F488419

General Info

Members Datasets Scaffolds Average Seq Length
1022 381 2040 221

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_0523085|Ga0436360_0523085_386_1141
Length 227
Sequence MATGADSMGGTMEPVSAKPISVVVAEDDVLLREGLASLLAREGFDVVGQAGDGAGLVELAREHRPDLVLVDIRMPPSHTTEGLDAARVIRAESPGTGIVVLSAYVDVEHAMETLDHVASGGSMVDPALVRELVAAQRKDDPLGELSEREREVLALMAEGRSNAGIAHRLWVTEGTVEKHVSSILSKLTLDASADDHRRVLAVITFLQTLSSGSGTARSPLPTDRTSR

Samples

Sample ID Description Type Environment
1 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
83 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
104 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
105 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
119 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
120 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
121 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
131 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
132 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
133 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
139 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
141 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
202 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
203 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
204 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
205 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
206 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
207 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
208 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
209 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
210 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
215 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
216 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
217 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
218 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
219 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
220 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
221 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
222 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
224 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
225 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
226 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
227 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
228 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
229 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
230 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
231 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
232 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
233 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
234 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
235 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
236 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
237 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
238 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
239 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
240 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
243 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
244 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
245 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
246 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
247 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
248 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
249 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
250 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
251 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
252 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
253 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
254 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
255 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
256 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
257 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
258 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
259 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
260 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
261 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
262 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
263 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
264 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
265 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
266 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
267 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
268 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
269 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
270 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
271 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
272 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
273 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
274 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
275 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
276 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
277 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
278 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
279 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
280 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
281 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
282 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
283 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
284 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
285 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
286 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
287 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
288 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
289 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
290 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
291 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
292 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
293 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
