116_0001852 Ga0496116_0001852_10227_10484 84
228 3300048920 Ga0496117_0248623 Ga0496117_0248623_603_860 84
229 3300048920 Ga0496117_0541241 Ga0496117_0541241_233_490 84
230 3300048921 Ga0496118_0142205 Ga0496118_0142205_141_398 84
231 3300048922 Ga0496119_0091208 Ga0496119_0091208_763_1020 84
232 3300048923 Ga0496120_0061040 Ga0496120_0061040_1549_1806 84
233 3300048924 Ga0496121_0123652 Ga0496121_0123652_201_458 84
234 3300048925 Ga0496122_0232375 Ga0496122_0232375_705_962 84
235 3300048926 Ga0496123_0477315 Ga0496123_0477315_17_274 84
236 3300048928 Ga0496125_0013225 Ga0496125_0013225_6544_6801 84
237 3300048928 Ga0496125_0059958 Ga0496125_0059958_1769_2026 84
238 3300048928 Ga0496125_0390002 Ga0496125_0390002_38_295 84
239 3300048929 Ga0496126_0206267 Ga0496126_0206267_934_1191 84
240 3300048929 Ga0496126_0282016 Ga0496126_0282016_1056_1316 84
241 3300048929 Ga0496126_1038807 Ga0496126_1038807_237_494 84
242 3300050490 nmdc:mga03n38_856146_c1 nmdc:mga03n38_856146_c1_27_284 84
243 3300050491 nmdc:mga00v17_19275_c1 nmdc:mga00v17_19275_c1_2224_2481 84
244 3300050495 nmdc:mga04h51_269530_c1 nmdc:mga04h51_269530_c1_256_513 84
245 3300050496 nmdc:mga07m45_53804_c1 nmdc:mga07m45_53804_c1_331_588 84
246 3300050516 nmdc:mga0sz30_27759_c1 nmdc:mga0sz30_27759_c1_1306_1563 84
247 3300053077 Ga0495601_0210254 Ga0495601_0210254_704_964 84
248 3300053087 Ga0500643_012153 Ga0500643_012153_198_455 84
249 3300053088 Ga0500644_0151700 Ga0500644_0151700_416_673 84
250 3300053094 Ga0500566_0000930 Ga0500566_0000930_1088_1345 84
251 3300053096 Ga0500641_0014253 Ga0500641_0014253_837_1094 84
252 3300053102 Ga0500554_073118 Ga0500554_073118_732_989 84
253 3300053103 Ga0500555_090523 Ga0500555_090523_426_683 84
254 3300053104 Ga0500556_0000002 Ga0500556_0000002_729396_729653 84
255 3300053105 Ga0500557_145960 Ga0500557_145960_163_420 84
256 3300053108 Ga0500562_050532 Ga0500562_050532_736_993 84
257 3300053116 Ga0500592_024109 Ga0500592_024109_451_708 84
258 3300053118 Ga0500594_0035706 Ga0500594_0035706_1019_1276 84
259 3300053121 Ga0500607_115404 Ga0500607_115404_701_958 84
260 3300053122 Ga0500608_014864 Ga0500608_014864_795_1052 84
261 3300053130 Ga0500642_0000010 Ga0500642_0000010_47768_48025 84
262 3300053131 Ga0500652_000511 Ga0500652_000511_1785_2042 84
263 3300053136 Ga0500559_0000919 Ga0500559_0000919_7799_8056 84
264 3300053138 Ga0500564_254083 Ga0500564_254083_288_545 84
265 3300053139 Ga0500568_0000680 Ga0500568_0000680_8044_8301 84
266 3300053146 Ga0500588_0396907 Ga0500588_0396907_119_376 84
267 3300053148 Ga0500590_173935 Ga0500590_173935_366_623 84
268 3300053151 Ga0500604_0009645 Ga0500604_0009645_573_830 84
269 3300053156 Ga0500622_0001697 Ga0500622_0001697_7825_8082 84
270 3300053158 Ga0500627_0057763 Ga0500627_0057763_1270_1527 84
271 3300053160 Ga0500633_0043029 Ga0500633_0043029_749_1006 84
272 3300053177 Ga0500636_0026370 Ga0500636_0026370_2933_3190 84
273 3300053730 Ga0500645_031958 Ga0500645_031958_759_1016 84
274 3300059510 Ga0587090_173321 Ga0587090_173321_186_443 84
275 3300060346 Ga0587111_0047675 Ga0587111_0047675_26_286 84
276 3300000549 LJQas_1028577 LJQas_10285772 85
277 3300003354 JGI25160J50197_1061223 JGI25160J50197_10612231 85
278 3300003579 Ga0007429J51699_1015309 Ga0007429J51699_10153092 85
279 3300004625 Ga0055543_1063225 Ga0055543_10632251 85
280 3300004798 Ga0058859_11717512 Ga0058859_117175121 85
281 3300004801 Ga0058860_12120592 Ga0058860_121205922 85
282 3300004801 Ga0058860_12138288 Ga0058860_121382881 85
283 3300004801 Ga0058860_12235858 Ga0058860_122358581 85
284 3300005262 Ga0065165_1006419 Ga0065165_10064193 85
285 3300005327 Ga0070658_10340868 Ga0070658_103408682 85
286 3300005328 Ga0070676_10886720 Ga0070676_108867201 85
287 3300005329 Ga0070683_100137268 Ga0070683_1001372682 85
288 3300005329 Ga0070683_101765083 Ga0070683_1017650832 85
289 3300005329 Ga0070683_101927706 Ga0070683_1019277061 85
290 3300005330 Ga0070690_100085524 Ga0070690_1000855242 85
291 3300005330 Ga0070690_101019401 Ga0070690_1010194011 85
292 3300005331 Ga0070670_100569267 Ga0070670_1005692672 85
293 3300005334 Ga0068869_100109499 Ga0068869_1001094992 85
294 3300005334 Ga0068869_101968256 Ga0068869_1019682561 85
295 3300005335 Ga0070666_10597901 Ga0070666_105979011 85
296 3300005335 Ga0070666_11319618 Ga0070666_113196181 85
297 3300005336 Ga0070680_100025555 Ga0070680_1000255552 85
298 3300005337 Ga0070682_100279158 Ga0070682_1002791582 85
299 3300005337 Ga0070682_100835209 Ga0070682_1008352092 85
300 3300005338 Ga0068868_100019111 Ga0068868_1000191114 85
301 3300005338 Ga0068868_100736188 Ga0068868_1007361882 85
302 3300005339 Ga0070660_101390764 Ga0070660_1013907642 85
303 3300005340 Ga0070689_100410580 Ga0070689_1004105802 85
304 3300005341 Ga0070691_10147971 Ga0070691_101479712 85
305 3300005344 Ga0070661_100307675 Ga0070661_1003076752 85
306 3300005344 Ga0070661_100388072 Ga0070661_1003880721 85
307 3300005347 Ga0070668_100056810 Ga0070668_1000568102 85
308 3300005347 Ga0070668_100760005 Ga0070668_1007600052 85
309 3300005354 Ga0070675_101073644 Ga0070675_1010736442 85
310 3300005355 Ga0070671_100206335 Ga0070671_1002063352 85
311 3300005355 Ga0070671_100342254 Ga0070671_1003422542 85
312 3300005355 Ga0070671_100429574 Ga0070671_1004295742 85
313 3300005356 Ga0070674_100195426 Ga0070674_1001954262 85
314 3300005356 Ga0070674_100241784 Ga0070674_1002417842 85
315 3300005364 Ga0070673_100596574 Ga0070673_1005965741 85
316 3300005364 Ga0070673_100677105 Ga0070673_1006771052 85
317 3300005364 Ga0070673_101095860 Ga0070673_1010958602 85
318 3300005364 Ga0070673_102151676 Ga0070673_1021516761 85
319 3300005366 Ga0070659_100634739 Ga0070659_1006347392 85
320 3300005366 Ga0070659_101313314 Ga0070659_1013133141 85
321 3300005367 Ga0070667_100666729 Ga0070667_1006667292 85
322 3300005434 Ga0070709_11071524 Ga0070709_110715242 85
323 3300005435 Ga0070714_100141594 Ga0070714_1001415942 85
324 3300005436 Ga0070713_100446532 Ga0070713_1004465322 85
325 3300005436 Ga0070713_101976019 Ga0070713_1019760191 85
