F488443

General Info

Members Datasets Scaffolds Average Seq Length
1023 306 2046 108

Family's Representative Sequence

Representative Sequence 3300025929|Ga0207664_10207285|Ga0207664_102072853
Length 116
Sequence MDEDELDVPEPDSDERRLNIQMPAELIGGTYANFANVSFSQYEFTLTFARIEHEVEEGDVPGAVVARVNASPRFIPELIAALQDSYSKYVTREGIRNLPEAQGHSDADDTSASPGG

Samples

Sample ID Description Type Environment
1 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
76 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
77 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
84 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
124 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
125 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
126 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
127 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
128 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
129 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
132 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
133 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
134 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
135 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
136 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
137 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
138 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
139 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
150 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
151 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
152 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
153 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
154 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
155 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
160 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
179 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
180 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
181 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
182 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
183 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
184 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
185 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
186 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
187 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
188 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
189 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
190 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
191 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
194 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
195 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
196 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
197 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
198 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
199 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
207 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
208 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
211 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
212 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
213 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
214 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
215 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
216 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
217 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
218 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
219 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
220 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
221 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
222 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
223 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
224 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
225 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
226 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
227 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
230 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
231 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
232 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
233 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
234 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
235 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
236 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
237 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
238 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
239 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
240 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
241 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
242 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
243 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
244 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
245 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
246 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
247 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
248 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
249 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
250 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
251 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
252 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
257 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
258 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
259 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
260 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
261 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
262 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
263 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
264 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
265 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
266 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
270 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
271 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
272 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
273 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
274 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
275 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
276 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
277 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
278 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
279 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
280 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
281 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
282 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
286 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
287 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
288 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
289 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
290 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
291 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
292 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
293 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
294 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
295 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
296 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
297 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
298 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
299 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
300 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
301 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
302 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
303 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
304 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
305 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
306 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0.98
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 8.02
Rhizosphere 91.1
Stem 0
Stem Tuber 0
Unclassified 15.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207664_10207285 3300025929 Bacteria 1695
2 Ga0070658_10009734 3300005327 Bacteria 7719
3 Ga0070658_10085504 3300005327 Bacteria 2594
4 Ga0070658_10374225 3300005327 Bacteria 1221
5 Ga0070658_10566130 3300005327 Bacteria 984
6 Ga0070658_11277009 3300005327 Unclassified 638
7 Ga0070683_100000682 3300005329 Bacteria 24589
8 Ga0070683_100046995 3300005329 Bacteria 3988
9 Ga0070683_100106628 3300005329 Bacteria 2642
10 Ga0070683_100629443 3300005329 Bacteria 1027
11 Ga0070680_100014283 3300005336 Bacteria 6202
12 Ga0070680_100105611 3300005336 Bacteria 2341
13 Ga0070680_100210240 3300005336 Bacteria 1641
14 Ga0070680_100445605 3300005336 Bacteria 1106
15 Ga0070680_100564676 3300005336 Unclassified 976
16 Ga0070682_100015147 3300005337 Bacteria 4464
17 Ga0070682_101354349 3300005337 Unclassified 607
18 Ga0070682_101787717 3300005337 Bacteria 536
19 Ga0068868_101450820 3300005338 Bacteria 641
20 Ga0070660_100001782 3300005339 Bacteria 14790
21 Ga0070660_100003328 3300005339 Bacteria 11044
22 Ga0070660_100031738 3300005339 Bacteria 3969
23 Ga0070660_100031952 3300005339 Bacteria 3958
24 Ga0070691_10056155 3300005341 Bacteria 1886
25 Ga0070691_10253315 3300005341 Bacteria 945
26 Ga0070687_101231344 3300005343 Unclassified 553
27 Ga0070661_100086770 3300005344 Bacteria 2314
28 Ga0070661_100259758 3300005344 Unclassified 1342
29 Ga0070661_100952102 3300005344 Bacteria 710
30 Ga0070671_100034613 3300005355 Bacteria 4182
31 Ga0070659_100846421 3300005366 Unclassified 797
32 Ga0070659_100857674 3300005366 Unclassified 792
33 Ga0070709_10008335 3300005434 Bacteria 5691
34 Ga0070709_10067769 3300005434 Bacteria 2293
35 Ga0070709_10078187 3300005434 Bacteria 2152
36 Ga0070709_10090319 3300005434 Bacteria 2019
37 Ga0070709_10463584 3300005434 Unclassified 956
38 Ga0070709_11766686 3300005434 Unclassified 506
39 Ga0070714_100002904 3300005435 Bacteria 12681
40 Ga0070714_100049516 3300005435 Bacteria 3576
41 Ga0070714_100071577 3300005435 Bacteria 2999
42 Ga0070714_100092539 3300005435 Bacteria 2650
43 Ga0070714_100094496 3300005435 Bacteria 2624
44 Ga0070714_100112726 3300005435 Bacteria 2410
45 Ga0070714_100215384 3300005435 Bacteria 1763
46 Ga0070714_100218997 3300005435 Unclassified 1749
47 Ga0070714_100431830 3300005435 Bacteria 1249