294 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
295 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
296 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
297 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
298 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
299 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
300 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
301 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
302 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
303 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
304 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
305 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
306 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
307 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
308 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
309 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
310 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
311 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
312 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
313 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
314 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
315 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
316 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
317 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
318 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
319 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
320 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
321 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
322 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
323 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
324 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
325 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
326 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
327 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
328 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
329 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
330 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
331 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
332 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
333 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
334 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
335 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
336 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
337 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
338 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
339 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
340 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
341 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
342 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
343 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
344 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
352 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
353 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
355 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
356 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
357 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
358 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
359 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
360 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
361 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
362 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
363 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
364 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
365 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
366 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
367 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
368 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
369 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
370 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
371 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
372 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
373 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
374 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
375 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
376 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
377 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
378 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
379 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
380 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
381 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0.2
Isolates 0.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.15
Nodule 0
Rhizoplane 10.67
Rhizosphere 84.93
Stem 0
Stem Tuber 0
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436360_0523085 3300039438 Bacteria 1609
2 LJNas_1001704 3300000546 Bacteria 2970
3 JGI24746J21847_1006939 3300001977 Bacteria 1740
4 JGI24737J22298_10080820 3300001990 Bacteria 967
5 JGI24743J22301_10005600 3300001991 Bacteria 2102
6 JGI24750J21931_1006453 3300002070 Bacteria 1460
7 JGI24745J21846_1014373 3300002073 Bacteria 916
8 JGI24748J21848_1002589 3300002074 Bacteria 2048
9 JGI24749J21850_1004724 3300002076 Bacteria 1907
10 JGI24744J21845_10001665 3300002077 Bacteria 4443
11 JGI24744J21845_10002839 3300002077 Bacteria 3538
12 JGI24742J22300_10000089 3300002244 Bacteria 13351
13 JGI25407J50210_10035780 3300003373 Bacteria 1279
14 Ga0070658_10720726 3300005327 Bacteria 866
15 Ga0070676_10003176 3300005328 Bacteria 8512
16 Ga0070676_10161649 3300005328 Bacteria 1442
17 Ga0070683_100072651 3300005329 Bacteria 3211
18 Ga0070683_100743751 3300005329 Bacteria 939
19 Ga0070690_100007614 3300005330 Bacteria 6204
20 Ga0070690_100053018 3300005330 Bacteria 2593
21 Ga0070670_100241920 3300005331 Bacteria 1571
22 Ga0068869_100005345 3300005334 Bacteria 8075
23 Ga0068869_100007876 3300005334 Bacteria 6837
24 Ga0068869_100683287 3300005334 Bacteria 874
25 Ga0070666_10015031 3300005335 Bacteria 4933
26 Ga0070680_100169897 3300005336 Bacteria 1834