326 3300005437 Ga0070710_11224279 Ga0070710_112242791 85
327 3300005439 Ga0070711_100688446 Ga0070711_1006884462 85
328 3300005439 Ga0070711_100944246 Ga0070711_1009442461 85
329 3300005439 Ga0070711_101033454 Ga0070711_1010334541 85
330 3300005440 Ga0070705_100488409 Ga0070705_1004884091 85
331 3300005445 Ga0070708_101118284 Ga0070708_1011182842 85
332 3300005455 Ga0070663_100047420 Ga0070663_1000474203 85
333 3300005455 Ga0070663_100162595 Ga0070663_1001625952 85
334 3300005455 Ga0070663_100185926 Ga0070663_1001859262 85
335 3300005455 Ga0070663_100188065 Ga0070663_1001880651 85
336 3300005455 Ga0070663_100403292 Ga0070663_1004032922 85
337 3300005456 Ga0070678_100087645 Ga0070678_1000876454 85
338 3300005456 Ga0070678_100197035 Ga0070678_1001970352 85
339 3300005456 Ga0070678_100253765 Ga0070678_1002537652 85
340 3300005456 Ga0070678_100397541 Ga0070678_1003975412 85
341 3300005457 Ga0070662_101694056 Ga0070662_1016940562 85
342 3300005458 Ga0070681_10553262 Ga0070681_105532621 85
343 3300005458 Ga0070681_11893691 Ga0070681_118936911 85
344 3300005459 Ga0068867_100732199 Ga0068867_1007321992 85
345 3300005466 Ga0070685_10700413 Ga0070685_107004132 85
346 3300005530 Ga0070679_100250531 Ga0070679_1002505313 85
347 3300005530 Ga0070679_100554944 Ga0070679_1005549441 85
348 3300005535 Ga0070684_100009838 Ga0070684_1000098383 85
349 3300005535 Ga0070684_100107204 Ga0070684_1001072042 85
350 3300005535 Ga0070684_101094835 Ga0070684_1010948351 85
351 3300005535 Ga0070684_102109956 Ga0070684_1021099561 85
352 3300005536 Ga0070697_100066932 Ga0070697_1000669322 85
353 3300005539 Ga0068853_100388284 Ga0068853_1003882841 85
354 3300005539 Ga0068853_100446152 Ga0068853_1004461521 85
355 3300005539 Ga0068853_100790886 Ga0068853_1007908862 85
356 3300005543 Ga0070672_101140138 Ga0070672_1011401381 85
357 3300005543 Ga0070672_101520948 Ga0070672_1015209481 85
358 3300005543 Ga0070672_102093248 Ga0070672_1020932481 85
359 3300005547 Ga0070693_101589770 Ga0070693_1015897701 85
360 3300005548 Ga0070665_100011491 Ga0070665_1000114914 85
361 3300005548 Ga0070665_100042315 Ga0070665_1000423152 85
362 3300005548 Ga0070665_100850243 Ga0070665_1008502432 85
363 3300005548 Ga0070665_100870382 Ga0070665_1008703822 85
364 3300005548 Ga0070665_100890225 Ga0070665_1008902251 85
365 3300005548 Ga0070665_100969884 Ga0070665_1009698843 85
366 3300005548 Ga0070665_101081343 Ga0070665_1010813431 85
367 3300005548 Ga0070665_101448135 Ga0070665_1014481352 85
368 3300005549 Ga0070704_100737768 Ga0070704_1007377681 85
369 3300005563 Ga0068855_100011695 Ga0068855_10001169519 85
370 3300005563 Ga0068855_100141459 Ga0068855_1001414595 85
371 3300005563 Ga0068855_101998876 Ga0068855_1019988762 85
372 3300005563 Ga0068855_102290455 Ga0068855_1022904551 85
373 3300005564 Ga0070664_101005214 Ga0070664_1010052142 85
374 3300005577 Ga0068857_100051462 Ga0068857_1000514622 85
375 3300005578 Ga0068854_100144116 Ga0068854_1001441163 85
376 3300005578 Ga0068854_100475680 Ga0068854_1004756802 85
377 3300005614 Ga0068856_100175881 Ga0068856_1001758812 85
378 3300005614 Ga0068856_100534318 Ga0068856_1005343182 85
379 3300005615 Ga0070702_100972572 Ga0070702_1009725721 85
380 3300005616 Ga0068852_100228219 Ga0068852_1002282191 85
381 3300005616 Ga0068852_100860164 Ga0068852_1008601641 85
382 3300005617 Ga0068859_101029638 Ga0068859_1010296382 85
383 3300005618 Ga0068864_100413495 Ga0068864_1004134952 85
384 3300005618 Ga0068864_100569293 Ga0068864_1005692932 85
385 3300005618 Ga0068864_101158656 Ga0068864_1011586562 85
386 3300005719 Ga0068861_102063060 Ga0068861_1020630602 85
387 3300005834 Ga0068851_10514720 Ga0068851_105147203 85
388 3300005834 Ga0068851_10681792 Ga0068851_106817922 85
389 3300005834 Ga0068851_10998605 Ga0068851_109986052 85
390 3300005840 Ga0068870_10764208 Ga0068870_107642082 85
391 3300005841 Ga0068863_100266678 Ga0068863_1002666783 85
392 3300005841 Ga0068863_100342384 Ga0068863_1003423841 85
393 3300005841 Ga0068863_100376646 Ga0068863_1003766461 85
394 3300005841 Ga0068863_101198272 Ga0068863_1011982722 85
395 3300005842 Ga0068858_100296627 Ga0068858_1002966271 85
396 3300005842 Ga0068858_100650869 Ga0068858_1006508691 85
397 3300005843 Ga0068860_100722632 Ga0068860_1007226322 85
398 3300005844 Ga0068862_100933399 Ga0068862_1009333992 85
399 3300005937 Ga0081455_10164221 Ga0081455_101642212 85
400 3300005983 Ga0081540_1040042 Ga0081540_10400422 85
401 3300005985 Ga0081539_10031363 Ga0081539_100313633 85
402 3300006038 Ga0075365_10013809 Ga0075365_100138096 85
403 3300006038 Ga0075365_10108867 Ga0075365_101088672 85
404 3300006038 Ga0075365_10180008 Ga0075365_101800082 85
405 3300006038 Ga0075365_10481332 Ga0075365_104813321 85
406 3300006042 Ga0075368_10092455 Ga0075368_100924551 85
407 3300006042 Ga0075368_10098359 Ga0075368_100983592 85
408 3300006048 Ga0075363_100002549 Ga0075363_1000025496 85
409 3300006048 Ga0075363_100038813 Ga0075363_1000388132 85
410 3300006048 Ga0075363_100921637 Ga0075363_1009216371 85
411 3300006051 Ga0075364_10932228 Ga0075364_109322282 85
412 3300006163 Ga0070715_10371455 Ga0070715_103714552 85
413 3300006175 Ga0070712_100928423 Ga0070712_1009284231 85
414 3300006178 Ga0075367_10056557 Ga0075367_100565572 85
415 3300006178 Ga0075367_10435230 Ga0075367_104352302 85
416 3300006178 Ga0075367_10478421 Ga0075367_104784212 85
417 3300006186 Ga0075369_10021798 Ga0075369_100217981 85
418 3300006186 Ga0075369_10026612 Ga0075369_100266122 85
419 3300006195 Ga0075366_10481588 Ga0075366_104815882 85
420 3300006195 Ga0075366_10894454 Ga0075366_108944541 85
421 3300006237 Ga0097621_100385326 Ga0097621_1003853262 85
422 3300006237 Ga0097621_100722979 Ga0097621_1007229791 85
423 3300006237 Ga0097621_101033396 Ga0097621_1010333962 85
424 3300006353 Ga0075370_10008373 Ga0075370_100083732 85
425 3300006353 Ga0075370_10009299 Ga0075370_100092994 85
426 3300006353 Ga0075370_10085642 Ga0075370_100856422 85
427 3300006358 Ga0068871_100364893 Ga0068871_1003648932 85
428 3300006358 Ga0068871_100457514 Ga0068871_1004575142 85
429 3300006358 Ga0068871_101402810 Ga0068871_1014028102 85