48 Ga0070714_100471587 3300005435 Bacteria 1194
49 Ga0070714_101529976 3300005435 Bacteria 652
50 Ga0070714_101842380 3300005435 Unclassified 591
51 Ga0070713_100000801 3300005436 Bacteria 20125
52 Ga0070713_100024783 3300005436 Bacteria 4680
53 Ga0070713_100518532 3300005436 Unclassified 1126
54 Ga0070710_10009224 3300005437 Bacteria 4822
55 Ga0070710_10025527 3300005437 Bacteria 3130
56 Ga0070710_10448744 3300005437 Unclassified 874
57 Ga0070710_10512121 3300005437 Bacteria 823
58 Ga0070710_10890300 3300005437 Bacteria 642
59 Ga0070711_100002572 3300005439 Bacteria 10383
60 Ga0070711_100053954 3300005439 Bacteria 2772
61 Ga0070711_100060945 3300005439 Bacteria 2625
62 Ga0070711_100926352 3300005439 Bacteria 745
63 Ga0070711_101064732 3300005439 Bacteria 696
64 Ga0070694_100247988 3300005444 Bacteria 1346
65 Ga0070694_100266842 3300005444 Bacteria 1300
66 Ga0070708_100635391 3300005445 Bacteria 1006
67 Ga0070663_101443352 3300005455 Bacteria 610
68 Ga0070681_10046923 3300005458 Bacteria 4319
69 Ga0070681_10071171 3300005458 Bacteria 3442
70 Ga0070681_10082518 3300005458 Bacteria 3170
71 Ga0070681_10152629 3300005458 Bacteria 2236
72 Ga0070681_10190835 3300005458 Bacteria 1968
73 Ga0070681_10211448 3300005458 Bacteria 1856
74 Ga0070681_10226054 3300005458 Bacteria 1786
75 Ga0070681_10227477 3300005458 Bacteria 1780
76 Ga0070681_10243805 3300005458 Bacteria 1710
77 Ga0070706_100718497 3300005467 Unclassified 926
78 Ga0070706_101700403 3300005467 Bacteria 575
79 Ga0070707_100022323 3300005468 Bacteria 5982
80 Ga0070707_100035404 3300005468 Bacteria 4762
81 Ga0070707_100243368 3300005468 Bacteria 1751
82 Ga0070707_100880331 3300005468 Unclassified 860
83 Ga0070698_100041252 3300005471 Bacteria 4738
84 Ga0070698_100049309 3300005471 Bacteria 4298
85 Ga0070698_100133400 3300005471 Bacteria 2438
86 Ga0070698_100366155 3300005471 Bacteria 1373
87 Ga0070699_100218255 3300005518 Bacteria 1699
88 Ga0070699_100274647 3300005518 Bacteria 1509
89 Ga0070699_100437513 3300005518 Bacteria 1185
90 Ga0070679_100012002 3300005530 Bacteria 8268
91 Ga0070679_100031188 3300005530 Bacteria 5265
92 Ga0070679_100091661 3300005530 Bacteria 3027
93 Ga0070679_100179570 3300005530 Bacteria 2089
94 Ga0070679_100230258 3300005530 Bacteria 1813
95 Ga0070679_100332401 3300005530 Bacteria 1468
96 Ga0070679_100399888 3300005530 Bacteria 1320
97 Ga0070684_100008210 3300005535 Bacteria 8157
98 Ga0070684_100071994 3300005535 Bacteria 3042
99 Ga0070684_101479769 3300005535 Bacteria 640
100 Ga0070695_100000265 3300005545 Bacteria 26294
101 Ga0070696_100815919 3300005546 Unclassified 769
102 Ga0070693_100409806 3300005547 Bacteria 942
103 Ga0070704_100109343 3300005549 Unclassified 2100
104 Ga0068855_100006484 3300005563 Bacteria 14232
105 Ga0068855_100409946 3300005563 Bacteria 1484
106 Ga0068855_100818834 3300005563 Bacteria 988
107 Ga0068855_100947419 3300005563 Unclassified 907
108 Ga0070664_101171552 3300005564 Bacteria 725
109 Ga0068857_100199718 3300005577 Bacteria 1823
110 Ga0068857_101844116 3300005577 Bacteria 592
111 Ga0068856_100098406 3300005614 Bacteria 2915
112 Ga0068856_100115279 3300005614 Bacteria 2686
113 Ga0068856_100427551 3300005614 Unclassified 1344
114 Ga0068856_100497399 3300005614 Bacteria 1240
115 Ga0068856_101493298 3300005614 Bacteria 690
116 Ga0070702_100050938 3300005615 Bacteria 2368
117 Ga0068852_100242824 3300005616 Unclassified 1722
118 Ga0068852_101119958 3300005616 Bacteria 807
119 Ga0068852_101257571 3300005616 Bacteria 762
120 Ga0068858_100683461 3300005842 Bacteria 998
121 Ga0068860_101767756 3300005843 Bacteria 640
122 Ga0070717_10007082 3300006028 Bacteria 8307
123 Ga0070717_10013600 3300006028 Bacteria 6243
124 Ga0070717_10031923 3300006028 Bacteria 4240
125 Ga0070717_10049217 3300006028 Bacteria 3459
126 Ga0070717_10176291 3300006028 Bacteria 1861
127 Ga0070717_10426752 3300006028 Bacteria 1193
128 Ga0070717_10477044 3300006028 Bacteria 1126
129 Ga0070717_10680881 3300006028 Bacteria 934
130 Ga0070717_10919315 3300006028 Unclassified 797
131 Ga0075365_10849160 3300006038 Unclassified 644
132 Ga0070715_10005269 3300006163 Bacteria 4300
133 Ga0070716_100003859 3300006173 Bacteria 7114
134 Ga0070716_100018111 3300006173 Bacteria 3664
135 Ga0070716_100020120 3300006173 Bacteria 3500
136 Ga0070716_100210958 3300006173 Bacteria 1298
137 Ga0070716_100436688 3300006173 Bacteria 951
138 Ga0070716_101581982 3300006173 Unclassified 538
139 Ga0070712_100028000 3300006175 Bacteria 3766
140 Ga0070712_100058473 3300006175 Bacteria 2712
141 Ga0070712_100253298 3300006175 Unclassified 1408
142 Ga0070712_100445355 3300006175 Bacteria 1077
143 Ga0070712_100837485 3300006175 Bacteria 791
144 Ga0070712_101081141 3300006175 Bacteria 696
145 Ga0075433_10324794 3300006852 Unclassified 1361
146 Ga0075433_10430070 3300006852 Bacteria 1164
147 Ga0075433_10493077 3300006852 Bacteria 1079
148 Ga0075434_100013210 3300006871 Bacteria 7847
149 Ga0068865_100417737 3300006881 Bacteria 1102
150 Ga0075436_100167210 3300006914 Bacteria 1552
151 Ga0075436_101282923 3300006914 Bacteria 554
152 Ga0075435_100725352 3300007076 Unclassified 864
153 Ga0075435_101357572 3300007076 Archaea 623
154 Ga0099795_10454618 3300007788 Unclassified 590
155 Ga0105240_10037102 3300009093 Bacteria 6265
156 Ga0105240_10058261 3300009093 Bacteria 4822
157 Ga0105240_10640569 3300009093 Unclassified 1166
158 Ga0105240_10808587 3300009093 Unclassified 1015
159 Ga0105240_11669978 3300009093 Bacteria 665
160 Ga0111539_11408433 3300009094 Unclassified 809
161 Ga0105245_10173604 3300009098 Bacteria 2054
162 Ga0105245_10496423 3300009098 Bacteria 1236
163 Ga0105245_11460550 3300009098 Bacteria 734
164 Ga0105247_10055600 3300009101 Bacteria 2442
165 Ga0114129_11629417 3300009147 Unclassified 789
166 Ga0105242_10433116 3300009176 Bacteria 1235
167 Ga0105242_10525862 3300009176 Bacteria 1129
168 Ga0105242_11776964 3300009176 Bacteria 654
169 Ga0105248_10493375 3300009177 Bacteria 1380
170 Ga0105248_10780279 3300009177 Bacteria 1078
171 Ga0105248_10806199 3300009177 Bacteria 1060
172 Ga0105237_10039879 3300009545 Bacteria 4738
173 Ga0105237_12118390 3300009545 Unclassified 571
174 Ga0105237_12284450 3300009545 Unclassified 551
175 Ga0105238_10035269 3300009551 Bacteria 5086
176 Ga0105238_11299361 3300009551 Unclassified 753
177 Ga0105238_11756639 3300009551 Bacteria 652
178 Ga0099796_10360770 3300010159 Bacteria 629
179 Ga0105239_10125430 3300010375 Bacteria 2853
180 Ga0105239_10606228 3300010375 Unclassified 1249
181 Ga0157373_10141834 3300013100 Bacteria 1690
182 Ga0157373_10208399 3300013100 Bacteria 1378
183 Ga0157373_10608029 3300013100 Bacteria 796
184 Ga0157371_10144028 3300013102 Bacteria 1698
185 Ga0157371_10569547 3300013102 Bacteria 841
186 Ga0157370_10009353 3300013104 Bacteria 10485
187 Ga0157370_10017077 3300013104 Bacteria 7331
188 Ga0157370_10141323 3300013104 Bacteria 2243
189 Ga0157370_10530462 3300013104 Unclassified 1080
190 Ga0157370_10605538 3300013104 Unclassified 1003
191 Ga0157370_11335105 3300013104 Unclassified 646
192 Ga0157370_11389367 3300013104 Bacteria 632
193 Ga0157370_11804151 3300013104 Unclassified 549
194 Ga0157370_11812284 3300013104 Unclassified 548
195 Ga0157369_10001145 3300013105 Bacteria 33059
196 Ga0157369_10019029 3300013105 Bacteria 7689
197 Ga0157369_10040236 3300013105 Bacteria 5104
198 Ga0157369_10416301 3300013105 Bacteria 1393
199 Ga0157369_10586687 3300013105 Bacteria 1151
200 Ga0157369_11171477 3300013105 Bacteria 785
201 Ga0157369_11246815 3300013105 Bacteria 758
202 Ga0157374_10120956 3300013296 Bacteria 2527
203 Ga0157374_10139452 3300013296 Bacteria 2353
204 Ga0157374_10882096 3300013296 Bacteria 912
205 Ga0157378_11129856 3300013297 Bacteria 821
206 Ga0163162_10245382 3300013306 Bacteria 1923
207 Ga0157372_10095372 3300013307 Bacteria 3389
208 Ga0157372_10219081 3300013307 Bacteria 2206
209 Ga0157372_10458840 3300013307 Bacteria 1485
210 Ga0157372_10560087 3300013307 Bacteria 1332
211 Ga0157372_10917960 3300013307 Bacteria 1015
212 Ga0157372_10990852 3300013307 Bacteria 973
213 Ga0157372_11772468 3300013307 Unclassified 710
214 Ga0157372_12066558 3300013307 Unclassified 655
215 Ga0157372_13230627 3300013307 Bacteria 520
216 Ga0157375_10327714 3300013308 Bacteria 1696
217 Ga0163163_12825034 3300014325 Unclassified 542
218 Ga0182008_10016723 3300014497 Bacteria 3806
219 Ga0182008_10099413 3300014497 Bacteria 1437
220 Ga0182008_10246628 3300014497 Bacteria 920
221 Ga0182008_10523615 3300014497 Bacteria 655
222 Ga0182008_10584864 3300014497 Bacteria 624
223 Ga0182008_10882034 3300014497 Bacteria 525
224 Ga0157379_10191763 3300014968 Unclassified 1847
225 Ga0157376_10017404 3300014969 Bacteria 5482
226 Ga0157376_11582992 3300014969 Unclassified 689
227 Ga0157376_12130055 3300014969 Unclassified 599
228 Ga0182006_1016295 3300015261 Bacteria 3171
229 Ga0182007_10018540 3300015262 Bacteria 2519
230 Ga0206356_10582850 3300020070 Bacteria 641
231 Ga0206356_11584572 3300020070 Bacteria 1564
232 Ga0206349_1467851 3300020075 Unclassified 666
233 Ga0206354_10451936 3300020081 Bacteria 3526
234 Ga0206354_10531976 3300020081 Unclassified 1148
235 Ga0206354_11239232 3300020081 Bacteria 879
236 Ga0206353_10289596 3300020082 Bacteria 1256
237 Ga0206353_11314291 3300020082 Bacteria 763
238 Ga0206353_12040664 3300020082 Bacteria 5700
239 Ga0213874_10046469 3300021377 Bacteria 1318
240 Ga0213876_10487114 3300021384 Bacteria 656
241 Ga0213871_10030518 3300021441 Bacteria 1403
242 Ga0224712_10655245 3300022467 Bacteria 515
243 Ga0207692_10023816 3300025898 Bacteria 2837
244 Ga0207692_10037256 3300025898 Bacteria 2378
245 Ga0207692_10330626 3300025898 Unclassified 935
246 Ga0207692_11084736 3300025898 Bacteria 530
247 Ga0207710_10062626 3300025900 Unclassified 1691
248 Ga0207647_10590702 3300025904 Bacteria 613
249 Ga0207685_10001113 3300025905 Bacteria 5343
250 Ga0207699_10026168 3300025906 Bacteria 3212
251 Ga0207699_10045831 3300025906 Bacteria 2554
252 Ga0207699_10046097 3300025906 Bacteria 2548
253 Ga0207699_10057762 3300025906 Bacteria 2318
254 Ga0207699_10068842 3300025906 Bacteria 2156
255 Ga0207699_10069126 3300025906 Bacteria 2152
256 Ga0207705_10017947 3300025909 Bacteria 5061
257 Ga0207705_10065177 3300025909 Bacteria 2633
258 Ga0207705_10067247 3300025909 Bacteria 2593
259 Ga0207705_10203568 3300025909 Bacteria 1500
260 Ga0207705_10238310 3300025909 Bacteria 1385
261 Ga0207684_10828969 3300025910 Unclassified 781
