F488419
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1022 | 381 | 2040 | 221 |
Family's Representative Sequence
| Representative Sequence | 3300039438|Ga0436360_0523085|Ga0436360_0523085_386_1141 |
| Length | 227 |
| Sequence | MATGADSMGGTMEPVSAKPISVVVAEDDVLLREGLASLLAREGFDVVGQAGDGAGLVELAREHRPDLVLVDIRMPPSHTTEGLDAARVIRAESPGTGIVVLSAYVDVEHAMETLDHVASGGSMVDPALVRELVAAQRKDDPLGELSEREREVLALMAEGRSNAGIAHRLWVTEGTVEKHVSSILSKLTLDASADDHRRVLAVITFLQTLSSGSGTARSPLPTDRTSR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 7 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 8 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 9 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 10 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 11 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 12 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 83 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 84 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 85 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 87 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 88 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 96 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 97 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 98 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 103 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 104 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 119 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 120 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 121 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 122 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 136 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 139 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 141 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 202 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 203 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 204 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 206 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 207 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 208 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 209 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 210 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 211 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 212 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 213 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 214 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 215 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 217 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 218 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 219 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 220 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 221 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 222 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 223 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 225 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 226 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 228 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 230 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 231 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 232 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 233 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 234 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 235 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 236 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 237 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 238 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 239 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 240 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 243 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 244 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 245 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 246 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 247 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 248 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 249 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 250 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 251 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 252 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 253 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 254 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 255 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 256 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 257 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 258 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 259 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 260 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 261 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 262 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 263 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 264 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 265 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 266 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 267 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 268 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 269 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 270 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 271 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 272 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 273 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 274 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 275 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 276 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 277 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 278 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 279 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 280 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 325 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 326 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 327 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 328 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 329 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 330 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 333 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 334 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 335 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 336 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 337 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 338 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 339 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 340 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 341 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 342 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 343 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 344 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 356 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 357 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 365 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 367 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 369 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 370 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 371 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 372 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 373 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 374 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 375 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 376 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 377 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 378 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 379 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 380 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 381 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.02 |
| Metatranscriptomes | 0.2 |
| Isolates | 0.78 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.15 |
| Nodule | 0 |
| Rhizoplane | 10.67 |
| Rhizosphere | 84.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0436360_0523085 | 3300039438 | Bacteria | 1609 |
| 2 | LJNas_1001704 | 3300000546 | Bacteria | 2970 |
| 3 | JGI24746J21847_1006939 | 3300001977 | Bacteria | 1740 |
| 4 | JGI24737J22298_10080820 | 3300001990 | Bacteria | 967 |
| 5 | JGI24743J22301_10005600 | 3300001991 | Bacteria | 2102 |
| 6 | JGI24750J21931_1006453 | 3300002070 | Bacteria | 1460 |
| 7 | JGI24745J21846_1014373 | 3300002073 | Bacteria | 916 |
| 8 | JGI24748J21848_1002589 | 3300002074 | Bacteria | 2048 |
| 9 | JGI24749J21850_1004724 | 3300002076 | Bacteria | 1907 |
| 10 | JGI24744J21845_10001665 | 3300002077 | Bacteria | 4443 |
| 11 | JGI24744J21845_10002839 | 3300002077 | Bacteria | 3538 |
| 12 | JGI24742J22300_10000089 | 3300002244 | Bacteria | 13351 |
| 13 | JGI25407J50210_10035780 | 3300003373 | Bacteria | 1279 |
| 14 | Ga0070658_10720726 | 3300005327 | Bacteria | 866 |
| 15 | Ga0070676_10003176 | 3300005328 | Bacteria | 8512 |
| 16 | Ga0070676_10161649 | 3300005328 | Bacteria | 1442 |
| 17 | Ga0070683_100072651 | 3300005329 | Bacteria | 3211 |
| 18 | Ga0070683_100743751 | 3300005329 | Bacteria | 939 |
| 19 | Ga0070690_100007614 | 3300005330 | Bacteria | 6204 |
| 20 | Ga0070690_100053018 | 3300005330 | Bacteria | 2593 |
| 21 | Ga0070670_100241920 | 3300005331 | Bacteria | 1571 |
| 22 | Ga0068869_100005345 | 3300005334 | Bacteria | 8075 |
| 23 | Ga0068869_100007876 | 3300005334 | Bacteria | 6837 |
| 24 | Ga0068869_100683287 | 3300005334 | Bacteria | 874 |
| 25 | Ga0070666_10015031 | 3300005335 | Bacteria | 4933 |
| 26 | Ga0070680_100169897 | 3300005336 | Bacteria | 1834 |
| 27 | Ga0070682_100008251 | 3300005337 | Bacteria | 5874 |
| 28 | Ga0070682_100086754 | 3300005337 | Bacteria | 2039 |
| 29 | Ga0070682_100101568 | 3300005337 | Bacteria | 1899 |
| 30 | Ga0070682_100407004 | 3300005337 | Bacteria | 1031 |
| 31 | Ga0070682_100423719 | 3300005337 | Bacteria | 1012 |
| 32 | Ga0068868_100000483 | 3300005338 | Bacteria | 26462 |
| 33 | Ga0068868_100061428 | 3300005338 | Bacteria | 2977 |
| 34 | Ga0068868_100100357 | 3300005338 | Bacteria | 2342 |
| 35 | Ga0068868_100187421 | 3300005338 | Bacteria | 1719 |
| 36 | Ga0070660_100223097 | 3300005339 | Bacteria | 1532 |
| 37 | Ga0070689_100026117 | 3300005340 | Bacteria | 4393 |
| 38 | Ga0070689_100131863 | 3300005340 | Bacteria | 2004 |
| 39 | Ga0070689_100191197 | 3300005340 | Bacteria | 1667 |
| 40 | Ga0070691_10096120 | 3300005341 | Bacteria | 1466 |
| 41 | Ga0070691_10171169 | 3300005341 | Bacteria | 1125 |
| 42 | Ga0070687_100081954 | 3300005343 | Bacteria | 1763 |
| 43 | Ga0070687_100517152 | 3300005343 | Bacteria | 806 |
| 44 | Ga0070661_100016242 | 3300005344 | Bacteria | 5259 |
| 45 | Ga0070692_10238053 | 3300005345 | Bacteria | 1084 |
| 46 | Ga0070692_10504194 | 3300005345 | Bacteria | 785 |
| 47 | Ga0070668_100000385 | 3300005347 | Bacteria | 29197 |
| 48 | Ga0070668_100000558 | 3300005347 | Bacteria | 24900 |
| 49 | Ga0070668_100076097 | 3300005347 | Bacteria | 2621 |
| 50 | Ga0070668_100114492 | 3300005347 | Bacteria | 2149 |
| 51 | Ga0070669_100000960 | 3300005353 | Bacteria | 21054 |
| 52 | Ga0070669_100006266 | 3300005353 | Bacteria | 8584 |
| 53 | Ga0070671_100006148 | 3300005355 | Bacteria | 9562 |
| 54 | Ga0070671_100093668 | 3300005355 | Bacteria | 2517 |
| 55 | Ga0070671_100217760 | 3300005355 | Bacteria | 1620 |
| 56 | Ga0070674_100004720 | 3300005356 | Bacteria | 7799 |
| 57 | Ga0070674_100008272 | 3300005356 | Bacteria | 6186 |
| 58 | Ga0070674_100474068 | 3300005356 | Bacteria | 1037 |
| 59 | Ga0070673_100058256 | 3300005364 | Bacteria | 3053 |
| 60 | Ga0070688_100011279 | 3300005365 | Bacteria | 4963 |
| 61 | Ga0070659_100005583 | 3300005366 | Bacteria | 9038 |
| 62 | Ga0070659_100154297 | 3300005366 | Bacteria | 1874 |
| 63 | Ga0070659_100665490 | 3300005366 | Bacteria | 898 |
| 64 | Ga0070667_100001425 | 3300005367 | Bacteria | 21427 |
| 65 | Ga0070667_100002282 | 3300005367 | Bacteria | 16878 |
| 66 | Ga0070667_100025244 | 3300005367 | Bacteria | 4940 |
| 67 | Ga0070667_100037980 | 3300005367 | Bacteria | 4038 |
| 68 | Ga0070667_100166766 | 3300005367 | Bacteria | 1943 |
| 69 | Ga0070667_100243518 | 3300005367 | Bacteria | 1606 |
| 70 | Ga0070709_10006066 | 3300005434 | Bacteria | 6577 |
| 71 | Ga0070709_10010319 | 3300005434 | Bacteria | 5168 |
| 72 | Ga0070709_10016027 | 3300005434 | Bacteria | 4271 |
| 73 | Ga0070709_10091419 | 3300005434 | Bacteria | 2008 |
| 74 | Ga0070709_10265994 | 3300005434 | Bacteria | 1241 |
| 75 | Ga0070714_100000805 | 3300005435 | Bacteria | 22198 |
| 76 | Ga0070714_100005264 | 3300005435 | Bacteria | 9856 |
| 77 | Ga0070714_100069064 | 3300005435 | Bacteria | 3050 |
| 78 | Ga0070714_100118280 | 3300005435 | Bacteria | 2354 |
| 79 | Ga0070714_100252388 | 3300005435 | Bacteria | 1631 |
| 80 | Ga0070714_100342789 | 3300005435 | Bacteria | 1402 |
| 81 | Ga0070714_100362049 | 3300005435 | Bacteria | 1364 |
| 82 | Ga0070714_100436991 | 3300005435 | Bacteria | 1241 |
| 83 | Ga0070713_100000392 | 3300005436 | Bacteria | 28109 |