430 3300006881 Ga0068865_100094141 Ga0068865_1000941412 85
431 3300006881 Ga0068865_100124095 Ga0068865_1001240952 85
432 3300006881 Ga0068865_100208689 Ga0068865_1002086891 85
433 3300006881 Ga0068865_100344292 Ga0068865_1003442922 85
434 3300006881 Ga0068865_101260261 Ga0068865_1012602612 85
435 3300006931 Ga0097620_101029638 Ga0097620_1010296382 85
436 3300007076 Ga0075435_100663332 Ga0075435_1006633321 85
437 3300007265 Ga0099794_10197348 Ga0099794_101973482 85
438 3300007265 Ga0099794_10349792 Ga0099794_103497921 85
439 3300007788 Ga0099795_10113860 Ga0099795_101138602 85
440 3300007788 Ga0099795_10419661 Ga0099795_104196612 85
441 3300009093 Ga0105240_10018404 Ga0105240_100184049 85
442 3300009093 Ga0105240_10132174 Ga0105240_101321742 85
443 3300009098 Ga0105245_10024626 Ga0105245_100246262 85
444 3300009098 Ga0105245_10497410 Ga0105245_104974102 85
445 3300009098 Ga0105245_11048984 Ga0105245_110489841 85
446 3300009101 Ga0105247_10130481 Ga0105247_101304813 85
447 3300009101 Ga0105247_10687782 Ga0105247_106877821 85
448 3300009101 Ga0105247_11407985 Ga0105247_114079851 85
449 3300009148 Ga0105243_10231613 Ga0105243_102316133 85
450 3300009148 Ga0105243_10665145 Ga0105243_106651452 85
451 3300009174 Ga0105241_10378005 Ga0105241_103780052 85
452 3300009174 Ga0105241_10503413 Ga0105241_105034131 85
453 3300009174 Ga0105241_11160216 Ga0105241_111602161 85
454 3300009176 Ga0105242_10156126 Ga0105242_101561262 85
455 3300009176 Ga0105242_10482555 Ga0105242_104825552 85
456 3300009176 Ga0105242_11144765 Ga0105242_111447651 85
457 3300009176 Ga0105242_11301689 Ga0105242_113016892 85
458 3300009177 Ga0105248_10112722 Ga0105248_101127222 85
459 3300009177 Ga0105248_10516191 Ga0105248_105161912 85
460 3300009545 Ga0105237_10012739 Ga0105237_100127393 85
461 3300009545 Ga0105237_10243938 Ga0105237_102439383 85
462 3300009545 Ga0105237_10408829 Ga0105237_104088292 85
463 3300009545 Ga0105237_11047400 Ga0105237_110474001 85
464 3300009545 Ga0105237_11393697 Ga0105237_113936972 85
465 3300009551 Ga0105238_10041149 Ga0105238_100411492 85
466 3300009551 Ga0105238_10060230 Ga0105238_100602302 85
467 3300009551 Ga0105238_10611943 Ga0105238_106119432 85
468 3300009551 Ga0105238_11610176 Ga0105238_116101761 85
469 3300009551 Ga0105238_12796583 Ga0105238_127965831 85
470 3300009553 Ga0105249_10538166 Ga0105249_105381662 85
471 3300009553 Ga0105249_11732636 Ga0105249_117326361 85
472 3300009553 Ga0105249_12090307 Ga0105249_120903071 85
473 3300010375 Ga0105239_10070304 Ga0105239_100703043 85
474 3300010375 Ga0105239_10272054 Ga0105239_102720542 85
475 3300010375 Ga0105239_10286189 Ga0105239_102861892 85
476 3300010375 Ga0105239_10416534 Ga0105239_104165342 85
477 3300010375 Ga0105239_11856287 Ga0105239_118562872 85
478 3300011119 Ga0105246_10013250 Ga0105246_100132504 85
479 3300011119 Ga0105246_10175355 Ga0105246_101753553 85
480 3300011119 Ga0105246_10717719 Ga0105246_107177192 85
481 3300011119 Ga0105246_11913015 Ga0105246_119130152 85
482 3300012494 Ga0157341_1038858 Ga0157341_10388581 85
483 3300013100 Ga0157373_10793337 Ga0157373_107933371 85
484 3300013104 Ga0157370_10807551 Ga0157370_108075512 85
485 3300013105 Ga0157369_10034915 Ga0157369_100349156 85
486 3300013105 Ga0157369_10407198 Ga0157369_104071982 85
487 3300013105 Ga0157369_10702505 Ga0157369_107025052 85
488 3300013296 Ga0157374_10453952 Ga0157374_104539521 85
489 3300013296 Ga0157374_12298788 Ga0157374_122987882 85
490 3300013297 Ga0157378_10274843 Ga0157378_102748433 85
491 3300013297 Ga0157378_10508336 Ga0157378_105083361 85
492 3300013297 Ga0157378_10901629 Ga0157378_109016293 85
493 3300013297 Ga0157378_10970053 Ga0157378_109700531 85
494 3300013297 Ga0157378_12586777 Ga0157378_125867771 85
495 3300013306 Ga0163162_10050813 Ga0163162_100508133 85
496 3300013306 Ga0163162_10884742 Ga0163162_108847422 85
497 3300013306 Ga0163162_11005945 Ga0163162_110059451 85
498 3300013306 Ga0163162_11524478 Ga0163162_115244782 85
499 3300013306 Ga0163162_12385246 Ga0163162_123852461 85
500 3300013308 Ga0157375_10071766 Ga0157375_100717663 85
501 3300013308 Ga0157375_10233563 Ga0157375_102335632 85
502 3300013308 Ga0157375_10289390 Ga0157375_102893902 85
503 3300013308 Ga0157375_10847240 Ga0157375_108472401 85
504 3300013308 Ga0157375_11806423 Ga0157375_118064231 85
505 3300014325 Ga0163163_10029693 Ga0163163_100296932 85
506 3300014325 Ga0163163_10129877 Ga0163163_101298773 85
507 3300014325 Ga0163163_10466641 Ga0163163_104666411 85
508 3300014325 Ga0163163_10678025 Ga0163163_106780252 85
509 3300014325 Ga0163163_11242954 Ga0163163_112429542 85
510 3300014325 Ga0163163_12298040 Ga0163163_122980402 85
511 3300014325 Ga0163163_12315031 Ga0163163_123150312 85
512 3300014326 Ga0157380_10594678 Ga0157380_105946781 85
513 3300014326 Ga0157380_10768167 Ga0157380_107681672 85
514 3300014326 Ga0157380_12663067 Ga0157380_126630672 85
515 3300014968 Ga0157379_10319230 Ga0157379_103192302 85
516 3300014968 Ga0157379_10495748 Ga0157379_104957483 85
517 3300014968 Ga0157379_11580556 Ga0157379_115805561 85
518 3300014968 Ga0157379_11718648 Ga0157379_117186481 85
519 3300014968 Ga0157379_11982230 Ga0157379_119822301 85
520 3300014968 Ga0157379_12094132 Ga0157379_120941321 85
521 3300014969 Ga0157376_10014758 Ga0157376_100147582 85
522 3300014969 Ga0157376_10100168 Ga0157376_101001683 85
523 3300014969 Ga0157376_10419030 Ga0157376_104190302 85
524 3300014969 Ga0157376_11996431 Ga0157376_119964311 85
525 3300017792 Ga0163161_10086127 Ga0163161_100861272 85
526 3300025302 Ga0207426_1002773 Ga0207426_10027739 85
527 3300025302 Ga0207426_1007634 Ga0207426_10076342 85
528 3300025898 Ga0207692_10297647 Ga0207692_102976472 85
529 3300025900 Ga0207710_10746721 Ga0207710_107467211 85
530 3300025903 Ga0207680_10683545 Ga0207680_106835452 85
531 3300025904 Ga0207647_10517568 Ga0207647_105175681 85
532 3300025908 Ga0207643_10270617 Ga0207643_102706172 85
533 3300025909 Ga0207705_10156161 Ga0207705_101561611 85
534 3300025910 Ga0207684_11030480 Ga0207684_110304802 85
535 3300025911 Ga0207654_10264258 Ga0207654_102642581 85