262 Ga0207707_10024218 3300025912 Bacteria 5311
263 Ga0207707_10025872 3300025912 Bacteria 5132
264 Ga0207707_10095478 3300025912 Bacteria 2598
265 Ga0207707_10112571 3300025912 Bacteria 2379
266 Ga0207707_10190270 3300025912 Bacteria 1790
267 Ga0207707_10231095 3300025912 Bacteria 1609
268 Ga0207707_10290210 3300025912 Bacteria 1415
269 Ga0207695_10225920 3300025913 Bacteria 1778
270 Ga0207695_10277597 3300025913 Bacteria 1570
271 Ga0207695_10667101 3300025913 Bacteria 921
272 Ga0207671_10190994 3300025914 Bacteria 1597
273 Ga0207693_10000814 3300025915 Bacteria 27803
274 Ga0207693_10000920 3300025915 Bacteria 26422
275 Ga0207693_10065202 3300025915 Bacteria 2853
276 Ga0207693_10259586 3300025915 Bacteria 1363
277 Ga0207693_10283420 3300025915 Bacteria 1298
278 Ga0207693_10395283 3300025915 Bacteria 1081
279 Ga0207693_10770359 3300025915 Bacteria 743
280 Ga0207663_10015847 3300025916 Bacteria 4168
281 Ga0207663_10096802 3300025916 Unclassified 1972
282 Ga0207663_10699025 3300025916 Bacteria 803
283 Ga0207663_10772227 3300025916 Bacteria 764
284 Ga0207663_11134982 3300025916 Bacteria 629
285 Ga0207660_10019550 3300025917 Bacteria 4528
286 Ga0207660_10083143 3300025917 Bacteria 2357
287 Ga0207660_10309987 3300025917 Bacteria 1258
288 Ga0207660_10527571 3300025917 Bacteria 959
289 Ga0207662_10435502 3300025918 Bacteria 894
290 Ga0207657_10003170 3300025919 Bacteria 17601
291 Ga0207657_10008838 3300025919 Bacteria 10190
292 Ga0207657_10014486 3300025919 Bacteria 7695
293 Ga0207657_10026169 3300025919 Bacteria 5367
294 Ga0207649_10030184 3300025920 Bacteria 3208
295 Ga0207649_10030419 3300025920 Unclassified 3198
296 Ga0207649_10142378 3300025920 Unclassified 1642
297 Ga0207649_10205547 3300025920 Unclassified 1394
298 Ga0207649_10547393 3300025920 Unclassified 885
299 Ga0207652_10011197 3300025921 Bacteria 7226
300 Ga0207652_10071202 3300025921 Bacteria 3021
301 Ga0207652_10109179 3300025921 Bacteria 2452
302 Ga0207652_10176255 3300025921 Unclassified 1920
303 Ga0207652_10183542 3300025921 Bacteria 1881
304 Ga0207652_10213223 3300025921 Bacteria 1739
305 Ga0207652_10418300 3300025921 Bacteria 1209
306 Ga0207652_10571169 3300025921 Bacteria 1015
307 Ga0207652_10844137 3300025921 Bacteria 811
308 Ga0207652_11576738 3300025921 Unclassified 561
309 Ga0207646_10001386 3300025922 Bacteria 30019
310 Ga0207646_10035040 3300025922 Bacteria 4536
311 Ga0207646_10617919 3300025922 Bacteria 972
312 Ga0207646_10783520 3300025922 Unclassified 850
313 Ga0207687_10241320 3300025927 Bacteria 1432
314 Ga0207700_10000006 3300025928 Bacteria 348187
315 Ga0207700_10026419 3300025928 Bacteria 4047
316 Ga0207700_10194226 3300025928 Bacteria 1707
317 Ga0207700_10560598 3300025928 Unclassified 1015
318 Ga0207700_11184650 3300025928 Bacteria 682
319 Ga0207664_10001397 3300025929 Bacteria 15865
320 Ga0207664_10003898 3300025929 Bacteria 10020
321 Ga0207664_10017802 3300025929 Bacteria 5220
322 Ga0207664_10018691 3300025929 Bacteria 5109
323 Ga0207664_10032295 3300025929 Bacteria 4011
324 Ga0207664_10035157 3300025929 Bacteria 3864
325 Ga0207664_10054343 3300025929 Bacteria 3173
326 Ga0207664_10190644 3300025929 Bacteria 1764
327 Ga0207664_10200363 3300025929 Bacteria 1723
328 Ga0207664_10233746 3300025929 Unclassified 1598
329 Ga0207664_10458001 3300025929 Bacteria 1139
330 Ga0207664_10707705 3300025929 Bacteria 906
331 Ga0207664_11021426 3300025929 Bacteria 741
332 Ga0207664_11366455 3300025929 Bacteria 629
333 Ga0207664_11422224 3300025929 Bacteria 614
334 Ga0207664_11479422 3300025929 Bacteria 601
335 Ga0207644_10083224 3300025931 Bacteria 2369
336 Ga0207644_10386778 3300025931 Unclassified 1142
337 Ga0207690_10251900 3300025932 Unclassified 1364
338 Ga0207690_11346899 3300025932 Bacteria 597
339 Ga0207690_11811886 3300025932 Bacteria 510
340 Ga0207690_11837553 3300025932 Unclassified 506
341 Ga0207686_10536237 3300025934 Bacteria 913
342 Ga0207686_11233929 3300025934 Bacteria 613
343 Ga0207704_10421870 3300025938 Bacteria 1058
344 Ga0207665_10000247 3300025939 Bacteria 37247
345 Ga0207665_10005520 3300025939 Bacteria 8434
346 Ga0207665_10075321 3300025939 Bacteria 2311
347 Ga0207665_10360193 3300025939 Bacteria 1100
348 Ga0207665_10551896 3300025939 Bacteria 895
349 Ga0207665_11381714 3300025939 Unclassified 561
350 Ga0207711_10280780 3300025941 Bacteria 1534
351 Ga0207711_10429780 3300025941 Unclassified 1229
352 Ga0207711_10464403 3300025941 Bacteria 1179
353 Ga0207711_10964423 3300025941 Bacteria 792
354 Ga0207661_10025875 3300025944 Bacteria 4465
355 Ga0207661_10033486 3300025944 Bacteria 3989
356 Ga0207661_10266862 3300025944 Bacteria 1526
357 Ga0207679_10479241 3300025945 Unclassified 1107
358 Ga0207667_10182073 3300025949 Bacteria 2157
359 Ga0207667_10460936 3300025949 Bacteria 1291
360 Ga0207667_10700870 3300025949 Bacteria 1015
361 Ga0207640_10090763 3300025981 Bacteria 2115
362 Ga0207677_11062385 3300026023 Bacteria 736
363 Ga0207639_12297231 3300026041 Unclassified 501
364 Ga0207678_11260407 3300026067 Bacteria 654
365 Ga0207678_11271975 3300026067 Bacteria 651
366 Ga0207702_10088815 3300026078 Bacteria 2701
367 Ga0207702_10189089 3300026078 Bacteria 1901
368 Ga0207702_10669249 3300026078 Bacteria 1022
369 Ga0207702_11085766 3300026078 Unclassified 794
370 Ga0207702_11244060 3300026078 Bacteria 739
371 Ga0207641_10290913 3300026088 Bacteria 1540
372 Ga0207674_10124716 3300026116 Bacteria 2541
373 Ga0207683_10147298 3300026121 Bacteria 2124
374 Ga0207698_10248799 3300026142 Unclassified 1625
375 Ga0207698_10503608 3300026142 Bacteria 1179
376 Ga0265337_1016990 3300028556 Bacteria 2342
377 Ga0265326_10049203 3300028558 Bacteria 1194
378 Ga0265319_1007813 3300028563 Bacteria 4757
379 Ga0265319_1022703 3300028563 Bacteria 2281
380 Ga0265319_1025818 3300028563 Bacteria 2099
381 Ga0265319_1187408 3300028563 Bacteria 636
382 Ga0265334_10009412 3300028573 Bacteria 4132
383 Ga0265334_10059590 3300028573 Bacteria 1442
384 Ga0265334_10075215 3300028573 Bacteria 1252
385 Ga0265334_10248913 3300028573 Unclassified 612
386 Ga0265318_10000788 3300028577 Bacteria 21011
387 Ga0265318_10029227 3300028577 Bacteria 2150
388 Ga0265318_10038532 3300028577 Bacteria 1827
389 Ga0265318_10077287 3300028577 Bacteria 1231
390 Ga0265322_10012790 3300028654 Bacteria 2430
391 Ga0265322_10044206 3300028654 Bacteria 1268
392 Ga0265322_10048347 3300028654 Bacteria 1209
393 Ga0265336_10001699 3300028666 Bacteria 9698
394 Ga0265336_10037811 3300028666 Bacteria 1483
395 Ga0265336_10054715 3300028666 Bacteria 1201
396 Ga0265336_10101403 3300028666 Bacteria 858
397 Ga0265338_10002456 3300028800 Bacteria 27727
398 Ga0265338_10003688 3300028800 Bacteria 21332
399 Ga0265338_10011083 3300028800 Bacteria 10457
400 Ga0265338_10027009 3300028800 Bacteria 5772
401 Ga0265338_10042058 3300028800 Bacteria 4262
402 Ga0265338_10072190 3300028800 Bacteria 2948
403 Ga0265338_10083009 3300028800 Bacteria 2681
404 Ga0265338_10113409 3300028800 Bacteria 2177
405 Ga0265338_10195867 3300028800 Unclassified 1527
406 Ga0265324_10083740 3300029957 Bacteria 1085
407 Ga0265330_10000672 3300031235 Bacteria 21962
408 Ga0265330_10004373 3300031235 Bacteria 7174
409 Ga0265330_10094669 3300031235 Unclassified 1281
410 Ga0265332_10018992 3300031238 Bacteria 3034
411 Ga0265332_10057099 3300031238 Bacteria 1673
412 Ga0265332_10374389 3300031238 Bacteria 588
413 Ga0265332_10383295 3300031238 Bacteria 581
414 Ga0265328_10012489 3300031239 Bacteria 3379
415 Ga0265328_10068228 3300031239 Bacteria 1306
416 Ga0265320_10014307 3300031240 Bacteria 4522
417 Ga0265320_10099056 3300031240 Bacteria 1343
418 Ga0265320_10169979 3300031240 Unclassified 979
419 Ga0265325_10020864 3300031241 Bacteria 3606
420 Ga0265325_10045429 3300031241 Bacteria 2282
421 Ga0265325_10060819 3300031241 Bacteria 1917
422 Ga0265325_10079377 3300031241 Bacteria 1633
423 Ga0265329_10016823 3300031242 Bacteria 2528
424 Ga0265329_10050423 3300031242 Bacteria 1326
425 Ga0265340_10006639 3300031247 Bacteria 6346
426 Ga0265340_10211349 3300031247 Bacteria 871
427 Ga0265339_10014310 3300031249 Bacteria 4784
428 Ga0265339_10175665 3300031249 Bacteria 1069
429 Ga0265331_10008097 3300031250 Bacteria 6002
430 Ga0265331_10030596 3300031250 Bacteria 2680
431 Ga0265327_10006666 3300031251 Bacteria 9160
432 Ga0265327_10063059 3300031251 Bacteria 1883
433 Ga0265327_10081029 3300031251 Bacteria 1603
434 Ga0265316_10025347 3300031344 Bacteria 4950
435 Ga0265316_10068014 3300031344 Bacteria 2753
436 Ga0265313_10010563 3300031595 Bacteria 5823
437 Ga0265313_10028666 3300031595 Bacteria 2890
438 Ga0265313_10030697 3300031595 Bacteria 2762
439 Ga0265314_10007395 3300031711 Bacteria 9526
440 Ga0265314_10093079 3300031711 Bacteria 1957
441 Ga0265314_10098822 3300031711 Bacteria 1881
442 Ga0265314_10104317 3300031711 Unclassified 1816
443 Ga0265342_10011777 3300031712 Bacteria 5963
444 Ga0265342_10019089 3300031712 Bacteria 4424
445 Ga0265342_10210518 3300031712 Bacteria 1051
446 Ga0265342_10240671 3300031712 Unclassified 969
447 Ga0265342_10528442 3300031712 Unclassified 600
448 Ga0307405_10093478 3300031731 Bacteria 1998
449 Ga0307416_100246297 3300032002 Bacteria 1736
450 Ga0307415_100305825 3300032126 Bacteria 1319
451 Ga0373926_0012170 3300035083 Bacteria 2906
452 Ga0373929_0198666 3300035085 Bacteria 561
453 Ga0373934_0192213 3300035086 Unclassified 840
454 Ga0373944_0136839 3300035089 Bacteria 855
455 Ga0373949_0013045 3300035090 Bacteria 1842
456 Ga0373951_0139555 3300035091 Bacteria 672
457 Ga0373923_0601161 3300035111 Bacteria 542
458 Ga0373936_0125929 3300035113 Bacteria 1098
459 Ga0373945_0581142 3300035116 Unclassified 505
460 Ga0373956_0463976 3300035119 Bacteria 604
461 Ga0373957_0313898 3300035120 Unclassified 666
462 Ga0373960_0292337 3300035121 Unclassified 604
463 Ga0373943_0001012 3300035170 Bacteria 12501
464 Ga0373943_0503745 3300035170 Unclassified 708
465 Ga0373946_0063315 3300035171 Bacteria 1579
466 Ga0373955_0035019 3300035172 Unclassified 2656
467 Ga0373955_1019257 3300035172 Bacteria 510
468 Ga0373961_0243972 3300035241 Unclassified 648
469 Ga0373931_0010780 3300035691 Bacteria 4401
470 Ga0373935_0047048 3300035692 Bacteria 2726
471 Ga0373927_0049245 3300035695 Bacteria 2725
472 Ga0373933_0048671 3300035724 Bacteria 2525
473 Ga0373947_0001552 3300035725 Bacteria 14072
474 Ga0373937_0000355 3300036401 Bacteria 42585
475 Ga0373937_0317727 3300036401 Bacteria 1473
476 Ga0373937_0379173 3300036401 Bacteria 1341