27 Ga0070682_100008251 3300005337 Bacteria 5874
28 Ga0070682_100086754 3300005337 Bacteria 2039
29 Ga0070682_100101568 3300005337 Bacteria 1899
30 Ga0070682_100407004 3300005337 Bacteria 1031
31 Ga0070682_100423719 3300005337 Bacteria 1012
32 Ga0068868_100000483 3300005338 Bacteria 26462
33 Ga0068868_100061428 3300005338 Bacteria 2977
34 Ga0068868_100100357 3300005338 Bacteria 2342
35 Ga0068868_100187421 3300005338 Bacteria 1719
36 Ga0070660_100223097 3300005339 Bacteria 1532
37 Ga0070689_100026117 3300005340 Bacteria 4393
38 Ga0070689_100131863 3300005340 Bacteria 2004
39 Ga0070689_100191197 3300005340 Bacteria 1667
40 Ga0070691_10096120 3300005341 Bacteria 1466
41 Ga0070691_10171169 3300005341 Bacteria 1125
42 Ga0070687_100081954 3300005343 Bacteria 1763
43 Ga0070687_100517152 3300005343 Bacteria 806
44 Ga0070661_100016242 3300005344 Bacteria 5259
45 Ga0070692_10238053 3300005345 Bacteria 1084
46 Ga0070692_10504194 3300005345 Bacteria 785
47 Ga0070668_100000385 3300005347 Bacteria 29197
48 Ga0070668_100000558 3300005347 Bacteria 24900
49 Ga0070668_100076097 3300005347 Bacteria 2621
50 Ga0070668_100114492 3300005347 Bacteria 2149
51 Ga0070669_100000960 3300005353 Bacteria 21054
52 Ga0070669_100006266 3300005353 Bacteria 8584
53 Ga0070671_100006148 3300005355 Bacteria 9562
54 Ga0070671_100093668 3300005355 Bacteria 2517
55 Ga0070671_100217760 3300005355 Bacteria 1620
56 Ga0070674_100004720 3300005356 Bacteria 7799
57 Ga0070674_100008272 3300005356 Bacteria 6186
58 Ga0070674_100474068 3300005356 Bacteria 1037
59 Ga0070673_100058256 3300005364 Bacteria 3053
60 Ga0070688_100011279 3300005365 Bacteria 4963
61 Ga0070659_100005583 3300005366 Bacteria 9038
62 Ga0070659_100154297 3300005366 Bacteria 1874
63 Ga0070659_100665490 3300005366 Bacteria 898
64 Ga0070667_100001425 3300005367 Bacteria 21427
65 Ga0070667_100002282 3300005367 Bacteria 16878
66 Ga0070667_100025244 3300005367 Bacteria 4940
67 Ga0070667_100037980 3300005367 Bacteria 4038
68 Ga0070667_100166766 3300005367 Bacteria 1943
69 Ga0070667_100243518 3300005367 Bacteria 1606
70 Ga0070709_10006066 3300005434 Bacteria 6577
71 Ga0070709_10010319 3300005434 Bacteria 5168
72 Ga0070709_10016027 3300005434 Bacteria 4271
73 Ga0070709_10091419 3300005434 Bacteria 2008
74 Ga0070709_10265994 3300005434 Bacteria 1241
75 Ga0070714_100000805 3300005435 Bacteria 22198
76 Ga0070714_100005264 3300005435 Bacteria 9856
77 Ga0070714_100069064 3300005435 Bacteria 3050
78 Ga0070714_100118280 3300005435 Bacteria 2354
79 Ga0070714_100252388 3300005435 Bacteria 1631
80 Ga0070714_100342789 3300005435 Bacteria 1402
81 Ga0070714_100362049 3300005435 Bacteria 1364
82 Ga0070714_100436991 3300005435 Bacteria 1241
83 Ga0070713_100000392 3300005436 Bacteria 28109
84 Ga0070713_100002559 3300005436 Bacteria 11899
85 Ga0070713_100004531 3300005436 Bacteria 9358
86 Ga0070713_100042889 3300005436 Bacteria 3695
87 Ga0070713_100247106 3300005436 Bacteria 1626
88 Ga0070713_100487845 3300005436 Bacteria 1161
89 Ga0070713_100670914 3300005436 Bacteria 988
90 Ga0070713_100793720 3300005436 Bacteria 907
91 Ga0070713_100864539 3300005436 Bacteria 869
92 Ga0070713_100942154 3300005436 Bacteria 831
93 Ga0070710_10000240 3300005437 Bacteria 25768
94 Ga0070710_10001472 3300005437 Bacteria 11083
95 Ga0070710_10003905 3300005437 Bacteria 7061
96 Ga0070710_10006432 3300005437 Bacteria 5643
97 Ga0070710_10036292 3300005437 Bacteria 2694
98 Ga0070710_10064656 3300005437 Unclassified 2093
99 Ga0070710_10072604 3300005437 Bacteria 1987
100 Ga0070710_10077457 3300005437 Bacteria 1932
101 Ga0070701_10001759 3300005438 Bacteria 8164
102 Ga0070701_10056189 3300005438 Bacteria 2058
103 Ga0070701_10084515 3300005438 Bacteria 1726
104 Ga0070711_100000197 3300005439 Bacteria 31831
105 Ga0070711_100002538 3300005439 Bacteria 10445
106 Ga0070711_100013514 3300005439 Bacteria 5126
107 Ga0070711_100017712 3300005439 Bacteria 4539
108 Ga0070711_100021255 3300005439 Bacteria 4193
109 Ga0070711_100035400 3300005439 Bacteria 3338
110 Ga0070711_100037812 3300005439 Bacteria 3240
111 Ga0070711_100056451 3300005439 Bacteria 2715
112 Ga0070711_100070841 3300005439 Bacteria 2456
113 Ga0070711_100088588 3300005439 Bacteria 2224
114 Ga0070711_100197176 3300005439 Bacteria 1551
115 Ga0070711_100261492 3300005439 Bacteria 1362
116 Ga0070711_100336887 3300005439 Bacteria 1209
117 Ga0070705_100550294 3300005440 Bacteria 885
118 Ga0070700_100001630 3300005441 Bacteria 11220
119 Ga0070708_100035130 3300005445 Bacteria 4365
120 Ga0070708_100064357 3300005445 Bacteria 3285
121 Ga0070708_100259120 3300005445 Bacteria 1635
122 Ga0070708_100398519 3300005445 Bacteria 1298
123 Ga0070663_100008356 3300005455 Bacteria 6360
124 Ga0070663_100015423 3300005455 Bacteria 4932
125 Ga0070663_100072983 3300005455 Bacteria 2502
126 Ga0070663_100153793 3300005455 Bacteria 1766
127 Ga0070678_100039972 3300005456 Bacteria 3315
128 Ga0070662_100013356 3300005457 Bacteria 5465
129 Ga0070662_100024583 3300005457 Bacteria 4152
130 Ga0070662_100308937 3300005457 Bacteria 1287
131 Ga0070681_10100810 3300005458 Bacteria 2833
132 Ga0070681_10573554 3300005458 Bacteria 1042
133 Ga0068867_100002073 3300005459 Bacteria 14047
134 Ga0068867_100170907 3300005459 Bacteria 1721
135 Ga0068867_100209512 3300005459 Bacteria 1565
136 Ga0070685_10021109 3300005466 Bacteria 3536
137 Ga0070685_10038246 3300005466 Bacteria 2721
138 Ga0070685_10066726 3300005466 Bacteria 2121
139 Ga0070685_10131749 3300005466 Bacteria 1564
140 Ga0070706_100066559 3300005467 Bacteria 3332
141 Ga0070706_100072683 3300005467 Bacteria 3182
142 Ga0070706_100310021 3300005467 Bacteria 1472
143 Ga0070707_100072548 3300005468 Bacteria 3318
144 Ga0070707_100168156 3300005468 Bacteria 2137
145 Ga0070707_100258890 3300005468 Bacteria 1693
146 Ga0070707_100416688 3300005468 Bacteria 1303
147 Ga0070698_100026365 3300005471 Bacteria 6049
148 Ga0070698_100118676 3300005471 Bacteria 2606
149 Ga0070698_100492266 3300005471 Bacteria 1164
150 Ga0070698_100545338 3300005471 Bacteria 1099
151 Ga0070699_100095029 3300005518 Bacteria 2609
152 Ga0070679_100100988 3300005530 Bacteria 2871