| 84 | Ga0070713_100002559 | 3300005436 | Bacteria | 11899 |
| 85 | Ga0070713_100004531 | 3300005436 | Bacteria | 9358 |
| 86 | Ga0070713_100042889 | 3300005436 | Bacteria | 3695 |
| 87 | Ga0070713_100247106 | 3300005436 | Bacteria | 1626 |
| 88 | Ga0070713_100487845 | 3300005436 | Bacteria | 1161 |
| 89 | Ga0070713_100670914 | 3300005436 | Bacteria | 988 |
| 90 | Ga0070713_100793720 | 3300005436 | Bacteria | 907 |
| 91 | Ga0070713_100864539 | 3300005436 | Bacteria | 869 |
| 92 | Ga0070713_100942154 | 3300005436 | Bacteria | 831 |
| 93 | Ga0070710_10000240 | 3300005437 | Bacteria | 25768 |
| 94 | Ga0070710_10001472 | 3300005437 | Bacteria | 11083 |
| 95 | Ga0070710_10003905 | 3300005437 | Bacteria | 7061 |
| 96 | Ga0070710_10006432 | 3300005437 | Bacteria | 5643 |
| 97 | Ga0070710_10036292 | 3300005437 | Bacteria | 2694 |
| 98 | Ga0070710_10064656 | 3300005437 | Unclassified | 2093 |
| 99 | Ga0070710_10072604 | 3300005437 | Bacteria | 1987 |
| 100 | Ga0070710_10077457 | 3300005437 | Bacteria | 1932 |
| 101 | Ga0070701_10001759 | 3300005438 | Bacteria | 8164 |
| 102 | Ga0070701_10056189 | 3300005438 | Bacteria | 2058 |
| 103 | Ga0070701_10084515 | 3300005438 | Bacteria | 1726 |
| 104 | Ga0070711_100000197 | 3300005439 | Bacteria | 31831 |
| 105 | Ga0070711_100002538 | 3300005439 | Bacteria | 10445 |
| 106 | Ga0070711_100013514 | 3300005439 | Bacteria | 5126 |
| 107 | Ga0070711_100017712 | 3300005439 | Bacteria | 4539 |
| 108 | Ga0070711_100021255 | 3300005439 | Bacteria | 4193 |
| 109 | Ga0070711_100035400 | 3300005439 | Bacteria | 3338 |
| 110 | Ga0070711_100037812 | 3300005439 | Bacteria | 3240 |
| 111 | Ga0070711_100056451 | 3300005439 | Bacteria | 2715 |
| 112 | Ga0070711_100070841 | 3300005439 | Bacteria | 2456 |
| 113 | Ga0070711_100088588 | 3300005439 | Bacteria | 2224 |
| 114 | Ga0070711_100197176 | 3300005439 | Bacteria | 1551 |
| 115 | Ga0070711_100261492 | 3300005439 | Bacteria | 1362 |
| 116 | Ga0070711_100336887 | 3300005439 | Bacteria | 1209 |
| 117 | Ga0070705_100550294 | 3300005440 | Bacteria | 885 |
| 118 | Ga0070700_100001630 | 3300005441 | Bacteria | 11220 |
| 119 | Ga0070708_100035130 | 3300005445 | Bacteria | 4365 |
| 120 | Ga0070708_100064357 | 3300005445 | Bacteria | 3285 |
| 121 | Ga0070708_100259120 | 3300005445 | Bacteria | 1635 |
| 122 | Ga0070708_100398519 | 3300005445 | Bacteria | 1298 |
| 123 | Ga0070663_100008356 | 3300005455 | Bacteria | 6360 |
| 124 | Ga0070663_100015423 | 3300005455 | Bacteria | 4932 |
| 125 | Ga0070663_100072983 | 3300005455 | Bacteria | 2502 |
| 126 | Ga0070663_100153793 | 3300005455 | Bacteria | 1766 |
| 127 | Ga0070678_100039972 | 3300005456 | Bacteria | 3315 |
| 128 | Ga0070662_100013356 | 3300005457 | Bacteria | 5465 |
| 129 | Ga0070662_100024583 | 3300005457 | Bacteria | 4152 |
| 130 | Ga0070662_100308937 | 3300005457 | Bacteria | 1287 |
| 131 | Ga0070681_10100810 | 3300005458 | Bacteria | 2833 |
| 132 | Ga0070681_10573554 | 3300005458 | Bacteria | 1042 |
| 133 | Ga0068867_100002073 | 3300005459 | Bacteria | 14047 |
| 134 | Ga0068867_100170907 | 3300005459 | Bacteria | 1721 |
| 135 | Ga0068867_100209512 | 3300005459 | Bacteria | 1565 |
| 136 | Ga0070685_10021109 | 3300005466 | Bacteria | 3536 |
| 137 | Ga0070685_10038246 | 3300005466 | Bacteria | 2721 |
| 138 | Ga0070685_10066726 | 3300005466 | Bacteria | 2121 |
| 139 | Ga0070685_10131749 | 3300005466 | Bacteria | 1564 |
| 140 | Ga0070706_100066559 | 3300005467 | Bacteria | 3332 |
| 141 | Ga0070706_100072683 | 3300005467 | Bacteria | 3182 |
| 142 | Ga0070706_100310021 | 3300005467 | Bacteria | 1472 |
| 143 | Ga0070707_100072548 | 3300005468 | Bacteria | 3318 |
| 144 | Ga0070707_100168156 | 3300005468 | Bacteria | 2137 |
| 145 | Ga0070707_100258890 | 3300005468 | Bacteria | 1693 |
| 146 | Ga0070707_100416688 | 3300005468 | Bacteria | 1303 |
| 147 | Ga0070698_100026365 | 3300005471 | Bacteria | 6049 |
| 148 | Ga0070698_100118676 | 3300005471 | Bacteria | 2606 |
| 149 | Ga0070698_100492266 | 3300005471 | Bacteria | 1164 |
| 150 | Ga0070698_100545338 | 3300005471 | Bacteria | 1099 |
| 151 | Ga0070699_100095029 | 3300005518 | Bacteria | 2609 |
| 152 | Ga0070679_100100988 | 3300005530 | Bacteria | 2871 |
| 153 | Ga0070697_100052226 | 3300005536 | Bacteria | 3321 |
| 154 | Ga0068853_100029215 | 3300005539 | Bacteria | 4645 |
| 155 | Ga0068853_100135999 | 3300005539 | Bacteria | 2203 |
| 156 | Ga0070672_100159837 | 3300005543 | Bacteria | 1868 |
| 157 | Ga0070686_100160315 | 3300005544 | Bacteria | 1584 |
| 158 | Ga0070686_100176158 | 3300005544 | Bacteria | 1516 |
| 159 | Ga0070695_100025441 | 3300005545 | Bacteria | 3655 |
| 160 | Ga0070695_100070423 | 3300005545 | Bacteria | 2288 |
| 161 | Ga0070696_100016686 | 3300005546 | Bacteria | 4951 |
| 162 | Ga0070696_100082778 | 3300005546 | Bacteria | 2275 |
| 163 | Ga0070696_100265618 | 3300005546 | Bacteria | 1303 |
| 164 | Ga0070693_100006772 | 3300005547 | Bacteria | 5565 |
| 165 | Ga0070693_100059516 | 3300005547 | Bacteria | 2214 |
| 166 | Ga0070693_100190642 | 3300005547 | Bacteria | 1325 |
| 167 | Ga0070693_100330094 | 3300005547 | Bacteria | 1038 |
| 168 | Ga0070665_100024629 | 3300005548 | Bacteria | 6065 |
| 169 | Ga0070665_100030158 | 3300005548 | Bacteria | 5457 |
| 170 | Ga0070665_100045778 | 3300005548 | Bacteria | 4394 |
| 171 | Ga0070665_100049147 | 3300005548 | Bacteria | 4232 |
| 172 | Ga0070665_100064333 | 3300005548 | Bacteria | 3678 |
| 173 | Ga0070665_100102507 | 3300005548 | Bacteria | 2865 |
| 174 | Ga0070665_100161578 | 3300005548 | Bacteria | 2242 |
| 175 | Ga0070665_100323313 | 3300005548 | Bacteria | 1547 |
| 176 | Ga0070704_100000219 | 3300005549 | Bacteria | 24091 |
| 177 | Ga0070704_100122631 | 3300005549 | Bacteria | 2000 |
| 178 | Ga0070704_100291480 | 3300005549 | Bacteria | 1356 |
| 179 | Ga0068855_100414973 | 3300005563 | Bacteria | 1473 |
| 180 | Ga0068857_100117496 | 3300005577 | Bacteria | 2393 |
| 181 | Ga0068854_100524179 | 3300005578 | Bacteria | 1001 |
| 182 | Ga0068856_100867339 | 3300005614 | Bacteria | 922 |
| 183 | Ga0070702_100002876 | 3300005615 | Bacteria | 7564 |
| 184 | Ga0070702_100099352 | 3300005615 | Bacteria | 1782 |
| 185 | Ga0070702_100151373 | 3300005615 | Bacteria | 1489 |
| 186 | Ga0068852_100094596 | 3300005616 | Bacteria | 2681 |
| 187 | Ga0068852_100568448 | 3300005616 | Bacteria | 1135 |
| 188 | Ga0068859_100004636 | 3300005617 | Bacteria | 14002 |
| 189 | Ga0068859_100028702 | 3300005617 | Bacteria | 5579 |
| 190 | Ga0068859_100075497 | 3300005617 | Bacteria | 3411 |
| 191 | Ga0068859_100579726 | 3300005617 | Bacteria | 1215 |
| 192 | Ga0068859_100768976 | 3300005617 | Bacteria | 1052 |
| 193 | Ga0068864_100027786 | 3300005618 | Bacteria | 4781 |
| 194 | Ga0068864_100563305 | 3300005618 | Bacteria | 1103 |
| 195 | Ga0068864_101150187 | 3300005618 | Bacteria | 773 |
| 196 | Ga0068866_10000870 | 3300005718 | Bacteria | 13343 |
| 197 | Ga0068861_100002108 | 3300005719 | Bacteria | 12895 |
| 198 | Ga0068861_100041041 | 3300005719 | Bacteria | 3464 |
| 199 | Ga0068861_100079048 | 3300005719 | Bacteria | 2570 |
| 200 | Ga0068851_10157067 | 3300005834 | Bacteria | 1247 |
| 201 | Ga0068863_100001428 | 3300005841 | Bacteria | 23666 |
| 202 | Ga0068863_100023450 | 3300005841 | Bacteria | 5893 |
| 203 | Ga0068863_100067753 | 3300005841 | Bacteria | 3376 |
| 204 | Ga0068863_100765393 | 3300005841 | Bacteria | 962 |
| 205 | Ga0068858_100004100 | 3300005842 | Bacteria | 14351 |
| 206 | Ga0068858_100051932 | 3300005842 | Bacteria | 3793 |
| 207 | Ga0068858_100197757 | 3300005842 | Bacteria | 1900 |
| 208 | Ga0068858_100913898 | 3300005842 | Bacteria | 858 |
| 209 | Ga0068860_100002016 | 3300005843 | Bacteria | 21427 |
| 210 | Ga0068860_100309536 | 3300005843 | Bacteria | 1549 |
| 211 | Ga0068860_100596966 | 3300005843 | Bacteria | 1109 |
| 212 | Ga0068860_100710674 | 3300005843 | Bacteria | 1015 |
| 213 | Ga0068862_100000035 | 3300005844 | Bacteria | 174953 |
| 214 | Ga0068862_100031914 | 3300005844 | Bacteria | 4449 |
| 215 | Ga0068862_100146506 | 3300005844 | Bacteria | 2099 |
| 216 | Ga0068862_100507602 | 3300005844 | Bacteria | 1145 |
| 217 | Ga0081455_10018519 | 3300005937 | Bacteria | 6629 |
| 218 | Ga0081455_10087009 | 3300005937 | Bacteria | 2544 |
| 219 | Ga0081455_10228632 | 3300005937 | Bacteria | 1374 |
| 220 | Ga0081455_10233712 | 3300005937 | Bacteria | 1355 |
| 221 | Ga0081538_10007006 | 3300005981 | Bacteria | 9807 |
| 222 | Ga0081538_10043959 | 3300005981 | Bacteria | 2795 |
| 223 | Ga0081538_10045432 | 3300005981 | Bacteria | 2723 |
| 224 | Ga0081540_1000009 | 3300005983 | Bacteria | 193562 |
| 225 | Ga0081539_10000062 | 3300005985 | Bacteria | 249871 |
| 226 | Ga0070717_10004522 | 3300006028 | Bacteria | 10050 |
| 227 | Ga0070717_10051350 | 3300006028 | Bacteria | 3393 |
| 228 | Ga0070717_10055216 | 3300006028 | Bacteria | 3276 |
| 229 | Ga0070717_10059483 | 3300006028 | Bacteria | 3162 |
| 230 | Ga0070717_10144573 | 3300006028 | Bacteria | 2053 |
| 231 | Ga0070717_10280244 | 3300006028 | Bacteria | 1478 |
| 232 | Ga0070717_10402902 | 3300006028 | Bacteria | 1229 |
| 233 | Ga0070717_10427115 | 3300006028 | Bacteria | 1192 |
| 234 | Ga0070717_10515281 | 3300006028 | Bacteria | 1082 |
| 235 | Ga0075365_10384636 | 3300006038 | Bacteria | 990 |
| 236 | Ga0075364_10003712 | 3300006051 | Bacteria | 8711 |
| 237 | Ga0070715_10004251 | 3300006163 | Bacteria | 4674 |
| 238 | Ga0070715_10015088 | 3300006163 | Bacteria | 2875 |
| 239 | Ga0070715_10032910 | 3300006163 | Bacteria | 2115 |
| 240 | Ga0070715_10042024 | 3300006163 | Bacteria | 1919 |
| 241 | Ga0070716_100000575 | 3300006173 | Bacteria | 15389 |
| 242 | Ga0070716_100003527 | 3300006173 | Bacteria | 7376 |
| 243 | Ga0070716_100033836 | 3300006173 | Bacteria | 2798 |
| 244 | Ga0070716_100034863 | 3300006173 | Bacteria | 2762 |
| 245 | Ga0070716_100050846 | 3300006173 | Bacteria | 2354 |
| 246 | Ga0070716_100127413 | 3300006173 | Bacteria | 1604 |
| 247 | Ga0070716_100401132 | 3300006173 | Bacteria | 986 |
| 248 | Ga0070712_100000786 | 3300006175 | Bacteria | 18763 |
| 249 | Ga0070712_100003582 | 3300006175 | Bacteria | 9567 |
| 250 | Ga0070712_100012910 | 3300006175 | Bacteria | 5322 |
| 251 | Ga0070712_100064838 | 3300006175 | Bacteria | 2591 |
| 252 | Ga0070712_100125473 | 3300006175 | Bacteria | 1938 |
| 253 | Ga0070712_100190405 | 3300006175 | Bacteria | 1605 |
| 254 | Ga0070712_100207045 | 3300006175 | Bacteria | 1545 |
| 255 | Ga0070712_100213747 | 3300006175 | Bacteria | 1522 |
| 256 | Ga0070712_100308529 | 3300006175 | Bacteria | 1283 |
| 257 | Ga0070712_100806827 | 3300006175 | Bacteria | 805 |
| 258 | Ga0075369_10001795 | 3300006186 | Bacteria | 7467 |
| 259 | Ga0075369_10007848 | 3300006186 | Bacteria | 4084 |
| 260 | Ga0075369_10081123 | 3300006186 | Bacteria | 1439 |
| 261 | Ga0097621_100034412 | 3300006237 | Bacteria | 4042 |
| 262 | Ga0097621_100145757 | 3300006237 | Bacteria | 2027 |
| 263 | Ga0075370_10104698 | 3300006353 | Bacteria | 1640 |
| 264 | Ga0068871_100092288 | 3300006358 | Bacteria | 2525 |
| 265 | Ga0075428_100011120 | 3300006844 | Bacteria | 10015 |
| 266 | Ga0075428_100089634 | 3300006844 | Bacteria | 3354 |
| 267 | Ga0075428_101123179 | 3300006844 | Bacteria | 830 |
| 268 | Ga0075430_100008192 | 3300006846 | Bacteria | 8828 |
| 269 | Ga0075430_100062522 | 3300006846 | Bacteria | 3127 |
| 270 | Ga0075430_100746655 | 3300006846 | Bacteria | 807 |
| 271 | Ga0075431_100009394 | 3300006847 | Bacteria | 9818 |
| 272 | Ga0075434_100123168 | 3300006871 | Bacteria | 2609 |
| 273 | Ga0075434_100762108 | 3300006871 | Bacteria | 985 |
| 274 | Ga0068865_100002144 | 3300006881 | Bacteria | 11650 |
| 275 | Ga0068865_100171913 | 3300006881 | Unclassified | 1662 |
| 276 | Ga0068865_100856540 | 3300006881 | Bacteria | 788 |
| 277 | Ga0075436_100166312 | 3300006914 | Bacteria | 1556 |
| 278 | Ga0097620_100004636 | 3300006931 | Bacteria | 14002 |
| 279 | Ga0097620_100028703 | 3300006931 | Bacteria | 5579 |
| 280 | Ga0097620_100075497 | 3300006931 | Bacteria | 3411 |
| 281 | Ga0097620_100579727 | 3300006931 | Bacteria | 1215 |
| 282 | Ga0097620_100768963 | 3300006931 | Bacteria | 1052 |
| 283 | Ga0075435_100483832 | 3300007076 | Bacteria | 1069 |
| 284 | Ga0099795_10096589 | 3300007788 | Bacteria | 1153 |
| 285 | Ga0105251_10078044 | 3300009011 | Bacteria | 1534 |
| 286 | Ga0105250_10129087 | 3300009092 | Bacteria | 1043 |
| 287 | Ga0105240_10143743 | 3300009093 | Bacteria | 2849 |
| 288 | Ga0105240_10162993 | 3300009093 | Bacteria | 2647 |
| 289 | Ga0111539_10158605 | 3300009094 | Bacteria | 2647 |
| 290 | Ga0105245_10012028 | 3300009098 | Bacteria | 7525 |
| 291 | Ga0105245_10026860 | 3300009098 | Bacteria | 5069 |
| 292 | Ga0105245_10116451 | 3300009098 | Bacteria | 2492 |
| 293 | Ga0105245_10157101 | 3300009098 | Bacteria | 2155 |
| 294 | Ga0105245_10251556 | 3300009098 | Bacteria | 1717 |
| 295 | Ga0105245_10389688 | 3300009098 | Bacteria | 1390 |
| 296 | Ga0105245_10467739 | 3300009098 | Bacteria | 1272 |
| 297 | Ga0105247_10000952 | 3300009101 | Bacteria | 21847 |
| 298 | Ga0105247_10005574 | 3300009101 | Bacteria | 7909 |
| 299 | Ga0114129_10001008 | 3300009147 | Bacteria | 36708 |
| 300 | Ga0114129_10377857 | 3300009147 | Bacteria | 1872 |