477 Ga0373937_1483170 3300036401 Unclassified 626
478 Ga0373937_1902801 3300036401 Bacteria 541
479 Ga0373925_0007406 3300037068 Bacteria 8008
480 Ga0395899_0080577 3300037312 Bacteria 2369
481 Ga0395899_0102523 3300037312 Bacteria 2065
482 Ga0395899_0143077 3300037312 Bacteria 1700
483 Ga0395899_0573369 3300037312 Bacteria 722
484 Ga0395900_0128055 3300037418 Bacteria 2603
485 Ga0395900_0140283 3300037418 Bacteria 2475
486 Ga0395900_0221277 3300037418 Archaea 1908
487 Ga0395900_0388044 3300037418 Bacteria 1363
488 Ga0395900_0658226 3300037418 Bacteria 983
489 Ga0395900_0709558 3300037418 Bacteria 939
490 Ga0395900_1448153 3300037418 Bacteria 599
491 Ga0395898_0095120 3300037466 Bacteria 2862
492 Ga0395898_0207769 3300037466 Bacteria 1868
493 Ga0395898_0796814 3300037466 Bacteria 885
494 Ga0395898_0904405 3300037466 Bacteria 821
495 Ga0395898_0917966 3300037466 Archaea 813
496 Ga0395898_0924804 3300037466 Bacteria 810
497 Ga0395898_1457309 3300037466 Unclassified 611
498 Ga0395905_0248304 3300037471 Bacteria 1662
499 Ga0395905_1042955 3300037471 Bacteria 721
500 Ga0395905_1048441 3300037471 Bacteria 718
501 Ga0395905_1146403 3300037471 Unclassified 681
502 Ga0395905_1557016 3300037471 Unclassified 566
503 Ga0395901_0089797 3300038443 Bacteria 3215
504 Ga0395901_0629307 3300038443 Bacteria 1079
505 Ga0395901_0789678 3300038443 Bacteria 939
506 Ga0395901_1088901 3300038443 Bacteria 770
507 Ga0395901_1129757 3300038443 Unclassified 753
508 Ga0395901_1273572 3300038443 Bacteria 698
509 Ga0395901_1289827 3300038443 Bacteria 692
510 Ga0436365_1260527 3300039437 Bacteria 708
511 Ga0436360_0134583 3300039438 Unclassified 704
512 Ga0436360_0249670 3300039438 Bacteria 2736
513 Ga0436363_0296049 3300039450 Bacteria 1572
514 Ga0439453_0002236 3300041408 Bacteria 2640
515 Ga0439461_0033180 3300041410 Bacteria 1085
516 Ga0451849_1048234 3300041505 Unclassified 1553
517 Ga0451853_1958868 3300041512 Unclassified 640
518 Ga0439445_0243414 3300042004 Bacteria 536
519 Ga0439448_0047072 3300042005 Bacteria 1406
520 Ga0439451_021447 3300042009 Bacteria 1303
521 Ga0466969_0003223 3300044656 Bacteria 8681
522 Ga0466969_0083616 3300044656 Bacteria 1520
523 Ga0466969_0128896 3300044656 Bacteria 1174
524 Ga0466969_0274891 3300044656 Bacteria 763
525 Ga0466972_0569304 3300044658 Unclassified 535
526 Ga0466965_0050616 3300044683 Unclassified 2060
527 Ga0466965_0052097 3300044683 Bacteria 2032
528 Ga0466965_0074998 3300044683 Bacteria 1705
529 Ga0466965_0075882 3300044683 Bacteria 1696
530 Ga0466965_0080484 3300044683 Unclassified 1646
531 Ga0466965_0515727 3300044683 Unclassified 672
532 Ga0466966_0017398 3300044684 Bacteria 4751
533 Ga0466966_0085063 3300044684 Bacteria 1966
534 Ga0466966_0086218 3300044684 Bacteria 1952
535 Ga0466966_0090799 3300044684 Bacteria 1896
536 Ga0466966_0254890 3300044684 Bacteria 1057
537 Ga0466966_0319246 3300044684 Bacteria 933
538 Ga0466966_0745912 3300044684 Bacteria 590
539 Ga0466961_0005282 3300044693 Bacteria 8128
540 Ga0466961_0008879 3300044693 Bacteria 6410
541 Ga0466961_0027130 3300044693 Bacteria 3682
542 Ga0466961_0079263 3300044693 Bacteria 2080
543 Ga0466961_0106343 3300044693 Unclassified 1766
544 Ga0466961_0133855 3300044693 Bacteria 1553
545 Ga0466961_0418829 3300044693 Bacteria 812
546 Ga0466963_0000010 3300044694 Bacteria 68690
547 Ga0466963_0000649 3300044694 Bacteria 16741
548 Ga0466963_0001770 3300044694 Bacteria 11779
549 Ga0466963_0002000 3300044694 Bacteria 11192
550 Ga0466963_0004407 3300044694 Bacteria 8176
551 Ga0466963_0004464 3300044694 Bacteria 8139
552 Ga0466963_0007182 3300044694 Bacteria 6641
553 Ga0466963_0010186 3300044694 Bacteria 5684
554 Ga0466963_0013797 3300044694 Bacteria 4973
555 Ga0466963_0023343 3300044694 Bacteria 3926
556 Ga0466963_0034779 3300044694 Bacteria 3280
557 Ga0466963_0061633 3300044694 Bacteria 2508
558 Ga0466963_0111563 3300044694 Bacteria 1877
559 Ga0466963_0165855 3300044694 Bacteria 1538
560 Ga0466963_0171253 3300044694 Bacteria 1514
561 Ga0466963_0284073 3300044694 Bacteria 1163
562 Ga0466963_0299326 3300044694 Bacteria 1131
563 Ga0466963_0374982 3300044694 Bacteria 1003
564 Ga0466963_0499035 3300044694 Unclassified 859
565 Ga0466963_0808330 3300044694 Bacteria 661
566 Ga0466963_0888203 3300044694 Unclassified 628
567 Ga0466964_0000213 3300044706 Bacteria 16442
568 Ga0466964_0008591 3300044706 Bacteria 3838
569 Ga0466964_0023691 3300044706 Bacteria 2387
570 Ga0466964_0031496 3300044706 Unclassified 2104
571 Ga0466964_0031869 3300044706 Bacteria 2092
572 Ga0466964_0039198 3300044706 Bacteria 1908
573 Ga0466964_0051369 3300044706 Bacteria 1693
574 Ga0466964_0100868 3300044706 Bacteria 1272
575 Ga0466964_0132499 3300044706 Bacteria 1137
576 Ga0466964_0167304 3300044706 Bacteria 1032
577 Ga0466964_0207540 3300044706 Bacteria 944
578 Ga0466964_0252216 3300044706 Bacteria 870
579 Ga0466964_0348546 3300044706 Unclassified 760
580 Ga0466964_0434408 3300044706 Bacteria 693
581 Ga0466964_0438146 3300044706 Unclassified 690
582 Ga0466964_0581351 3300044706 Unclassified 612
583 Ga0466971_0004429 3300044719 Bacteria 6060
584 Ga0466971_0006123 3300044719 Bacteria 5229
585 Ga0466971_0010450 3300044719 Bacteria 4057
586 Ga0466971_0034738 3300044719 Bacteria 2259
587 Ga0466971_0094401 3300044719 Bacteria 1371
588 Ga0466971_0295719 3300044719 Bacteria 777
589 Ga0466968_0001937 3300044735 Bacteria 7503
590 Ga0466968_0003137 3300044735 Bacteria 6099
591 Ga0466968_0005017 3300044735 Bacteria 4960
592 Ga0466968_0011205 3300044735 Bacteria 3494
593 Ga0466968_0018981 3300044735 Bacteria 2762
594 Ga0466968_0093842 3300044735 Bacteria 1333
595 Ga0466968_0138895 3300044735 Bacteria 1110
596 Ga0466970_0004127 3300044765 Bacteria 7141
597 Ga0466970_0137134 3300044765 Bacteria 1346
598 Ga0466970_0178128 3300044765 Bacteria 1179
599 Ga0466970_0283130 3300044765 Bacteria 933
600 Ga0466970_0724194 3300044765 Bacteria 581
601 Ga0466957_0009295 3300044842 Bacteria 5608
602 Ga0466957_0021958 3300044842 Bacteria 3764
603 Ga0466957_0025441 3300044842 Bacteria 3508
604 Ga0466957_0033272 3300044842 Bacteria 3092
605 Ga0466957_0094799 3300044842 Bacteria 1874
606 Ga0466957_0234214 3300044842 Bacteria 1216
607 Ga0466957_0289971 3300044842 Bacteria 1097
608 Ga0466957_0317661 3300044842 Bacteria 1050
609 Ga0466957_0408286 3300044842 Bacteria 930
610 Ga0466957_0459239 3300044842 Bacteria 878
611 Ga0466957_1067989 3300044842 Bacteria 581
612 Ga0466957_1135314 3300044842 Bacteria 564
613 Ga0466957_1298025 3300044842 Unclassified 528
614 Ga0466957_1433304 3300044842 Bacteria 503
615 Ga0466960_0005761 3300044901 Bacteria 4931
616 Ga0466960_0011815 3300044901 Bacteria 3668
617 Ga0466960_0039338 3300044901 Bacteria 2230
618 Ga0466960_0055310 3300044901 Bacteria 1930
619 Ga0466960_0097033 3300044901 Unclassified 1512
620 Ga0466960_0458479 3300044901 Bacteria 742
621 Ga0466960_0471454 3300044901 Unclassified 732
622 Ga0466960_0481040 3300044901 Bacteria 725
623 Ga0466959_0003840 3300045049 Bacteria 9964
624 Ga0466959_0009312 3300045049 Bacteria 6979
625 Ga0466959_0032586 3300045049 Bacteria 3857
626 Ga0466959_0050692 3300045049 Bacteria 3046
627 Ga0466959_0068110 3300045049 Bacteria 2580
628 Ga0466959_0596101 3300045049 Bacteria 743
629 Ga0466959_0874037 3300045049 Bacteria 600
630 Ga0451576_2700887 3300045051 Unclassified 505
631 Ga0466958_0000431 3300045836 Bacteria 17350
632 Ga0466958_0001425 3300045836 Bacteria 11326
633 Ga0466958_0002150 3300045836 Bacteria 9809
634 Ga0466958_0025195 3300045836 Bacteria 3505
635 Ga0466958_0066615 3300045836 Bacteria 2199
636 Ga0466958_0079309 3300045836 Bacteria 2019
637 Ga0466958_0115347 3300045836 Unclassified 1678
638 Ga0466958_0116169 3300045836 Bacteria 1672
639 Ga0466958_0399438 3300045836 Bacteria 887
640 Ga0466958_0409828 3300045836 Bacteria 875
641 Ga0466958_0551108 3300045836 Bacteria 749
642 Ga0466958_0642807 3300045836 Bacteria 690
643 Ga0466958_0783635 3300045836 Unclassified 621
644 Ga0466958_1069720 3300045836 Unclassified 526
645 Ga0466967_0000332 3300045976 Bacteria 21635
646 Ga0466967_0001331 3300045976 Bacteria 14150
647 Ga0466967_0002063 3300045976 Bacteria 12278
648 Ga0466967_0002354 3300045976 Bacteria 11698
649 Ga0466967_0010334 3300045976 Bacteria 6995
650 Ga0466967_0015409 3300045976 Bacteria 5990
651 Ga0466967_0016719 3300045976 Bacteria 5796
652 Ga0466967_0022864 3300045976 Bacteria 5111
653 Ga0466967_0023774 3300045976 Bacteria 5027
654 Ga0466967_0024167 3300045976 Bacteria 4992
655 Ga0466967_0038072 3300045976 Bacteria 4122
656 Ga0466967_0042311 3300045976 Bacteria 3935
657 Ga0466967_0062915 3300045976 Bacteria 3295
658 Ga0466967_0066290 3300045976 Bacteria 3216
659 Ga0466967_0077443 3300045976 Bacteria 2993
660 Ga0466967_0079621 3300045976 Bacteria 2954
661 Ga0466967_0099263 3300045976 Bacteria 2659
662 Ga0466967_0113945 3300045976 Bacteria 2488
663 Ga0466967_0127686 3300045976 Bacteria 2357
664 Ga0466967_0158743 3300045976 Bacteria 2121
665 Ga0466967_0169342 3300045976 Bacteria 2054
666 Ga0466967_0199979 3300045976 Bacteria 1892
667 Ga0466967_0202306 3300045976 Bacteria 1881
668 Ga0466967_0232813 3300045976 Bacteria 1754
669 Ga0466967_0245079 3300045976 Bacteria 1710
670 Ga0466967_0264260 3300045976 Unclassified 1647
671 Ga0466967_0421752 3300045976 Bacteria 1301
672 Ga0466967_0439108 3300045976 Bacteria 1274
673 Ga0466967_0451495 3300045976 Bacteria 1256
674 Ga0466967_0545234 3300045976 Unclassified 1141
675 Ga0466967_0709865 3300045976 Bacteria 996
676 Ga0466967_0718067 3300045976 Bacteria 990
677 Ga0466967_1210509 3300045976 Bacteria 752
678 Ga0495592_0000732 3300046454 Bacteria 22931
679 Ga0495592_0004058 3300046454 Bacteria 10646
680 Ga0495592_0080194 3300046454 Bacteria 2362
681 Ga0495592_0158825 3300046454 Bacteria 1557
682 Ga0495592_0387691 3300046454 Bacteria 888
683 Ga0495592_0461163 3300046454 Bacteria 794
684 Ga0495592_0769422 3300046454 Bacteria 574
685 Ga0495603_0046829 3300046455 Bacteria 2576
686 Ga0495629_0017747 3300046459 Bacteria 5100
687 Ga0495629_0131264 3300046459 Bacteria 1745
688 Ga0495629_0235242 3300046459 Bacteria 1262
689 Ga0495629_0252307 3300046459 Bacteria 1214
690 Ga0495629_0439069 3300046459 Bacteria 885
691 Ga0495641_0016066 3300046461 Bacteria 3958
692 Ga0495641_0026195 3300046461 Bacteria 2849
693 Ga0495641_0079331 3300046461 Bacteria 1471
694 Ga0495641_0086874 3300046461 Bacteria 1399
695 Ga0495641_0114459 3300046461 Bacteria 1203