153 Ga0070697_100052226 3300005536 Bacteria 3321
154 Ga0068853_100029215 3300005539 Bacteria 4645
155 Ga0068853_100135999 3300005539 Bacteria 2203
156 Ga0070672_100159837 3300005543 Bacteria 1868
157 Ga0070686_100160315 3300005544 Bacteria 1584
158 Ga0070686_100176158 3300005544 Bacteria 1516
159 Ga0070695_100025441 3300005545 Bacteria 3655
160 Ga0070695_100070423 3300005545 Bacteria 2288
161 Ga0070696_100016686 3300005546 Bacteria 4951
162 Ga0070696_100082778 3300005546 Bacteria 2275
163 Ga0070696_100265618 3300005546 Bacteria 1303
164 Ga0070693_100006772 3300005547 Bacteria 5565
165 Ga0070693_100059516 3300005547 Bacteria 2214
166 Ga0070693_100190642 3300005547 Bacteria 1325
167 Ga0070693_100330094 3300005547 Bacteria 1038
168 Ga0070665_100024629 3300005548 Bacteria 6065
169 Ga0070665_100030158 3300005548 Bacteria 5457
170 Ga0070665_100045778 3300005548 Bacteria 4394
171 Ga0070665_100049147 3300005548 Bacteria 4232
172 Ga0070665_100064333 3300005548 Bacteria 3678
173 Ga0070665_100102507 3300005548 Bacteria 2865
174 Ga0070665_100161578 3300005548 Bacteria 2242
175 Ga0070665_100323313 3300005548 Bacteria 1547
176 Ga0070704_100000219 3300005549 Bacteria 24091
177 Ga0070704_100122631 3300005549 Bacteria 2000
178 Ga0070704_100291480 3300005549 Bacteria 1356
179 Ga0068855_100414973 3300005563 Bacteria 1473
180 Ga0068857_100117496 3300005577 Bacteria 2393
181 Ga0068854_100524179 3300005578 Bacteria 1001
182 Ga0068856_100867339 3300005614 Bacteria 922
183 Ga0070702_100002876 3300005615 Bacteria 7564
184 Ga0070702_100099352 3300005615 Bacteria 1782
185 Ga0070702_100151373 3300005615 Bacteria 1489
186 Ga0068852_100094596 3300005616 Bacteria 2681
187 Ga0068852_100568448 3300005616 Bacteria 1135
188 Ga0068859_100004636 3300005617 Bacteria 14002
189 Ga0068859_100028702 3300005617 Bacteria 5579
190 Ga0068859_100075497 3300005617 Bacteria 3411
191 Ga0068859_100579726 3300005617 Bacteria 1215
192 Ga0068859_100768976 3300005617 Bacteria 1052
193 Ga0068864_100027786 3300005618 Bacteria 4781
194 Ga0068864_100563305 3300005618 Bacteria 1103
195 Ga0068864_101150187 3300005618 Bacteria 773
196 Ga0068866_10000870 3300005718 Bacteria 13343
197 Ga0068861_100002108 3300005719 Bacteria 12895
198 Ga0068861_100041041 3300005719 Bacteria 3464
199 Ga0068861_100079048 3300005719 Bacteria 2570
200 Ga0068851_10157067 3300005834 Bacteria 1247
201 Ga0068863_100001428 3300005841 Bacteria 23666
202 Ga0068863_100023450 3300005841 Bacteria 5893
203 Ga0068863_100067753 3300005841 Bacteria 3376
204 Ga0068863_100765393 3300005841 Bacteria 962
205 Ga0068858_100004100 3300005842 Bacteria 14351
206 Ga0068858_100051932 3300005842 Bacteria 3793
207 Ga0068858_100197757 3300005842 Bacteria 1900
208 Ga0068858_100913898 3300005842 Bacteria 858
209 Ga0068860_100002016 3300005843 Bacteria 21427
210 Ga0068860_100309536 3300005843 Bacteria 1549
211 Ga0068860_100596966 3300005843 Bacteria 1109
212 Ga0068860_100710674 3300005843 Bacteria 1015
213 Ga0068862_100000035 3300005844 Bacteria 174953
214 Ga0068862_100031914 3300005844 Bacteria 4449
215 Ga0068862_100146506 3300005844 Bacteria 2099
216 Ga0068862_100507602 3300005844 Bacteria 1145
217 Ga0081455_10018519 3300005937 Bacteria 6629
218 Ga0081455_10087009 3300005937 Bacteria 2544
219 Ga0081455_10228632 3300005937 Bacteria 1374
220 Ga0081455_10233712 3300005937 Bacteria 1355
221 Ga0081538_10007006 3300005981 Bacteria 9807
222 Ga0081538_10043959 3300005981 Bacteria 2795
223 Ga0081538_10045432 3300005981 Bacteria 2723
224 Ga0081540_1000009 3300005983 Bacteria 193562
225 Ga0081539_10000062 3300005985 Bacteria 249871
226 Ga0070717_10004522 3300006028 Bacteria 10050
227 Ga0070717_10051350 3300006028 Bacteria 3393
228 Ga0070717_10055216 3300006028 Bacteria 3276
229 Ga0070717_10059483 3300006028 Bacteria 3162
230 Ga0070717_10144573 3300006028 Bacteria 2053
231 Ga0070717_10280244 3300006028 Bacteria 1478
232 Ga0070717_10402902 3300006028 Bacteria 1229
233 Ga0070717_10427115 3300006028 Bacteria 1192
234 Ga0070717_10515281 3300006028 Bacteria 1082
235 Ga0075365_10384636 3300006038 Bacteria 990
236 Ga0075364_10003712 3300006051 Bacteria 8711
237 Ga0070715_10004251 3300006163 Bacteria 4674
238 Ga0070715_10015088 3300006163 Bacteria 2875
239 Ga0070715_10032910 3300006163 Bacteria 2115
240 Ga0070715_10042024 3300006163 Bacteria 1919
241 Ga0070716_100000575 3300006173 Bacteria 15389
242 Ga0070716_100003527 3300006173 Bacteria 7376
243 Ga0070716_100033836 3300006173 Bacteria 2798
244 Ga0070716_100034863 3300006173 Bacteria 2762
245 Ga0070716_100050846 3300006173 Bacteria 2354
246 Ga0070716_100127413 3300006173 Bacteria 1604
247 Ga0070716_100401132 3300006173 Bacteria 986
248 Ga0070712_100000786 3300006175 Bacteria 18763
249 Ga0070712_100003582 3300006175 Bacteria 9567
250 Ga0070712_100012910 3300006175 Bacteria 5322
251 Ga0070712_100064838 3300006175 Bacteria 2591
252 Ga0070712_100125473 3300006175 Bacteria 1938
253 Ga0070712_100190405 3300006175 Bacteria 1605
254 Ga0070712_100207045 3300006175 Bacteria 1545
255 Ga0070712_100213747 3300006175 Bacteria 1522
256 Ga0070712_100308529 3300006175 Bacteria 1283
257 Ga0070712_100806827 3300006175 Bacteria 805
258 Ga0075369_10001795 3300006186 Bacteria 7467
259 Ga0075369_10007848 3300006186 Bacteria 4084
260 Ga0075369_10081123 3300006186 Bacteria 1439
261 Ga0097621_100034412 3300006237 Bacteria 4042
262 Ga0097621_100145757 3300006237 Bacteria 2027
263 Ga0075370_10104698 3300006353 Bacteria 1640
264 Ga0068871_100092288 3300006358 Bacteria 2525
265 Ga0075428_100011120 3300006844 Bacteria 10015
266 Ga0075428_100089634 3300006844 Bacteria 3354
267 Ga0075428_101123179 3300006844 Bacteria 830
268 Ga0075430_100008192 3300006846 Bacteria 8828
269 Ga0075430_100062522 3300006846 Bacteria 3127
270 Ga0075430_100746655 3300006846 Bacteria 807
271 Ga0075431_100009394 3300006847 Bacteria 9818
272 Ga0075434_100123168 3300006871 Bacteria 2609
273 Ga0075434_100762108 3300006871 Bacteria 985
274 Ga0068865_100002144 3300006881 Bacteria 11650
275 Ga0068865_100171913 3300006881 Unclassified 1662
276 Ga0068865_100856540 3300006881 Bacteria 788
277 Ga0075436_100166312 3300006914 Bacteria 1556