536 3300025911 Ga0207654_10607996 Ga0207654_106079962 85
537 3300025912 Ga0207707_10064122 Ga0207707_100641226 85
538 3300025912 Ga0207707_10829420 Ga0207707_108294201 85
539 3300025914 Ga0207671_10070454 Ga0207671_100704542 85
540 3300025914 Ga0207671_10351919 Ga0207671_103519192 85
541 3300025914 Ga0207671_11300282 Ga0207671_113002821 85
542 3300025915 Ga0207693_10789696 Ga0207693_107896961 85
543 3300025916 Ga0207663_10229264 Ga0207663_102292642 85
544 3300025916 Ga0207663_10488418 Ga0207663_104884182 85
545 3300025917 Ga0207660_10018427 Ga0207660_100184277 85
546 3300025917 Ga0207660_11100922 Ga0207660_111009222 85
547 3300025919 Ga0207657_10021019 Ga0207657_100210197 85
548 3300025920 Ga0207649_10208243 Ga0207649_102082433 85
549 3300025921 Ga0207652_10046466 Ga0207652_100464662 85
550 3300025921 Ga0207652_11210324 Ga0207652_112103242 85
551 3300025924 Ga0207694_10056784 Ga0207694_100567845 85
552 3300025924 Ga0207694_10128231 Ga0207694_101282312 85
553 3300025927 Ga0207687_10024625 Ga0207687_100246252 85
554 3300025927 Ga0207687_10676143 Ga0207687_106761431 85
555 3300025927 Ga0207687_11484447 Ga0207687_114844471 85
556 3300025928 Ga0207700_10195699 Ga0207700_101956991 85
557 3300025928 Ga0207700_11339459 Ga0207700_113394591 85
558 3300025931 Ga0207644_10229896 Ga0207644_102298962 85
559 3300025931 Ga0207644_10311440 Ga0207644_103114401 85
560 3300025931 Ga0207644_11352368 Ga0207644_113523681 85
561 3300025932 Ga0207690_10961096 Ga0207690_109610961 85
562 3300025933 Ga0207706_10378444 Ga0207706_103784442 85
563 3300025934 Ga0207686_10204516 Ga0207686_102045163 85
564 3300025934 Ga0207686_11193854 Ga0207686_111938541 85
565 3300025934 Ga0207686_11284991 Ga0207686_112849912 85
566 3300025935 Ga0207709_11196390 Ga0207709_111963901 85
567 3300025936 Ga0207670_10362810 Ga0207670_103628102 85
568 3300025936 Ga0207670_11472910 Ga0207670_114729101 85
569 3300025937 Ga0207669_10055936 Ga0207669_100559361 85
570 3300025938 Ga0207704_10100617 Ga0207704_101006172 85
571 3300025938 Ga0207704_10300664 Ga0207704_103006641 85
572 3300025940 Ga0207691_11318892 Ga0207691_113188921 85
573 3300025940 Ga0207691_11668851 Ga0207691_116688512 85
574 3300025941 Ga0207711_10077644 Ga0207711_100776443 85
575 3300025941 Ga0207711_10650076 Ga0207711_106500761 85
576 3300025941 Ga0207711_10743477 Ga0207711_107434772 85
577 3300025941 Ga0207711_10983237 Ga0207711_109832371 85
578 3300025942 Ga0207689_11609039 Ga0207689_116090391 85
579 3300025944 Ga0207661_10044310 Ga0207661_100443105 85
580 3300025944 Ga0207661_10269239 Ga0207661_102692392 85
581 3300025945 Ga0207679_10039717 Ga0207679_100397171 85
582 3300025945 Ga0207679_10280723 Ga0207679_102807232 85
583 3300025945 Ga0207679_10485131 Ga0207679_104851312 85
584 3300025945 Ga0207679_11797003 Ga0207679_117970031 85
585 3300025945 Ga0207679_12008091 Ga0207679_120080912 85
586 3300025949 Ga0207667_10037598 Ga0207667_100375987 85
587 3300025949 Ga0207667_11990483 Ga0207667_119904831 85
588 3300025960 Ga0207651_10365634 Ga0207651_103656341 85
589 3300025960 Ga0207651_10612276 Ga0207651_106122761 85
590 3300025961 Ga0207712_11571164 Ga0207712_115711641 85
591 3300025972 Ga0207668_10065215 Ga0207668_100652152 85
592 3300025972 Ga0207668_10527596 Ga0207668_105275961 85
593 3300025972 Ga0207668_11643169 Ga0207668_116431692 85
594 3300025972 Ga0207668_11713240 Ga0207668_117132401 85
595 3300025981 Ga0207640_10235065 Ga0207640_102350653 85
596 3300025986 Ga0207658_10749478 Ga0207658_107494781 85
597 3300026023 Ga0207677_10032765 Ga0207677_100327654 85
598 3300026023 Ga0207677_10329956 Ga0207677_103299562 85
599 3300026035 Ga0207703_10352317 Ga0207703_103523172 85
600 3300026041 Ga0207639_10031835 Ga0207639_100318352 85
601 3300026041 Ga0207639_10337881 Ga0207639_103378811 85
602 3300026067 Ga0207678_10011180 Ga0207678_100111803 85
603 3300026067 Ga0207678_10043207 Ga0207678_100432072 85
604 3300026067 Ga0207678_10068408 Ga0207678_100684082 85
605 3300026067 Ga0207678_10408032 Ga0207678_104080322 85
606 3300026067 Ga0207678_10861223 Ga0207678_108612231 85
607 3300026067 Ga0207678_10862575 Ga0207678_108625752 85
608 3300026075 Ga0207708_11272946 Ga0207708_112729461 85
609 3300026078 Ga0207702_10579547 Ga0207702_105795472 85
610 3300026078 Ga0207702_10739716 Ga0207702_107397162 85
611 3300026088 Ga0207641_10332460 Ga0207641_103324603 85
612 3300026088 Ga0207641_10697841 Ga0207641_106978412 85
613 3300026088 Ga0207641_11502070 Ga0207641_115020701 85
614 3300026089 Ga0207648_10500479 Ga0207648_105004792 85
615 3300026089 Ga0207648_11038522 Ga0207648_110385222 85
616 3300026089 Ga0207648_11190356 Ga0207648_111903561 85
617 3300026095 Ga0207676_10109249 Ga0207676_101092492 85
618 3300026095 Ga0207676_10908533 Ga0207676_109085332 85
619 3300026116 Ga0207674_10126828 Ga0207674_101268284 85
620 3300026118 Ga0207675_102234416 Ga0207675_1022344161 85
621 3300026121 Ga0207683_10051095 Ga0207683_100510955 85
622 3300026121 Ga0207683_10160115 Ga0207683_101601152 85
623 3300026121 Ga0207683_10200387 Ga0207683_102003872 85
624 3300026121 Ga0207683_10505736 Ga0207683_105057361 85
625 3300026142 Ga0207698_10041587 Ga0207698_100415874 85
626 3300026142 Ga0207698_10226506 Ga0207698_102265061 85
627 3300026142 Ga0207698_11856875 Ga0207698_118568752 85
628 3300027671 Ga0209588_1038760 Ga0209588_10387602 85
629 3300027866 Ga0209813_10041476 Ga0209813_100414762 85
630 3300027866 Ga0209813_10225265 Ga0209813_102252651 85
631 3300028379 Ga0268266_10000951 Ga0268266_1000095116 85
632 3300028379 Ga0268266_10058052 Ga0268266_100580523 85
633 3300028379 Ga0268266_10302052 Ga0268266_103020522 85
634 3300028379 Ga0268266_10907570 Ga0268266_109075702 85
635 3300028381 Ga0268264_10000022 Ga0268264_1000002236 85
636 3300028381 Ga0268264_10970473 Ga0268264_109704732 85
637 3300028381 Ga0268264_11173148 Ga0268264_111731482 85
638 3300028381 Ga0268264_11766700 Ga0268264_117667002 85
639 3300028794 Ga0307515_10049717 Ga0307515_100497175 85
640 3300028794 Ga0307515_10714455 Ga0307515_107144551 85
641 3300028794 Ga0307515_10838904 Ga0307515_108389042 85