696 Ga0495641_0204830 3300046461 Bacteria 884
697 Ga0495651_0000029 3300046462 Bacteria 105042
698 Ga0495651_0037777 3300046462 Bacteria 3760
699 Ga0495651_0139797 3300046462 Bacteria 1757
700 Ga0495651_0161878 3300046462 Bacteria 1602
701 Ga0495651_0342042 3300046462 Bacteria 991
702 Ga0495651_0454263 3300046462 Unclassified 827
703 Ga0495653_0001363 3300046463 Bacteria 18977
704 Ga0495653_0008307 3300046463 Bacteria 8509
705 Ga0495653_0072654 3300046463 Bacteria 2568
706 Ga0495653_0091261 3300046463 Bacteria 2227
707 Ga0495653_0115764 3300046463 Unclassified 1918
708 Ga0495653_0135178 3300046463 Bacteria 1740
709 Ga0495653_0151920 3300046463 Bacteria 1617
710 Ga0495653_0227844 3300046463 Bacteria 1249
711 Ga0495653_0374914 3300046463 Bacteria 910
712 Ga0495653_0575937 3300046463 Unclassified 694
713 Ga0495653_0861213 3300046463 Unclassified 542
714 Ga0495580_0024113 3300046472 Bacteria 4459
715 Ga0495582_0004164 3300046473 Bacteria 8134
716 Ga0495582_0150648 3300046473 Bacteria 1320
717 Ga0495639_0006273 3300046475 Bacteria 5106
718 Ga0495639_0340620 3300046475 Bacteria 752
719 Ga0495662_0001522 3300046476 Bacteria 11502
720 Ga0495662_0023497 3300046476 Bacteria 2977
721 Ga0495664_0042590 3300046477 Bacteria 2689
722 Ga0495664_0201632 3300046477 Bacteria 1205
723 Ga0495664_0267472 3300046477 Bacteria 1033
724 Ga0495584_0007847 3300046491 Bacteria 5550
725 Ga0495585_0025444 3300046492 Bacteria 3390
726 Ga0495594_0145070 3300046499 Bacteria 1347
727 Ga0495594_0319906 3300046499 Bacteria 884
728 Ga0495594_0639243 3300046499 Unclassified 603
729 Ga0495596_0062955 3300046500 Bacteria 1443
730 Ga0495607_0040771 3300046501 Bacteria 2762
731 Ga0495608_0014722 3300046511 Bacteria 5429
732 Ga0495608_0023778 3300046511 Bacteria 4194
733 Ga0495608_0032053 3300046511 Bacteria 3552
734 Ga0495608_0115571 3300046511 Bacteria 1722
735 Ga0495608_0312755 3300046511 Archaea 971
736 Ga0495608_0355764 3300046511 Unclassified 901
737 Ga0495608_0418423 3300046511 Bacteria 818
738 Ga0495618_0009479 3300046514 Bacteria 5882
739 Ga0495618_0034082 3300046514 Bacteria 3191
740 Ga0495618_0067575 3300046514 Bacteria 2273
741 Ga0495618_0104752 3300046514 Bacteria 1811
742 Ga0495618_0736342 3300046514 Unclassified 578
743 Ga0495628_0000016 3300046516 Bacteria 170260
744 Ga0495628_0014430 3300046516 Bacteria 6622
745 Ga0495628_0028205 3300046516 Bacteria 4563
746 Ga0495630_0000505 3300046517 Bacteria 28893
747 Ga0495630_0298166 3300046517 Bacteria 1232
748 Ga0495630_0681174 3300046517 Bacteria 787
749 Ga0495630_0770971 3300046517 Unclassified 735
750 Ga0495630_1362339 3300046517 Unclassified 534
751 Ga0495644_0020878 3300046523 Bacteria 2498
752 Ga0495663_0375953 3300046525 Bacteria 520
753 Ga0495666_0186505 3300046526 Bacteria 957
754 Ga0495652_0000045 3300046529 Bacteria 122469
755 Ga0495652_0006417 3300046529 Bacteria 10948
756 Ga0495652_0042714 3300046529 Bacteria 3908
757 Ga0495652_0081521 3300046529 Bacteria 2668
758 Ga0495652_0083596 3300046529 Bacteria 2627
759 Ga0495652_0118634 3300046529 Unclassified 2114
760 Ga0495652_0232474 3300046529 Unclassified 1378
761 Ga0495665_0029813 3300046531 Bacteria 2921
762 Ga0495640_0007391 3300046533 Bacteria 8645
763 Ga0495640_0014315 3300046533 Bacteria 6006
764 Ga0495640_0125500 3300046533 Bacteria 1665
765 Ga0495640_0954284 3300046533 Unclassified 506
766 Ga0495586_0034130 3300046535 Bacteria 2731
767 Ga0495586_0088546 3300046535 Bacteria 1708
768 Ga0495587_0000083 3300046536 Bacteria 73166
769 Ga0495587_0114475 3300046536 Bacteria 1547
770 Ga0495587_0655845 3300046536 Bacteria 576
771 Ga0495587_0674079 3300046536 Bacteria 568
772 Ga0495645_0001902 3300046543 Bacteria 14187
773 Ga0495645_0021257 3300046543 Bacteria 4689
774 Ga0495645_0028921 3300046543 Bacteria 4027
775 Ga0495645_0306506 3300046543 Bacteria 1035
776 Ga0495667_0025440 3300046559 Bacteria 3989
777 Ga0495667_0069376 3300046559 Bacteria 2300
778 Ga0495667_0111199 3300046559 Unclassified 1770
779 Ga0495667_0120029 3300046559 Bacteria 1698
780 Ga0495667_0193124 3300046559 Bacteria 1304
781 Ga0495667_0223154 3300046559 Archaea 1202
782 Ga0495667_0540690 3300046559 Bacteria 728
783 Ga0495656_0001481 3300046615 Bacteria 7683
784 Ga0495668_0245643 3300046616 Bacteria 980
785 Ga0495634_0003355 3300046642 Bacteria 12860
786 Ga0495634_0038164 3300046642 Bacteria 3276
787 Ga0495634_0091496 3300046642 Bacteria 1975
788 Ga0495634_0200725 3300046642 Bacteria 1239
789 Ga0495611_0124287 3300046648 Bacteria 1203
790 Ga0495635_0004708 3300046663 Bacteria 9481
791 Ga0495635_0044339 3300046663 Bacteria 3069
792 Ga0495635_0159815 3300046663 Unclassified 1533
793 Ga0495635_0275879 3300046663 Unclassified 1130
794 Ga0495635_0402960 3300046663 Bacteria 908
795 Ga0495635_0409722 3300046663 Unclassified 900
796 Ga0495635_0561639 3300046663 Bacteria 747
797 Ga0495635_0816601 3300046663 Bacteria 600
798 Ga0495661_0159110 3300046665 Bacteria 1214
799 Ga0495588_0088482 3300046674 Unclassified 1621
800 Ga0495657_0011595 3300046675 Bacteria 6586
801 Ga0495657_0037285 3300046675 Bacteria 3352
802 Ga0495657_0187772 3300046675 Bacteria 1264
803 Ga0495657_0241416 3300046675 Bacteria 1090
804 Ga0495657_0345525 3300046675 Bacteria 881
805 Ga0495657_0346145 3300046675 Bacteria 880
806 Ga0495657_0399648 3300046675 Bacteria 809
807 Ga0495657_0469575 3300046675 Bacteria 735
808 Ga0495657_0706024 3300046675 Bacteria 579
809 Ga0495599_0000187 3300046678 Bacteria 40807
810 Ga0495599_0000610 3300046678 Bacteria 20335
811 Ga0495599_0200702 3300046678 Bacteria 1225
812 Ga0495599_0235184 3300046678 Unclassified 1118
813 Ga0495599_0463928 3300046678 Unclassified 749
814 Ga0495623_0000121 3300046679 Bacteria 47882
815 Ga0495623_0005723 3300046679 Bacteria 8117
816 Ga0495623_0194689 3300046679 Bacteria 1169
817 Ga0495646_0001537 3300046680 Bacteria 13770
818 Ga0495646_0062692 3300046680 Bacteria 2210
819 Ga0495647_0000468 3300046681 Bacteria 11697
820 Ga0495647_0049997 3300046681 Bacteria 1621
821 Ga0495658_0011253 3300046683 Bacteria 4495
822 Ga0495658_0203263 3300046683 Bacteria 1235
823 Ga0495669_0276031 3300046684 Bacteria 808
824 Ga0495613_0062116 3300046689 Bacteria 2735
825 Ga0495613_0081268 3300046689 Bacteria 2355
826 Ga0495613_0456135 3300046689 Bacteria 865
827 Ga0495624_0005932 3300046690 Bacteria 8730
828 Ga0495624_0022126 3300046690 Bacteria 4208
829 Ga0495624_0408691 3300046690 Bacteria 815
830 Ga0495624_0633771 3300046690 Bacteria 636
831 Ga0495670_0072448 3300046691 Bacteria 1745
832 Ga0495589_0200021 3300046794 Bacteria 943
833 Ga0495600_0041000 3300046809 Bacteria 3017
834 Ga0495600_0228921 3300046809 Bacteria 1187
835 Ga0495600_0268406 3300046809 Bacteria 1083
836 Ga0495600_0473465 3300046809 Unclassified 772
837 Ga0495660_0280624 3300046810 Bacteria 762
838 Ga0495581_0002035 3300047315 Bacteria 11369
839 Ga0495581_0047064 3300047315 Bacteria 2493
840 Ga0495581_0263017 3300047315 Bacteria 1009
841 Ga0495604_0000072 3300047317 Bacteria 88631
842 Ga0495604_0087853 3300047317 Bacteria 2314
843 Ga0495604_0375810 3300047317 Bacteria 940
844 Ga0495604_0601678 3300047317 Bacteria 705
845 Ga0495674_0012591 3300047319 Bacteria 7969
846 Ga0495674_0073771 3300047319 Bacteria 2940
847 Ga0495674_0493489 3300047319 Bacteria 980
848 Ga0495674_0582007 3300047319 Unclassified 888
849 Ga0495676_0071355 3300047321 Bacteria 2670
850 Ga0495676_0155177 3300047321 Bacteria 1625
851 Ga0495676_0160103 3300047321 Bacteria 1593
852 Ga0495676_0429865 3300047321 Bacteria 873
853 Ga0495680_0004810 3300047322 Bacteria 12812
854 Ga0495680_0007057 3300047322 Bacteria 10354
855 Ga0495680_0016342 3300047322 Bacteria 6379
856 Ga0495680_0037008 3300047322 Bacteria 3911
857 Ga0495680_0108643 3300047322 Bacteria 2058
858 Ga0495680_0181638 3300047322 Archaea 1518
859 Ga0495680_0611430 3300047322 Unclassified 728
860 Ga0495680_0929519 3300047322 Bacteria 560
861 Ga0495683_0226532 3300047323 Bacteria 831
862 Ga0495675_0000031 3300047444 Bacteria 99240
863 Ga0495675_0355316 3300047444 Bacteria 861
864 Ga0495675_0563240 3300047444 Bacteria 649
865 Ga0495677_0028578 3300047445 Bacteria 2026
866 Ga0495679_055719 3300047446 Bacteria 1173
867 Ga0495684_0008099 3300047471 Bacteria 8125
868 Ga0495684_0019924 3300047471 Bacteria 5168
869 Ga0495684_0027689 3300047471 Bacteria 4352
870 Ga0495684_0297074 3300047471 Unclassified 1161
871 Ga0495684_0516700 3300047471 Unclassified 818
872 Ga0495684_0674395 3300047471 Unclassified 688
873 Ga0495593_0000333 3300047673 Bacteria 26121
874 Ga0495593_0119571 3300047673 Bacteria 1341
875 Ga0495602_0000133 3300048088 Bacteria 69392
876 Ga0495602_0024934 3300048088 Bacteria 5795
877 Ga0495602_0095157 3300048088 Bacteria 2460
878 Ga0495602_0678536 3300048088 Bacteria 701
879 Ga0495602_0723161 3300048088 Bacteria 674
880 Ga0495614_0001325 3300048089 Bacteria 10682
881 Ga0496100_0034269 3300048903 Bacteria 3184
882 Ga0496100_0049310 3300048903 Bacteria 2722
883 Ga0496100_0144881 3300048903 Bacteria 1688
884 Ga0496100_0974278 3300048903 Unclassified 667
885 Ga0496101_0002509 3300048904 Bacteria 11277
886 Ga0496101_0044485 3300048904 Bacteria 3178
887 Ga0496101_0110389 3300048904 Bacteria 2069
888 Ga0496101_0260787 3300048904 Bacteria 1352
889 Ga0496101_0952560 3300048904 Bacteria 675
890 Ga0496101_1067501 3300048904 Bacteria 634
891 Ga0496102_0005815 3300048905 Bacteria 10487
892 Ga0496102_0055705 3300048905 Bacteria 3605
893 Ga0496102_0100308 3300048905 Bacteria 2689
894 Ga0496102_0185761 3300048905 Bacteria 1959
895 Ga0496102_0352481 3300048905 Bacteria 1386
896 Ga0496102_0849525 3300048905 Bacteria 835
897 Ga0496103_0016363 3300048906 Bacteria 4426
898 Ga0496103_0023625 3300048906 Bacteria 3709
899 Ga0496104_0034254 3300048907 Bacteria 4733
900 Ga0496104_0039390 3300048907 Bacteria 4425
901 Ga0496104_0864155 3300048907 Bacteria 810
902 Ga0496104_0988404 3300048907 Unclassified 746
903 Ga0496105_0010632 3300048908 Bacteria 7240
904 Ga0496105_0017937 3300048908 Bacteria 5680
905 Ga0496105_0104099 3300048908 Unclassified 2344
906 Ga0496105_0845583 3300048908 Bacteria 693
907 Ga0496105_1212534 3300048908 Bacteria 555
908 Ga0496106_0030068 3300048909 Bacteria 4050
909 Ga0496106_0041047 3300048909 Bacteria 3466
910 Ga0496106_0103195 3300048909 Bacteria 2213
911 Ga0496106_0741584 3300048909 Bacteria 781
912 Ga0496107_0010435 3300048910 Bacteria 6453
913 Ga0496107_0093099 3300048910 Bacteria 2204
914 Ga0496107_0154752 3300048910 Bacteria 1697