278 Ga0097620_100004636 3300006931 Bacteria 14002
279 Ga0097620_100028703 3300006931 Bacteria 5579
280 Ga0097620_100075497 3300006931 Bacteria 3411
281 Ga0097620_100579727 3300006931 Bacteria 1215
282 Ga0097620_100768963 3300006931 Bacteria 1052
283 Ga0075435_100483832 3300007076 Bacteria 1069
284 Ga0099795_10096589 3300007788 Bacteria 1153
285 Ga0105251_10078044 3300009011 Bacteria 1534
286 Ga0105250_10129087 3300009092 Bacteria 1043
287 Ga0105240_10143743 3300009093 Bacteria 2849
288 Ga0105240_10162993 3300009093 Bacteria 2647
289 Ga0111539_10158605 3300009094 Bacteria 2647
290 Ga0105245_10012028 3300009098 Bacteria 7525
291 Ga0105245_10026860 3300009098 Bacteria 5069
292 Ga0105245_10116451 3300009098 Bacteria 2492
293 Ga0105245_10157101 3300009098 Bacteria 2155
294 Ga0105245_10251556 3300009098 Bacteria 1717
295 Ga0105245_10389688 3300009098 Bacteria 1390
296 Ga0105245_10467739 3300009098 Bacteria 1272
297 Ga0105247_10000952 3300009101 Bacteria 21847
298 Ga0105247_10005574 3300009101 Bacteria 7909
299 Ga0114129_10001008 3300009147 Bacteria 36708
300 Ga0114129_10377857 3300009147 Bacteria 1872
301 Ga0114129_10378107 3300009147 Bacteria 1871
302 Ga0114129_10467018 3300009147 Bacteria 1653
303 Ga0114129_10658569 3300009147 Bacteria 1351
304 Ga0114129_11244674 3300009147 Bacteria 925
305 Ga0114129_11438542 3300009147 Bacteria 849
306 Ga0114129_11595288 3300009147 Bacteria 799
307 Ga0105243_10002044 3300009148 Bacteria 17099
308 Ga0105243_10099360 3300009148 Bacteria 2412
309 Ga0105243_10422431 3300009148 Bacteria 1244
310 Ga0105241_10032842 3300009174 Bacteria 3894
311 Ga0105241_10314121 3300009174 Bacteria 1349
312 Ga0105241_10544282 3300009174 Bacteria 1041
313 Ga0105242_10000373 3300009176 Bacteria 35638
314 Ga0105242_10081903 3300009176 Bacteria 2700
315 Ga0105242_10304416 3300009176 Bacteria 1456
316 Ga0105242_10370373 3300009176 Bacteria 1328
317 Ga0105242_10632427 3300009176 Bacteria 1038
318 Ga0105248_10002237 3300009177 Bacteria 21398
319 Ga0105248_10025822 3300009177 Bacteria 6533
320 Ga0105248_10917920 3300009177 Bacteria 989
321 Ga0105248_11633343 3300009177 Bacteria 730
322 Ga0105237_10122503 3300009545 Bacteria 2594
323 Ga0105237_10172256 3300009545 Bacteria 2165
324 Ga0105237_10718738 3300009545 Bacteria 1005
325 Ga0105237_11138217 3300009545 Bacteria 787
326 Ga0105249_10000046 3300009553 Bacteria 176363
327 Ga0105249_10002144 3300009553 Bacteria 17095
328 Ga0105249_10021311 3300009553 Bacteria 5802
329 Ga0105249_10055721 3300009553 Bacteria 3618
330 Ga0105249_10275817 3300009553 Bacteria 1677
331 Ga0105249_10291520 3300009553 Bacteria 1633
332 Ga0105249_10566629 3300009553 Bacteria 1188
333 Ga0105249_10707101 3300009553 Bacteria 1068
334 Ga0105239_10031982 3300010375 Bacteria 5782
335 Ga0105239_10229779 3300010375 Bacteria 2081
336 Ga0105239_10461828 3300010375 Bacteria 1441
337 Ga0105239_10620477 3300010375 Bacteria 1234
338 Ga0105239_10804595 3300010375 Bacteria 1077
339 Ga0105239_11426624 3300010375 Bacteria 799
340 Ga0157329_1002048 3300012491 Bacteria 1109
341 Ga0157341_1003699 3300012494 Bacteria 1080
342 Ga0157313_1001835 3300012503 Bacteria 1199
343 Ga0157342_1000461 3300012507 Bacteria 2481
344 Ga0157373_10248874 3300013100 Bacteria 1257
345 Ga0157371_10221018 3300013102 Bacteria 1360
346 Ga0157371_10506486 3300013102 Bacteria 892
347 Ga0157369_10091807 3300013105 Bacteria 3241
348 Ga0157369_10435526 3300013105 Bacteria 1358
349 Ga0157369_10860336 3300013105 Bacteria 930
350 Ga0157374_10112070 3300013296 Bacteria 2625
351 Ga0157374_10855036 3300013296 Bacteria 927
352 Ga0157378_10003240 3300013297 Bacteria 14484
353 Ga0157378_10040034 3300013297 Bacteria 4156
354 Ga0157378_10185843 3300013297 Bacteria 1957
355 Ga0157378_10742103 3300013297 Bacteria 1004
356 Ga0163162_10007730 3300013306 Bacteria 10476
357 Ga0163162_10107172 3300013306 Bacteria 2889
358 Ga0163162_10427716 3300013306 Bacteria 1456
359 Ga0163162_10680281 3300013306 Bacteria 1151
360 Ga0157372_10012120 3300013307 Bacteria 9184
361 Ga0157372_10348223 3300013307 Bacteria 1726
362 Ga0157372_10490706 3300013307 Bacteria 1432
363 Ga0157372_10819347 3300013307 Bacteria 1081
364 Ga0157375_10000487 3300013308 Bacteria 35984
365 Ga0157375_10114525 3300013308 Bacteria 2798
366 Ga0157375_10220901 3300013308 Bacteria 2053
367 Ga0157375_10317600 3300013308 Bacteria 1722
368 Ga0157375_10730282 3300013308 Bacteria 1143
369 Ga0157375_10923453 3300013308 Bacteria 1016
370 Ga0157375_11100176 3300013308 Bacteria 930
371 Ga0157375_11799280 3300013308 Bacteria 726
372 Ga0163163_10020015 3300014325 Bacteria 6296
373 Ga0163163_10030667 3300014325 Bacteria 5183
374 Ga0163163_10087848 3300014325 Bacteria 3120
375 Ga0157380_10000989 3300014326 Bacteria 18069
376 Ga0157380_10053351 3300014326 Bacteria 3205
377 Ga0157377_10153706 3300014745 Bacteria 1425
378 Ga0157379_10136346 3300014968 Bacteria 2211
379 Ga0157379_10271024 3300014968 Bacteria 1544
380 Ga0157376_10022726 3300014969 Bacteria 4895
381 Ga0182005_1032735 3300015265 Bacteria 1415
382 Ga0163161_10005652 3300017792 Bacteria 8670
383 Ga0163161_10007739 3300017792 Bacteria 7432
384 Ga0163161_10336651 3300017792 Bacteria 1196
385 Ga0206354_11547857 3300020081 Bacteria 1643
386 Ga0213875_10041147 3300021388 Bacteria 2174
387 Ga0213875_10069811 3300021388 Bacteria 1640
388 Ga0224712_10023447 3300022467 Bacteria 2143
389 Ga0224572_1002087 3300024225 Bacteria 3149
390 Ga0207653_10017017 3300025885 Bacteria 2286
391 Ga0207692_10000678 3300025898 Bacteria 12026
392 Ga0207692_10000889 3300025898 Bacteria 10801
393 Ga0207692_10004462 3300025898 Bacteria 5544
394 Ga0207692_10026141 3300025898 Bacteria 2736
395 Ga0207692_10077385 3300025898 Bacteria 1770
396 Ga0207692_10087266 3300025898 Bacteria 1683
397 Ga0207692_10097273 3300025898 Bacteria 1609
398 Ga0207692_10254748 3300025898 Bacteria 1053
399 Ga0207642_10000231 3300025899 Bacteria 16524
400 Ga0207642_10028634 3300025899 Bacteria 2296
401 Ga0207642_10030983 3300025899 Bacteria 2235
402 Ga0207710_10000153 3300025900 Bacteria 76530
403 Ga0207710_10007850 3300025900 Bacteria 4517
404 Ga0207710_10055404 3300025900 Bacteria 1787