642 3300030521 Ga0307511_10400044 Ga0307511_104000441 85
643 3300030763 Ga0265763_1009226 Ga0265763_10092261 85
644 3300030963 Ga0265768_104851 Ga0265768_1048511 85
645 3300031018 Ga0265773_1037946 Ga0265773_10379461 85
646 3300031018 Ga0265773_1049542 Ga0265773_10495421 85
647 3300031235 Ga0265330_10062556 Ga0265330_100625562 85
648 3300031235 Ga0265330_10136062 Ga0265330_101360622 85
649 3300031238 Ga0265332_10018173 Ga0265332_100181732 85
650 3300031238 Ga0265332_10095848 Ga0265332_100958481 85
651 3300031242 Ga0265329_10222595 Ga0265329_102225951 85
652 3300031247 Ga0265340_10003276 Ga0265340_100032766 85
653 3300031250 Ga0265331_10131128 Ga0265331_101311282 85
654 3300031250 Ga0265331_10207500 Ga0265331_102075002 85
655 3300031344 Ga0265316_10553254 Ga0265316_105532542 85
656 3300031456 Ga0307513_10256828 Ga0307513_102568283 85
657 3300031456 Ga0307513_10464086 Ga0307513_104640861 85
658 3300031456 Ga0307513_10765441 Ga0307513_107654411 85
659 3300031507 Ga0307509_10321969 Ga0307509_103219692 85
660 3300031507 Ga0307509_10337441 Ga0307509_103374412 85
661 3300031548 Ga0307408_100488110 Ga0307408_1004881101 85
662 3300031616 Ga0307508_10000001 Ga0307508_10000001105 85
663 3300031616 Ga0307508_10035326 Ga0307508_100353262 85
664 3300031616 Ga0307508_10066155 Ga0307508_100661552 85
665 3300031616 Ga0307508_10114872 Ga0307508_101148722 85
666 3300031616 Ga0307508_10235537 Ga0307508_102355371 85
667 3300031667 Ga0310111_138504 Ga0310111_1385042 85
668 3300031712 Ga0265342_10116106 Ga0265342_101161062 85
669 3300031712 Ga0265342_10534231 Ga0265342_105342312 85
670 3300031730 Ga0307516_10002141 Ga0307516_1000214115 85
671 3300031730 Ga0307516_10021175 Ga0307516_100211758 85
672 3300031852 Ga0307410_11550232 Ga0307410_115502321 85
673 3300031903 Ga0307407_10618249 Ga0307407_106182491 85
674 3300032002 Ga0307416_100328953 Ga0307416_1003289531 85
675 3300032004 Ga0307414_11905509 Ga0307414_119055091 85
676 3300032005 Ga0307411_10553621 Ga0307411_105536211 85
677 3300033180 Ga0307510_10016586 Ga0307510_100165866 85
678 3300033180 Ga0307510_10030555 Ga0307510_100305554 85
679 3300033180 Ga0307510_10547822 Ga0307510_105478221 85
680 3300034816 Ga0373930_0005832 Ga0373930_0005832_1576_1845 85
681 3300034957 Ga0373938_0078962 Ga0373938_0078962_151_420 85
682 3300035085 Ga0373929_0037615 Ga0373929_0037615_460_729 85
683 3300035088 Ga0373940_0252916 Ga0373940_0252916_131_400 85
684 3300035090 Ga0373949_0109289 Ga0373949_0109289_333_602 85
685 3300035090 Ga0373949_0121359 Ga0373949_0121359_22_279 85
686 3300035113 Ga0373936_0106618 Ga0373936_0106618_386_643 85
687 3300035113 Ga0373936_0310319 Ga0373936_0310319_316_573 85
688 3300035115 Ga0373941_0081552 Ga0373941_0081552_181_450 85
689 3300035117 Ga0373953_0006214 Ga0373953_0006214_3485_3745 85
690 3300035119 Ga0373956_0056474 Ga0373956_0056474_350_610 85
691 3300035120 Ga0373957_0051852 Ga0373957_0051852_1128_1388 85
692 3300035172 Ga0373955_0090902 Ga0373955_0090902_36_296 85
693 3300035207 Ga0373942_0137388 Ga0373942_0137388_238_507 85
694 3300035242 Ga0373962_0126761 Ga0373962_0126761_226_495 85
695 3300035691 Ga0373931_0002926 Ga0373931_0002926_1998_2267 85
696 3300035691 Ga0373931_0578857 Ga0373931_0578857_38_295 85
697 3300035692 Ga0373935_0333426 Ga0373935_0333426_681_938 85
698 3300035695 Ga0373927_0089135 Ga0373927_0089135_1698_1967 85
699 3300035695 Ga0373927_0772947 Ga0373927_0772947_95_352 85
700 3300035724 Ga0373933_0018065 Ga0373933_0018065_1307_1567 85
701 3300035725 Ga0373947_0445069 Ga0373947_0445069_278_547 85
702 3300035725 Ga0373947_0922944 Ga0373947_0922944_87_344 85
703 3300036242 Ga0310104_06677 Ga0310104_06677_34_291 85
704 3300036401 Ga0373937_0090156 Ga0373937_0090156_653_913 85
705 3300036401 Ga0373937_0797502 Ga0373937_0797502_375_644 85
706 3300036458 Ga0310112_022196 Ga0310112_022196_68_325 85
707 3300036458 Ga0310112_062193 Ga0310112_062193_216_473 85
708 3300036459 Ga0372808_013555 Ga0372808_013555_874_1131 85
709 3300036459 Ga0372808_040196 Ga0372808_040196_26_283 85
710 3300036534 Ga0310109_026198 Ga0310109_026198_19_276 85
711 3300036534 Ga0310109_035897 Ga0310109_035897_29_286 85
712 3300036534 Ga0310109_039782 Ga0310109_039782_326_583 85
713 3300037068 Ga0373925_0044622 Ga0373925_0044622_338_607 85
714 3300037068 Ga0373925_0422470 Ga0373925_0422470_260_517 85
715 3300037068 Ga0373925_0981788 Ga0373925_0981788_425_682 85
716 3300037471 Ga0395905_1417490 Ga0395905_1417490_133_390 85
717 3300039437 Ga0436365_1151076 Ga0436365_1151076_86_346 85
718 3300039437 Ga0436365_1218047 Ga0436365_1218047_658_918 85
719 3300041413 Ga0439465_0337197 Ga0439465_0337197_27_284 85
720 3300041452 Ga0451793_0500760 Ga0451793_0500760_134_403 85
721 3300041494 Ga0451837_1456358 Ga0451837_1456358_264_521 85
722 3300041498 Ga0451841_0515919 Ga0451841_0515919_11_268 85
723 3300041501 Ga0451845_0877925 Ga0451845_0877925_53_322 85
724 3300041503 Ga0451847_0531047 Ga0451847_0531047_301_558 85
725 3300041507 Ga0451851_0943936 Ga0451851_0943936_431_688 85
726 3300041509 Ga0451843_0094426 Ga0451843_0094426_25_282 85
727 3300041511 Ga0451855_1030746 Ga0451855_1030746_194_463 85
728 3300041512 Ga0451853_2459925 Ga0451853_2459925_27_284 85
729 3300042006 Ga0439432_183807 Ga0439432_183807_236_493 85
730 3300042156 Ga0439446_0140299 Ga0439446_0140299_176_433 85
731 3300044658 Ga0466972_0002947 Ga0466972_0002947_7965_8222 85
732 3300044735 Ga0466968_0005930 Ga0466968_0005930_2520_2777 85
733 3300044901 Ga0466960_0003317 Ga0466960_0003317_5803_6060 85
734 3300045976 Ga0466967_0978674 Ga0466967_0978674_174_431 85
735 3300046452 Ga0495617_011960 Ga0495617_011960_50_307 85
736 3300046454 Ga0495592_0010679 Ga0495592_0010679_3277_3537 85
737 3300046454 Ga0495592_0184866 Ga0495592_0184866_809_1078 85
738 3300046454 Ga0495592_0812336 Ga0495592_0812336_23_280 85
739 3300046455 Ga0495603_0060084 Ga0495603_0060084_1377_1634 85
740 3300046457 Ga0495590_0021201 Ga0495590_0021201_1283_1540 85
741 3300046459 Ga0495629_0017434 Ga0495629_0017434_1246_1506 85