915 Ga0496107_0155954 3300048910 Bacteria 1690
916 Ga0496107_1045708 3300048910 Unclassified 591
917 Ga0496108_0011946 3300048911 Bacteria 7065
918 Ga0496108_0036442 3300048911 Bacteria 4092
919 Ga0496108_0482952 3300048911 Bacteria 1082
920 Ga0496108_0631030 3300048911 Bacteria 932
921 Ga0496109_0009062 3300048912 Bacteria 8475
922 Ga0496109_0056369 3300048912 Bacteria 3586
923 Ga0496109_0344092 3300048912 Bacteria 1408
924 Ga0496109_0609685 3300048912 Bacteria 1028
925 Ga0496109_0620230 3300048912 Bacteria 1018
926 Ga0496110_0006093 3300048913 Bacteria 9501
927 Ga0496110_0237736 3300048913 Unclassified 1657
928 Ga0496110_0279650 3300048913 Bacteria 1520
929 Ga0496110_0733996 3300048913 Bacteria 890
930 Ga0496111_0016935 3300048914 Bacteria 5030
931 Ga0496111_0022289 3300048914 Bacteria 4432
932 Ga0496111_0271384 3300048914 Unclassified 1258
933 Ga0496111_0293454 3300048914 Bacteria 1206
934 Ga0496111_1136859 3300048914 Bacteria 555
935 Ga0496112_0056461 3300048915 Bacteria 3864
936 Ga0496112_0071929 3300048915 Bacteria 3418
937 Ga0496112_0082148 3300048915 Bacteria 3187
938 Ga0496112_0087667 3300048915 Bacteria 3079
939 Ga0496112_0089402 3300048915 Bacteria 3048
940 Ga0496112_0186249 3300048915 Bacteria 2039
941 Ga0496112_0289113 3300048915 Bacteria 1585
942 Ga0496112_0434252 3300048915 Unclassified 1251
943 Ga0496112_1036068 3300048915 Archaea 740
944 Ga0496112_1216066 3300048915 Bacteria 670
945 Ga0496112_1233356 3300048915 Unclassified 664
946 Ga0496113_0041344 3300048916 Bacteria 3402
947 Ga0496113_0166052 3300048916 Bacteria 1746
948 Ga0496113_0181263 3300048916 Bacteria 1670
949 Ga0496113_0234272 3300048916 Unclassified 1464
950 Ga0496113_0300215 3300048916 Bacteria 1286
951 Ga0496113_0555840 3300048916 Bacteria 920
952 Ga0496113_0738305 3300048916 Bacteria 784
953 Ga0496114_0011562 3300048917 Bacteria 7053
954 Ga0496114_0096721 3300048917 Bacteria 2514
955 Ga0496114_0176094 3300048917 Bacteria 1866
956 Ga0496115_0026093 3300048918 Bacteria 4556
957 Ga0496115_0043589 3300048918 Bacteria 3579
958 Ga0496115_0080724 3300048918 Bacteria 2648
959 Ga0496115_0082447 3300048918 Bacteria 2620
960 Ga0496115_0100595 3300048918 Bacteria 2370
961 Ga0496115_0199138 3300048918 Bacteria 1654
962 Ga0496115_0641835 3300048918 Bacteria 840
963 Ga0501034_0004589 3300049571 Bacteria 15299
964 Ga0501038_0655408 3300049574 Bacteria 790
965 Ga0501048_0291163 3300049582 Bacteria 1161
966 Ga0501067_0027300 3300049583 Bacteria 3163
967 Ga0501067_0057526 3300049583 Unclassified 2153
968 Ga0501067_0238382 3300049583 Bacteria 1012
969 Ga0501067_0274228 3300049583 Bacteria 939
970 Ga0501069_0019863 3300049585 Bacteria 3635
971 Ga0501069_0033705 3300049585 Bacteria 2821
972 Ga0501070_0025291 3300049586 Bacteria 4978
973 Ga0501070_0051543 3300049586 Bacteria 3416
974 Ga0501070_0846256 3300049586 Unclassified 716
975 Ga0501072_0015894 3300049588 Bacteria 5769
976 Ga0501073_0052133 3300049589 Bacteria 2865
977 Ga0501074_0017998 3300049590 Bacteria 5133
978 Ga0501079_0036453 3300049741 Bacteria 3789
979 Ga0501080_0000535 3300049742 Bacteria 29918
980 Ga0501080_0007055 3300049742 Bacteria 10146
981 Ga0501083_0011627 3300049744 Bacteria 6176
982 nmdc:mga05p37_1052152_c1 3300050507 Unclassified 858
983 nmdc:mga0n895_180850_c1 3300050512 Bacteria 2140
984 nmdc:mga0n895_5478_c1 3300050512 Bacteria 10620
985 nmdc:mga0rr50_1006024_c1 3300050513 Archaea 710
986 nmdc:mga0rr50_544609_c1 3300050513 Unclassified 988
987 nmdc:mga08x19_381534_c1 3300050514 Unclassified 987
988 nmdc:mga08x19_737301_c1 3300050514 Bacteria 699
989 nmdc:mga0a205_299821_c1 3300050515 Bacteria 1480
990 nmdc:mga0a205_488426_c1 3300050515 Bacteria 1089
991 Ga0495601_0000304 3300053077 Bacteria 26118
992 Ga0495601_0026164 3300053077 Bacteria 3600
993 Ga0495601_0033652 3300053077 Bacteria 3193
994 Ga0495601_0111956 3300053077 Unclassified 1768
995 Ga0495601_0167849 3300053077 Unclassified 1434
996 Ga0495601_0525157 3300053077 Unclassified 763
997 Ga0495601_0670365 3300053077 Unclassified 663
998 Ga0495612_0005159 3300053078 Bacteria 5399
999 Ga0495612_0011693 3300053078 Bacteria 3538
1000 Ga0495612_0424336 3300053078 Unclassified 606
1001 Ga0495612_0601550 3300053078 Bacteria 508
1002 Ga0495595_0004259 3300053084 Bacteria 5752
1003 Ga0495595_0010303 3300053084 Bacteria 3884
1004 Ga0495595_0015196 3300053084 Bacteria 3280
1005 Ga0495595_0104732 3300053084 Bacteria 1367
1006 Ga0495595_0617963 3300053084 Unclassified 554
1007 Ga0495595_0738570 3300053084 Bacteria 505
1008 Ga0495619_0000836 3300053085 Bacteria 20199
1009 Ga0495619_0001937 3300053085 Bacteria 13798
1010 Ga0495619_0109203 3300053085 Bacteria 1889
1011 Ga0495619_0109497 3300053085 Bacteria 1886
1012 Ga0495619_0296165 3300053085 Bacteria 1121
1013 Ga0495619_0568792 3300053085 Bacteria 777
1014 Ga0500566_0008196 3300053094 Bacteria 6182
1015 Ga0500614_224465 3300053123 Unclassified 583
1016 Ga0501082_0804749 3300060353 Bacteria 822
1017 Ga0466962_0002608 3300061719 Bacteria 8568
1018 Ga0466962_0005598 3300061719 Bacteria 6033
1019 Ga0466962_0012201 3300061719 Bacteria 4131
1020 Ga0466962_0028295 3300061719 Bacteria 2685
1021 Ga0466962_0029341 3300061719 Bacteria 2633
1022 Ga0466962_0041976 3300061719 Unclassified 2189
1023 Ga0466962_0382425 3300061719 Unclassified 703
1024 Ga0207664_10207285
1025 Ga0070658_10009734
1026 Ga0070658_10085504
1027 Ga0070658_10374225
1028 Ga0070658_10566130
1029 Ga0070658_11277009
1030 Ga0070683_100000682
1031 Ga0070683_100046995
1032 Ga0070683_100106628
1033 Ga0070683_100629443
1034 Ga0070680_100014283
1035 Ga0070680_100105611
1036 Ga0070680_100210240
1037 Ga0070680_100445605
1038 Ga0070680_100564676
1039 Ga0070682_100015147
1040 Ga0070682_101354349
1041 Ga0070682_101787717
1042 Ga0068868_101450820
1043 Ga0070660_100001782
1044 Ga0070660_100003328
1045 Ga0070660_100031738
1046 Ga0070660_100031952
1047 Ga0070691_10056155
1048 Ga0070691_10253315
1049 Ga0070687_101231344
1050 Ga0070661_100086770
1051 Ga0070661_100259758
1052 Ga0070661_100952102
1053 Ga0070671_100034613
1054 Ga0070659_100846421
1055 Ga0070659_100857674
1056 Ga0070709_10008335
1057 Ga0070709_10067769
1058 Ga0070709_10078187
1059 Ga0070709_10090319
1060 Ga0070709_10463584
1061 Ga0070709_11766686
1062 Ga0070714_100002904
1063 Ga0070714_100049516
1064 Ga0070714_100071577
1065 Ga0070714_100092539
1066 Ga0070714_100094496
1067 Ga0070714_100112726
1068 Ga0070714_100215384
1069 Ga0070714_100218997
1070 Ga0070714_100431830
1071 Ga0070714_100471587
1072 Ga0070714_101529976
1073 Ga0070714_101842380
1074 Ga0070713_100000801
1075 Ga0070713_100024783
1076 Ga0070713_100518532
1077 Ga0070710_10009224
1078 Ga0070710_10025527
1079 Ga0070710_10448744
1080 Ga0070710_10512121
1081 Ga0070710_10890300
1082 Ga0070711_100002572
1083 Ga0070711_100053954
1084 Ga0070711_100060945
1085 Ga0070711_100926352
1086 Ga0070711_101064732
1087 Ga0070694_100247988
1088 Ga0070694_100266842
1089 Ga0070708_100635391
1090 Ga0070663_101443352
1091 Ga0070681_10046923
1092 Ga0070681_10071171
1093 Ga0070681_10082518
1094 Ga0070681_10152629
1095 Ga0070681_10190835
1096 Ga0070681_10211448
1097 Ga0070681_10226054
1098 Ga0070681_10227477
1099 Ga0070681_10243805
1100 Ga0070706_100718497
1101 Ga0070706_101700403
1102 Ga0070707_100022323
1103 Ga0070707_100035404
1104 Ga0070707_100243368
1105 Ga0070707_100880331
1106 Ga0070698_100041252
1107 Ga0070698_100049309
1108 Ga0070698_100133400
1109 Ga0070698_100366155
1110 Ga0070699_100218255
1111 Ga0070699_100274647
1112 Ga0070699_100437513
1113 Ga0070679_100012002
1114 Ga0070679_100031188
1115 Ga0070679_100091661
1116 Ga0070679_100179570
1117 Ga0070679_100230258
1118 Ga0070679_100332401
1119 Ga0070679_100399888
1120 Ga0070684_100008210
1121 Ga0070684_100071994
1122 Ga0070684_101479769
1123 Ga0070695_100000265
1124 Ga0070696_100815919
1125 Ga0070693_100409806
1126 Ga0070704_100109343
1127 Ga0068855_100006484
1128 Ga0068855_100409946
1129 Ga0068855_100818834
1130 Ga0068855_100947419
1131 Ga0070664_101171552
1132 Ga0068857_100199718
1133 Ga0068857_101844116
1134 Ga0068856_100098406
1135 Ga0068856_100115279
1136 Ga0068856_100427551
1137 Ga0068856_100497399
1138 Ga0068856_101493298
1139 Ga0070702_100050938
1140 Ga0068852_100242824
1141 Ga0068852_101119958
1142 Ga0068852_101257571
1143 Ga0068858_100683461
1144 Ga0068860_101767756
1145 Ga0070717_10007082
1146 Ga0070717_10013600
1147 Ga0070717_10031923
1148 Ga0070717_10049217
1149 Ga0070717_10176291
1150 Ga0070717_10426752
1151 Ga0070717_10477044
1152 Ga0070717_10680881
1153 Ga0070717_10919315
1154 Ga0075365_10849160
1155 Ga0070715_10005269
1156 Ga0070716_100003859
1157 Ga0070716_100018111
1158 Ga0070716_100020120
1159 Ga0070716_100210958
1160 Ga0070716_100436688
1161 Ga0070716_101581982
1162 Ga0070712_100028000
1163 Ga0070712_100058473
1164 Ga0070712_100253298
1165 Ga0070712_100445355
1166 Ga0070712_100837485
1167 Ga0070712_101081141
1168 Ga0075433_10324794
1169 Ga0075433_10430070
1170 Ga0075433_10493077
1171 Ga0075434_100013210
1172 Ga0068865_100417737
1173 Ga0075436_100167210
1174 Ga0075436_101282923
1175 Ga0075435_100725352
1176 Ga0075435_101357572
1177 Ga0099795_10454618
1178 Ga0105240_10037102
1179 Ga0105240_10058261
1180 Ga0105240_10640569
1181 Ga0105240_10808587
1182 Ga0105240_11669978
1183 Ga0111539_11408433
1184 Ga0105245_10173604
1185 Ga0105245_10496423
1186 Ga0105245_11460550
1187 Ga0105247_10055600
1188 Ga0114129_11629417
1189 Ga0105242_10433116
1190 Ga0105242_10525862
1191 Ga0105242_11776964
1192 Ga0105248_10493375
1193 Ga0105248_10780279
1194 Ga0105248_10806199
1195 Ga0105237_10039879
1196 Ga0105237_12118390
1197 Ga0105237_12284450
1198 Ga0105238_10035269
1199 Ga0105238_11299361
1200 Ga0105238_11756639
1201 Ga0099796_10360770
1202 Ga0105239_10125430
1203 Ga0105239_10606228
1204 Ga0157373_10141834
1205 Ga0157373_10208399
1206 Ga0157373_10608029
1207 Ga0157371_10144028
1208 Ga0157371_10569547
1209 Ga0157370_10009353
1210 Ga0157370_10017077
1211 Ga0157370_10141323
1212 Ga0157370_10530462
1213 Ga0157370_10605538
1214 Ga0157370_11335105
1215 Ga0157370_11389367
1216 Ga0157370_11804151
1217 Ga0157370_11812284
1218 Ga0157369_10001145
1219 Ga0157369_10019029
1220 Ga0157369_10040236
1221 Ga0157369_10416301
1222 Ga0157369_10586687
1223 Ga0157369_11171477
1224 Ga0157369_11246815
1225 Ga0157374_10120956
1226 Ga0157374_10139452
1227 Ga0157374_10882096
1228 Ga0157378_11129856
1229 Ga0163162_10245382
1230 Ga0157372_10095372
1231 Ga0157372_10219081