| 301 | Ga0114129_10378107 | 3300009147 | Bacteria | 1871 |
| 302 | Ga0114129_10467018 | 3300009147 | Bacteria | 1653 |
| 303 | Ga0114129_10658569 | 3300009147 | Bacteria | 1351 |
| 304 | Ga0114129_11244674 | 3300009147 | Bacteria | 925 |
| 305 | Ga0114129_11438542 | 3300009147 | Bacteria | 849 |
| 306 | Ga0114129_11595288 | 3300009147 | Bacteria | 799 |
| 307 | Ga0105243_10002044 | 3300009148 | Bacteria | 17099 |
| 308 | Ga0105243_10099360 | 3300009148 | Bacteria | 2412 |
| 309 | Ga0105243_10422431 | 3300009148 | Bacteria | 1244 |
| 310 | Ga0105241_10032842 | 3300009174 | Bacteria | 3894 |
| 311 | Ga0105241_10314121 | 3300009174 | Bacteria | 1349 |
| 312 | Ga0105241_10544282 | 3300009174 | Bacteria | 1041 |
| 313 | Ga0105242_10000373 | 3300009176 | Bacteria | 35638 |
| 314 | Ga0105242_10081903 | 3300009176 | Bacteria | 2700 |
| 315 | Ga0105242_10304416 | 3300009176 | Bacteria | 1456 |
| 316 | Ga0105242_10370373 | 3300009176 | Bacteria | 1328 |
| 317 | Ga0105242_10632427 | 3300009176 | Bacteria | 1038 |
| 318 | Ga0105248_10002237 | 3300009177 | Bacteria | 21398 |
| 319 | Ga0105248_10025822 | 3300009177 | Bacteria | 6533 |
| 320 | Ga0105248_10917920 | 3300009177 | Bacteria | 989 |
| 321 | Ga0105248_11633343 | 3300009177 | Bacteria | 730 |
| 322 | Ga0105237_10122503 | 3300009545 | Bacteria | 2594 |
| 323 | Ga0105237_10172256 | 3300009545 | Bacteria | 2165 |
| 324 | Ga0105237_10718738 | 3300009545 | Bacteria | 1005 |
| 325 | Ga0105237_11138217 | 3300009545 | Bacteria | 787 |
| 326 | Ga0105249_10000046 | 3300009553 | Bacteria | 176363 |
| 327 | Ga0105249_10002144 | 3300009553 | Bacteria | 17095 |
| 328 | Ga0105249_10021311 | 3300009553 | Bacteria | 5802 |
| 329 | Ga0105249_10055721 | 3300009553 | Bacteria | 3618 |
| 330 | Ga0105249_10275817 | 3300009553 | Bacteria | 1677 |
| 331 | Ga0105249_10291520 | 3300009553 | Bacteria | 1633 |
| 332 | Ga0105249_10566629 | 3300009553 | Bacteria | 1188 |
| 333 | Ga0105249_10707101 | 3300009553 | Bacteria | 1068 |
| 334 | Ga0105239_10031982 | 3300010375 | Bacteria | 5782 |
| 335 | Ga0105239_10229779 | 3300010375 | Bacteria | 2081 |
| 336 | Ga0105239_10461828 | 3300010375 | Bacteria | 1441 |
| 337 | Ga0105239_10620477 | 3300010375 | Bacteria | 1234 |
| 338 | Ga0105239_10804595 | 3300010375 | Bacteria | 1077 |
| 339 | Ga0105239_11426624 | 3300010375 | Bacteria | 799 |
| 340 | Ga0157329_1002048 | 3300012491 | Bacteria | 1109 |
| 341 | Ga0157341_1003699 | 3300012494 | Bacteria | 1080 |
| 342 | Ga0157313_1001835 | 3300012503 | Bacteria | 1199 |
| 343 | Ga0157342_1000461 | 3300012507 | Bacteria | 2481 |
| 344 | Ga0157373_10248874 | 3300013100 | Bacteria | 1257 |
| 345 | Ga0157371_10221018 | 3300013102 | Bacteria | 1360 |
| 346 | Ga0157371_10506486 | 3300013102 | Bacteria | 892 |
| 347 | Ga0157369_10091807 | 3300013105 | Bacteria | 3241 |
| 348 | Ga0157369_10435526 | 3300013105 | Bacteria | 1358 |
| 349 | Ga0157369_10860336 | 3300013105 | Bacteria | 930 |
| 350 | Ga0157374_10112070 | 3300013296 | Bacteria | 2625 |
| 351 | Ga0157374_10855036 | 3300013296 | Bacteria | 927 |
| 352 | Ga0157378_10003240 | 3300013297 | Bacteria | 14484 |
| 353 | Ga0157378_10040034 | 3300013297 | Bacteria | 4156 |
| 354 | Ga0157378_10185843 | 3300013297 | Bacteria | 1957 |
| 355 | Ga0157378_10742103 | 3300013297 | Bacteria | 1004 |
| 356 | Ga0163162_10007730 | 3300013306 | Bacteria | 10476 |
| 357 | Ga0163162_10107172 | 3300013306 | Bacteria | 2889 |
| 358 | Ga0163162_10427716 | 3300013306 | Bacteria | 1456 |
| 359 | Ga0163162_10680281 | 3300013306 | Bacteria | 1151 |
| 360 | Ga0157372_10012120 | 3300013307 | Bacteria | 9184 |
| 361 | Ga0157372_10348223 | 3300013307 | Bacteria | 1726 |
| 362 | Ga0157372_10490706 | 3300013307 | Bacteria | 1432 |
| 363 | Ga0157372_10819347 | 3300013307 | Bacteria | 1081 |
| 364 | Ga0157375_10000487 | 3300013308 | Bacteria | 35984 |
| 365 | Ga0157375_10114525 | 3300013308 | Bacteria | 2798 |
| 366 | Ga0157375_10220901 | 3300013308 | Bacteria | 2053 |
| 367 | Ga0157375_10317600 | 3300013308 | Bacteria | 1722 |
| 368 | Ga0157375_10730282 | 3300013308 | Bacteria | 1143 |
| 369 | Ga0157375_10923453 | 3300013308 | Bacteria | 1016 |
| 370 | Ga0157375_11100176 | 3300013308 | Bacteria | 930 |
| 371 | Ga0157375_11799280 | 3300013308 | Bacteria | 726 |
| 372 | Ga0163163_10020015 | 3300014325 | Bacteria | 6296 |
| 373 | Ga0163163_10030667 | 3300014325 | Bacteria | 5183 |
| 374 | Ga0163163_10087848 | 3300014325 | Bacteria | 3120 |
| 375 | Ga0157380_10000989 | 3300014326 | Bacteria | 18069 |
| 376 | Ga0157380_10053351 | 3300014326 | Bacteria | 3205 |
| 377 | Ga0157377_10153706 | 3300014745 | Bacteria | 1425 |
| 378 | Ga0157379_10136346 | 3300014968 | Bacteria | 2211 |
| 379 | Ga0157379_10271024 | 3300014968 | Bacteria | 1544 |
| 380 | Ga0157376_10022726 | 3300014969 | Bacteria | 4895 |
| 381 | Ga0182005_1032735 | 3300015265 | Bacteria | 1415 |
| 382 | Ga0163161_10005652 | 3300017792 | Bacteria | 8670 |
| 383 | Ga0163161_10007739 | 3300017792 | Bacteria | 7432 |
| 384 | Ga0163161_10336651 | 3300017792 | Bacteria | 1196 |
| 385 | Ga0206354_11547857 | 3300020081 | Bacteria | 1643 |
| 386 | Ga0213875_10041147 | 3300021388 | Bacteria | 2174 |
| 387 | Ga0213875_10069811 | 3300021388 | Bacteria | 1640 |
| 388 | Ga0224712_10023447 | 3300022467 | Bacteria | 2143 |
| 389 | Ga0224572_1002087 | 3300024225 | Bacteria | 3149 |
| 390 | Ga0207653_10017017 | 3300025885 | Bacteria | 2286 |
| 391 | Ga0207692_10000678 | 3300025898 | Bacteria | 12026 |
| 392 | Ga0207692_10000889 | 3300025898 | Bacteria | 10801 |
| 393 | Ga0207692_10004462 | 3300025898 | Bacteria | 5544 |
| 394 | Ga0207692_10026141 | 3300025898 | Bacteria | 2736 |
| 395 | Ga0207692_10077385 | 3300025898 | Bacteria | 1770 |
| 396 | Ga0207692_10087266 | 3300025898 | Bacteria | 1683 |
| 397 | Ga0207692_10097273 | 3300025898 | Bacteria | 1609 |
| 398 | Ga0207692_10254748 | 3300025898 | Bacteria | 1053 |
| 399 | Ga0207642_10000231 | 3300025899 | Bacteria | 16524 |
| 400 | Ga0207642_10028634 | 3300025899 | Bacteria | 2296 |
| 401 | Ga0207642_10030983 | 3300025899 | Bacteria | 2235 |
| 402 | Ga0207710_10000153 | 3300025900 | Bacteria | 76530 |
| 403 | Ga0207710_10007850 | 3300025900 | Bacteria | 4517 |
| 404 | Ga0207710_10055404 | 3300025900 | Bacteria | 1787 |
| 405 | Ga0207688_10003373 | 3300025901 | Bacteria | 8720 |
| 406 | Ga0207688_10003437 | 3300025901 | Bacteria | 8636 |
| 407 | Ga0207688_10005363 | 3300025901 | Bacteria | 6962 |
| 408 | Ga0207688_10010533 | 3300025901 | Bacteria | 5029 |
| 409 | Ga0207688_10028536 | 3300025901 | Bacteria | 3070 |
| 410 | Ga0207688_10084926 | 3300025901 | Bacteria | 1813 |
| 411 | Ga0207680_10163742 | 3300025903 | Bacteria | 1493 |
| 412 | Ga0207647_10007734 | 3300025904 | Bacteria | 7738 |
| 413 | Ga0207647_10031359 | 3300025904 | Bacteria | 3421 |
| 414 | Ga0207647_10071882 | 3300025904 | Bacteria | 2087 |
| 415 | Ga0207685_10023232 | 3300025905 | Bacteria | 2108 |
| 416 | Ga0207685_10034954 | 3300025905 | Bacteria | 1830 |
| 417 | Ga0207685_10036183 | 3300025905 | Bacteria | 1808 |
| 418 | Ga0207685_10129877 | 3300025905 | Bacteria | 1117 |
| 419 | Ga0207699_10000205 | 3300025906 | Bacteria | 35487 |
| 420 | Ga0207699_10002986 | 3300025906 | Bacteria | 8043 |
| 421 | Ga0207699_10012801 | 3300025906 | Bacteria | 4273 |
| 422 | Ga0207699_10027176 | 3300025906 | Bacteria | 3165 |
| 423 | Ga0207699_10033147 | 3300025906 | Bacteria | 2917 |
| 424 | Ga0207699_10136811 | 3300025906 | Bacteria | 1605 |
| 425 | Ga0207699_10142157 | 3300025906 | Bacteria | 1578 |
| 426 | Ga0207699_10330717 | 3300025906 | Bacteria | 1071 |
| 427 | Ga0207645_10036125 | 3300025907 | Bacteria | 3173 |
| 428 | Ga0207645_10112267 | 3300025907 | Bacteria | 1765 |
| 429 | Ga0207643_10001272 | 3300025908 | Bacteria | 14725 |
| 430 | Ga0207684_10057381 | 3300025910 | Bacteria | 3303 |
| 431 | Ga0207684_10487879 | 3300025910 | Bacteria | 1056 |
| 432 | Ga0207654_10025312 | 3300025911 | Bacteria | 3200 |
| 433 | Ga0207654_10098494 | 3300025911 | Bacteria | 1797 |
| 434 | Ga0207671_10015516 | 3300025914 | Bacteria | 5959 |
| 435 | Ga0207671_10263383 | 3300025914 | Bacteria | 1357 |
| 436 | Ga0207671_10707001 | 3300025914 | Bacteria | 801 |
| 437 | Ga0207693_10000355 | 3300025915 | Bacteria | 42002 |
| 438 | Ga0207693_10002200 | 3300025915 | Bacteria | 16997 |
| 439 | Ga0207693_10006667 | 3300025915 | Bacteria | 9538 |
| 440 | Ga0207693_10008293 | 3300025915 | Bacteria | 8507 |
| 441 | Ga0207693_10008945 | 3300025915 | Bacteria | 8172 |
| 442 | Ga0207693_10027108 | 3300025915 | Bacteria | 4531 |
| 443 | Ga0207693_10079956 | 3300025915 | Bacteria | 2559 |
| 444 | Ga0207693_10092279 | 3300025915 | Bacteria | 2373 |
| 445 | Ga0207693_10100871 | 3300025915 | Bacteria | 2263 |
| 446 | Ga0207693_10235819 | 3300025915 | Bacteria | 1436 |
| 447 | Ga0207693_10341396 | 3300025915 | Bacteria | 1172 |
| 448 | Ga0207663_10004333 | 3300025916 | Bacteria | 7045 |
| 449 | Ga0207663_10012575 | 3300025916 | Bacteria | 4581 |
| 450 | Ga0207663_10013199 | 3300025916 | Bacteria | 4486 |
| 451 | Ga0207663_10020576 | 3300025916 | Bacteria | 3739 |
| 452 | Ga0207663_10027871 | 3300025916 | Bacteria | 3299 |
| 453 | Ga0207663_10028380 | 3300025916 | Bacteria | 3275 |
| 454 | Ga0207663_10046506 | 3300025916 | Bacteria | 2674 |
| 455 | Ga0207663_10057636 | 3300025916 | Bacteria | 2448 |
| 456 | Ga0207663_10116797 | 3300025916 | Bacteria | 1819 |
| 457 | Ga0207660_10352138 | 3300025917 | Bacteria | 1180 |
| 458 | Ga0207662_10025722 | 3300025918 | Bacteria | 3391 |
| 459 | Ga0207662_10310882 | 3300025918 | Bacteria | 1050 |
| 460 | Ga0207657_10191457 | 3300025919 | Bacteria | 1650 |
| 461 | Ga0207657_10194640 | 3300025919 | Bacteria | 1634 |
| 462 | Ga0207649_10694601 | 3300025920 | Bacteria | 789 |
| 463 | Ga0207646_10010946 | 3300025922 | Bacteria | 8808 |
| 464 | Ga0207646_10053722 | 3300025922 | Bacteria | 3603 |
| 465 | Ga0207646_10076070 | 3300025922 | Bacteria | 2999 |
| 466 | Ga0207646_10112214 | 3300025922 | Unclassified | 2447 |
| 467 | Ga0207646_10213347 | 3300025922 | Bacteria | 1743 |
| 468 | Ga0207646_10351443 | 3300025922 | Bacteria | 1332 |
| 469 | Ga0207646_10654147 | 3300025922 | Bacteria | 941 |
| 470 | Ga0207681_10000615 | 3300025923 | Bacteria | 23920 |
| 471 | Ga0207681_10007134 | 3300025923 | Bacteria | 6852 |
| 472 | Ga0207681_10370496 | 3300025923 | Bacteria | 1151 |
| 473 | Ga0207681_10384161 | 3300025923 | Bacteria | 1131 |
| 474 | Ga0207650_10734643 | 3300025925 | Bacteria | 835 |
| 475 | Ga0207687_10001302 | 3300025927 | Bacteria | 17029 |
| 476 | Ga0207687_10037386 | 3300025927 | Bacteria | 3312 |
| 477 | Ga0207687_10057611 | 3300025927 | Bacteria | 2730 |
| 478 | Ga0207687_10062671 | 3300025927 | Bacteria | 2630 |
| 479 | Ga0207687_10082234 | 3300025927 | Bacteria | 2329 |
| 480 | Ga0207687_10113333 | 3300025927 | Bacteria | 2017 |
| 481 | Ga0207687_10755419 | 3300025927 | Bacteria | 828 |
| 482 | Ga0207700_10000171 | 3300025928 | Bacteria | 38786 |
| 483 | Ga0207700_10047773 | 3300025928 | Bacteria | 3175 |
| 484 | Ga0207700_10050731 | 3300025928 | Bacteria | 3093 |
| 485 | Ga0207700_10057550 | 3300025928 | Bacteria | 2932 |
| 486 | Ga0207700_10108780 | 3300025928 | Bacteria | 2227 |
| 487 | Ga0207700_10118770 | 3300025928 | Bacteria | 2140 |
| 488 | Ga0207700_10179637 | 3300025928 | Bacteria | 1771 |
| 489 | Ga0207700_10212207 | 3300025928 | Bacteria | 1637 |
| 490 | Ga0207700_10589015 | 3300025928 | Bacteria | 989 |
| 491 | Ga0207664_10001768 | 3300025929 | Bacteria | 14241 |
| 492 | Ga0207664_10014960 | 3300025929 | Bacteria | 5618 |
| 493 | Ga0207664_10021138 | 3300025929 | Bacteria | 4833 |
| 494 | Ga0207664_10035023 | 3300025929 | Bacteria | 3871 |
| 495 | Ga0207664_10041588 | 3300025929 | Bacteria | 3581 |
| 496 | Ga0207664_10044912 | 3300025929 | Bacteria | 3462 |
| 497 | Ga0207664_10054296 | 3300025929 | Bacteria | 3174 |
| 498 | Ga0207664_10060648 | 3300025929 | Bacteria | 3015 |
| 499 | Ga0207664_10080310 | 3300025929 | Bacteria | 2650 |
| 500 | Ga0207664_10105222 | 3300025929 | Bacteria | 2338 |
| 501 | Ga0207664_10377789 | 3300025929 | Bacteria | 1258 |
| 502 | Ga0207644_10331031 | 3300025931 | Bacteria | 1233 |
| 503 | Ga0207644_10415168 | 3300025931 | Bacteria | 1102 |
| 504 | Ga0207690_10040271 | 3300025932 | Bacteria | 3054 |
| 505 | Ga0207690_10218791 | 3300025932 | Bacteria | 1456 |
| 506 | Ga0207706_10006718 | 3300025933 | Bacteria | 10635 |
| 507 | Ga0207706_10027319 | 3300025933 | Bacteria | 5104 |
| 508 | Ga0207706_10041447 | 3300025933 | Bacteria | 4082 |
| 509 | Ga0207706_10044707 | 3300025933 | Bacteria | 3924 |
| 510 | Ga0207686_10008241 | 3300025934 | Bacteria | 5623 |
| 511 | Ga0207686_10178073 | 3300025934 | Bacteria | 1505 |
| 512 | Ga0207709_10002257 | 3300025935 | Bacteria | 12252 |
| 513 | Ga0207709_10163190 | 3300025935 | Bacteria | 1556 |
| 514 | Ga0207709_10206561 | 3300025935 | Bacteria | 1406 |
| 515 | Ga0207670_10133049 | 3300025936 | Bacteria | 1825 |
| 516 | Ga0207669_10057151 | 3300025937 | Bacteria | 2373 |
| 517 | Ga0207669_10063093 | 3300025937 | Bacteria | 2285 |
| 518 | Ga0207669_10454445 | 3300025937 | Bacteria | 1016 |
| 519 | Ga0207704_10001019 | 3300025938 | Bacteria | 12430 |
| 520 | Ga0207704_10206690 | 3300025938 | Bacteria | 1441 |
| 521 | Ga0207704_10217541 | 3300025938 | Bacteria | 1411 |