742 3300046460 Ga0495638_0188705 Ga0495638_0188705_506_763 85
743 3300046460 Ga0495638_0211886 Ga0495638_0211886_636_893 85
744 3300046460 Ga0495638_0515833 Ga0495638_0515833_220_477 85
745 3300046462 Ga0495651_0002792 Ga0495651_0002792_3839_4099 85
746 3300046463 Ga0495653_0003251 Ga0495653_0003251_3176_3436 85
747 3300046474 Ga0495605_0383069 Ga0495605_0383069_294_551 85
748 3300046474 Ga0495605_0482429 Ga0495605_0482429_50_307 85
749 3300046475 Ga0495639_0303232 Ga0495639_0303232_105_362 85
750 3300046475 Ga0495639_0638141 Ga0495639_0638141_14_271 85
751 3300046477 Ga0495664_0777338 Ga0495664_0777338_101_370 85
752 3300046492 Ga0495585_0033897 Ga0495585_0033897_850_1107 85
753 3300046492 Ga0495585_0106773 Ga0495585_0106773_1087_1344 85
754 3300046506 Ga0495583_0117389 Ga0495583_0117389_817_1074 85
755 3300046507 Ga0495606_0275850 Ga0495606_0275850_37_294 85
756 3300046507 Ga0495606_0331037 Ga0495606_0331037_175_432 85
757 3300046511 Ga0495608_0003162 Ga0495608_0003162_653_913 85
758 3300046511 Ga0495608_0549210 Ga0495608_0549210_272_541 85
759 3300046512 Ga0495610_0118425 Ga0495610_0118425_409_666 85
760 3300046512 Ga0495610_0142481 Ga0495610_0142481_109_366 85
761 3300046513 Ga0495616_0138805 Ga0495616_0138805_401_658 85
762 3300046513 Ga0495616_0219399 Ga0495616_0219399_420_677 85
763 3300046514 Ga0495618_0041879 Ga0495618_0041879_1128_1388 85
764 3300046516 Ga0495628_0083080 Ga0495628_0083080_2054_2314 85
765 3300046516 Ga0495628_0197939 Ga0495628_0197939_326_595 85
766 3300046517 Ga0495630_0403692 Ga0495630_0403692_383_652 85
767 3300046517 Ga0495630_1139896 Ga0495630_1139896_284_547 85
768 3300046524 Ga0495648_0080224 Ga0495648_0080224_1516_1773 85
769 3300046524 Ga0495648_0102525 Ga0495648_0102525_241_498 85
770 3300046526 Ga0495666_0081025 Ga0495666_0081025_1233_1490 85
771 3300046529 Ga0495652_0063052 Ga0495652_0063052_344_604 85
772 3300046529 Ga0495652_0366519 Ga0495652_0366519_323_592 85
773 3300046533 Ga0495640_0216997 Ga0495640_0216997_931_1191 85
774 3300046535 Ga0495586_0923680 Ga0495586_0923680_196_465 85
775 3300046536 Ga0495587_0182478 Ga0495587_0182478_255_515 85
776 3300046542 Ga0495597_0112347 Ga0495597_0112347_89_346 85
777 3300046543 Ga0495645_0287622 Ga0495645_0287622_246_515 85
778 3300046543 Ga0495645_0359043 Ga0495645_0359043_81_338 85
779 3300046557 Ga0495622_0096124 Ga0495622_0096124_994_1251 85
780 3300046615 Ga0495656_0153373 Ga0495656_0153373_564_821 85
781 3300046615 Ga0495656_0669689 Ga0495656_0669689_259_516 85
782 3300046616 Ga0495668_0031702 Ga0495668_0031702_2107_2364 85
783 3300046616 Ga0495668_0162698 Ga0495668_0162698_851_1108 85
784 3300046616 Ga0495668_0251904 Ga0495668_0251904_464_721 85
785 3300046616 Ga0495668_0865044 Ga0495668_0865044_147_404 85
786 3300046642 Ga0495634_0012063 Ga0495634_0012063_5870_6130 85
787 3300046648 Ga0495611_0182619 Ga0495611_0182619_553_810 85
788 3300046648 Ga0495611_0540167 Ga0495611_0540167_258_515 85
789 3300046660 Ga0495625_0155073 Ga0495625_0155073_805_1062 85
790 3300046660 Ga0495625_0274308 Ga0495625_0274308_468_737 85
791 3300046660 Ga0495625_0742793 Ga0495625_0742793_303_560 85
792 3300046663 Ga0495635_0000230 Ga0495635_0000230_25377_25637 85
793 3300046663 Ga0495635_0730470 Ga0495635_0730470_109_378 85
794 3300046663 Ga0495635_0806027 Ga0495635_0806027_159_416 85
795 3300046663 Ga0495635_1075107 Ga0495635_1075107_149_406 85
796 3300046664 Ga0495659_0006340 Ga0495659_0006340_1130_1387 85
797 3300046674 Ga0495588_0141359 Ga0495588_0141359_935_1204 85
798 3300046674 Ga0495588_0284579 Ga0495588_0284579_257_514 85
799 3300046675 Ga0495657_0019646 Ga0495657_0019646_63_323 85
800 3300046678 Ga0495599_0003970 Ga0495599_0003970_7268_7528 85
801 3300046679 Ga0495623_0626562 Ga0495623_0626562_157_417 85
802 3300046680 Ga0495646_0011572 Ga0495646_0011572_1502_1762 85
803 3300046681 Ga0495647_0145903 Ga0495647_0145903_716_973 85
804 3300046684 Ga0495669_0157650 Ga0495669_0157650_398_655 85
805 3300046689 Ga0495613_0097036 Ga0495613_0097036_1307_1567 85
806 3300046689 Ga0495613_0448507 Ga0495613_0448507_209_478 85
807 3300046694 Ga0495649_0566949 Ga0495649_0566949_71_328 85
808 3300046694 Ga0495649_0588446 Ga0495649_0588446_50_307 85
809 3300046794 Ga0495589_0112151 Ga0495589_0112151_177_434 85
810 3300046809 Ga0495600_0004716 Ga0495600_0004716_3967_4227 85
811 3300046809 Ga0495600_0245468 Ga0495600_0245468_578_847 85
812 3300047315 Ga0495581_0206596 Ga0495581_0206596_767_1024 85
813 3300047315 Ga0495581_0261632 Ga0495581_0261632_514_774 85
814 3300047317 Ga0495604_0004194 Ga0495604_0004194_10910_11170 85
815 3300047319 Ga0495674_0008381 Ga0495674_0008381_4190_4450 85
816 3300047319 Ga0495674_0240261 Ga0495674_0240261_415_684 85
817 3300047320 Ga0495672_0023877 Ga0495672_0023877_1227_1484 85
818 3300047320 Ga0495672_0024111 Ga0495672_0024111_130_387 85
819 3300047320 Ga0495672_0126330 Ga0495672_0126330_965_1222 85
820 3300047321 Ga0495676_0174994 Ga0495676_0174994_1027_1284 85
821 3300047322 Ga0495680_0011451 Ga0495680_0011451_3802_4062 85
822 3300047323 Ga0495683_0051610 Ga0495683_0051610_843_1100 85
823 3300047444 Ga0495675_0001005 Ga0495675_0001005_3811_4071 85
824 3300047446 Ga0495679_115800 Ga0495679_115800_93_350 85
825 3300047447 Ga0495685_037620 Ga0495685_037620_364_621 85
826 3300047469 Ga0495673_0086629 Ga0495673_0086629_284_541 85
827 3300047469 Ga0495673_0099576 Ga0495673_0099576_50_307 85
828 3300047470 Ga0495681_0388230 Ga0495681_0388230_69_326 85
829 3300047673 Ga0495593_0002243 Ga0495593_0002243_2883_3143 85
830 3300048088 Ga0495602_0023393 Ga0495602_0023393_1928_2188 85
831 3300048088 Ga0495602_1015168 Ga0495602_1015168_149_406 85
832 3300048091 Ga0495626_0093542 Ga0495626_0093542_994_1251 85
833 3300048903 Ga0496100_0014273 Ga0496100_0014273_118_375 85
834 3300048903 Ga0496100_0044857 Ga0496100_0044857_729_986 85
835 3300048903 Ga0496100_0061540 Ga0496100_0061540_939_1208 85
836 3300048904 Ga0496101_0036493 Ga0496101_0036493_1585_1854 85
837 3300048904 Ga0496101_0201852 Ga0496101_0201852_1175_1432 85
838 3300048904 Ga0496101_0267419 Ga0496101_0267419_453_716 85