1232 Ga0157372_10458840
1233 Ga0157372_10560087
1234 Ga0157372_10917960
1235 Ga0157372_10990852
1236 Ga0157372_11772468
1237 Ga0157372_12066558
1238 Ga0157372_13230627
1239 Ga0157375_10327714
1240 Ga0163163_12825034
1241 Ga0182008_10016723
1242 Ga0182008_10099413
1243 Ga0182008_10246628
1244 Ga0182008_10523615
1245 Ga0182008_10584864
1246 Ga0182008_10882034
1247 Ga0157379_10191763
1248 Ga0157376_10017404
1249 Ga0157376_11582992
1250 Ga0157376_12130055
1251 Ga0182006_1016295
1252 Ga0182007_10018540
1253 Ga0206356_10582850
1254 Ga0206356_11584572
1255 Ga0206349_1467851
1256 Ga0206354_10451936
1257 Ga0206354_10531976
1258 Ga0206354_11239232
1259 Ga0206353_10289596
1260 Ga0206353_11314291
1261 Ga0206353_12040664
1262 Ga0213874_10046469
1263 Ga0213876_10487114
1264 Ga0213871_10030518
1265 Ga0224712_10655245
1266 Ga0207692_10023816
1267 Ga0207692_10037256
1268 Ga0207692_10330626
1269 Ga0207692_11084736
1270 Ga0207710_10062626
1271 Ga0207647_10590702
1272 Ga0207685_10001113
1273 Ga0207699_10026168
1274 Ga0207699_10045831
1275 Ga0207699_10046097
1276 Ga0207699_10057762
1277 Ga0207699_10068842
1278 Ga0207699_10069126
1279 Ga0207705_10017947
1280 Ga0207705_10065177
1281 Ga0207705_10067247
1282 Ga0207705_10203568
1283 Ga0207705_10238310
1284 Ga0207684_10828969
1285 Ga0207707_10024218
1286 Ga0207707_10025872
1287 Ga0207707_10095478
1288 Ga0207707_10112571
1289 Ga0207707_10190270
1290 Ga0207707_10231095
1291 Ga0207707_10290210
1292 Ga0207695_10225920
1293 Ga0207695_10277597
1294 Ga0207695_10667101
1295 Ga0207671_10190994
1296 Ga0207693_10000814
1297 Ga0207693_10000920
1298 Ga0207693_10065202
1299 Ga0207693_10259586
1300 Ga0207693_10283420
1301 Ga0207693_10395283
1302 Ga0207693_10770359
1303 Ga0207663_10015847
1304 Ga0207663_10096802
1305 Ga0207663_10699025
1306 Ga0207663_10772227
1307 Ga0207663_11134982
1308 Ga0207660_10019550
1309 Ga0207660_10083143
1310 Ga0207660_10309987
1311 Ga0207660_10527571
1312 Ga0207662_10435502
1313 Ga0207657_10003170
1314 Ga0207657_10008838
1315 Ga0207657_10014486
1316 Ga0207657_10026169
1317 Ga0207649_10030184
1318 Ga0207649_10030419
1319 Ga0207649_10142378
1320 Ga0207649_10205547
1321 Ga0207649_10547393
1322 Ga0207652_10011197
1323 Ga0207652_10071202
1324 Ga0207652_10109179
1325 Ga0207652_10176255
1326 Ga0207652_10183542
1327 Ga0207652_10213223
1328 Ga0207652_10418300
1329 Ga0207652_10571169
1330 Ga0207652_10844137
1331 Ga0207652_11576738
1332 Ga0207646_10001386
1333 Ga0207646_10035040
1334 Ga0207646_10617919
1335 Ga0207646_10783520
1336 Ga0207687_10241320
1337 Ga0207700_10000006
1338 Ga0207700_10026419
1339 Ga0207700_10194226
1340 Ga0207700_10560598
1341 Ga0207700_11184650
1342 Ga0207664_10001397
1343 Ga0207664_10003898
1344 Ga0207664_10017802
1345 Ga0207664_10018691
1346 Ga0207664_10032295
1347 Ga0207664_10035157
1348 Ga0207664_10054343
1349 Ga0207664_10190644
1350 Ga0207664_10200363
1351 Ga0207664_10233746
1352 Ga0207664_10458001
1353 Ga0207664_10707705
1354 Ga0207664_11021426
1355 Ga0207664_11366455
1356 Ga0207664_11422224
1357 Ga0207664_11479422
1358 Ga0207644_10083224
1359 Ga0207644_10386778
1360 Ga0207690_10251900
1361 Ga0207690_11346899
1362 Ga0207690_11811886
1363 Ga0207690_11837553
1364 Ga0207686_10536237
1365 Ga0207686_11233929
1366 Ga0207704_10421870
1367 Ga0207665_10000247
1368 Ga0207665_10005520
1369 Ga0207665_10075321
1370 Ga0207665_10360193
1371 Ga0207665_10551896
1372 Ga0207665_11381714
1373 Ga0207711_10280780
1374 Ga0207711_10429780
1375 Ga0207711_10464403
1376 Ga0207711_10964423
1377 Ga0207661_10025875
1378 Ga0207661_10033486
1379 Ga0207661_10266862
1380 Ga0207679_10479241
1381 Ga0207667_10182073
1382 Ga0207667_10460936
1383 Ga0207667_10700870
1384 Ga0207640_10090763
1385 Ga0207677_11062385
1386 Ga0207639_12297231
1387 Ga0207678_11260407
1388 Ga0207678_11271975
1389 Ga0207702_10088815
1390 Ga0207702_10189089
1391 Ga0207702_10669249
1392 Ga0207702_11085766
1393 Ga0207702_11244060
1394 Ga0207641_10290913
1395 Ga0207674_10124716
1396 Ga0207683_10147298
1397 Ga0207698_10248799
1398 Ga0207698_10503608
1399 Ga0265337_1016990
1400 Ga0265326_10049203
1401 Ga0265319_1007813
1402 Ga0265319_1022703
1403 Ga0265319_1025818
1404 Ga0265319_1187408
1405 Ga0265334_10009412
1406 Ga0265334_10059590
1407 Ga0265334_10075215
1408 Ga0265334_10248913
1409 Ga0265318_10000788
1410 Ga0265318_10029227
1411 Ga0265318_10038532
1412 Ga0265318_10077287
1413 Ga0265322_10012790
1414 Ga0265322_10044206
1415 Ga0265322_10048347
1416 Ga0265336_10001699
1417 Ga0265336_10037811
1418 Ga0265336_10054715
1419 Ga0265336_10101403
1420 Ga0265338_10002456
1421 Ga0265338_10003688
1422 Ga0265338_10011083
1423 Ga0265338_10027009
1424 Ga0265338_10042058
1425 Ga0265338_10072190
1426 Ga0265338_10083009
1427 Ga0265338_10113409
1428 Ga0265338_10195867
1429 Ga0265324_10083740
1430 Ga0265330_10000672
1431 Ga0265330_10004373
1432 Ga0265330_10094669
1433 Ga0265332_10018992
1434 Ga0265332_10057099
1435 Ga0265332_10374389
1436 Ga0265332_10383295
1437 Ga0265328_10012489
1438 Ga0265328_10068228
1439 Ga0265320_10014307
1440 Ga0265320_10099056
1441 Ga0265320_10169979
1442 Ga0265325_10020864
1443 Ga0265325_10045429
1444 Ga0265325_10060819
1445 Ga0265325_10079377
1446 Ga0265329_10016823
1447 Ga0265329_10050423
1448 Ga0265340_10006639
1449 Ga0265340_10211349
1450 Ga0265339_10014310
1451 Ga0265339_10175665
1452 Ga0265331_10008097
1453 Ga0265331_10030596
1454 Ga0265327_10006666
1455 Ga0265327_10063059
1456 Ga0265327_10081029
1457 Ga0265316_10025347
1458 Ga0265316_10068014
1459 Ga0265313_10010563
1460 Ga0265313_10028666
1461 Ga0265313_10030697
1462 Ga0265314_10007395
1463 Ga0265314_10093079
1464 Ga0265314_10098822
1465 Ga0265314_10104317
1466 Ga0265342_10011777
1467 Ga0265342_10019089
1468 Ga0265342_10210518
1469 Ga0265342_10240671
1470 Ga0265342_10528442
1471 Ga0307405_10093478
1472 Ga0307416_100246297
1473 Ga0307415_100305825
1474 Ga0373926_0012170
1475 Ga0373929_0198666
1476 Ga0373934_0192213
1477 Ga0373944_0136839
1478 Ga0373949_0013045
1479 Ga0373951_0139555
1480 Ga0373923_0601161
1481 Ga0373936_0125929
1482 Ga0373945_0581142
1483 Ga0373956_0463976
1484 Ga0373957_0313898
1485 Ga0373960_0292337
1486 Ga0373943_0001012
1487 Ga0373943_0503745
1488 Ga0373946_0063315
1489 Ga0373955_0035019
1490 Ga0373955_1019257
1491 Ga0373961_0243972
1492 Ga0373931_0010780
1493 Ga0373935_0047048
1494 Ga0373927_0049245
1495 Ga0373933_0048671
1496 Ga0373947_0001552
1497 Ga0373937_0000355
1498 Ga0373937_0317727
1499 Ga0373937_0379173
1500 Ga0373937_1483170
1501 Ga0373937_1902801
1502 Ga0373925_0007406
1503 Ga0395899_0080577
1504 Ga0395899_0102523
1505 Ga0395899_0143077
1506 Ga0395899_0573369
1507 Ga0395900_0128055
1508 Ga0395900_0140283
1509 Ga0395900_0221277
1510 Ga0395900_0388044
1511 Ga0395900_0658226
1512 Ga0395900_0709558
1513 Ga0395900_1448153
1514 Ga0395898_0095120
1515 Ga0395898_0207769
1516 Ga0395898_0796814
1517 Ga0395898_0904405
1518 Ga0395898_0917966
1519 Ga0395898_0924804
1520 Ga0395898_1457309
1521 Ga0395905_0248304
1522 Ga0395905_1042955
1523 Ga0395905_1048441
1524 Ga0395905_1146403
1525 Ga0395905_1557016
1526 Ga0395901_0089797
1527 Ga0395901_0629307
1528 Ga0395901_0789678
1529 Ga0395901_1088901
1530 Ga0395901_1129757
1531 Ga0395901_1273572
1532 Ga0395901_1289827
1533 Ga0436365_1260527
1534 Ga0436360_0134583
1535 Ga0436360_0249670
1536 Ga0436363_0296049
1537 Ga0439453_0002236
1538 Ga0439461_0033180
1539 Ga0451849_1048234
1540 Ga0451853_1958868
1541 Ga0439445_0243414
1542 Ga0439448_0047072
1543 Ga0439451_021447
1544 Ga0466969_0003223
1545 Ga0466969_0083616
1546 Ga0466969_0128896
1547 Ga0466969_0274891
1548 Ga0466972_0569304
1549 Ga0466965_0050616
1550 Ga0466965_0052097
1551 Ga0466965_0074998
1552 Ga0466965_0075882
1553 Ga0466965_0080484
1554 Ga0466965_0515727
1555 Ga0466966_0017398
1556 Ga0466966_0085063
1557 Ga0466966_0086218
1558 Ga0466966_0090799
1559 Ga0466966_0254890
1560 Ga0466966_0319246
1561 Ga0466966_0745912
1562 Ga0466961_0005282
1563 Ga0466961_0008879
1564 Ga0466961_0027130
1565 Ga0466961_0079263
1566 Ga0466961_0106343
1567 Ga0466961_0133855
1568 Ga0466961_0418829
1569 Ga0466963_0000010
1570 Ga0466963_0000649
1571 Ga0466963_0001770
1572 Ga0466963_0002000
1573 Ga0466963_0004407
1574 Ga0466963_0004464
1575 Ga0466963_0007182
1576 Ga0466963_0010186
1577 Ga0466963_0013797
1578 Ga0466963_0023343
1579 Ga0466963_0034779
1580 Ga0466963_0061633
1581 Ga0466963_0111563
1582 Ga0466963_0165855
1583 Ga0466963_0171253
1584 Ga0466963_0284073
1585 Ga0466963_0299326
1586 Ga0466963_0374982
1587 Ga0466963_0499035
1588 Ga0466963_0808330
1589 Ga0466963_0888203
1590 Ga0466964_0000213
1591 Ga0466964_0008591
1592 Ga0466964_0023691
1593 Ga0466964_0031496
1594 Ga0466964_0031869
1595 Ga0466964_0039198
1596 Ga0466964_0051369
1597 Ga0466964_0100868
1598 Ga0466964_0132499
1599 Ga0466964_0167304
1600 Ga0466964_0207540
1601 Ga0466964_0252216
1602 Ga0466964_0348546
1603 Ga0466964_0434408
1604 Ga0466964_0438146
1605 Ga0466964_0581351
1606 Ga0466971_0004429
1607 Ga0466971_0006123
1608 Ga0466971_0010450
1609 Ga0466971_0034738
1610 Ga0466971_0094401
1611 Ga0466971_0295719
1612 Ga0466968_0001937
1613 Ga0466968_0003137
1614 Ga0466968_0005017
1615 Ga0466968_0011205
1616 Ga0466968_0018981
1617 Ga0466968_0093842
1618 Ga0466968_0138895
1619 Ga0466970_0004127
1620 Ga0466970_0137134
1621 Ga0466970_0178128
1622 Ga0466970_0283130
1623 Ga0466970_0724194
1624 Ga0466957_0009295
1625 Ga0466957_0021958
1626 Ga0466957_0025441
1627 Ga0466957_0033272
1628 Ga0466957_0094799
1629 Ga0466957_0234214
1630 Ga0466957_0289971
1631 Ga0466957_0317661
1632 Ga0466957_0408286
1633 Ga0466957_0459239
1634 Ga0466957_1067989
1635 Ga0466957_1135314
1636 Ga0466957_1298025
1637 Ga0466957_1433304
1638 Ga0466960_0005761
1639 Ga0466960_0011815
1640 Ga0466960_0039338
1641 Ga0466960_0055310
1642 Ga0466960_0097033
1643 Ga0466960_0458479
1644 Ga0466960_0471454
1645 Ga0466960_0481040
1646 Ga0466959_0003840
1647 Ga0466959_0009312
1648 Ga0466959_0032586
1649 Ga0466959_0050692
1650 Ga0466959_0068110
1651 Ga0466959_0596101
1652 Ga0466959_0874037
1653 Ga0451576_2700887
1654 Ga0466958_0000431
1655 Ga0466958_0001425
1656 Ga0466958_0002150
1657 Ga0466958_0025195
1658 Ga0466958_0066615
1659 Ga0466958_0079309
1660 Ga0466958_0115347
1661 Ga0466958_0116169
1662 Ga0466958_0399438
1663 Ga0466958_0409828
1664 Ga0466958_0551108
1665 Ga0466958_0642807
1666 Ga0466958_0783635
1667 Ga0466958_1069720
1668 Ga0466967_0000332
1669 Ga0466967_0001331
1670 Ga0466967_0002063
1671 Ga0466967_0002354
1672 Ga0466967_0010334