| 522 | Ga0207665_10001616 | 3300025939 | Bacteria | 15211 |
| 523 | Ga0207665_10004106 | 3300025939 | Bacteria | 9709 |
| 524 | Ga0207665_10004322 | 3300025939 | Bacteria | 9438 |
| 525 | Ga0207665_10017844 | 3300025939 | Bacteria | 4665 |
| 526 | Ga0207665_10030413 | 3300025939 | Bacteria | 3568 |
| 527 | Ga0207665_10040916 | 3300025939 | Bacteria | 3094 |
| 528 | Ga0207665_10110673 | 3300025939 | Bacteria | 1930 |
| 529 | Ga0207691_10005983 | 3300025940 | Bacteria | 11746 |
| 530 | Ga0207691_10063467 | 3300025940 | Bacteria | 3350 |
| 531 | Ga0207711_10001535 | 3300025941 | Bacteria | 21402 |
| 532 | Ga0207711_10012911 | 3300025941 | Bacteria | 6938 |
| 533 | Ga0207711_10410687 | 3300025941 | Bacteria | 1258 |
| 534 | Ga0207689_10001836 | 3300025942 | Bacteria | 20086 |
| 535 | Ga0207689_10003085 | 3300025942 | Bacteria | 15334 |
| 536 | Ga0207689_10009603 | 3300025942 | Bacteria | 8342 |
| 537 | Ga0207689_10079292 | 3300025942 | Bacteria | 2699 |
| 538 | Ga0207661_10085125 | 3300025944 | Bacteria | 2620 |
| 539 | Ga0207661_10476611 | 3300025944 | Bacteria | 1139 |
| 540 | Ga0207651_10132741 | 3300025960 | Bacteria | 1909 |
| 541 | Ga0207651_10212092 | 3300025960 | Bacteria | 1560 |
| 542 | Ga0207712_10000042 | 3300025961 | Bacteria | 176338 |
| 543 | Ga0207712_10003564 | 3300025961 | Bacteria | 9819 |
| 544 | Ga0207712_10100331 | 3300025961 | Bacteria | 2151 |
| 545 | Ga0207712_10187069 | 3300025961 | Bacteria | 1632 |
| 546 | Ga0207712_10197764 | 3300025961 | Bacteria | 1591 |
| 547 | Ga0207668_10001287 | 3300025972 | Bacteria | 14926 |
| 548 | Ga0207668_10011615 | 3300025972 | Bacteria | 5357 |
| 549 | Ga0207668_10212358 | 3300025972 | Bacteria | 1549 |
| 550 | Ga0207668_10288767 | 3300025972 | Bacteria | 1348 |
| 551 | Ga0207640_10012123 | 3300025981 | Bacteria | 4901 |
| 552 | Ga0207640_10069835 | 3300025981 | Bacteria | 2360 |
| 553 | Ga0207658_10000377 | 3300025986 | Bacteria | 43514 |
| 554 | Ga0207658_10001454 | 3300025986 | Bacteria | 18467 |
| 555 | Ga0207658_10006137 | 3300025986 | Bacteria | 8201 |
| 556 | Ga0207658_10201140 | 3300025986 | Bacteria | 1663 |
| 557 | Ga0207658_10336987 | 3300025986 | Bacteria | 1310 |
| 558 | Ga0207677_10000670 | 3300026023 | Bacteria | 20364 |
| 559 | Ga0207677_10035276 | 3300026023 | Bacteria | 3247 |
| 560 | Ga0207677_10084246 | 3300026023 | Bacteria | 2291 |
| 561 | Ga0207677_10665922 | 3300026023 | Bacteria | 920 |
| 562 | Ga0207703_10004329 | 3300026035 | Bacteria | 11672 |
| 563 | Ga0207703_10005964 | 3300026035 | Bacteria | 9761 |
| 564 | Ga0207703_10047195 | 3300026035 | Bacteria | 3472 |
| 565 | Ga0207703_10190521 | 3300026035 | Bacteria | 1816 |
| 566 | Ga0207639_10024650 | 3300026041 | Bacteria | 4356 |
| 567 | Ga0207678_10005601 | 3300026067 | Bacteria | 11231 |
| 568 | Ga0207678_10010855 | 3300026067 | Bacteria | 8006 |
| 569 | Ga0207678_10013818 | 3300026067 | Bacteria | 7095 |
| 570 | Ga0207678_10176415 | 3300026067 | Bacteria | 1824 |
| 571 | Ga0207708_10003270 | 3300026075 | Bacteria | 11946 |
| 572 | Ga0207708_10011001 | 3300026075 | Bacteria | 6729 |
| 573 | Ga0207708_10028032 | 3300026075 | Bacteria | 4264 |
| 574 | Ga0207708_10072259 | 3300026075 | Unclassified | 2643 |
| 575 | Ga0207702_10072036 | 3300026078 | Bacteria | 2977 |
| 576 | Ga0207702_10192978 | 3300026078 | Bacteria | 1883 |
| 577 | Ga0207702_10260053 | 3300026078 | Bacteria | 1634 |
| 578 | Ga0207641_10001215 | 3300026088 | Bacteria | 25767 |
| 579 | Ga0207641_10008290 | 3300026088 | Bacteria | 8586 |
| 580 | Ga0207641_10032028 | 3300026088 | Bacteria | 4364 |
| 581 | Ga0207641_10051429 | 3300026088 | Bacteria | 3489 |
| 582 | Ga0207641_10198841 | 3300026088 | Bacteria | 1847 |
| 583 | Ga0207648_10000671 | 3300026089 | Bacteria | 38354 |
| 584 | Ga0207648_10035258 | 3300026089 | Bacteria | 4408 |
| 585 | Ga0207648_10309793 | 3300026089 | Bacteria | 1417 |
| 586 | Ga0207676_10074756 | 3300026095 | Bacteria | 2731 |
| 587 | Ga0207676_10296180 | 3300026095 | Bacteria | 1475 |
| 588 | Ga0207676_10374935 | 3300026095 | Bacteria | 1323 |
| 589 | Ga0207674_10161727 | 3300026116 | Bacteria | 2193 |
| 590 | Ga0207674_10394680 | 3300026116 | Bacteria | 1337 |
| 591 | Ga0207675_100000388 | 3300026118 | Bacteria | 42128 |
| 592 | Ga0207675_100019325 | 3300026118 | Bacteria | 6356 |
| 593 | Ga0207675_100120596 | 3300026118 | Bacteria | 2481 |
| 594 | Ga0207683_10006709 | 3300026121 | Bacteria | 9849 |
| 595 | Ga0207683_10006989 | 3300026121 | Bacteria | 9676 |
| 596 | Ga0207683_10086132 | 3300026121 | Bacteria | 2793 |
| 597 | Ga0207683_10236611 | 3300026121 | Bacteria | 1666 |
| 598 | Ga0207698_10053929 | 3300026142 | Bacteria | 3090 |
| 599 | Ga0207698_10127881 | 3300026142 | Bacteria | 2165 |
| 600 | Ga0207698_10530574 | 3300026142 | Bacteria | 1150 |
| 601 | Ga0268266_10013359 | 3300028379 | Bacteria | 7075 |
| 602 | Ga0268266_10021397 | 3300028379 | Bacteria | 5509 |
| 603 | Ga0268266_10035706 | 3300028379 | Bacteria | 4228 |
| 604 | Ga0268265_10000051 | 3300028380 | Bacteria | 174968 |
| 605 | Ga0268265_10022066 | 3300028380 | Bacteria | 4469 |
| 606 | Ga0268265_10098077 | 3300028380 | Bacteria | 2359 |
| 607 | Ga0268265_10153781 | 3300028380 | Bacteria | 1944 |
| 608 | Ga0268265_10334430 | 3300028380 | Bacteria | 1377 |
| 609 | Ga0268265_10608311 | 3300028380 | Bacteria | 1045 |
| 610 | Ga0268264_10000108 | 3300028381 | Bacteria | 208791 |
| 611 | Ga0268264_10091040 | 3300028381 | Bacteria | 2630 |
| 612 | Ga0265327_10011353 | 3300031251 | Bacteria | 6143 |
| 613 | Ga0307513_10045574 | 3300031456 | Bacteria | 4792 |
| 614 | Ga0307513_10226026 | 3300031456 | Bacteria | 1688 |
| 615 | Ga0307408_100031410 | 3300031548 | Bacteria | 3698 |
| 616 | Ga0307408_100409066 | 3300031548 | Bacteria | 1167 |
| 617 | Ga0307405_10056800 | 3300031731 | Bacteria | 2456 |
| 618 | Ga0307405_10072792 | 3300031731 | Bacteria | 2216 |
| 619 | Ga0307413_10064657 | 3300031824 | Bacteria | 2274 |
| 620 | Ga0307413_10141922 | 3300031824 | Bacteria | 1661 |
| 621 | Ga0307410_10045488 | 3300031852 | Bacteria | 2923 |
| 622 | Ga0307410_10124108 | 3300031852 | Bacteria | 1887 |
| 623 | Ga0307406_10023171 | 3300031901 | Bacteria | 3691 |
| 624 | Ga0307407_10465665 | 3300031903 | Bacteria | 920 |
| 625 | Ga0307412_10009683 | 3300031911 | Bacteria | 5533 |
| 626 | Ga0307412_10250032 | 3300031911 | Bacteria | 1376 |
| 627 | Ga0307409_100004802 | 3300031995 | Bacteria | 7667 |
| 628 | Ga0307416_100006312 | 3300032002 | Bacteria | 7410 |
| 629 | Ga0307416_100288254 | 3300032002 | Bacteria | 1623 |
| 630 | Ga0307416_100947558 | 3300032002 | Bacteria | 963 |
| 631 | Ga0307414_10161705 | 3300032004 | Bacteria | 1779 |
| 632 | Ga0307411_10127113 | 3300032005 | Bacteria | 1856 |
| 633 | Ga0307411_10365507 | 3300032005 | Bacteria | 1181 |
| 634 | Ga0307415_100019600 | 3300032126 | Bacteria | 4111 |
| 635 | Ga0307415_100041593 | 3300032126 | Bacteria | 3052 |
| 636 | Ga0307415_100079663 | 3300032126 | Bacteria | 2334 |
| 637 | Ga0373950_0024350 | 3300034818 | Bacteria | 1088 |
| 638 | Ga0373926_0003753 | 3300035083 | Bacteria | 4946 |
| 639 | Ga0373926_0047736 | 3300035083 | Bacteria | 1539 |
| 640 | Ga0373928_0033975 | 3300035084 | Bacteria | 1143 |
| 641 | Ga0373929_0029965 | 3300035085 | Bacteria | 1158 |
| 642 | Ga0373934_0019071 | 3300035086 | Bacteria | 2630 |
| 643 | Ga0373934_0073268 | 3300035086 | Bacteria | 1371 |
| 644 | Ga0373940_0017273 | 3300035088 | Bacteria | 1797 |
| 645 | Ga0373944_0005556 | 3300035089 | Bacteria | 3323 |
| 646 | Ga0373923_0010842 | 3300035111 | Bacteria | 3328 |
| 647 | Ga0373923_0035279 | 3300035111 | Bacteria | 2035 |
| 648 | Ga0373923_0159153 | 3300035111 | Bacteria | 1030 |
| 649 | Ga0373932_0063305 | 3300035112 | Bacteria | 1130 |
| 650 | Ga0373936_0007284 | 3300035113 | Bacteria | 4162 |
| 651 | Ga0373939_0003646 | 3300035114 | Bacteria | 3625 |
| 652 | Ga0373945_0006316 | 3300035116 | Bacteria | 3817 |
| 653 | Ga0373953_0015691 | 3300035117 | Bacteria | 2752 |
| 654 | Ga0373953_0129371 | 3300035117 | Bacteria | 1076 |
| 655 | Ga0373956_0020753 | 3300035119 | Bacteria | 2798 |
| 656 | Ga0373957_0018421 | 3300035120 | Bacteria | 2446 |
| 657 | Ga0373957_0065598 | 3300035120 | Bacteria | 1413 |
| 658 | Ga0373943_0000792 | 3300035170 | Bacteria | 13870 |
| 659 | Ga0373943_0174365 | 3300035170 | Bacteria | 1178 |
| 660 | Ga0373946_0000743 | 3300035171 | Bacteria | 11084 |
| 661 | Ga0373946_0064031 | 3300035171 | Bacteria | 1572 |
| 662 | Ga0373955_0010188 | 3300035172 | Bacteria | 4430 |
| 663 | Ga0373955_0021302 | 3300035172 | Bacteria | 3271 |
| 664 | Ga0373955_0152074 | 3300035172 | Bacteria | 1362 |
| 665 | Ga0373962_0059804 | 3300035242 | Bacteria | 1117 |
| 666 | Ga0373924_0060383 | 3300035410 | Bacteria | 1585 |
| 667 | Ga0373931_0011349 | 3300035691 | Bacteria | 4304 |
| 668 | Ga0373931_0131659 | 3300035691 | Bacteria | 1440 |
| 669 | Ga0373931_0138039 | 3300035691 | Bacteria | 1409 |
| 670 | Ga0373931_0267841 | 3300035691 | Bacteria | 1045 |
| 671 | Ga0373935_0004837 | 3300035692 | Bacteria | 7916 |
| 672 | Ga0373935_0083939 | 3300035692 | Bacteria | 2074 |
| 673 | Ga0373935_0125177 | 3300035692 | Bacteria | 1721 |
| 674 | Ga0373927_0005172 | 3300035695 | Bacteria | 9024 |
| 675 | Ga0373933_0017926 | 3300035724 | Bacteria | 3975 |
| 676 | Ga0373933_0044510 | 3300035724 | Bacteria | 2629 |
| 677 | Ga0373947_0005102 | 3300035725 | Bacteria | 7693 |
| 678 | Ga0373937_0018158 | 3300036401 | Bacteria | 6275 |
| 679 | Ga0373937_0026771 | 3300036401 | Bacteria | 5211 |
| 680 | Ga0373937_0255278 | 3300036401 | Bacteria | 1652 |
| 681 | Ga0373925_0003276 | 3300037068 | Bacteria | 12604 |
| 682 | Ga0373925_0135900 | 3300037068 | Bacteria | 1921 |
| 683 | Ga0373925_0573789 | 3300037068 | Bacteria | 928 |
| 684 | Ga0395899_0033538 | 3300037312 | Bacteria | 3855 |
| 685 | Ga0395900_0006143 | 3300037418 | Bacteria | 12534 |
| 686 | Ga0395900_0029126 | 3300037418 | Bacteria | 5664 |
| 687 | Ga0395900_0094100 | 3300037418 | Bacteria | 3078 |
| 688 | Ga0395900_0143943 | 3300037418 | Bacteria | 2439 |
| 689 | Ga0395898_0653047 | 3300037466 | Bacteria | 994 |
| 690 | Ga0395898_1045153 | 3300037466 | Bacteria | 751 |
| 691 | Ga0395905_0019411 | 3300037471 | Bacteria | 6444 |
| 692 | Ga0395905_0812078 | 3300037471 | Bacteria | 838 |
| 693 | Ga0436364_0280192 | 3300037853 | Bacteria | 9128 |
| 694 | Ga0436364_0563277 | 3300037853 | Bacteria | 5101 |
| 695 | Ga0436364_0707129 | 3300037853 | Bacteria | 5783 |
| 696 | Ga0436364_0900715 | 3300037853 | Bacteria | 3561 |
| 697 | Ga0395901_0002571 | 3300038443 | Bacteria | 18392 |
| 698 | Ga0395901_0155900 | 3300038443 | Bacteria | 2399 |
| 699 | Ga0395901_0272469 | 3300038443 | Bacteria | 1760 |
| 700 | Ga0436363_0833973 | 3300039450 | Bacteria | 1343 |
| 701 | Ga0436362_0856774 | 3300039453 | Bacteria | 1054 |
| 702 | Ga0439461_0002411 | 3300041410 | Bacteria | 2981 |
| 703 | Ga0439466_0011732 | 3300041411 | Bacteria | 3236 |
| 704 | Ga0439466_0012636 | 3300041411 | Bacteria | 3104 |
| 705 | Ga0439466_0099318 | 3300041411 | Bacteria | 908 |
| 706 | Ga0439465_0004694 | 3300041413 | Bacteria | 4405 |
| 707 | Ga0439465_0005800 | 3300041413 | Bacteria | 3932 |
| 708 | Ga0439465_0046231 | 3300041413 | Bacteria | 1416 |
| 709 | Ga0451837_0445302 | 3300041494 | Bacteria | 1597 |
| 710 | Ga0439431_0022379 | 3300041997 | Bacteria | 1523 |
| 711 | Ga0439431_0034190 | 3300041997 | Bacteria | 1274 |
| 712 | Ga0439442_027703 | 3300042002 | Bacteria | 1181 |
| 713 | Ga0439445_0005864 | 3300042004 | Bacteria | 2809 |
| 714 | Ga0439448_0015918 | 3300042005 | Bacteria | 2283 |
| 715 | Ga0439448_0104706 | 3300042005 | Bacteria | 963 |
| 716 | Ga0439450_054337 | 3300042008 | Bacteria | 957 |
| 717 | Ga0439451_018400 | 3300042009 | Bacteria | 1410 |
| 718 | Ga0439454_007151 | 3300042011 | Bacteria | 1392 |
| 719 | Ga0439455_0018222 | 3300042012 | Bacteria | 1645 |
| 720 | Ga0439463_012673 | 3300042016 | Bacteria | 2074 |
| 721 | Ga0439463_041305 | 3300042016 | Bacteria | 1172 |
| 722 | Ga0439463_046496 | 3300042016 | Bacteria | 1105 |
| 723 | Ga0439463_062357 | 3300042016 | Bacteria | 953 |
| 724 | Ga0450902_021180 | 3300042137 | Bacteria | 1074 |
| 725 | Ga0450910_043965 | 3300042147 | Bacteria | 727 |
| 726 | Ga0439434_0045819 | 3300042435 | Bacteria | 1349 |
| 727 | Ga0439444_0008585 | 3300042437 | Bacteria | 1594 |
| 728 | Ga0439464_0015335 | 3300042439 | Bacteria | 2067 |
| 729 | Ga0439464_0028315 | 3300042439 | Bacteria | 1561 |
| 730 | Ga0439460_0068431 | 3300042461 | Bacteria | 1096 |
| 731 | Ga0466972_0051121 | 3300044658 | Bacteria | 1994 |
| 732 | Ga0466972_0136600 | 3300044658 | Bacteria | 1154 |
| 733 | Ga0466972_0148245 | 3300044658 | Bacteria | 1103 |
| 734 | Ga0466965_0008107 | 3300044683 | Bacteria | 4852 |
| 735 | Ga0466965_0073507 | 3300044683 | Bacteria | 1721 |
| 736 | Ga0466965_0088331 | 3300044683 | Bacteria | 1574 |
| 737 | Ga0466966_0076967 | 3300044684 | Bacteria | 2082 |
| 738 | Ga0466966_0083159 | 3300044684 | Bacteria | 1992 |
| 739 | Ga0466961_0002733 | 3300044693 | Bacteria | 10973 |
| 740 | Ga0466961_0077260 | 3300044693 | Bacteria | 2109 |
| 741 | Ga0466968_0013935 | 3300044735 | Bacteria | 3169 |
| 742 | Ga0466968_0036733 | 3300044735 | Bacteria | 2054 |
| 743 | Ga0466970_0045395 | 3300044765 | Bacteria | 2339 |