839 3300048905 Ga0496102_0047584 Ga0496102_0047584_341_604 85
840 3300048905 Ga0496102_0055990 Ga0496102_0055990_1512_1769 85
841 3300048905 Ga0496102_0165484 Ga0496102_0165484_1542_1799 85
842 3300048905 Ga0496102_0495915 Ga0496102_0495915_162_419 85
843 3300048905 Ga0496102_0741326 Ga0496102_0741326_233_502 85
844 3300048905 Ga0496102_1392180 Ga0496102_1392180_275_532 85
845 3300048905 Ga0496102_1738578 Ga0496102_1738578_248_508 85
846 3300048906 Ga0496103_0116937 Ga0496103_0116937_720_977 85
847 3300048906 Ga0496103_0791906 Ga0496103_0791906_171_428 85
848 3300048906 Ga0496103_0954574 Ga0496103_0954574_254_517 85
849 3300048907 Ga0496104_0031531 Ga0496104_0031531_1469_1726 85
850 3300048907 Ga0496104_0032314 Ga0496104_0032314_3688_3951 85
851 3300048907 Ga0496104_0056952 Ga0496104_0056952_2250_2519 85
852 3300048907 Ga0496104_0253277 Ga0496104_0253277_459_716 85
853 3300048907 Ga0496104_1568453 Ga0496104_1568453_289_546 85
854 3300048908 Ga0496105_0011247 Ga0496105_0011247_2667_2936 85
855 3300048908 Ga0496105_0020951 Ga0496105_0020951_2871_3128 85
856 3300048908 Ga0496105_0389856 Ga0496105_0389856_787_1044 85
857 3300048909 Ga0496106_0026827 Ga0496106_0026827_3286_3549 85
858 3300048909 Ga0496106_0031902 Ga0496106_0031902_1193_1450 85
859 3300048909 Ga0496106_0046979 Ga0496106_0046979_1048_1317 85
860 3300048910 Ga0496107_0014561 Ga0496107_0014561_82_339 85
861 3300048910 Ga0496107_0169046 Ga0496107_0169046_453_716 85
862 3300048911 Ga0496108_0043218 Ga0496108_0043218_2800_3069 85
863 3300048911 Ga0496108_0094038 Ga0496108_0094038_535_798 85
864 3300048911 Ga0496108_0490131 Ga0496108_0490131_787_1044 85
865 3300048911 Ga0496108_0615137 Ga0496108_0615137_95_355 85
866 3300048912 Ga0496109_0028587 Ga0496109_0028587_107_364 85
867 3300048912 Ga0496109_0038696 Ga0496109_0038696_231_500 85
868 3300048912 Ga0496109_0161278 Ga0496109_0161278_1742_2002 85
869 3300048912 Ga0496109_0570771 Ga0496109_0570771_16_279 85
870 3300048913 Ga0496110_0053465 Ga0496110_0053465_652_909 85
871 3300048913 Ga0496110_0088670 Ga0496110_0088670_226_495 85
872 3300048913 Ga0496110_1504467 Ga0496110_1504467_184_441 85
873 3300048914 Ga0496111_0099650 Ga0496111_0099650_940_1197 85
874 3300048914 Ga0496111_0130090 Ga0496111_0130090_1507_1764 85
875 3300048914 Ga0496111_0276131 Ga0496111_0276131_970_1230 85
876 3300048914 Ga0496111_0299562 Ga0496111_0299562_165_428 85
877 3300048914 Ga0496111_0344774 Ga0496111_0344774_284_541 85
878 3300048914 Ga0496111_0718387 Ga0496111_0718387_388_645 85
879 3300048915 Ga0496112_0010586 Ga0496112_0010586_6413_6676 85
880 3300048915 Ga0496112_0068948 Ga0496112_0068948_2250_2519 85
881 3300048915 Ga0496112_0559267 Ga0496112_0559267_223_480 85
882 3300048915 Ga0496112_0603281 Ga0496112_0603281_743_1000 85
883 3300048916 Ga0496113_0033763 Ga0496113_0033763_71_340 85
884 3300048916 Ga0496113_0430197 Ga0496113_0430197_661_918 85
885 3300048916 Ga0496113_0489284 Ga0496113_0489284_697_960 85
886 3300048917 Ga0496114_0024702 Ga0496114_0024702_2933_3190 85
887 3300048917 Ga0496114_0054153 Ga0496114_0054153_64_321 85
888 3300048917 Ga0496114_0141757 Ga0496114_0141757_1024_1293 85
889 3300048917 Ga0496114_0374728 Ga0496114_0374728_953_1210 85
890 3300048917 Ga0496114_0481440 Ga0496114_0481440_216_485 85
891 3300048918 Ga0496115_0006501 Ga0496115_0006501_5528_5785 85
892 3300048918 Ga0496115_0017237 Ga0496115_0017237_4601_4870 85
893 3300048918 Ga0496115_0132938 Ga0496115_0132938_271_531 85
894 3300048919 Ga0496116_0064344 Ga0496116_0064344_656_913 85
895 3300048924 Ga0496121_0003622 Ga0496121_0003622_7248_7505 85
896 3300048924 Ga0496121_0021812 Ga0496121_0021812_4613_4870 85
897 3300048924 Ga0496121_0058140 Ga0496121_0058140_2312_2569 85
898 3300048924 Ga0496121_0079072 Ga0496121_0079072_1008_1265 85
899 3300048924 Ga0496121_0257078 Ga0496121_0257078_446_703 85
900 3300048926 Ga0496123_0164615 Ga0496123_0164615_650_907 85
901 3300048929 Ga0496126_0003918 Ga0496126_0003918_3591_3848 85
902 3300048929 Ga0496126_0162705 Ga0496126_0162705_59_316 85
903 3300048929 Ga0496126_0191243 Ga0496126_0191243_479_736 85
904 3300048929 Ga0496126_0421113 Ga0496126_0421113_79_336 85
905 3300049459 Ga0495678_067495 Ga0495678_067495_852_1109 85
906 3300049460 Ga0495682_0185262 Ga0495682_0185262_50_307 85
907 3300049531 Ga0501315_060822 Ga0501315_060822_37_306 85
908 3300050489 nmdc:mga03683_311918_c1 nmdc:mga03683_311918_c1_39_296 85
909 3300050490 nmdc:mga03n38_30616_c2 nmdc:mga03n38_30616_c2_263_523 85
910 3300050490 nmdc:mga03n38_4045_c1 nmdc:mga03n38_4045_c1_907_1164 85
911 3300050490 nmdc:mga03n38_41091_c1 nmdc:mga03n38_41091_c1_793_1050 85
912 3300050490 nmdc:mga03n38_904321_c1 nmdc:mga03n38_904321_c1_104_361 85
913 3300050491 nmdc:mga00v17_458905_c1 nmdc:mga00v17_458905_c1_35_295 85
914 3300050491 nmdc:mga00v17_916149_c1 nmdc:mga00v17_916149_c1_20_277 85
915 3300050492 nmdc:mga0yw44_147071_c1 nmdc:mga0yw44_147071_c1_667_924 85
916 3300050492 nmdc:mga0yw44_167125_c1 nmdc:mga0yw44_167125_c1_863_1120 85
917 3300050492 nmdc:mga0yw44_189271_c1 nmdc:mga0yw44_189271_c1_974_1231 85
918 3300050492 nmdc:mga0yw44_343682_c1 nmdc:mga0yw44_343682_c1_437_697 85
919 3300050492 nmdc:mga0yw44_36131_c1 nmdc:mga0yw44_36131_c1_760_1017 85
920 3300050493 nmdc:mga0k408_118194_c1 nmdc:mga0k408_118194_c1_394_651 85
921 3300050493 nmdc:mga0k408_382734_c1 nmdc:mga0k408_382734_c1_437_694 85
922 3300050494 nmdc:mga06z11_120038_c1 nmdc:mga06z11_120038_c1_654_911 85
923 3300050494 nmdc:mga06z11_471347_c1 nmdc:mga06z11_471347_c1_216_473 85
924 3300050494 nmdc:mga06z11_62524_c1 nmdc:mga06z11_62524_c1_379_636 85
925 3300050494 nmdc:mga06z11_92545_c1 nmdc:mga06z11_92545_c1_632_889 85
926 3300050494 nmdc:mga06z11_986522_c1 nmdc:mga06z11_986522_c1_200_460 85
927 3300050495 nmdc:mga04h51_216478_c1 nmdc:mga04h51_216478_c1_148_405 85
928 3300050495 nmdc:mga04h51_231998_c1 nmdc:mga04h51_231998_c1_150_407 85
929 3300050495 nmdc:mga04h51_23622_c1 nmdc:mga04h51_23622_c1_659_916 85
930 3300050496 nmdc:mga07m45_3883_c1 nmdc:mga07m45_3883_c1_6051_6308 85
931 3300050496 nmdc:mga07m45_447027_c1 nmdc:mga07m45_447027_c1_309_566 85