405 Ga0207688_10003373 3300025901 Bacteria 8720
406 Ga0207688_10003437 3300025901 Bacteria 8636
407 Ga0207688_10005363 3300025901 Bacteria 6962
408 Ga0207688_10010533 3300025901 Bacteria 5029
409 Ga0207688_10028536 3300025901 Bacteria 3070
410 Ga0207688_10084926 3300025901 Bacteria 1813
411 Ga0207680_10163742 3300025903 Bacteria 1493
412 Ga0207647_10007734 3300025904 Bacteria 7738
413 Ga0207647_10031359 3300025904 Bacteria 3421
414 Ga0207647_10071882 3300025904 Bacteria 2087
415 Ga0207685_10023232 3300025905 Bacteria 2108
416 Ga0207685_10034954 3300025905 Bacteria 1830
417 Ga0207685_10036183 3300025905 Bacteria 1808
418 Ga0207685_10129877 3300025905 Bacteria 1117
419 Ga0207699_10000205 3300025906 Bacteria 35487
420 Ga0207699_10002986 3300025906 Bacteria 8043
421 Ga0207699_10012801 3300025906 Bacteria 4273
422 Ga0207699_10027176 3300025906 Bacteria 3165
423 Ga0207699_10033147 3300025906 Bacteria 2917
424 Ga0207699_10136811 3300025906 Bacteria 1605
425 Ga0207699_10142157 3300025906 Bacteria 1578
426 Ga0207699_10330717 3300025906 Bacteria 1071
427 Ga0207645_10036125 3300025907 Bacteria 3173
428 Ga0207645_10112267 3300025907 Bacteria 1765
429 Ga0207643_10001272 3300025908 Bacteria 14725
430 Ga0207684_10057381 3300025910 Bacteria 3303
431 Ga0207684_10487879 3300025910 Bacteria 1056
432 Ga0207654_10025312 3300025911 Bacteria 3200
433 Ga0207654_10098494 3300025911 Bacteria 1797
434 Ga0207671_10015516 3300025914 Bacteria 5959
435 Ga0207671_10263383 3300025914 Bacteria 1357
436 Ga0207671_10707001 3300025914 Bacteria 801
437 Ga0207693_10000355 3300025915 Bacteria 42002
438 Ga0207693_10002200 3300025915 Bacteria 16997
439 Ga0207693_10006667 3300025915 Bacteria 9538
440 Ga0207693_10008293 3300025915 Bacteria 8507
441 Ga0207693_10008945 3300025915 Bacteria 8172
442 Ga0207693_10027108 3300025915 Bacteria 4531
443 Ga0207693_10079956 3300025915 Bacteria 2559
444 Ga0207693_10092279 3300025915 Bacteria 2373
445 Ga0207693_10100871 3300025915 Bacteria 2263
446 Ga0207693_10235819 3300025915 Bacteria 1436
447 Ga0207693_10341396 3300025915 Bacteria 1172
448 Ga0207663_10004333 3300025916 Bacteria 7045
449 Ga0207663_10012575 3300025916 Bacteria 4581
450 Ga0207663_10013199 3300025916 Bacteria 4486
451 Ga0207663_10020576 3300025916 Bacteria 3739
452 Ga0207663_10027871 3300025916 Bacteria 3299
453 Ga0207663_10028380 3300025916 Bacteria 3275
454 Ga0207663_10046506 3300025916 Bacteria 2674
455 Ga0207663_10057636 3300025916 Bacteria 2448
456 Ga0207663_10116797 3300025916 Bacteria 1819
457 Ga0207660_10352138 3300025917 Bacteria 1180
458 Ga0207662_10025722 3300025918 Bacteria 3391
459 Ga0207662_10310882 3300025918 Bacteria 1050
460 Ga0207657_10191457 3300025919 Bacteria 1650
461 Ga0207657_10194640 3300025919 Bacteria 1634
462 Ga0207649_10694601 3300025920 Bacteria 789
463 Ga0207646_10010946 3300025922 Bacteria 8808
464 Ga0207646_10053722 3300025922 Bacteria 3603
465 Ga0207646_10076070 3300025922 Bacteria 2999
466 Ga0207646_10112214 3300025922 Unclassified 2447
467 Ga0207646_10213347 3300025922 Bacteria 1743
468 Ga0207646_10351443 3300025922 Bacteria 1332
469 Ga0207646_10654147 3300025922 Bacteria 941
470 Ga0207681_10000615 3300025923 Bacteria 23920
471 Ga0207681_10007134 3300025923 Bacteria 6852
472 Ga0207681_10370496 3300025923 Bacteria 1151
473 Ga0207681_10384161 3300025923 Bacteria 1131
474 Ga0207650_10734643 3300025925 Bacteria 835
475 Ga0207687_10001302 3300025927 Bacteria 17029
476 Ga0207687_10037386 3300025927 Bacteria 3312
477 Ga0207687_10057611 3300025927 Bacteria 2730
478 Ga0207687_10062671 3300025927 Bacteria 2630
479 Ga0207687_10082234 3300025927 Bacteria 2329
480 Ga0207687_10113333 3300025927 Bacteria 2017
481 Ga0207687_10755419 3300025927 Bacteria 828
482 Ga0207700_10000171 3300025928 Bacteria 38786
483 Ga0207700_10047773 3300025928 Bacteria 3175
484 Ga0207700_10050731 3300025928 Bacteria 3093
485 Ga0207700_10057550 3300025928 Bacteria 2932
486 Ga0207700_10108780 3300025928 Bacteria 2227
487 Ga0207700_10118770 3300025928 Bacteria 2140
488 Ga0207700_10179637 3300025928 Bacteria 1771
489 Ga0207700_10212207 3300025928 Bacteria 1637
490 Ga0207700_10589015 3300025928 Bacteria 989
491 Ga0207664_10001768 3300025929 Bacteria 14241
492 Ga0207664_10014960 3300025929 Bacteria 5618
493 Ga0207664_10021138 3300025929 Bacteria 4833
494 Ga0207664_10035023 3300025929 Bacteria 3871
495 Ga0207664_10041588 3300025929 Bacteria 3581
496 Ga0207664_10044912 3300025929 Bacteria 3462
497 Ga0207664_10054296 3300025929 Bacteria 3174
498 Ga0207664_10060648 3300025929 Bacteria 3015
499 Ga0207664_10080310 3300025929 Bacteria 2650
500 Ga0207664_10105222 3300025929 Bacteria 2338
501 Ga0207664_10377789 3300025929 Bacteria 1258
502 Ga0207644_10331031 3300025931 Bacteria 1233
503 Ga0207644_10415168 3300025931 Bacteria 1102
504 Ga0207690_10040271 3300025932 Bacteria 3054
505 Ga0207690_10218791 3300025932 Bacteria 1456
506 Ga0207706_10006718 3300025933 Bacteria 10635
507 Ga0207706_10027319 3300025933 Bacteria 5104
508 Ga0207706_10041447 3300025933 Bacteria 4082
509 Ga0207706_10044707 3300025933 Bacteria 3924
510 Ga0207686_10008241 3300025934 Bacteria 5623
511 Ga0207686_10178073 3300025934 Bacteria 1505
512 Ga0207709_10002257 3300025935 Bacteria 12252
513 Ga0207709_10163190 3300025935 Bacteria 1556
514 Ga0207709_10206561 3300025935 Bacteria 1406
515 Ga0207670_10133049 3300025936 Bacteria 1825
516 Ga0207669_10057151 3300025937 Bacteria 2373
517 Ga0207669_10063093 3300025937 Bacteria 2285
518 Ga0207669_10454445 3300025937 Bacteria 1016
519 Ga0207704_10001019 3300025938 Bacteria 12430
520 Ga0207704_10206690 3300025938 Bacteria 1441
521 Ga0207704_10217541 3300025938 Bacteria 1411
522 Ga0207665_10001616 3300025939 Bacteria 15211
523 Ga0207665_10004106 3300025939 Bacteria 9709
524 Ga0207665_10004322 3300025939 Bacteria 9438
525 Ga0207665_10017844 3300025939 Bacteria 4665
526 Ga0207665_10030413 3300025939 Bacteria 3568
527 Ga0207665_10040916 3300025939 Bacteria 3094
528 Ga0207665_10110673 3300025939 Bacteria 1930
529 Ga0207691_10005983 3300025940 Bacteria 11746
530 Ga0207691_10063467 3300025940 Bacteria 3350