| 744 | Ga0466970_0054011 | 3300044765 | Bacteria | 2145 |
| 745 | Ga0466970_0072757 | 3300044765 | Bacteria | 1849 |
| 746 | Ga0466970_0076952 | 3300044765 | Bacteria | 1798 |
| 747 | Ga0466957_0012179 | 3300044842 | Bacteria | 4976 |
| 748 | Ga0466957_0022295 | 3300044842 | Bacteria | 3735 |
| 749 | Ga0466957_0176516 | 3300044842 | Bacteria | 1393 |
| 750 | Ga0466960_0000113 | 3300044901 | Bacteria | 27016 |
| 751 | Ga0466960_0021687 | 3300044901 | Bacteria | 2863 |
| 752 | Ga0466960_0171124 | 3300044901 | Bacteria | 1172 |
| 753 | Ga0466960_0172022 | 3300044901 | Bacteria | 1169 |
| 754 | Ga0466959_0004571 | 3300045049 | Bacteria | 9288 |
| 755 | Ga0466959_0006274 | 3300045049 | Bacteria | 8214 |
| 756 | Ga0466959_0010862 | 3300045049 | Bacteria | 6526 |
| 757 | Ga0466959_0200347 | 3300045049 | Bacteria | 1390 |
| 758 | Ga0466958_0109914 | 3300045836 | Bacteria | 1720 |
| 759 | Ga0466958_0115277 | 3300045836 | Bacteria | 1679 |
| 760 | Ga0466958_0330364 | 3300045836 | Bacteria | 980 |
| 761 | Ga0466967_0117224 | 3300045976 | Bacteria | 2454 |
| 762 | Ga0495592_0122873 | 3300046454 | Bacteria | 1824 |
| 763 | Ga0495592_0163625 | 3300046454 | Bacteria | 1529 |
| 764 | Ga0495603_0433663 | 3300046455 | Bacteria | 753 |
| 765 | Ga0495638_0000446 | 3300046460 | Bacteria | 49572 |
| 766 | Ga0495641_0041566 | 3300046461 | Bacteria | 2135 |
| 767 | Ga0495641_0155630 | 3300046461 | Bacteria | 1022 |
| 768 | Ga0495651_0020376 | 3300046462 | Bacteria | 5147 |
| 769 | Ga0495651_0042965 | 3300046462 | Bacteria | 3507 |
| 770 | Ga0495651_0062515 | 3300046462 | Bacteria | 2849 |
| 771 | Ga0495651_0159977 | 3300046462 | Bacteria | 1614 |
| 772 | Ga0495653_0012013 | 3300046463 | Bacteria | 7069 |
| 773 | Ga0495653_0028807 | 3300046463 | Bacteria | 4439 |
| 774 | Ga0495580_0302318 | 3300046472 | Bacteria | 1089 |
| 775 | Ga0495582_0144865 | 3300046473 | Bacteria | 1347 |
| 776 | Ga0495664_0002773 | 3300046477 | Bacteria | 9428 |
| 777 | Ga0495664_0050945 | 3300046477 | Bacteria | 2458 |
| 778 | Ga0495596_0121585 | 3300046500 | Bacteria | 1013 |
| 779 | Ga0495608_0028095 | 3300046511 | Bacteria | 3824 |
| 780 | Ga0495608_0072530 | 3300046511 | Bacteria | 2246 |
| 781 | Ga0495618_0024728 | 3300046514 | Bacteria | 3722 |
| 782 | Ga0495618_0042412 | 3300046514 | Bacteria | 2868 |
| 783 | Ga0495618_0156086 | 3300046514 | Bacteria | 1456 |
| 784 | Ga0495628_0058918 | 3300046516 | Bacteria | 3017 |
| 785 | Ga0495628_0080519 | 3300046516 | Bacteria | 2531 |
| 786 | Ga0495628_0133166 | 3300046516 | Bacteria | 1900 |
| 787 | Ga0495628_0221016 | 3300046516 | Bacteria | 1423 |
| 788 | Ga0495630_0027453 | 3300046517 | Bacteria | 4224 |
| 789 | Ga0495630_0251156 | 3300046517 | Bacteria | 1351 |
| 790 | Ga0495630_0643041 | 3300046517 | Bacteria | 812 |
| 791 | Ga0495644_0074041 | 3300046523 | Bacteria | 1281 |
| 792 | Ga0495652_0050156 | 3300046529 | Bacteria | 3570 |
| 793 | Ga0495652_0052635 | 3300046529 | Bacteria | 3471 |
| 794 | Ga0495654_0197639 | 3300046530 | Bacteria | 862 |
| 795 | Ga0495665_0002954 | 3300046531 | Bacteria | 9179 |
| 796 | Ga0495665_0003630 | 3300046531 | Bacteria | 8374 |
| 797 | Ga0495640_0085787 | 3300046533 | Bacteria | 2086 |
| 798 | Ga0495587_0040206 | 3300046536 | Bacteria | 2796 |
| 799 | Ga0495587_0053611 | 3300046536 | Bacteria | 2377 |
| 800 | Ga0495645_0100297 | 3300046543 | Bacteria | 2059 |
| 801 | Ga0495645_0116450 | 3300046543 | Bacteria | 1886 |
| 802 | Ga0495645_0420540 | 3300046543 | Bacteria | 848 |
| 803 | Ga0495667_0005958 | 3300046559 | Bacteria | 8242 |
| 804 | Ga0495667_0010235 | 3300046559 | Bacteria | 6344 |
| 805 | Ga0495667_0031038 | 3300046559 | Bacteria | 3588 |
| 806 | Ga0495667_0116483 | 3300046559 | Bacteria | 1726 |
| 807 | Ga0495634_0028024 | 3300046642 | Bacteria | 3913 |
| 808 | Ga0495634_0207242 | 3300046642 | Bacteria | 1215 |
| 809 | Ga0495634_0215788 | 3300046642 | Bacteria | 1186 |
| 810 | Ga0495625_0273930 | 3300046660 | Bacteria | 1088 |
| 811 | Ga0495635_0001859 | 3300046663 | Bacteria | 14293 |
| 812 | Ga0495635_0019489 | 3300046663 | Bacteria | 4728 |
| 813 | Ga0495635_0029558 | 3300046663 | Bacteria | 3811 |
| 814 | Ga0495635_0034826 | 3300046663 | Bacteria | 3492 |
| 815 | Ga0495657_0009701 | 3300046675 | Bacteria | 7279 |
| 816 | Ga0495657_0043596 | 3300046675 | Bacteria | 3058 |
| 817 | Ga0495657_0084786 | 3300046675 | Bacteria | 2043 |
| 818 | Ga0495599_0052805 | 3300046678 | Bacteria | 2546 |
| 819 | Ga0495599_0061181 | 3300046678 | Bacteria | 2353 |
| 820 | Ga0495623_0108871 | 3300046679 | Bacteria | 1681 |
| 821 | Ga0495613_0155784 | 3300046689 | Bacteria | 1628 |
| 822 | Ga0495624_0002363 | 3300046690 | Bacteria | 14327 |
| 823 | Ga0495600_0219197 | 3300046809 | Bacteria | 1217 |
| 824 | Ga0495600_0225025 | 3300046809 | Bacteria | 1199 |
| 825 | Ga0495581_0020267 | 3300047315 | Bacteria | 3860 |
| 826 | Ga0495581_0085238 | 3300047315 | Bacteria | 1831 |
| 827 | Ga0495604_0107154 | 3300047317 | Bacteria | 2043 |
| 828 | Ga0495604_0220813 | 3300047317 | Bacteria | 1305 |
| 829 | Ga0495674_0001119 | 3300047319 | Bacteria | 25781 |
| 830 | Ga0495674_0028758 | 3300047319 | Bacteria | 5064 |
| 831 | Ga0495674_0524890 | 3300047319 | Bacteria | 945 |
| 832 | Ga0495672_0012959 | 3300047320 | Bacteria | 5778 |
| 833 | Ga0495672_0015435 | 3300047320 | Bacteria | 5186 |
| 834 | Ga0495672_0207443 | 3300047320 | Bacteria | 976 |
| 835 | Ga0495676_0052512 | 3300047321 | Bacteria | 3253 |
| 836 | Ga0495680_0050452 | 3300047322 | Bacteria | 3254 |
| 837 | Ga0495680_0053811 | 3300047322 | Bacteria | 3129 |
| 838 | Ga0495675_0039590 | 3300047444 | Bacteria | 3002 |
| 839 | Ga0495675_0060719 | 3300047444 | Bacteria | 2396 |
| 840 | Ga0495673_0000640 | 3300047469 | Bacteria | 34402 |
| 841 | Ga0495684_0002878 | 3300047471 | Bacteria | 13550 |
| 842 | Ga0495684_0020977 | 3300047471 | Bacteria | 5032 |
| 843 | Ga0495684_0045583 | 3300047471 | Bacteria | 3355 |
| 844 | Ga0495593_0399587 | 3300047673 | Bacteria | 687 |
| 845 | Ga0495602_0164985 | 3300048088 | Bacteria | 1725 |
| 846 | Ga0496100_0001433 | 3300048903 | Bacteria | 11669 |
| 847 | Ga0496100_0024697 | 3300048903 | Bacteria | 3668 |
| 848 | Ga0496100_0084433 | 3300048903 | Bacteria | 2152 |
| 849 | Ga0496100_0131253 | 3300048903 | Bacteria | 1765 |
| 850 | Ga0496100_0166764 | 3300048903 | Bacteria | 1583 |
| 851 | Ga0496101_0000878 | 3300048904 | Bacteria | 17724 |
| 852 | Ga0496101_0004040 | 3300048904 | Bacteria | 9171 |
| 853 | Ga0496101_0004844 | 3300048904 | Bacteria | 8536 |
| 854 | Ga0496101_0018373 | 3300048904 | Bacteria | 4754 |
| 855 | Ga0496102_0000131 | 3300048905 | Bacteria | 104032 |
| 856 | Ga0496102_0009118 | 3300048905 | Bacteria | 8510 |
| 857 | Ga0496102_0021846 | 3300048905 | Bacteria | 5664 |
| 858 | Ga0496102_0051939 | 3300048905 | Bacteria | 3734 |
| 859 | Ga0496102_0188374 | 3300048905 | Bacteria | 1944 |
| 860 | Ga0496102_0257849 | 3300048905 | Bacteria | 1644 |
| 861 | Ga0496102_0320987 | 3300048905 | Bacteria | 1459 |
| 862 | Ga0496102_0488419 | 3300048905 | Bacteria | 1153 |
| 863 | Ga0496103_0000584 | 3300048906 | Bacteria | 28834 |
| 864 | Ga0496103_0000859 | 3300048906 | Bacteria | 22103 |
| 865 | Ga0496103_0024140 | 3300048906 | Bacteria | 3667 |
| 866 | Ga0496103_0063151 | 3300048906 | Bacteria | 2306 |
| 867 | Ga0496103_0094575 | 3300048906 | Bacteria | 1888 |
| 868 | Ga0496103_0156845 | 3300048906 | Bacteria | 1459 |
| 869 | Ga0496103_0270566 | 3300048906 | Bacteria | 1093 |
| 870 | Ga0496103_0348169 | 3300048906 | Bacteria | 953 |
| 871 | Ga0496104_0002120 | 3300048907 | Bacteria | 17226 |
| 872 | Ga0496104_0006446 | 3300048907 | Bacteria | 10317 |
| 873 | Ga0496104_0030846 | 3300048907 | Bacteria | 4985 |
| 874 | Ga0496104_0041539 | 3300048907 | Bacteria | 4312 |
| 875 | Ga0496104_0060438 | 3300048907 | Bacteria | 3590 |
| 876 | Ga0496104_0122217 | 3300048907 | Bacteria | 2500 |
| 877 | Ga0496104_0157959 | 3300048907 | Bacteria | 2176 |
| 878 | Ga0496104_0295543 | 3300048907 | Bacteria | 1532 |
| 879 | Ga0496104_0401072 | 3300048907 | Bacteria | 1284 |
| 880 | Ga0496105_0006239 | 3300048908 | Bacteria | 9152 |
| 881 | Ga0496105_0017484 | 3300048908 | Bacteria | 5751 |
| 882 | Ga0496105_0018109 | 3300048908 | Bacteria | 5653 |
| 883 | Ga0496105_0045646 | 3300048908 | Bacteria | 3616 |
| 884 | Ga0496105_0308435 | 3300048908 | Bacteria | 1271 |
| 885 | Ga0496106_0000264 | 3300048909 | Bacteria | 36882 |
| 886 | Ga0496106_0079176 | 3300048909 | Bacteria | 2523 |
| 887 | Ga0496106_0200729 | 3300048909 | Bacteria | 1587 |
| 888 | Ga0496106_0245935 | 3300048909 | Bacteria | 1429 |
| 889 | Ga0496106_0246570 | 3300048909 | Bacteria | 1427 |
| 890 | Ga0496106_0313844 | 3300048909 | Bacteria | 1258 |
| 891 | Ga0496106_0940860 | 3300048909 | Bacteria | 681 |
| 892 | Ga0496107_0002087 | 3300048910 | Bacteria | 12791 |
| 893 | Ga0496107_0011379 | 3300048910 | Bacteria | 6194 |
| 894 | Ga0496107_0028090 | 3300048910 | Bacteria | 3997 |
| 895 | Ga0496107_0035884 | 3300048910 | Bacteria | 3556 |
| 896 | Ga0496107_0110024 | 3300048910 | Bacteria | 2024 |
| 897 | Ga0496107_0192125 | 3300048910 | Bacteria | 1517 |
| 898 | Ga0496108_0000246 | 3300048911 | Bacteria | 48269 |
| 899 | Ga0496108_0004292 | 3300048911 | Bacteria | 11476 |
| 900 | Ga0496108_0042719 | 3300048911 | Bacteria | 3785 |
| 901 | Ga0496108_0096422 | 3300048911 | Bacteria | 2519 |
| 902 | Ga0496108_0100491 | 3300048911 | Bacteria | 2467 |
| 903 | Ga0496108_0182188 | 3300048911 | Bacteria | 1819 |
| 904 | Ga0496108_0198094 | 3300048911 | Bacteria | 1742 |
| 905 | Ga0496108_0236291 | 3300048911 | Bacteria | 1589 |
| 906 | Ga0496109_0004032 | 3300048912 | Bacteria | 12266 |
| 907 | Ga0496109_0005253 | 3300048912 | Bacteria | 10813 |
| 908 | Ga0496109_0038359 | 3300048912 | Bacteria | 4331 |
| 909 | Ga0496109_0038784 | 3300048912 | Bacteria | 4308 |
| 910 | Ga0496109_0086397 | 3300048912 | Bacteria | 2897 |
| 911 | Ga0496109_0129500 | 3300048912 | Bacteria | 2355 |
| 912 | Ga0496109_0178112 | 3300048912 | Bacteria | 1996 |
| 913 | Ga0496109_0409943 | 3300048912 | Bacteria | 1280 |
| 914 | Ga0496109_0678687 | 3300048912 | Bacteria | 967 |
| 915 | Ga0496109_0761813 | 3300048912 | Bacteria | 906 |
| 916 | Ga0496110_0021997 | 3300048913 | Bacteria | 5409 |
| 917 | Ga0496110_0023699 | 3300048913 | Bacteria | 5222 |
| 918 | Ga0496110_0024081 | 3300048913 | Bacteria | 5187 |
| 919 | Ga0496110_0124483 | 3300048913 | Bacteria | 2325 |
| 920 | Ga0496110_0160975 | 3300048913 | Bacteria | 2035 |
| 921 | Ga0496110_0196799 | 3300048913 | Bacteria | 1830 |
| 922 | Ga0496110_0360661 | 3300048913 | Bacteria | 1324 |
| 923 | Ga0496111_0014763 | 3300048914 | Bacteria | 5345 |
| 924 | Ga0496111_0028674 | 3300048914 | Bacteria | 3946 |
| 925 | Ga0496111_0053090 | 3300048914 | Bacteria | 2928 |
| 926 | Ga0496111_0169926 | 3300048914 | Bacteria | 1620 |
| 927 | Ga0496111_0254065 | 3300048914 | Bacteria | 1304 |
| 928 | Ga0496111_0285548 | 3300048914 | Bacteria | 1224 |
| 929 | Ga0496112_0008267 | 3300048915 | Bacteria | 9312 |
| 930 | Ga0496112_0031603 | 3300048915 | Bacteria | 5136 |
| 931 | Ga0496112_0058709 | 3300048915 | Bacteria | 3789 |
| 932 | Ga0496112_0145847 | 3300048915 | Bacteria | 2335 |
| 933 | Ga0496112_0221222 | 3300048915 | Bacteria | 1849 |
| 934 | Ga0496112_0690967 | 3300048915 | Bacteria | 949 |
| 935 | Ga0496112_0815583 | 3300048915 | Bacteria | 857 |
| 936 | Ga0496112_0838482 | 3300048915 | Bacteria | 843 |
| 937 | Ga0496113_0015679 | 3300048916 | Bacteria | 5218 |
| 938 | Ga0496113_0016219 | 3300048916 | Bacteria | 5143 |
| 939 | Ga0496113_0396777 | 3300048916 | Bacteria | 1107 |
| 940 | Ga0496114_0006511 | 3300048917 | Bacteria | 9201 |
| 941 | Ga0496114_0050846 | 3300048917 | Bacteria | 3450 |
| 942 | Ga0496114_0088884 | 3300048917 | Bacteria | 2621 |
| 943 | Ga0496114_0103965 | 3300048917 | Bacteria | 2428 |
| 944 | Ga0496114_0312675 | 3300048917 | Bacteria | 1388 |
| 945 | Ga0496114_0488034 | 3300048917 | Bacteria | 1090 |
| 946 | Ga0496115_0002052 | 3300048918 | Bacteria | 14416 |
| 947 | Ga0496115_0002133 | 3300048918 | Bacteria | 14141 |
| 948 | Ga0496115_0013228 | 3300048918 | Bacteria | 6235 |
| 949 | Ga0496115_0087064 | 3300048918 | Bacteria | 2549 |
| 950 | Ga0496115_0113465 | 3300048918 | Bacteria | 2227 |
| 951 | Ga0496115_0186352 | 3300048918 | Bacteria | 1715 |
| 952 | Ga0496115_0277232 | 3300048918 | Bacteria | 1377 |
| 953 | Ga0496115_0277607 | 3300048918 | Bacteria | 1376 |
| 954 | Ga0496115_0592942 | 3300048918 | Bacteria | 882 |
| 955 | Ga0496116_0002121 | 3300048919 | Bacteria | 21120 |
| 956 | Ga0496117_0002770 | 3300048920 | Bacteria | 21471 |
| 957 | Ga0496118_0002961 | 3300048921 | Bacteria | 21991 |
| 958 | Ga0496120_0007762 | 3300048923 | Bacteria | 7925 |
| 959 | Ga0496121_0010397 | 3300048924 | Bacteria | 10503 |
| 960 | Ga0496126_0005120 | 3300048929 | Bacteria | 15192 |
| 961 | Ga0496126_0033996 | 3300048929 | Bacteria | 4793 |
| 962 | Ga0496126_0040721 | 3300048929 | Bacteria | 4306 |
| 963 | Ga0496126_0057471 | 3300048929 | Bacteria | 3512 |
| 964 | Ga0501032_0001494 | 3300049569 | Bacteria | 18671 |
| 965 | Ga0501034_0016345 | 3300049571 | Bacteria | 7616 |
| 966 | Ga0501034_0020028 | 3300049571 | Bacteria | 6833 |