1673 Ga0466967_0015409
1674 Ga0466967_0016719
1675 Ga0466967_0022864
1676 Ga0466967_0023774
1677 Ga0466967_0024167
1678 Ga0466967_0038072
1679 Ga0466967_0042311
1680 Ga0466967_0062915
1681 Ga0466967_0066290
1682 Ga0466967_0077443
1683 Ga0466967_0079621
1684 Ga0466967_0099263
1685 Ga0466967_0113945
1686 Ga0466967_0127686
1687 Ga0466967_0158743
1688 Ga0466967_0169342
1689 Ga0466967_0199979
1690 Ga0466967_0202306
1691 Ga0466967_0232813
1692 Ga0466967_0245079
1693 Ga0466967_0264260
1694 Ga0466967_0421752
1695 Ga0466967_0439108
1696 Ga0466967_0451495
1697 Ga0466967_0545234
1698 Ga0466967_0709865
1699 Ga0466967_0718067
1700 Ga0466967_1210509
1701 Ga0495592_0000732
1702 Ga0495592_0004058
1703 Ga0495592_0080194
1704 Ga0495592_0158825
1705 Ga0495592_0387691
1706 Ga0495592_0461163
1707 Ga0495592_0769422
1708 Ga0495603_0046829
1709 Ga0495629_0017747
1710 Ga0495629_0131264
1711 Ga0495629_0235242
1712 Ga0495629_0252307
1713 Ga0495629_0439069
1714 Ga0495641_0016066
1715 Ga0495641_0026195
1716 Ga0495641_0079331
1717 Ga0495641_0086874
1718 Ga0495641_0114459
1719 Ga0495641_0204830
1720 Ga0495651_0000029
1721 Ga0495651_0037777
1722 Ga0495651_0139797
1723 Ga0495651_0161878
1724 Ga0495651_0342042
1725 Ga0495651_0454263
1726 Ga0495653_0001363
1727 Ga0495653_0008307
1728 Ga0495653_0072654
1729 Ga0495653_0091261
1730 Ga0495653_0115764
1731 Ga0495653_0135178
1732 Ga0495653_0151920
1733 Ga0495653_0227844
1734 Ga0495653_0374914
1735 Ga0495653_0575937
1736 Ga0495653_0861213
1737 Ga0495580_0024113
1738 Ga0495582_0004164
1739 Ga0495582_0150648
1740 Ga0495639_0006273
1741 Ga0495639_0340620
1742 Ga0495662_0001522
1743 Ga0495662_0023497
1744 Ga0495664_0042590
1745 Ga0495664_0201632
1746 Ga0495664_0267472
1747 Ga0495584_0007847
1748 Ga0495585_0025444
1749 Ga0495594_0145070
1750 Ga0495594_0319906
1751 Ga0495594_0639243
1752 Ga0495596_0062955
1753 Ga0495607_0040771
1754 Ga0495608_0014722
1755 Ga0495608_0023778
1756 Ga0495608_0032053
1757 Ga0495608_0115571
1758 Ga0495608_0312755
1759 Ga0495608_0355764
1760 Ga0495608_0418423
1761 Ga0495618_0009479
1762 Ga0495618_0034082
1763 Ga0495618_0067575
1764 Ga0495618_0104752
1765 Ga0495618_0736342
1766 Ga0495628_0000016
1767 Ga0495628_0014430
1768 Ga0495628_0028205
1769 Ga0495630_0000505
1770 Ga0495630_0298166
1771 Ga0495630_0681174
1772 Ga0495630_0770971
1773 Ga0495630_1362339
1774 Ga0495644_0020878
1775 Ga0495663_0375953
1776 Ga0495666_0186505
1777 Ga0495652_0000045
1778 Ga0495652_0006417
1779 Ga0495652_0042714
1780 Ga0495652_0081521
1781 Ga0495652_0083596
1782 Ga0495652_0118634
1783 Ga0495652_0232474
1784 Ga0495665_0029813
1785 Ga0495640_0007391
1786 Ga0495640_0014315
1787 Ga0495640_0125500
1788 Ga0495640_0954284
1789 Ga0495586_0034130
1790 Ga0495586_0088546
1791 Ga0495587_0000083
1792 Ga0495587_0114475
1793 Ga0495587_0655845
1794 Ga0495587_0674079
1795 Ga0495645_0001902
1796 Ga0495645_0021257
1797 Ga0495645_0028921
1798 Ga0495645_0306506
1799 Ga0495667_0025440
1800 Ga0495667_0069376
1801 Ga0495667_0111199
1802 Ga0495667_0120029
1803 Ga0495667_0193124
1804 Ga0495667_0223154
1805 Ga0495667_0540690
1806 Ga0495656_0001481
1807 Ga0495668_0245643
1808 Ga0495634_0003355
1809 Ga0495634_0038164
1810 Ga0495634_0091496
1811 Ga0495634_0200725
1812 Ga0495611_0124287
1813 Ga0495635_0004708
1814 Ga0495635_0044339
1815 Ga0495635_0159815
1816 Ga0495635_0275879
1817 Ga0495635_0402960
1818 Ga0495635_0409722
1819 Ga0495635_0561639
1820 Ga0495635_0816601
1821 Ga0495661_0159110
1822 Ga0495588_0088482
1823 Ga0495657_0011595
1824 Ga0495657_0037285
1825 Ga0495657_0187772
1826 Ga0495657_0241416
1827 Ga0495657_0345525
1828 Ga0495657_0346145
1829 Ga0495657_0399648
1830 Ga0495657_0469575
1831 Ga0495657_0706024
1832 Ga0495599_0000187
1833 Ga0495599_0000610
1834 Ga0495599_0200702
1835 Ga0495599_0235184
1836 Ga0495599_0463928
1837 Ga0495623_0000121
1838 Ga0495623_0005723
1839 Ga0495623_0194689
1840 Ga0495646_0001537
1841 Ga0495646_0062692
1842 Ga0495647_0000468
1843 Ga0495647_0049997
1844 Ga0495658_0011253
1845 Ga0495658_0203263
1846 Ga0495669_0276031
1847 Ga0495613_0062116
1848 Ga0495613_0081268
1849 Ga0495613_0456135
1850 Ga0495624_0005932
1851 Ga0495624_0022126
1852 Ga0495624_0408691
1853 Ga0495624_0633771
1854 Ga0495670_0072448
1855 Ga0495589_0200021
1856 Ga0495600_0041000
1857 Ga0495600_0228921
1858 Ga0495600_0268406
1859 Ga0495600_0473465
1860 Ga0495660_0280624
1861 Ga0495581_0002035
1862 Ga0495581_0047064
1863 Ga0495581_0263017
1864 Ga0495604_0000072
1865 Ga0495604_0087853
1866 Ga0495604_0375810
1867 Ga0495604_0601678
1868 Ga0495674_0012591
1869 Ga0495674_0073771
1870 Ga0495674_0493489
1871 Ga0495674_0582007
1872 Ga0495676_0071355
1873 Ga0495676_0155177
1874 Ga0495676_0160103
1875 Ga0495676_0429865
1876 Ga0495680_0004810
1877 Ga0495680_0007057
1878 Ga0495680_0016342
1879 Ga0495680_0037008
1880 Ga0495680_0108643
1881 Ga0495680_0181638
1882 Ga0495680_0611430
1883 Ga0495680_0929519
1884 Ga0495683_0226532
1885 Ga0495675_0000031
1886 Ga0495675_0355316
1887 Ga0495675_0563240
1888 Ga0495677_0028578
1889 Ga0495679_055719
1890 Ga0495684_0008099
1891 Ga0495684_0019924
1892 Ga0495684_0027689
1893 Ga0495684_0297074
1894 Ga0495684_0516700
1895 Ga0495684_0674395
1896 Ga0495593_0000333
1897 Ga0495593_0119571
1898 Ga0495602_0000133
1899 Ga0495602_0024934
1900 Ga0495602_0095157
1901 Ga0495602_0678536
1902 Ga0495602_0723161
1903 Ga0495614_0001325
1904 Ga0496100_0034269
1905 Ga0496100_0049310
1906 Ga0496100_0144881
1907 Ga0496100_0974278
1908 Ga0496101_0002509
1909 Ga0496101_0044485
1910 Ga0496101_0110389
1911 Ga0496101_0260787
1912 Ga0496101_0952560
1913 Ga0496101_1067501
1914 Ga0496102_0005815
1915 Ga0496102_0055705
1916 Ga0496102_0100308
1917 Ga0496102_0185761
1918 Ga0496102_0352481
1919 Ga0496102_0849525
1920 Ga0496103_0016363
1921 Ga0496103_0023625
1922 Ga0496104_0034254
1923 Ga0496104_0039390
1924 Ga0496104_0864155
1925 Ga0496104_0988404
1926 Ga0496105_0010632
1927 Ga0496105_0017937
1928 Ga0496105_0104099
1929 Ga0496105_0845583
1930 Ga0496105_1212534
1931 Ga0496106_0030068
1932 Ga0496106_0041047
1933 Ga0496106_0103195
1934 Ga0496106_0741584
1935 Ga0496107_0010435
1936 Ga0496107_0093099
1937 Ga0496107_0154752
1938 Ga0496107_0155954
1939 Ga0496107_1045708
1940 Ga0496108_0011946
1941 Ga0496108_0036442
1942 Ga0496108_0482952
1943 Ga0496108_0631030
1944 Ga0496109_0009062
1945 Ga0496109_0056369
1946 Ga0496109_0344092
1947 Ga0496109_0609685
1948 Ga0496109_0620230
1949 Ga0496110_0006093
1950 Ga0496110_0237736
1951 Ga0496110_0279650
1952 Ga0496110_0733996
1953 Ga0496111_0016935
1954 Ga0496111_0022289
1955 Ga0496111_0271384
1956 Ga0496111_0293454
1957 Ga0496111_1136859
1958 Ga0496112_0056461
1959 Ga0496112_0071929
1960 Ga0496112_0082148
1961 Ga0496112_0087667
1962 Ga0496112_0089402
1963 Ga0496112_0186249
1964 Ga0496112_0289113
1965 Ga0496112_0434252
1966 Ga0496112_1036068
1967 Ga0496112_1216066
1968 Ga0496112_1233356
1969 Ga0496113_0041344
1970 Ga0496113_0166052
1971 Ga0496113_0181263
1972 Ga0496113_0234272
1973 Ga0496113_0300215
1974 Ga0496113_0555840
1975 Ga0496113_0738305
1976 Ga0496114_0011562
1977 Ga0496114_0096721
1978 Ga0496114_0176094
1979 Ga0496115_0026093
1980 Ga0496115_0043589
1981 Ga0496115_0080724
1982 Ga0496115_0082447
1983 Ga0496115_0100595
1984 Ga0496115_0199138
1985 Ga0496115_0641835
1986 Ga0501034_0004589
1987 Ga0501038_0655408
1988 Ga0501048_0291163
1989 Ga0501067_0027300
1990 Ga0501067_0057526
1991 Ga0501067_0238382
1992 Ga0501067_0274228
1993 Ga0501069_0019863
1994 Ga0501069_0033705
1995 Ga0501070_0025291
1996 Ga0501070_0051543
1997 Ga0501070_0846256
1998 Ga0501072_0015894
1999 Ga0501073_0052133
2000 Ga0501074_0017998
2001 Ga0501079_0036453
2002 Ga0501080_0000535
2003 Ga0501080_0007055
2004 Ga0501083_0011627
2005 nmdc:mga05p37_1052152_c1
2006 nmdc:mga0n895_180850_c1
2007 nmdc:mga0n895_5478_c1
2008 nmdc:mga0rr50_1006024_c1
2009 nmdc:mga0rr50_544609_c1
2010 nmdc:mga08x19_381534_c1
2011 nmdc:mga08x19_737301_c1
2012 nmdc:mga0a205_299821_c1
2013 nmdc:mga0a205_488426_c1
2014 Ga0495601_0000304
2015 Ga0495601_0026164
2016 Ga0495601_0033652
2017 Ga0495601_0111956
2018 Ga0495601_0167849
2019 Ga0495601_0525157
2020 Ga0495601_0670365
2021 Ga0495612_0005159
2022 Ga0495612_0011693
2023 Ga0495612_0424336
2024 Ga0495612_0601550
2025 Ga0495595_0004259
2026 Ga0495595_0010303
2027 Ga0495595_0015196
2028 Ga0495595_0104732
2029 Ga0495595_0617963
2030 Ga0495595_0738570
2031 Ga0495619_0000836
2032 Ga0495619_0001937
2033 Ga0495619_0109203
2034 Ga0495619_0109497
2035 Ga0495619_0296165
2036 Ga0495619_0568792
2037 Ga0500566_0008196
2038 Ga0500614_224465
2039 Ga0501082_0804749
2040 Ga0466962_0002608
2041 Ga0466962_0005598
2042 Ga0466962_0012201
2043 Ga0466962_0028295
2044 Ga0466962_0029341
2045 Ga0466962_0041976
2046 Ga0466962_0382425

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11950

DUF3467

Protein of unknown function (DUF3467)

2

95

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qp7-assembly1.cif.gz_1 structure of the human 48s initiation complex in closed state (h48s aug closed) 0.7527 36 71
5g06-assembly1.cif.gz_D cryo-em structure of yeast cytoplasmic exosome 0.7471 16 52
7lbm-assembly1.cif.gz_0 structure of the human mediator-bound transcription pre-initiation complex 0.7464 36 73
6ybt-assembly1.cif.gz_1 structure of a human 48s translational initiation complex - eif3bgi 0.7457 36 71
6d6k-assembly1.cif.gz_A structure of polyribonucleotide nucleotidyltransferase from acinetobacter baumannii 0.7401 16 51
ID Description Score Start End Superfamily
af_A4ID27_51_409_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.808 36 73 2.130.10.10
af_Q8S2H5_315_629_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8078 36 73 3.60.21.10
af_Q7XU84_7_321_3.60.40.10 Alpha Beta;4-Layer Sandwich;Phosphatase 2c; domain 1;PPM-type phosphatase domain 0.7712 36 51 3.60.40.10
af_Q4G061_490_685_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7584 36 71 2.130.10.10
af_A0A2R8Q7Q3_23_327_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7378 34 73 3.60.21.10
ID Description Score Start End GO Terms
AF-U5HJB3-F1-model_v4 Zn(2)-C6 fungal-type domain-containing protein 0.7849 36 73
AF-A0A1G3QPD1-F1-model_v4 Type II secretion system protein K 0.7645 36 73
AF-A0A6L7MRY7-F1-model_v4 General secretion pathway protein GspK 0.7574 36 73
AF-A0A7S2CZ40-F1-model_v4 F-box protein Hrt3/FBXO9 C-terminal domain-containing protein 0.7551 34 74
AF-A0A1S1M166-F1-model_v4 Uncharacterized protein 0.7545 36 73 GO:0016020

Map