531 Ga0207711_10001535 3300025941 Bacteria 21402
532 Ga0207711_10012911 3300025941 Bacteria 6938
533 Ga0207711_10410687 3300025941 Bacteria 1258
534 Ga0207689_10001836 3300025942 Bacteria 20086
535 Ga0207689_10003085 3300025942 Bacteria 15334
536 Ga0207689_10009603 3300025942 Bacteria 8342
537 Ga0207689_10079292 3300025942 Bacteria 2699
538 Ga0207661_10085125 3300025944 Bacteria 2620
539 Ga0207661_10476611 3300025944 Bacteria 1139
540 Ga0207651_10132741 3300025960 Bacteria 1909
541 Ga0207651_10212092 3300025960 Bacteria 1560
542 Ga0207712_10000042 3300025961 Bacteria 176338
543 Ga0207712_10003564 3300025961 Bacteria 9819
544 Ga0207712_10100331 3300025961 Bacteria 2151
545 Ga0207712_10187069 3300025961 Bacteria 1632
546 Ga0207712_10197764 3300025961 Bacteria 1591
547 Ga0207668_10001287 3300025972 Bacteria 14926
548 Ga0207668_10011615 3300025972 Bacteria 5357
549 Ga0207668_10212358 3300025972 Bacteria 1549
550 Ga0207668_10288767 3300025972 Bacteria 1348
551 Ga0207640_10012123 3300025981 Bacteria 4901
552 Ga0207640_10069835 3300025981 Bacteria 2360
553 Ga0207658_10000377 3300025986 Bacteria 43514
554 Ga0207658_10001454 3300025986 Bacteria 18467
555 Ga0207658_10006137 3300025986 Bacteria 8201
556 Ga0207658_10201140 3300025986 Bacteria 1663
557 Ga0207658_10336987 3300025986 Bacteria 1310
558 Ga0207677_10000670 3300026023 Bacteria 20364
559 Ga0207677_10035276 3300026023 Bacteria 3247
560 Ga0207677_10084246 3300026023 Bacteria 2291
561 Ga0207677_10665922 3300026023 Bacteria 920
562 Ga0207703_10004329 3300026035 Bacteria 11672
563 Ga0207703_10005964 3300026035 Bacteria 9761
564 Ga0207703_10047195 3300026035 Bacteria 3472
565 Ga0207703_10190521 3300026035 Bacteria 1816
566 Ga0207639_10024650 3300026041 Bacteria 4356
567 Ga0207678_10005601 3300026067 Bacteria 11231
568 Ga0207678_10010855 3300026067 Bacteria 8006
569 Ga0207678_10013818 3300026067 Bacteria 7095
570 Ga0207678_10176415 3300026067 Bacteria 1824
571 Ga0207708_10003270 3300026075 Bacteria 11946
572 Ga0207708_10011001 3300026075 Bacteria 6729
573 Ga0207708_10028032 3300026075 Bacteria 4264
574 Ga0207708_10072259 3300026075 Unclassified 2643
575 Ga0207702_10072036 3300026078 Bacteria 2977
576 Ga0207702_10192978 3300026078 Bacteria 1883
577 Ga0207702_10260053 3300026078 Bacteria 1634
578 Ga0207641_10001215 3300026088 Bacteria 25767
579 Ga0207641_10008290 3300026088 Bacteria 8586
580 Ga0207641_10032028 3300026088 Bacteria 4364
581 Ga0207641_10051429 3300026088 Bacteria 3489
582 Ga0207641_10198841 3300026088 Bacteria 1847
583 Ga0207648_10000671 3300026089 Bacteria 38354
584 Ga0207648_10035258 3300026089 Bacteria 4408
585 Ga0207648_10309793 3300026089 Bacteria 1417
586 Ga0207676_10074756 3300026095 Bacteria 2731
587 Ga0207676_10296180 3300026095 Bacteria 1475
588 Ga0207676_10374935 3300026095 Bacteria 1323
589 Ga0207674_10161727 3300026116 Bacteria 2193
590 Ga0207674_10394680 3300026116 Bacteria 1337
591 Ga0207675_100000388 3300026118 Bacteria 42128
592 Ga0207675_100019325 3300026118 Bacteria 6356
593 Ga0207675_100120596 3300026118 Bacteria 2481
594 Ga0207683_10006709 3300026121 Bacteria 9849
595 Ga0207683_10006989 3300026121 Bacteria 9676
596 Ga0207683_10086132 3300026121 Bacteria 2793
597 Ga0207683_10236611 3300026121 Bacteria 1666
598 Ga0207698_10053929 3300026142 Bacteria 3090
599 Ga0207698_10127881 3300026142 Bacteria 2165
600 Ga0207698_10530574 3300026142 Bacteria 1150
601 Ga0268266_10013359 3300028379 Bacteria 7075
602 Ga0268266_10021397 3300028379 Bacteria 5509
603 Ga0268266_10035706 3300028379 Bacteria 4228
604 Ga0268265_10000051 3300028380 Bacteria 174968
605 Ga0268265_10022066 3300028380 Bacteria 4469
606 Ga0268265_10098077 3300028380 Bacteria 2359
607 Ga0268265_10153781 3300028380 Bacteria 1944
608 Ga0268265_10334430 3300028380 Bacteria 1377
609 Ga0268265_10608311 3300028380 Bacteria 1045
610 Ga0268264_10000108 3300028381 Bacteria 208791
611 Ga0268264_10091040 3300028381 Bacteria 2630
612 Ga0265327_10011353 3300031251 Bacteria 6143
613 Ga0307513_10045574 3300031456 Bacteria 4792
614 Ga0307513_10226026 3300031456 Bacteria 1688
615 Ga0307408_100031410 3300031548 Bacteria 3698
616 Ga0307408_100409066 3300031548 Bacteria 1167
617 Ga0307405_10056800 3300031731 Bacteria 2456
618 Ga0307405_10072792 3300031731 Bacteria 2216
619 Ga0307413_10064657 3300031824 Bacteria 2274
620 Ga0307413_10141922 3300031824 Bacteria 1661
621 Ga0307410_10045488 3300031852 Bacteria 2923
622 Ga0307410_10124108 3300031852 Bacteria 1887
623 Ga0307406_10023171 3300031901 Bacteria 3691
624 Ga0307407_10465665 3300031903 Bacteria 920
625 Ga0307412_10009683 3300031911 Bacteria 5533
626 Ga0307412_10250032 3300031911 Bacteria 1376
627 Ga0307409_100004802 3300031995 Bacteria 7667
628 Ga0307416_100006312 3300032002 Bacteria 7410
629 Ga0307416_100288254 3300032002 Bacteria 1623
630 Ga0307416_100947558 3300032002 Bacteria 963
631 Ga0307414_10161705 3300032004 Bacteria 1779
632 Ga0307411_10127113 3300032005 Bacteria 1856
633 Ga0307411_10365507 3300032005 Bacteria 1181
634 Ga0307415_100019600 3300032126 Bacteria 4111
635 Ga0307415_100041593 3300032126 Bacteria 3052
636 Ga0307415_100079663 3300032126 Bacteria 2334
637 Ga0373950_0024350 3300034818 Bacteria 1088
638 Ga0373926_0003753 3300035083 Bacteria 4946
639 Ga0373926_0047736 3300035083 Bacteria 1539
640 Ga0373928_0033975 3300035084 Bacteria 1143
641 Ga0373929_0029965 3300035085 Bacteria 1158
642 Ga0373934_0019071 3300035086 Bacteria 2630
643 Ga0373934_0073268 3300035086 Bacteria 1371
644 Ga0373940_0017273 3300035088 Bacteria 1797
645 Ga0373944_0005556 3300035089 Bacteria 3323
646 Ga0373923_0010842 3300035111 Bacteria 3328
647 Ga0373923_0035279 3300035111 Bacteria 2035
648 Ga0373923_0159153 3300035111 Bacteria 1030
649 Ga0373932_0063305 3300035112 Bacteria 1130
650 Ga0373936_0007284 3300035113 Bacteria 4162
651 Ga0373939_0003646 3300035114 Bacteria 3625
652 Ga0373945_0006316 3300035116 Bacteria 3817
653 Ga0373953_0015691 3300035117 Bacteria 2752
654 Ga0373953_0129371 3300035117 Bacteria 1076
655 Ga0373956_0020753 3300035119 Bacteria 2798
656 Ga0373957_0018421 3300035120 Bacteria 2446
657 Ga0373957_0065598 3300035120 Bacteria 1413