| 967 | Ga0501036_0007823 | 3300049572 | Bacteria | 8744 |
| 968 | Ga0501037_0000711 | 3300049573 | Bacteria | 25295 |
| 969 | Ga0501038_0000982 | 3300049574 | Bacteria | 25589 |
| 970 | Ga0501038_0060667 | 3300049574 | Bacteria | 3236 |
| 971 | Ga0501039_0000266 | 3300049575 | Bacteria | 37974 |
| 972 | Ga0501039_0055849 | 3300049575 | Bacteria | 3059 |
| 973 | Ga0501043_0000776 | 3300049579 | Bacteria | 28344 |
| 974 | Ga0501043_0106925 | 3300049579 | Bacteria | 2197 |
| 975 | Ga0501070_0001392 | 3300049586 | Bacteria | 21651 |
| 976 | Ga0501077_0091838 | 3300049593 | Bacteria | 1924 |
| 977 | Ga0501035_0086346 | 3300049822 | Bacteria | 2765 |
| 978 | Ga0501044_0045334 | 3300049823 | Bacteria | 4556 |
| 979 | Ga0501044_0125488 | 3300049823 | Bacteria | 2564 |
| 980 | nmdc:mga00v17_1052_c1 | 3300050491 | Bacteria | 14588 |
| 981 | nmdc:mga00v17_25637_c1 | 3300050491 | Bacteria | 3428 |
| 982 | nmdc:mga00v17_353907_c1 | 3300050491 | Bacteria | 955 |
| 983 | nmdc:mga0yw44_185007_c1 | 3300050492 | Bacteria | 1372 |
| 984 | nmdc:mga0yw44_340609_c1 | 3300050492 | Bacteria | 1008 |
| 985 | nmdc:mga05p37_10381_c1 | 3300050507 | Bacteria | 11056 |
| 986 | nmdc:mga05p37_81024_c1 | 3300050507 | Bacteria | 3998 |
| 987 | nmdc:mga05p37_900249_c1 | 3300050507 | Bacteria | 954 |
| 988 | nmdc:mga0qj67_4056_c2 | 3300050509 | Bacteria | 4335 |
| 989 | nmdc:mga0qj67_42026_c1 | 3300050509 | Bacteria | 3598 |
| 990 | nmdc:mga06r32_11739_c1 | 3300050510 | Bacteria | 7887 |
| 991 | nmdc:mga06r32_162452_c1 | 3300050510 | Bacteria | 2216 |
| 992 | nmdc:mga08y16_137477_c1 | 3300050511 | Bacteria | 2540 |
| 993 | nmdc:mga0n895_115915_c1 | 3300050512 | Bacteria | 2697 |
| 994 | nmdc:mga0n895_180649_c1 | 3300050512 | Bacteria | 2141 |
| 995 | nmdc:mga0rr50_626104_c1 | 3300050513 | Bacteria | 918 |
| 996 | nmdc:mga08x19_472159_c1 | 3300050514 | Bacteria | 884 |
| 997 | nmdc:mga08x19_715500_c1 | 3300050514 | Bacteria | 711 |
| 998 | nmdc:mga0sz30_14057_c1 | 3300050516 | Bacteria | 3144 |
| 999 | nmdc:mga0sz30_36736_c1 | 3300050516 | Bacteria | 2048 |
| 1000 | nmdc:mga0sz30_4504_c1 | 3300050516 | Bacteria | 5040 |
| 1001 | nmdc:mga0sz30_91255_c1 | 3300050516 | Bacteria | 1325 |
| 1002 | Ga0495601_0044270 | 3300053077 | Bacteria | 2798 |
| 1003 | Ga0495601_0137338 | 3300053077 | Bacteria | 1594 |
| 1004 | Ga0500635_0064116 | 3300053080 | Bacteria | 1290 |
| 1005 | Ga0495619_0183079 | 3300053085 | Bacteria | 1449 |
| 1006 | Ga0500643_002451 | 3300053087 | Bacteria | 9591 |
| 1007 | Ga0500652_028231 | 3300053131 | Bacteria | 2178 |
| 1008 | Ga0500559_0099413 | 3300053136 | Bacteria | 1339 |
| 1009 | Ga0500604_0108565 | 3300053151 | Bacteria | 920 |
| 1010 | Ga0500645_000004 | 3300053730 | Bacteria | 305014 |
| 1011 | Ga0500645_009385 | 3300053730 | Bacteria | 3289 |
| 1012 | Ga0466962_0083988 | 3300061719 | Bacteria | 1523 |
| 1013 | 2515853889 | 2515154155 | Bacteria | 7985436 |
| 1014 | 2676473170 | 2675903058 | Bacteria | 6822861 |
| 1015 | 2738703296 | 2738541274 | Bacteria | 6909446 |
| 1016 | 2738890002 | 2738541308 | Bacteria | 7020677 |
| 1017 | 2739329243 | 2738543028 | Bacteria | 6917070 |
| 1018 | 2827631765 | 2827628540 | Bacteria | 6858585 |
| 1019 | 2929216633 | 2929212328 | Bacteria | 7708288 |
| 1020 | 2939585574 | 2939582691 | Bacteria | 7088898 |
| 1021 | Ga0436360_0523085 | |||
| 1022 | LJNas_1001704 | |||
| 1023 | JGI24746J21847_1006939 | |||
| 1024 | JGI24737J22298_10080820 | |||
| 1025 | JGI24743J22301_10005600 | |||
| 1026 | JGI24750J21931_1006453 | |||
| 1027 | JGI24745J21846_1014373 | |||
| 1028 | JGI24748J21848_1002589 | |||
| 1029 | JGI24749J21850_1004724 | |||
| 1030 | JGI24744J21845_10001665 | |||
| 1031 | JGI24744J21845_10002839 | |||
| 1032 | JGI24742J22300_10000089 | |||
| 1033 | JGI25407J50210_10035780 | |||
| 1034 | Ga0070658_10720726 | |||
| 1035 | Ga0070676_10003176 | |||
| 1036 | Ga0070676_10161649 | |||
| 1037 | Ga0070683_100072651 | |||
| 1038 | Ga0070683_100743751 | |||
| 1039 | Ga0070690_100007614 | |||
| 1040 | Ga0070690_100053018 | |||
| 1041 | Ga0070670_100241920 | |||
| 1042 | Ga0068869_100005345 | |||
| 1043 | Ga0068869_100007876 | |||
| 1044 | Ga0068869_100683287 | |||
| 1045 | Ga0070666_10015031 | |||
| 1046 | Ga0070680_100169897 | |||
| 1047 | Ga0070682_100008251 | |||
| 1048 | Ga0070682_100086754 | |||
| 1049 | Ga0070682_100101568 | |||
| 1050 | Ga0070682_100407004 | |||
| 1051 | Ga0070682_100423719 | |||
| 1052 | Ga0068868_100000483 | |||
| 1053 | Ga0068868_100061428 | |||
| 1054 | Ga0068868_100100357 | |||
| 1055 | Ga0068868_100187421 | |||
| 1056 | Ga0070660_100223097 | |||
| 1057 | Ga0070689_100026117 | |||
| 1058 | Ga0070689_100131863 | |||
| 1059 | Ga0070689_100191197 | |||
| 1060 | Ga0070691_10096120 | |||
| 1061 | Ga0070691_10171169 | |||
| 1062 | Ga0070687_100081954 | |||
| 1063 | Ga0070687_100517152 | |||
| 1064 | Ga0070661_100016242 | |||
| 1065 | Ga0070692_10238053 | |||
| 1066 | Ga0070692_10504194 | |||
| 1067 | Ga0070668_100000385 | |||
| 1068 | Ga0070668_100000558 | |||
| 1069 | Ga0070668_100076097 | |||
| 1070 | Ga0070668_100114492 | |||
| 1071 | Ga0070669_100000960 | |||
| 1072 | Ga0070669_100006266 | |||
| 1073 | Ga0070671_100006148 | |||
| 1074 | Ga0070671_100093668 | |||
| 1075 | Ga0070671_100217760 | |||
| 1076 | Ga0070674_100004720 | |||
| 1077 | Ga0070674_100008272 | |||
| 1078 | Ga0070674_100474068 | |||
| 1079 | Ga0070673_100058256 | |||
| 1080 | Ga0070688_100011279 | |||
| 1081 | Ga0070659_100005583 | |||
| 1082 | Ga0070659_100154297 | |||
| 1083 | Ga0070659_100665490 | |||
| 1084 | Ga0070667_100001425 | |||
| 1085 | Ga0070667_100002282 | |||
| 1086 | Ga0070667_100025244 | |||
| 1087 | Ga0070667_100037980 | |||
| 1088 | Ga0070667_100166766 | |||
| 1089 | Ga0070667_100243518 | |||
| 1090 | Ga0070709_10006066 | |||
| 1091 | Ga0070709_10010319 | |||
| 1092 | Ga0070709_10016027 | |||
| 1093 | Ga0070709_10091419 | |||
| 1094 | Ga0070709_10265994 | |||
| 1095 | Ga0070714_100000805 | |||
| 1096 | Ga0070714_100005264 | |||
| 1097 | Ga0070714_100069064 | |||
| 1098 | Ga0070714_100118280 | |||
| 1099 | Ga0070714_100252388 | |||
| 1100 | Ga0070714_100342789 | |||
| 1101 | Ga0070714_100362049 | |||
| 1102 | Ga0070714_100436991 | |||
| 1103 | Ga0070713_100000392 | |||
| 1104 | Ga0070713_100002559 | |||
| 1105 | Ga0070713_100004531 | |||
| 1106 | Ga0070713_100042889 | |||
| 1107 | Ga0070713_100247106 | |||
| 1108 | Ga0070713_100487845 | |||
| 1109 | Ga0070713_100670914 | |||
| 1110 | Ga0070713_100793720 | |||
| 1111 | Ga0070713_100864539 | |||
| 1112 | Ga0070713_100942154 | |||
| 1113 | Ga0070710_10000240 | |||
| 1114 | Ga0070710_10001472 | |||
| 1115 | Ga0070710_10003905 | |||
| 1116 | Ga0070710_10006432 | |||
| 1117 | Ga0070710_10036292 | |||
| 1118 | Ga0070710_10064656 | |||
| 1119 | Ga0070710_10072604 | |||
| 1120 | Ga0070710_10077457 | |||
| 1121 | Ga0070701_10001759 | |||
| 1122 | Ga0070701_10056189 | |||
| 1123 | Ga0070701_10084515 | |||
| 1124 | Ga0070711_100000197 | |||
| 1125 | Ga0070711_100002538 | |||
| 1126 | Ga0070711_100013514 | |||
| 1127 | Ga0070711_100017712 | |||
| 1128 | Ga0070711_100021255 | |||
| 1129 | Ga0070711_100035400 | |||
| 1130 | Ga0070711_100037812 | |||
| 1131 | Ga0070711_100056451 | |||
| 1132 | Ga0070711_100070841 | |||
| 1133 | Ga0070711_100088588 | |||
| 1134 | Ga0070711_100197176 | |||
| 1135 | Ga0070711_100261492 | |||
| 1136 | Ga0070711_100336887 | |||
| 1137 | Ga0070705_100550294 | |||
| 1138 | Ga0070700_100001630 | |||
| 1139 | Ga0070708_100035130 | |||
| 1140 | Ga0070708_100064357 | |||
| 1141 | Ga0070708_100259120 | |||
| 1142 | Ga0070708_100398519 | |||
| 1143 | Ga0070663_100008356 | |||
| 1144 | Ga0070663_100015423 | |||
| 1145 | Ga0070663_100072983 | |||
| 1146 | Ga0070663_100153793 | |||
| 1147 | Ga0070678_100039972 | |||
| 1148 | Ga0070662_100013356 | |||
| 1149 | Ga0070662_100024583 | |||
| 1150 | Ga0070662_100308937 | |||
| 1151 | Ga0070681_10100810 | |||
| 1152 | Ga0070681_10573554 | |||
| 1153 | Ga0068867_100002073 | |||
| 1154 | Ga0068867_100170907 | |||
| 1155 | Ga0068867_100209512 | |||
| 1156 | Ga0070685_10021109 | |||
| 1157 | Ga0070685_10038246 | |||
| 1158 | Ga0070685_10066726 | |||
| 1159 | Ga0070685_10131749 | |||
| 1160 | Ga0070706_100066559 | |||
| 1161 | Ga0070706_100072683 | |||
| 1162 | Ga0070706_100310021 | |||
| 1163 | Ga0070707_100072548 | |||
| 1164 | Ga0070707_100168156 | |||
| 1165 | Ga0070707_100258890 | |||
| 1166 | Ga0070707_100416688 | |||
| 1167 | Ga0070698_100026365 | |||
| 1168 | Ga0070698_100118676 | |||
| 1169 | Ga0070698_100492266 | |||
| 1170 | Ga0070698_100545338 | |||
| 1171 | Ga0070699_100095029 | |||
| 1172 | Ga0070679_100100988 | |||
| 1173 | Ga0070697_100052226 | |||
| 1174 | Ga0068853_100029215 | |||
| 1175 | Ga0068853_100135999 | |||
| 1176 | Ga0070672_100159837 | |||
| 1177 | Ga0070686_100160315 | |||
| 1178 | Ga0070686_100176158 | |||
| 1179 | Ga0070695_100025441 | |||
| 1180 | Ga0070695_100070423 | |||
| 1181 | Ga0070696_100016686 | |||
| 1182 | Ga0070696_100082778 | |||
| 1183 | Ga0070696_100265618 | |||
| 1184 | Ga0070693_100006772 | |||
| 1185 | Ga0070693_100059516 | |||
| 1186 | Ga0070693_100190642 | |||
| 1187 | Ga0070693_100330094 | |||
| 1188 | Ga0070665_100024629 | |||
| 1189 | Ga0070665_100030158 | |||
| 1190 | Ga0070665_100045778 | |||
| 1191 | Ga0070665_100049147 | |||
| 1192 | Ga0070665_100064333 | |||
| 1193 | Ga0070665_100102507 | |||
| 1194 | Ga0070665_100161578 | |||
| 1195 | Ga0070665_100323313 | |||
| 1196 | Ga0070704_100000219 | |||
| 1197 | Ga0070704_100122631 | |||
| 1198 | Ga0070704_100291480 | |||
| 1199 | Ga0068855_100414973 | |||
| 1200 | Ga0068857_100117496 | |||
| 1201 | Ga0068854_100524179 | |||
| 1202 | Ga0068856_100867339 | |||
| 1203 | Ga0070702_100002876 | |||
| 1204 | Ga0070702_100099352 | |||
| 1205 | Ga0070702_100151373 | |||
| 1206 | Ga0068852_100094596 | |||
| 1207 | Ga0068852_100568448 | |||
| 1208 | Ga0068859_100004636 | |||
| 1209 | Ga0068859_100028702 | |||
| 1210 | Ga0068859_100075497 | |||
| 1211 | Ga0068859_100579726 | |||
| 1212 | Ga0068859_100768976 | |||
| 1213 | Ga0068864_100027786 | |||
| 1214 | Ga0068864_100563305 | |||
| 1215 | Ga0068864_101150187 | |||
| 1216 | Ga0068866_10000870 | |||
| 1217 | Ga0068861_100002108 | |||
| 1218 | Ga0068861_100041041 | |||
| 1219 | Ga0068861_100079048 | |||
| 1220 | Ga0068851_10157067 | |||
| 1221 | Ga0068863_100001428 | |||
| 1222 | Ga0068863_100023450 | |||
| 1223 | Ga0068863_100067753 | |||
| 1224 | Ga0068863_100765393 | |||
| 1225 | Ga0068858_100004100 | |||
| 1226 | Ga0068858_100051932 | |||
| 1227 | Ga0068858_100197757 | |||
| 1228 | Ga0068858_100913898 | |||
| 1229 | Ga0068860_100002016 | |||
| 1230 | Ga0068860_100309536 | |||
| 1231 | Ga0068860_100596966 | |||
| 1232 | Ga0068860_100710674 | |||
| 1233 | Ga0068862_100000035 | |||
| 1234 | Ga0068862_100031914 | |||
| 1235 | Ga0068862_100146506 | |||
| 1236 | Ga0068862_100507602 | |||
| 1237 | Ga0081455_10018519 | |||
| 1238 | Ga0081455_10087009 | |||
| 1239 | Ga0081455_10228632 | |||
| 1240 | Ga0081455_10233712 | |||
| 1241 | Ga0081538_10007006 | |||
| 1242 | Ga0081538_10043959 | |||
| 1243 | Ga0081538_10045432 | |||
| 1244 | Ga0081540_1000009 | |||
| 1245 | Ga0081539_10000062 | |||
| 1246 | Ga0070717_10004522 | |||
| 1247 | Ga0070717_10051350 | |||
| 1248 | Ga0070717_10055216 | |||
| 1249 | Ga0070717_10059483 | |||
| 1250 | Ga0070717_10144573 | |||
| 1251 | Ga0070717_10280244 | |||
| 1252 | Ga0070717_10402902 | |||
| 1253 | Ga0070717_10427115 | |||
| 1254 | Ga0070717_10515281 | |||
| 1255 | Ga0075365_10384636 | |||
| 1256 | Ga0075364_10003712 | |||
| 1257 | Ga0070715_10004251 | |||
| 1258 | Ga0070715_10015088 | |||
| 1259 | Ga0070715_10032910 | |||
| 1260 | Ga0070715_10042024 | |||
| 1261 | Ga0070716_100000575 | |||
| 1262 | Ga0070716_100003527 | |||
| 1263 | Ga0070716_100033836 | |||
| 1264 | Ga0070716_100034863 | |||
| 1265 | Ga0070716_100050846 | |||
| 1266 | Ga0070716_100127413 | |||
| 1267 | Ga0070716_100401132 | |||
| 1268 | Ga0070712_100000786 | |||
| 1269 | Ga0070712_100003582 | |||
| 1270 | Ga0070712_100012910 | |||
| 1271 | Ga0070712_100064838 | |||
| 1272 | Ga0070712_100125473 | |||
| 1273 | Ga0070712_100190405 | |||
| 1274 | Ga0070712_100207045 | |||
| 1275 | Ga0070712_100213747 | |||
| 1276 | Ga0070712_100308529 | |||
| 1277 | Ga0070712_100806827 | |||
| 1278 | Ga0075369_10001795 | |||
| 1279 | Ga0075369_10007848 | |||
| 1280 | Ga0075369_10081123 | |||
| 1281 | Ga0097621_100034412 | |||
| 1282 | Ga0097621_100145757 | |||
| 1283 | Ga0075370_10104698 | |||
| 1284 | Ga0068871_100092288 | |||
| 1285 | Ga0075428_100011120 | |||
| 1286 | Ga0075428_100089634 | |||
| 1287 | Ga0075428_101123179 | |||
| 1288 | Ga0075430_100008192 | |||
| 1289 | Ga0075430_100062522 | |||
| 1290 | Ga0075430_100746655 | |||
| 1291 | Ga0075431_100009394 | |||
| 1292 | Ga0075434_100123168 | |||
| 1293 | Ga0075434_100762108 | |||
| 1294 | Ga0068865_100002144 | |||
| 1295 | Ga0068865_100171913 | |||
| 1296 | Ga0068865_100856540 | |||
| 1297 | Ga0075436_100166312 | |||
| 1298 | Ga0097620_100004636 | |||
| 1299 | Ga0097620_100028703 | |||
| 1300 | Ga0097620_100075497 | |||
| 1301 | Ga0097620_100579727 | |||
| 1302 | Ga0097620_100768963 | |||
| 1303 | Ga0075435_100483832 | |||
| 1304 | Ga0099795_10096589 | |||
| 1305 | Ga0105251_10078044 | |||