932 3300050496 nmdc:mga07m45_86964_c1 nmdc:mga07m45_86964_c1_1216_1473 85
933 3300050513 nmdc:mga0rr50_720424_c1 nmdc:mga0rr50_720424_c1_477_734 85
934 3300050514 nmdc:mga08x19_992255_c1 nmdc:mga08x19_992255_c1_192_449 85
935 3300050516 nmdc:mga0sz30_593296_c1 nmdc:mga0sz30_593296_c1_191_448 85
936 3300050516 nmdc:mga0sz30_59677_c1 nmdc:mga0sz30_59677_c1_1089_1346 85
937 3300053078 Ga0495612_0093779 Ga0495612_0093779_773_1030 85
938 3300053080 Ga0500635_0099609 Ga0500635_0099609_228_485 85
939 3300053084 Ga0495595_0001042 Ga0495595_0001042_1057_1317 85
940 3300053084 Ga0495595_0036630 Ga0495595_0036630_229_498 85
941 3300053084 Ga0495595_0060983 Ga0495595_0060983_1276_1545 85
942 3300053085 Ga0495619_0002925 Ga0495619_0002925_7196_7456 85
943 3300053085 Ga0495619_0069905 Ga0495619_0069905_1749_2018 85
944 3300053090 Ga0500646_0078978 Ga0500646_0078978_254_511 85
945 3300053091 Ga0500647_0197851 Ga0500647_0197851_83_340 85
946 3300053092 Ga0500583_0111877 Ga0500583_0111877_76_333 85
947 3300053093 Ga0500651_0703078 Ga0500651_0703078_67_324 85
948 3300053094 Ga0500566_0000047 Ga0500566_0000047_42944_43201 85
949 3300053094 Ga0500566_0002386 Ga0500566_0002386_2777_3034 85
950 3300053094 Ga0500566_0095747 Ga0500566_0095747_906_1166 85
951 3300053095 Ga0500640_001486 Ga0500640_001486_6197_6454 85
952 3300053096 Ga0500641_0004333 Ga0500641_0004333_1963_2220 85
953 3300053098 Ga0500650_0276304 Ga0500650_0276304_404_661 85
954 3300053098 Ga0500650_0440191 Ga0500650_0440191_217_474 85
955 3300053104 Ga0500556_0005914 Ga0500556_0005914_418_675 85
956 3300053104 Ga0500556_0424974 Ga0500556_0424974_61_318 85
957 3300053108 Ga0500562_132380 Ga0500562_132380_53_310 85
958 3300053109 Ga0500569_186771 Ga0500569_186771_88_345 85
959 3300053111 Ga0500572_000071 Ga0500572_000071_13797_14054 85
960 3300053115 Ga0500591_034835 Ga0500591_034835_2105_2362 85
961 3300053119 Ga0500595_007366 Ga0500595_007366_3419_3676 85
962 3300053119 Ga0500595_020065 Ga0500595_020065_1989_2246 85
963 3300053123 Ga0500614_000552 Ga0500614_000552_3816_4073 85
964 3300053126 Ga0500621_268059 Ga0500621_268059_238_495 85
965 3300053130 Ga0500642_0464607 Ga0500642_0464607_237_494 85
966 3300053133 Ga0500655_052599 Ga0500655_052599_110_367 85
967 3300053133 Ga0500655_080920 Ga0500655_080920_167_427 85
968 3300053134 Ga0500658_0204496 Ga0500658_0204496_422_679 85
969 3300053136 Ga0500559_0005925 Ga0500559_0005925_2483_2740 85
970 3300053136 Ga0500559_0239828 Ga0500559_0239828_511_768 85
971 3300053139 Ga0500568_0034974 Ga0500568_0034974_932_1189 85
972 3300053139 Ga0500568_0053267 Ga0500568_0053267_20_277 85
973 3300053139 Ga0500568_0288571 Ga0500568_0288571_103_360 85
974 3300053142 Ga0500577_0078346 Ga0500577_0078346_612_869 85
975 3300053143 Ga0500579_279576 Ga0500579_279576_235_492 85
976 3300053146 Ga0500588_0377568 Ga0500588_0377568_184_441 85
977 3300053147 Ga0500589_112624 Ga0500589_112624_53_310 85
978 3300053148 Ga0500590_172573 Ga0500590_172573_543_800 85
979 3300053148 Ga0500590_232649 Ga0500590_232649_345_605 85
980 3300053150 Ga0500603_000190 Ga0500603_000190_7919_8176 85
981 3300053151 Ga0500604_0183312 Ga0500604_0183312_265_522 85
982 3300053158 Ga0500627_0174424 Ga0500627_0174424_383_640 85
983 3300053158 Ga0500627_0495969 Ga0500627_0495969_50_307 85
984 3300053159 Ga0500630_001753 Ga0500630_001753_1365_1622 85
985 3300053160 Ga0500633_0260601 Ga0500633_0260601_354_611 85
986 3300053161 Ga0500634_0168913 Ga0500634_0168913_682_939 85
987 3300053161 Ga0500634_0352715 Ga0500634_0352715_35_292 85
988 3300053162 Ga0500638_050493 Ga0500638_050493_1317_1574 85
989 3300053163 Ga0500639_000087 Ga0500639_000087_17306_17563 85
990 3300053163 Ga0500639_180715 Ga0500639_180715_504_761 85
991 3300053178 Ga0500637_0139935 Ga0500637_0139935_846_1103 85
992 3300053178 Ga0500637_0159095 Ga0500637_0159095_739_996 85
993 3300053725 Ga0500576_210813 Ga0500576_210813_179_436 85
994 3300053728 Ga0500657_177386 Ga0500657_177386_363_620 85
995 3300053731 Ga0500609_006198 Ga0500609_006198_249_506 85
996 3300053735 Ga0500596_000958 Ga0500596_000958_4412_4669 85
997 3300053737 Ga0500601_023501 Ga0500601_023501_32_289 85
998 3300055283 Ga0500661_034556 Ga0500661_034556_70_327 85
999 3300059477 Ga0587084_114439 Ga0587084_114439_80_337 85
1000 3300059490 Ga0587066_179457 Ga0587066_179457_140_397 85
1001 3300059491 Ga0587070_122016 Ga0587070_122016_146_403 85
1002 3300059505 Ga0587083_0189321 Ga0587083_0189321_174_431 85
1003 3300059506 Ga0587085_168268 Ga0587085_168268_145_414 85
1004 3300059508 Ga0587088_164094 Ga0587088_164094_138_395 85
1005 3300059510 Ga0587090_115060 Ga0587090_115060_292_549 85
1006 3300059511 Ga0587091_240738 Ga0587091_240738_218_475 85
1007 3300059512 Ga0587092_112323 Ga0587092_112323_273_530 85
1008 3300059513 Ga0587094_131233 Ga0587094_131233_28_285 85
1009 3300059623 Ga0587101_069978 Ga0587101_069978_44_301 85
1010 3300059623 Ga0587101_112396 Ga0587101_112396_151_408 85
1011 3300059624 Ga0587109_074498 Ga0587109_074498_339_596 85
1012 3300059627 Ga0587117_133487 Ga0587117_133487_28_285 85
1013 3300059641 Ga0587068_163424 Ga0587068_163424_28_285 85
1014 3300059642 Ga0587069_129982 Ga0587069_129982_222_479 85
1015 3300059644 Ga0587075_066830 Ga0587075_066830_127_384 85
1016 3300059644 Ga0587075_082130 Ga0587075_082130_214_471 85
1017 3300059645 Ga0587076_208143 Ga0587076_208143_28_285 85
1018 3300059646 Ga0587078_064624 Ga0587078_064624_28_285 85
1019 3300059647 Ga0587079_092162 Ga0587079_092162_318_575 85
1020 3300059647 Ga0587079_099550 Ga0587079_099550_128_385 85
1021 3300059647 Ga0587079_200664 Ga0587079_200664_248_505 85
1022 3300059649 Ga0587102_041714 Ga0587102_041714_223_483 85
1023 3300060344 Ga0587071_077994 Ga0587071_077994_117_374 85
1024 3300060346 Ga0587111_0088831 Ga0587111_0088831_349_606 85
1025 3300060346 Ga0587111_0162230 Ga0587111_0162230_306_563 85
1026 3300060346 Ga0587111_0167082 Ga0587111_0167082_137_394 85

Feature Viewer

pLDDT pTM Quality
60.61 0.23 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map