| 1306 | Ga0105250_10129087 | |||
| 1307 | Ga0105240_10143743 | |||
| 1308 | Ga0105240_10162993 | |||
| 1309 | Ga0111539_10158605 | |||
| 1310 | Ga0105245_10012028 | |||
| 1311 | Ga0105245_10026860 | |||
| 1312 | Ga0105245_10116451 | |||
| 1313 | Ga0105245_10157101 | |||
| 1314 | Ga0105245_10251556 | |||
| 1315 | Ga0105245_10389688 | |||
| 1316 | Ga0105245_10467739 | |||
| 1317 | Ga0105247_10000952 | |||
| 1318 | Ga0105247_10005574 | |||
| 1319 | Ga0114129_10001008 | |||
| 1320 | Ga0114129_10377857 | |||
| 1321 | Ga0114129_10378107 | |||
| 1322 | Ga0114129_10467018 | |||
| 1323 | Ga0114129_10658569 | |||
| 1324 | Ga0114129_11244674 | |||
| 1325 | Ga0114129_11438542 | |||
| 1326 | Ga0114129_11595288 | |||
| 1327 | Ga0105243_10002044 | |||
| 1328 | Ga0105243_10099360 | |||
| 1329 | Ga0105243_10422431 | |||
| 1330 | Ga0105241_10032842 | |||
| 1331 | Ga0105241_10314121 | |||
| 1332 | Ga0105241_10544282 | |||
| 1333 | Ga0105242_10000373 | |||
| 1334 | Ga0105242_10081903 | |||
| 1335 | Ga0105242_10304416 | |||
| 1336 | Ga0105242_10370373 | |||
| 1337 | Ga0105242_10632427 | |||
| 1338 | Ga0105248_10002237 | |||
| 1339 | Ga0105248_10025822 | |||
| 1340 | Ga0105248_10917920 | |||
| 1341 | Ga0105248_11633343 | |||
| 1342 | Ga0105237_10122503 | |||
| 1343 | Ga0105237_10172256 | |||
| 1344 | Ga0105237_10718738 | |||
| 1345 | Ga0105237_11138217 | |||
| 1346 | Ga0105249_10000046 | |||
| 1347 | Ga0105249_10002144 | |||
| 1348 | Ga0105249_10021311 | |||
| 1349 | Ga0105249_10055721 | |||
| 1350 | Ga0105249_10275817 | |||
| 1351 | Ga0105249_10291520 | |||
| 1352 | Ga0105249_10566629 | |||
| 1353 | Ga0105249_10707101 | |||
| 1354 | Ga0105239_10031982 | |||
| 1355 | Ga0105239_10229779 | |||
| 1356 | Ga0105239_10461828 | |||
| 1357 | Ga0105239_10620477 | |||
| 1358 | Ga0105239_10804595 | |||
| 1359 | Ga0105239_11426624 | |||
| 1360 | Ga0157329_1002048 | |||
| 1361 | Ga0157341_1003699 | |||
| 1362 | Ga0157313_1001835 | |||
| 1363 | Ga0157342_1000461 | |||
| 1364 | Ga0157373_10248874 | |||
| 1365 | Ga0157371_10221018 | |||
| 1366 | Ga0157371_10506486 | |||
| 1367 | Ga0157369_10091807 | |||
| 1368 | Ga0157369_10435526 | |||
| 1369 | Ga0157369_10860336 | |||
| 1370 | Ga0157374_10112070 | |||
| 1371 | Ga0157374_10855036 | |||
| 1372 | Ga0157378_10003240 | |||
| 1373 | Ga0157378_10040034 | |||
| 1374 | Ga0157378_10185843 | |||
| 1375 | Ga0157378_10742103 | |||
| 1376 | Ga0163162_10007730 | |||
| 1377 | Ga0163162_10107172 | |||
| 1378 | Ga0163162_10427716 | |||
| 1379 | Ga0163162_10680281 | |||
| 1380 | Ga0157372_10012120 | |||
| 1381 | Ga0157372_10348223 | |||
| 1382 | Ga0157372_10490706 | |||
| 1383 | Ga0157372_10819347 | |||
| 1384 | Ga0157375_10000487 | |||
| 1385 | Ga0157375_10114525 | |||
| 1386 | Ga0157375_10220901 | |||
| 1387 | Ga0157375_10317600 | |||
| 1388 | Ga0157375_10730282 | |||
| 1389 | Ga0157375_10923453 | |||
| 1390 | Ga0157375_11100176 | |||
| 1391 | Ga0157375_11799280 | |||
| 1392 | Ga0163163_10020015 | |||
| 1393 | Ga0163163_10030667 | |||
| 1394 | Ga0163163_10087848 | |||
| 1395 | Ga0157380_10000989 | |||
| 1396 | Ga0157380_10053351 | |||
| 1397 | Ga0157377_10153706 | |||
| 1398 | Ga0157379_10136346 | |||
| 1399 | Ga0157379_10271024 | |||
| 1400 | Ga0157376_10022726 | |||
| 1401 | Ga0182005_1032735 | |||
| 1402 | Ga0163161_10005652 | |||
| 1403 | Ga0163161_10007739 | |||
| 1404 | Ga0163161_10336651 | |||
| 1405 | Ga0206354_11547857 | |||
| 1406 | Ga0213875_10041147 | |||
| 1407 | Ga0213875_10069811 | |||
| 1408 | Ga0224712_10023447 | |||
| 1409 | Ga0224572_1002087 | |||
| 1410 | Ga0207653_10017017 | |||
| 1411 | Ga0207692_10000678 | |||
| 1412 | Ga0207692_10000889 | |||
| 1413 | Ga0207692_10004462 | |||
| 1414 | Ga0207692_10026141 | |||
| 1415 | Ga0207692_10077385 | |||
| 1416 | Ga0207692_10087266 | |||
| 1417 | Ga0207692_10097273 | |||
| 1418 | Ga0207692_10254748 | |||
| 1419 | Ga0207642_10000231 | |||
| 1420 | Ga0207642_10028634 | |||
| 1421 | Ga0207642_10030983 | |||
| 1422 | Ga0207710_10000153 | |||
| 1423 | Ga0207710_10007850 | |||
| 1424 | Ga0207710_10055404 | |||
| 1425 | Ga0207688_10003373 | |||
| 1426 | Ga0207688_10003437 | |||
| 1427 | Ga0207688_10005363 | |||
| 1428 | Ga0207688_10010533 | |||
| 1429 | Ga0207688_10028536 | |||
| 1430 | Ga0207688_10084926 | |||
| 1431 | Ga0207680_10163742 | |||
| 1432 | Ga0207647_10007734 | |||
| 1433 | Ga0207647_10031359 | |||
| 1434 | Ga0207647_10071882 | |||
| 1435 | Ga0207685_10023232 | |||
| 1436 | Ga0207685_10034954 | |||
| 1437 | Ga0207685_10036183 | |||
| 1438 | Ga0207685_10129877 | |||
| 1439 | Ga0207699_10000205 | |||
| 1440 | Ga0207699_10002986 | |||
| 1441 | Ga0207699_10012801 | |||
| 1442 | Ga0207699_10027176 | |||
| 1443 | Ga0207699_10033147 | |||
| 1444 | Ga0207699_10136811 | |||
| 1445 | Ga0207699_10142157 | |||
| 1446 | Ga0207699_10330717 | |||
| 1447 | Ga0207645_10036125 | |||
| 1448 | Ga0207645_10112267 | |||
| 1449 | Ga0207643_10001272 | |||
| 1450 | Ga0207684_10057381 | |||
| 1451 | Ga0207684_10487879 | |||
| 1452 | Ga0207654_10025312 | |||
| 1453 | Ga0207654_10098494 | |||
| 1454 | Ga0207671_10015516 | |||
| 1455 | Ga0207671_10263383 | |||
| 1456 | Ga0207671_10707001 | |||
| 1457 | Ga0207693_10000355 | |||
| 1458 | Ga0207693_10002200 | |||
| 1459 | Ga0207693_10006667 | |||
| 1460 | Ga0207693_10008293 | |||
| 1461 | Ga0207693_10008945 | |||
| 1462 | Ga0207693_10027108 | |||
| 1463 | Ga0207693_10079956 | |||
| 1464 | Ga0207693_10092279 | |||
| 1465 | Ga0207693_10100871 | |||
| 1466 | Ga0207693_10235819 | |||
| 1467 | Ga0207693_10341396 | |||
| 1468 | Ga0207663_10004333 | |||
| 1469 | Ga0207663_10012575 | |||
| 1470 | Ga0207663_10013199 | |||
| 1471 | Ga0207663_10020576 | |||
| 1472 | Ga0207663_10027871 | |||
| 1473 | Ga0207663_10028380 | |||
| 1474 | Ga0207663_10046506 | |||
| 1475 | Ga0207663_10057636 | |||
| 1476 | Ga0207663_10116797 | |||
| 1477 | Ga0207660_10352138 | |||
| 1478 | Ga0207662_10025722 | |||
| 1479 | Ga0207662_10310882 | |||
| 1480 | Ga0207657_10191457 | |||
| 1481 | Ga0207657_10194640 | |||
| 1482 | Ga0207649_10694601 | |||
| 1483 | Ga0207646_10010946 | |||
| 1484 | Ga0207646_10053722 | |||
| 1485 | Ga0207646_10076070 | |||
| 1486 | Ga0207646_10112214 | |||
| 1487 | Ga0207646_10213347 | |||
| 1488 | Ga0207646_10351443 | |||
| 1489 | Ga0207646_10654147 | |||
| 1490 | Ga0207681_10000615 | |||
| 1491 | Ga0207681_10007134 | |||
| 1492 | Ga0207681_10370496 | |||
| 1493 | Ga0207681_10384161 | |||
| 1494 | Ga0207650_10734643 | |||
| 1495 | Ga0207687_10001302 | |||
| 1496 | Ga0207687_10037386 | |||
| 1497 | Ga0207687_10057611 | |||
| 1498 | Ga0207687_10062671 | |||
| 1499 | Ga0207687_10082234 | |||
| 1500 | Ga0207687_10113333 | |||
| 1501 | Ga0207687_10755419 | |||
| 1502 | Ga0207700_10000171 | |||
| 1503 | Ga0207700_10047773 | |||
| 1504 | Ga0207700_10050731 | |||
| 1505 | Ga0207700_10057550 | |||
| 1506 | Ga0207700_10108780 | |||
| 1507 | Ga0207700_10118770 | |||
| 1508 | Ga0207700_10179637 | |||
| 1509 | Ga0207700_10212207 | |||
| 1510 | Ga0207700_10589015 | |||
| 1511 | Ga0207664_10001768 | |||
| 1512 | Ga0207664_10014960 | |||
| 1513 | Ga0207664_10021138 | |||
| 1514 | Ga0207664_10035023 | |||
| 1515 | Ga0207664_10041588 | |||
| 1516 | Ga0207664_10044912 | |||
| 1517 | Ga0207664_10054296 | |||
| 1518 | Ga0207664_10060648 | |||
| 1519 | Ga0207664_10080310 | |||
| 1520 | Ga0207664_10105222 | |||
| 1521 | Ga0207664_10377789 | |||
| 1522 | Ga0207644_10331031 | |||
| 1523 | Ga0207644_10415168 | |||
| 1524 | Ga0207690_10040271 | |||
| 1525 | Ga0207690_10218791 | |||
| 1526 | Ga0207706_10006718 | |||
| 1527 | Ga0207706_10027319 | |||
| 1528 | Ga0207706_10041447 | |||
| 1529 | Ga0207706_10044707 | |||
| 1530 | Ga0207686_10008241 | |||
| 1531 | Ga0207686_10178073 | |||
| 1532 | Ga0207709_10002257 | |||
| 1533 | Ga0207709_10163190 | |||
| 1534 | Ga0207709_10206561 | |||
| 1535 | Ga0207670_10133049 | |||
| 1536 | Ga0207669_10057151 | |||
| 1537 | Ga0207669_10063093 | |||
| 1538 | Ga0207669_10454445 | |||
| 1539 | Ga0207704_10001019 | |||
| 1540 | Ga0207704_10206690 | |||
| 1541 | Ga0207704_10217541 | |||
| 1542 | Ga0207665_10001616 | |||
| 1543 | Ga0207665_10004106 | |||
| 1544 | Ga0207665_10004322 | |||
| 1545 | Ga0207665_10017844 | |||
| 1546 | Ga0207665_10030413 | |||
| 1547 | Ga0207665_10040916 | |||
| 1548 | Ga0207665_10110673 | |||
| 1549 | Ga0207691_10005983 | |||
| 1550 | Ga0207691_10063467 | |||
| 1551 | Ga0207711_10001535 | |||
| 1552 | Ga0207711_10012911 | |||
| 1553 | Ga0207711_10410687 | |||
| 1554 | Ga0207689_10001836 | |||
| 1555 | Ga0207689_10003085 | |||
| 1556 | Ga0207689_10009603 | |||
| 1557 | Ga0207689_10079292 | |||
| 1558 | Ga0207661_10085125 | |||
| 1559 | Ga0207661_10476611 | |||
| 1560 | Ga0207651_10132741 | |||
| 1561 | Ga0207651_10212092 | |||
| 1562 | Ga0207712_10000042 | |||
| 1563 | Ga0207712_10003564 | |||
| 1564 | Ga0207712_10100331 | |||
| 1565 | Ga0207712_10187069 | |||
| 1566 | Ga0207712_10197764 | |||
| 1567 | Ga0207668_10001287 | |||
| 1568 | Ga0207668_10011615 | |||
| 1569 | Ga0207668_10212358 | |||
| 1570 | Ga0207668_10288767 | |||
| 1571 | Ga0207640_10012123 | |||
| 1572 | Ga0207640_10069835 | |||
| 1573 | Ga0207658_10000377 | |||
| 1574 | Ga0207658_10001454 | |||
| 1575 | Ga0207658_10006137 | |||
| 1576 | Ga0207658_10201140 | |||
| 1577 | Ga0207658_10336987 | |||
| 1578 | Ga0207677_10000670 | |||
| 1579 | Ga0207677_10035276 | |||
| 1580 | Ga0207677_10084246 | |||
| 1581 | Ga0207677_10665922 | |||
| 1582 | Ga0207703_10004329 | |||
| 1583 | Ga0207703_10005964 | |||
| 1584 | Ga0207703_10047195 | |||
| 1585 | Ga0207703_10190521 | |||
| 1586 | Ga0207639_10024650 | |||
| 1587 | Ga0207678_10005601 | |||
| 1588 | Ga0207678_10010855 | |||
| 1589 | Ga0207678_10013818 | |||
| 1590 | Ga0207678_10176415 | |||
| 1591 | Ga0207708_10003270 | |||
| 1592 | Ga0207708_10011001 | |||
| 1593 | Ga0207708_10028032 | |||
| 1594 | Ga0207708_10072259 | |||
| 1595 | Ga0207702_10072036 | |||
| 1596 | Ga0207702_10192978 | |||
| 1597 | Ga0207702_10260053 | |||
| 1598 | Ga0207641_10001215 | |||
| 1599 | Ga0207641_10008290 | |||
| 1600 | Ga0207641_10032028 | |||
| 1601 | Ga0207641_10051429 | |||
| 1602 | Ga0207641_10198841 | |||
| 1603 | Ga0207648_10000671 | |||
| 1604 | Ga0207648_10035258 | |||
| 1605 | Ga0207648_10309793 | |||
| 1606 | Ga0207676_10074756 | |||
| 1607 | Ga0207676_10296180 | |||
| 1608 | Ga0207676_10374935 | |||
| 1609 | Ga0207674_10161727 | |||
| 1610 | Ga0207674_10394680 | |||
| 1611 | Ga0207675_100000388 | |||
| 1612 | Ga0207675_100019325 | |||
| 1613 | Ga0207675_100120596 | |||
| 1614 | Ga0207683_10006709 | |||
| 1615 | Ga0207683_10006989 | |||
| 1616 | Ga0207683_10086132 | |||
| 1617 | Ga0207683_10236611 | |||
| 1618 | Ga0207698_10053929 | |||
| 1619 | Ga0207698_10127881 | |||
| 1620 | Ga0207698_10530574 | |||
| 1621 | Ga0268266_10013359 | |||
| 1622 | Ga0268266_10021397 | |||
| 1623 | Ga0268266_10035706 | |||
| 1624 | Ga0268265_10000051 | |||
| 1625 | Ga0268265_10022066 | |||
| 1626 | Ga0268265_10098077 | |||
| 1627 | Ga0268265_10153781 | |||
| 1628 | Ga0268265_10334430 | |||
| 1629 | Ga0268265_10608311 | |||
| 1630 | Ga0268264_10000108 | |||
| 1631 | Ga0268264_10091040 | |||
| 1632 | Ga0265327_10011353 | |||
| 1633 | Ga0307513_10045574 | |||
| 1634 | Ga0307513_10226026 | |||
| 1635 | Ga0307408_100031410 | |||
| 1636 | Ga0307408_100409066 | |||
| 1637 | Ga0307405_10056800 | |||
| 1638 | Ga0307405_10072792 | |||
| 1639 | Ga0307413_10064657 | |||
| 1640 | Ga0307413_10141922 | |||
| 1641 | Ga0307410_10045488 | |||
| 1642 | Ga0307410_10124108 | |||
| 1643 | Ga0307406_10023171 | |||
| 1644 | Ga0307407_10465665 | |||
| 1645 | Ga0307412_10009683 | |||
| 1646 | Ga0307412_10250032 | |||
| 1647 | Ga0307409_100004802 | |||
| 1648 | Ga0307416_100006312 | |||
| 1649 | Ga0307416_100288254 | |||
| 1650 | Ga0307416_100947558 | |||
| 1651 | Ga0307414_10161705 | |||
| 1652 | Ga0307411_10127113 | |||
| 1653 | Ga0307411_10365507 | |||
| 1654 | Ga0307415_100019600 | |||
| 1655 | Ga0307415_100041593 | |||
| 1656 | Ga0307415_100079663 | |||
| 1657 | Ga0373950_0024350 | |||
| 1658 | Ga0373926_0003753 | |||
| 1659 | Ga0373926_0047736 | |||
| 1660 | Ga0373928_0033975 | |||
| 1661 | Ga0373929_0029965 | |||
| 1662 | Ga0373934_0019071 | |||
| 1663 | Ga0373934_0073268 | |||
| 1664 | Ga0373940_0017273 | |||
| 1665 | Ga0373944_0005556 | |||
| 1666 | Ga0373923_0010842 | |||
| 1667 | Ga0373923_0035279 | |||
| 1668 | Ga0373923_0159153 | |||
| 1669 | Ga0373932_0063305 | |||
| 1670 | Ga0373936_0007284 | |||
| 1671 | Ga0373939_0003646 | |||
| 1672 | Ga0373945_0006316 | |||
| 1673 | Ga0373953_0015691 | |||
| 1674 | Ga0373953_0129371 | |||
| 1675 | Ga0373956_0020753 | |||
| 1676 | Ga0373957_0018421 | |||
| 1677 | Ga0373957_0065598 | |||
| 1678 | Ga0373943_0000792 | |||
| 1679 | Ga0373943_0174365 | |||
| 1680 | Ga0373946_0000743 | |||
| 1681 | Ga0373946_0064031 | |||
| 1682 | Ga0373955_0010188 | |||
| 1683 | Ga0373955_0021302 | |||
| 1684 | Ga0373955_0152074 | |||
| 1685 | Ga0373962_0059804 | |||
| 1686 | Ga0373924_0060383 | |||
| 1687 | Ga0373931_0011349 | |||
| 1688 | Ga0373931_0131659 | |||
| 1689 | Ga0373931_0138039 | |||
| 1690 | Ga0373931_0267841 | |||
| 1691 | Ga0373935_0004837 | |||
| 1692 | Ga0373935_0083939 | |||
| 1693 | Ga0373935_0125177 | |||
| 1694 | Ga0373927_0005172 | |||
| 1695 | Ga0373933_0017926 | |||
| 1696 | Ga0373933_0044510 | |||
| 1697 | Ga0373947_0005102 | |||
| 1698 | Ga0373937_0018158 | |||
| 1699 | Ga0373937_0026771 | |||
| 1700 | Ga0373937_0255278 | |||
| 1701 | Ga0373925_0003276 | |||
| 1702 | Ga0373925_0135900 | |||
| 1703 | Ga0373925_0573789 | |||
| 1704 | Ga0395899_0033538 | |||
| 1705 | Ga0395900_0006143 | |||
| 1706 | Ga0395900_0029126 | |||
| 1707 | Ga0395900_0094100 | |||
| 1708 | Ga0395900_0143943 | |||
| 1709 | Ga0395898_0653047 | |||
| 1710 | Ga0395898_1045153 | |||
| 1711 | Ga0395905_0019411 | |||
| 1712 | Ga0395905_0812078 | |||
| 1713 | Ga0436364_0280192 | |||
| 1714 | Ga0436364_0563277 | |||
| 1715 | Ga0436364_0707129 | |||
| 1716 | Ga0436364_0900715 | |||
| 1717 | Ga0395901_0002571 | |||
| 1718 | Ga0395901_0155900 | |||
| 1719 | Ga0395901_0272469 | |||
| 1720 | Ga0436363_0833973 | |||
| 1721 | Ga0436362_0856774 | |||
| 1722 | Ga0439461_0002411 | |||
| 1723 | Ga0439466_0011732 | |||
| 1724 | Ga0439466_0012636 | |||
| 1725 | Ga0439466_0099318 | |||
| 1726 | Ga0439465_0004694 | |||
| 1727 | Ga0439465_0005800 | |||
| 1728 | Ga0439465_0046231 | |||
| 1729 | Ga0451837_0445302 | |||
| 1730 | Ga0439431_0022379 | |||
| 1731 | Ga0439431_0034190 | |||
| 1732 | Ga0439442_027703 | |||
| 1733 | Ga0439445_0005864 | |||
| 1734 | Ga0439448_0015918 | |||
| 1735 | Ga0439448_0104706 | |||
| 1736 | Ga0439450_054337 | |||
| 1737 | Ga0439451_018400 | |||
| 1738 | Ga0439454_007151 | |||
| 1739 | Ga0439455_0018222 | |||
| 1740 | Ga0439463_012673 | |||
| 1741 | Ga0439463_041305 | |||
| 1742 | Ga0439463_046496 | |||
| 1743 | Ga0439463_062357 | |||
| 1744 | Ga0450902_021180 | |||
| 1745 | Ga0450910_043965 | |||
| 1746 | Ga0439434_0045819 | |||
| 1747 | Ga0439444_0008585 | |||
| 1748 | Ga0439464_0015335 | |||
| 1749 | Ga0439464_0028315 | |||
| 1750 | Ga0439460_0068431 | |||
| 1751 | Ga0466972_0051121 | |||
| 1752 | Ga0466972_0136600 | |||
| 1753 | Ga0466972_0148245 | |||
| 1754 | Ga0466965_0008107 | |||
| 1755 | Ga0466965_0073507 | |||
| 1756 | Ga0466965_0088331 | |||
| 1757 | Ga0466966_0076967 | |||
| 1758 | Ga0466966_0083159 | |||
| 1759 | Ga0466961_0002733 | |||
| 1760 | Ga0466961_0077260 | |||
| 1761 | Ga0466968_0013935 | |||
| 1762 | Ga0466968_0036733 | |||
| 1763 | Ga0466970_0045395 | |||
| 1764 | Ga0466970_0054011 | |||
| 1765 | Ga0466970_0072757 | |||
| 1766 | Ga0466970_0076952 | |||
| 1767 | Ga0466957_0012179 | |||
| 1768 | Ga0466957_0022295 | |||
| 1769 | Ga0466957_0176516 | |||
| 1770 | Ga0466960_0000113 | |||
| 1771 | Ga0466960_0021687 | |||
| 1772 | Ga0466960_0171124 | |||
| 1773 | Ga0466960_0172022 | |||
| 1774 | Ga0466959_0004571 | |||
| 1775 | Ga0466959_0006274 | |||
| 1776 | Ga0466959_0010862 | |||
| 1777 | Ga0466959_0200347 | |||
| 1778 | Ga0466958_0109914 | |||
| 1779 | Ga0466958_0115277 | |||
| 1780 | Ga0466958_0330364 | |||
| 1781 | Ga0466967_0117224 | |||
| 1782 | Ga0495592_0122873 | |||
| 1783 | Ga0495592_0163625 | |||
| 1784 | Ga0495603_0433663 | |||
| 1785 | Ga0495638_0000446 | |||
| 1786 | Ga0495641_0041566 | |||
| 1787 | Ga0495641_0155630 | |||
| 1788 | Ga0495651_0020376 | |||
| 1789 | Ga0495651_0042965 | |||
| 1790 | Ga0495651_0062515 | |||
| 1791 | Ga0495651_0159977 | |||
| 1792 | Ga0495653_0012013 | |||
| 1793 | Ga0495653_0028807 | |||
| 1794 | Ga0495580_0302318 | |||
| 1795 | Ga0495582_0144865 | |||
| 1796 | Ga0495664_0002773 | |||
| 1797 | Ga0495664_0050945 | |||
| 1798 | Ga0495596_0121585 | |||
| 1799 | Ga0495608_0028095 | |||
| 1800 | Ga0495608_0072530 | |||
| 1801 | Ga0495618_0024728 | |||
| 1802 | Ga0495618_0042412 | |||
| 1803 | Ga0495618_0156086 | |||
| 1804 | Ga0495628_0058918 | |||
| 1805 | Ga0495628_0080519 | |||
| 1806 | Ga0495628_0133166 | |||
| 1807 | Ga0495628_0221016 | |||
| 1808 | Ga0495630_0027453 | |||
| 1809 | Ga0495630_0251156 | |||
| 1810 | Ga0495630_0643041 | |||
| 1811 | Ga0495644_0074041 | |||
| 1812 | Ga0495652_0050156 | |||
| 1813 | Ga0495652_0052635 | |||
| 1814 | Ga0495654_0197639 | |||
| 1815 | Ga0495665_0002954 | |||
| 1816 | Ga0495665_0003630 | |||
| 1817 | Ga0495640_0085787 | |||
| 1818 | Ga0495587_0040206 | |||
| 1819 | Ga0495587_0053611 | |||
| 1820 | Ga0495645_0100297 | |||
| 1821 | Ga0495645_0116450 | |||
| 1822 | Ga0495645_0420540 | |||
| 1823 | Ga0495667_0005958 | |||
| 1824 | Ga0495667_0010235 | |||
| 1825 | Ga0495667_0031038 | |||
| 1826 | Ga0495667_0116483 | |||
| 1827 | Ga0495634_0028024 | |||
| 1828 | Ga0495634_0207242 | |||
| 1829 | Ga0495634_0215788 | |||
| 1830 | Ga0495625_0273930 | |||
| 1831 | Ga0495635_0001859 | |||
| 1832 | Ga0495635_0019489 | |||
| 1833 | Ga0495635_0029558 | |||
| 1834 | Ga0495635_0034826 | |||
| 1835 | Ga0495657_0009701 | |||
| 1836 | Ga0495657_0043596 | |||
| 1837 | Ga0495657_0084786 | |||
| 1838 | Ga0495599_0052805 | |||
| 1839 | Ga0495599_0061181 | |||
| 1840 | Ga0495623_0108871 | |||
| 1841 | Ga0495613_0155784 | |||
| 1842 | Ga0495624_0002363 | |||
| 1843 | Ga0495600_0219197 | |||
| 1844 | Ga0495600_0225025 | |||
| 1845 | Ga0495581_0020267 | |||
| 1846 | Ga0495581_0085238 | |||
| 1847 | Ga0495604_0107154 | |||
| 1848 | Ga0495604_0220813 | |||
| 1849 | Ga0495674_0001119 | |||
| 1850 | Ga0495674_0028758 | |||
| 1851 | Ga0495674_0524890 | |||
| 1852 | Ga0495672_0012959 | |||
| 1853 | Ga0495672_0015435 | |||
| 1854 | Ga0495672_0207443 | |||
| 1855 | Ga0495676_0052512 | |||
| 1856 | Ga0495680_0050452 | |||
| 1857 | Ga0495680_0053811 | |||
| 1858 | Ga0495675_0039590 | |||
| 1859 | Ga0495675_0060719 | |||
| 1860 | Ga0495673_0000640 | |||
| 1861 | Ga0495684_0002878 | |||
| 1862 | Ga0495684_0020977 | |||
| 1863 | Ga0495684_0045583 | |||
| 1864 | Ga0495593_0399587 | |||
| 1865 | Ga0495602_0164985 | |||
| 1866 | Ga0496100_0001433 | |||
| 1867 | Ga0496100_0024697 | |||
| 1868 | Ga0496100_0084433 | |||
| 1869 | Ga0496100_0131253 | |||
| 1870 | Ga0496100_0166764 | |||
| 1871 | Ga0496101_0000878 | |||
| 1872 | Ga0496101_0004040 | |||
| 1873 | Ga0496101_0004844 | |||
| 1874 | Ga0496101_0018373 | |||
| 1875 | Ga0496102_0000131 | |||
| 1876 | Ga0496102_0009118 | |||
| 1877 | Ga0496102_0021846 | |||
| 1878 | Ga0496102_0051939 | |||
| 1879 | Ga0496102_0188374 | |||
| 1880 | Ga0496102_0257849 | |||
| 1881 | Ga0496102_0320987 | |||
| 1882 | Ga0496102_0488419 | |||
| 1883 | Ga0496103_0000584 | |||
| 1884 | Ga0496103_0000859 | |||
| 1885 | Ga0496103_0024140 | |||
| 1886 | Ga0496103_0063151 | |||
| 1887 | Ga0496103_0094575 | |||
| 1888 | Ga0496103_0156845 | |||
| 1889 | Ga0496103_0270566 | |||
| 1890 | Ga0496103_0348169 | |||
| 1891 | Ga0496104_0002120 | |||
| 1892 | Ga0496104_0006446 | |||
| 1893 | Ga0496104_0030846 | |||
| 1894 | Ga0496104_0041539 | |||
| 1895 | Ga0496104_0060438 | |||
| 1896 | Ga0496104_0122217 | |||
| 1897 | Ga0496104_0157959 | |||
| 1898 | Ga0496104_0295543 | |||
| 1899 | Ga0496104_0401072 | |||
| 1900 | Ga0496105_0006239 | |||
| 1901 | Ga0496105_0017484 | |||
| 1902 | Ga0496105_0018109 | |||
| 1903 | Ga0496105_0045646 | |||
| 1904 | Ga0496105_0308435 | |||
| 1905 | Ga0496106_0000264 | |||
| 1906 | Ga0496106_0079176 | |||
| 1907 | Ga0496106_0200729 | |||
| 1908 | Ga0496106_0245935 | |||
| 1909 | Ga0496106_0246570 | |||
| 1910 | Ga0496106_0313844 | |||
| 1911 | Ga0496106_0940860 | |||
| 1912 | Ga0496107_0002087 | |||
| 1913 | Ga0496107_0011379 | |||
| 1914 | Ga0496107_0028090 | |||
| 1915 | Ga0496107_0035884 | |||
| 1916 | Ga0496107_0110024 | |||
| 1917 | Ga0496107_0192125 | |||
| 1918 | Ga0496108_0000246 | |||
| 1919 | Ga0496108_0004292 | |||
| 1920 | Ga0496108_0042719 | |||
| 1921 | Ga0496108_0096422 | |||
| 1922 | Ga0496108_0100491 | |||
| 1923 | Ga0496108_0182188 | |||
| 1924 | Ga0496108_0198094 | |||
| 1925 | Ga0496108_0236291 | |||
| 1926 | Ga0496109_0004032 | |||
| 1927 | Ga0496109_0005253 | |||
| 1928 | Ga0496109_0038359 | |||
| 1929 | Ga0496109_0038784 | |||
| 1930 | Ga0496109_0086397 | |||
| 1931 | Ga0496109_0129500 | |||
| 1932 | Ga0496109_0178112 | |||
| 1933 | Ga0496109_0409943 | |||
| 1934 | Ga0496109_0678687 | |||
| 1935 | Ga0496109_0761813 | |||
| 1936 | Ga0496110_0021997 | |||
| 1937 | Ga0496110_0023699 | |||
| 1938 | Ga0496110_0024081 | |||
| 1939 | Ga0496110_0124483 | |||
| 1940 | Ga0496110_0160975 | |||
| 1941 | Ga0496110_0196799 | |||
| 1942 | Ga0496110_0360661 | |||
| 1943 | Ga0496111_0014763 | |||
| 1944 | Ga0496111_0028674 | |||
| 1945 | Ga0496111_0053090 | |||
| 1946 | Ga0496111_0169926 | |||
| 1947 | Ga0496111_0254065 | |||
| 1948 | Ga0496111_0285548 | |||
| 1949 | Ga0496112_0008267 | |||
| 1950 | Ga0496112_0031603 | |||
| 1951 | Ga0496112_0058709 | |||
| 1952 | Ga0496112_0145847 | |||
| 1953 | Ga0496112_0221222 | |||
| 1954 | Ga0496112_0690967 | |||
| 1955 | Ga0496112_0815583 | |||
| 1956 | Ga0496112_0838482 | |||
| 1957 | Ga0496113_0015679 | |||
| 1958 | Ga0496113_0016219 | |||
| 1959 | Ga0496113_0396777 | |||
| 1960 | Ga0496114_0006511 | |||
| 1961 | Ga0496114_0050846 | |||
| 1962 | Ga0496114_0088884 | |||
| 1963 | Ga0496114_0103965 | |||
| 1964 | Ga0496114_0312675 | |||
| 1965 | Ga0496114_0488034 | |||
| 1966 | Ga0496115_0002052 | |||
| 1967 | Ga0496115_0002133 | |||
| 1968 | Ga0496115_0013228 | |||
| 1969 | Ga0496115_0087064 | |||
| 1970 | Ga0496115_0113465 | |||
| 1971 | Ga0496115_0186352 | |||
| 1972 | Ga0496115_0277232 | |||
| 1973 | Ga0496115_0277607 | |||
| 1974 | Ga0496115_0592942 | |||
| 1975 | Ga0496116_0002121 | |||
| 1976 | Ga0496117_0002770 | |||
| 1977 | Ga0496118_0002961 | |||
| 1978 | Ga0496120_0007762 | |||
| 1979 | Ga0496121_0010397 | |||
| 1980 | Ga0496126_0005120 | |||
| 1981 | Ga0496126_0033996 | |||
| 1982 | Ga0496126_0040721 | |||
| 1983 | Ga0496126_0057471 | |||
| 1984 | Ga0501032_0001494 | |||
| 1985 | Ga0501034_0016345 | |||
| 1986 | Ga0501034_0020028 | |||
| 1987 | Ga0501036_0007823 | |||
| 1988 | Ga0501037_0000711 | |||
| 1989 | Ga0501038_0000982 | |||
| 1990 | Ga0501038_0060667 | |||
| 1991 | Ga0501039_0000266 | |||
| 1992 | Ga0501039_0055849 | |||
| 1993 | Ga0501043_0000776 | |||
| 1994 | Ga0501043_0106925 | |||
| 1995 | Ga0501070_0001392 | |||
| 1996 | Ga0501077_0091838 | |||
| 1997 | Ga0501035_0086346 | |||
| 1998 | Ga0501044_0045334 | |||
| 1999 | Ga0501044_0125488 | |||
| 2000 | nmdc:mga00v17_1052_c1 | |||
| 2001 | nmdc:mga00v17_25637_c1 | |||
| 2002 | nmdc:mga00v17_353907_c1 | |||
| 2003 | nmdc:mga0yw44_185007_c1 | |||
| 2004 | nmdc:mga0yw44_340609_c1 | |||
| 2005 | nmdc:mga05p37_10381_c1 | |||
| 2006 | nmdc:mga05p37_81024_c1 | |||
| 2007 | nmdc:mga05p37_900249_c1 | |||
| 2008 | nmdc:mga0qj67_4056_c2 | |||
| 2009 | nmdc:mga0qj67_42026_c1 | |||
| 2010 | nmdc:mga06r32_11739_c1 | |||
| 2011 | nmdc:mga06r32_162452_c1 | |||
| 2012 | nmdc:mga08y16_137477_c1 | |||
| 2013 | nmdc:mga0n895_115915_c1 | |||
| 2014 | nmdc:mga0n895_180649_c1 | |||
| 2015 | nmdc:mga0rr50_626104_c1 | |||
| 2016 | nmdc:mga08x19_472159_c1 | |||
| 2017 | nmdc:mga08x19_715500_c1 | |||
| 2018 | nmdc:mga0sz30_14057_c1 | |||
| 2019 | nmdc:mga0sz30_36736_c1 | |||
| 2020 | nmdc:mga0sz30_4504_c1 | |||
| 2021 | nmdc:mga0sz30_91255_c1 | |||
| 2022 | Ga0495601_0044270 | |||
| 2023 | Ga0495601_0137338 | |||
| 2024 | Ga0500635_0064116 | |||
| 2025 | Ga0495619_0183079 | |||
| 2026 | Ga0500643_002451 | |||
| 2027 | Ga0500652_028231 | |||
| 2028 | Ga0500559_0099413 | |||
| 2029 | Ga0500604_0108565 | |||
| 2030 | Ga0500645_000004 | |||
| 2031 | Ga0500645_009385 | |||
| 2032 | Ga0466962_0083988 | |||
| 2033 | 2515853889 | |||
| 2034 | 2676473170 | |||
| 2035 | 2738703296 | |||
| 2036 | 2738890002 | |||
| 2037 | 2739329243 | |||
| 2038 | 2827631765 | |||
| 2039 | 2929216633 | |||
| 2040 | 2939585574 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7x1k-assembly1.cif.gz_B | crystal structure of the flagellar expression regulator degu from listeria monocytogenes | 0.9682 | 153 | 215 |
| 4qic-assembly1.cif.gz_A | co-crystal structure of anti-anti-sigma factor phyr complexed with anti-sigma factor nepr from bartonella quintana | 0.9535 | 3 | 76 |
| 7ve5-assembly1.cif.gz_B | c-terminal domain of vrar | 0.9535 | 153 | 215 |
| 4wsz-assembly1.cif.gz_A | crystal structure of the dna binding domains of wild type liar from e. faecalis | 0.9526 | 153 | 215 |
| 4wsz-assembly1.cif.gz_B | crystal structure of the dna binding domains of wild type liar from e. faecalis | 0.9524 | 153 | 215 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4hyeB02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9563 | 153 | 216 | 1.10.10.10 |
| af_P06993_830_894_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9486 | 153 | 217 | 1.10.10.10 |
| 4qicC02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9462 | 5 | 76 | 3.40.50.2300 |
| af_O69730_8_88_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9458 | 4 | 87 | 3.40.50.2300 |
| 4if4B02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9446 | 153 | 215 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I2SCA5-F1-model_v4 | Response regulator receiver domain-containing protein | 0.9893 | 3 | 136 |
GO:0000160
GO:0003677 |
| AF-A0A538JGH7-F1-model_v4 | Response regulator | 0.9835 | 1 | 134 |
GO:0000160
GO:0004016 GO:0009190 |
| AF-A9WTE0-F1-model_v4 | Two-component response regulator | 0.983 | 1 | 92 |
GO:0000160
|
| AF-A0A260LY16-F1-model_v4 | Response regulatory domain-containing protein | 0.9804 | 1 | 89 |
GO:0000160
GO:0003677 |
| AF-A0A7Y5X430-F1-model_v4 | Response regulator | 0.9795 | 3 | 142 |
GO:0000160
GO:0004016 GO:0009190 |