658 Ga0373943_0000792 3300035170 Bacteria 13870
659 Ga0373943_0174365 3300035170 Bacteria 1178
660 Ga0373946_0000743 3300035171 Bacteria 11084
661 Ga0373946_0064031 3300035171 Bacteria 1572
662 Ga0373955_0010188 3300035172 Bacteria 4430
663 Ga0373955_0021302 3300035172 Bacteria 3271
664 Ga0373955_0152074 3300035172 Bacteria 1362
665 Ga0373962_0059804 3300035242 Bacteria 1117
666 Ga0373924_0060383 3300035410 Bacteria 1585
667 Ga0373931_0011349 3300035691 Bacteria 4304
668 Ga0373931_0131659 3300035691 Bacteria 1440
669 Ga0373931_0138039 3300035691 Bacteria 1409
670 Ga0373931_0267841 3300035691 Bacteria 1045
671 Ga0373935_0004837 3300035692 Bacteria 7916
672 Ga0373935_0083939 3300035692 Bacteria 2074
673 Ga0373935_0125177 3300035692 Bacteria 1721
674 Ga0373927_0005172 3300035695 Bacteria 9024
675 Ga0373933_0017926 3300035724 Bacteria 3975
676 Ga0373933_0044510 3300035724 Bacteria 2629
677 Ga0373947_0005102 3300035725 Bacteria 7693
678 Ga0373937_0018158 3300036401 Bacteria 6275
679 Ga0373937_0026771 3300036401 Bacteria 5211
680 Ga0373937_0255278 3300036401 Bacteria 1652
681 Ga0373925_0003276 3300037068 Bacteria 12604
682 Ga0373925_0135900 3300037068 Bacteria 1921
683 Ga0373925_0573789 3300037068 Bacteria 928
684 Ga0395899_0033538 3300037312 Bacteria 3855
685 Ga0395900_0006143 3300037418 Bacteria 12534
686 Ga0395900_0029126 3300037418 Bacteria 5664
687 Ga0395900_0094100 3300037418 Bacteria 3078
688 Ga0395900_0143943 3300037418 Bacteria 2439
689 Ga0395898_0653047 3300037466 Bacteria 994
690 Ga0395898_1045153 3300037466 Bacteria 751
691 Ga0395905_0019411 3300037471 Bacteria 6444
692 Ga0395905_0812078 3300037471 Bacteria 838
693 Ga0436364_0280192 3300037853 Bacteria 9128
694 Ga0436364_0563277 3300037853 Bacteria 5101
695 Ga0436364_0707129 3300037853 Bacteria 5783
696 Ga0436364_0900715 3300037853 Bacteria 3561
697 Ga0395901_0002571 3300038443 Bacteria 18392
698 Ga0395901_0155900 3300038443 Bacteria 2399
699 Ga0395901_0272469 3300038443 Bacteria 1760
700 Ga0436363_0833973 3300039450 Bacteria 1343
701 Ga0436362_0856774 3300039453 Bacteria 1054
702 Ga0439461_0002411 3300041410 Bacteria 2981
703 Ga0439466_0011732 3300041411 Bacteria 3236
704 Ga0439466_0012636 3300041411 Bacteria 3104
705 Ga0439466_0099318 3300041411 Bacteria 908
706 Ga0439465_0004694 3300041413 Bacteria 4405
707 Ga0439465_0005800 3300041413 Bacteria 3932
708 Ga0439465_0046231 3300041413 Bacteria 1416
709 Ga0451837_0445302 3300041494 Bacteria 1597
710 Ga0439431_0022379 3300041997 Bacteria 1523
711 Ga0439431_0034190 3300041997 Bacteria 1274
712 Ga0439442_027703 3300042002 Bacteria 1181
713 Ga0439445_0005864 3300042004 Bacteria 2809
714 Ga0439448_0015918 3300042005 Bacteria 2283
715 Ga0439448_0104706 3300042005 Bacteria 963
716 Ga0439450_054337 3300042008 Bacteria 957
717 Ga0439451_018400 3300042009 Bacteria 1410
718 Ga0439454_007151 3300042011 Bacteria 1392
719 Ga0439455_0018222 3300042012 Bacteria 1645
720 Ga0439463_012673 3300042016 Bacteria 2074
721 Ga0439463_041305 3300042016 Bacteria 1172
722 Ga0439463_046496 3300042016 Bacteria 1105
723 Ga0439463_062357 3300042016 Bacteria 953
724 Ga0450902_021180 3300042137 Bacteria 1074
725 Ga0450910_043965 3300042147 Bacteria 727
726 Ga0439434_0045819 3300042435 Bacteria 1349
727 Ga0439444_0008585 3300042437 Bacteria 1594
728 Ga0439464_0015335 3300042439 Bacteria 2067
729 Ga0439464_0028315 3300042439 Bacteria 1561
730 Ga0439460_0068431 3300042461 Bacteria 1096
731 Ga0466972_0051121 3300044658 Bacteria 1994
732 Ga0466972_0136600 3300044658 Bacteria 1154
733 Ga0466972_0148245 3300044658 Bacteria 1103
734 Ga0466965_0008107 3300044683 Bacteria 4852
735 Ga0466965_0073507 3300044683 Bacteria 1721
736 Ga0466965_0088331 3300044683 Bacteria 1574
737 Ga0466966_0076967 3300044684 Bacteria 2082
738 Ga0466966_0083159 3300044684 Bacteria 1992
739 Ga0466961_0002733 3300044693 Bacteria 10973
740 Ga0466961_0077260 3300044693 Bacteria 2109
741 Ga0466968_0013935 3300044735 Bacteria 3169
742 Ga0466968_0036733 3300044735 Bacteria 2054
743 Ga0466970_0045395 3300044765 Bacteria 2339
744 Ga0466970_0054011 3300044765 Bacteria 2145
745 Ga0466970_0072757 3300044765 Bacteria 1849
746 Ga0466970_0076952 3300044765 Bacteria 1798
747 Ga0466957_0012179 3300044842 Bacteria 4976
748 Ga0466957_0022295 3300044842 Bacteria 3735
749 Ga0466957_0176516 3300044842 Bacteria 1393
750 Ga0466960_0000113 3300044901 Bacteria 27016
751 Ga0466960_0021687 3300044901 Bacteria 2863
752 Ga0466960_0171124 3300044901 Bacteria 1172
753 Ga0466960_0172022 3300044901 Bacteria 1169
754 Ga0466959_0004571 3300045049 Bacteria 9288
755 Ga0466959_0006274 3300045049 Bacteria 8214
756 Ga0466959_0010862 3300045049 Bacteria 6526
757 Ga0466959_0200347 3300045049 Bacteria 1390
758 Ga0466958_0109914 3300045836 Bacteria 1720
759 Ga0466958_0115277 3300045836 Bacteria 1679
760 Ga0466958_0330364 3300045836 Bacteria 980
761 Ga0466967_0117224 3300045976 Bacteria 2454
762 Ga0495592_0122873 3300046454 Bacteria 1824
763 Ga0495592_0163625 3300046454 Bacteria 1529
764 Ga0495603_0433663 3300046455 Bacteria 753
765 Ga0495638_0000446 3300046460 Bacteria 49572
766 Ga0495641_0041566 3300046461 Bacteria 2135
767 Ga0495641_0155630 3300046461 Bacteria 1022
768 Ga0495651_0020376 3300046462 Bacteria 5147
769 Ga0495651_0042965 3300046462 Bacteria 3507
770 Ga0495651_0062515 3300046462 Bacteria 2849
771 Ga0495651_0159977 3300046462 Bacteria 1614
772 Ga0495653_0012013 3300046463 Bacteria 7069
773 Ga0495653_0028807 3300046463 Bacteria 4439
774 Ga0495580_0302318 3300046472 Bacteria 1089
775 Ga0495582_0144865 3300046473 Bacteria 1347
776 Ga0495664_0002773 3300046477 Bacteria 9428
777 Ga0495664_0050945 3300046477 Bacteria 2458
778 Ga0495596_0121585 3300046500 Bacteria 1013
779 Ga0495608_0028095 3300046511 Bacteria 3824
780 Ga0495608_0072530 3300046511 Bacteria 2246
781 Ga0495618_0024728 3300046514 Bacteria 3722
782 Ga0495618_0042412 3300046514 Bacteria 2868
783 Ga0495618_0156086 3300046514 Bacteria 1456
784 Ga0495628_0058918 3300046516 Bacteria 3017
785 Ga0495628_0080519 3300046516 Bacteria 2531
786 Ga0495628_0133166 3300046516 Bacteria 1900
787 Ga0495628_0221016 3300046516 Bacteria 1423
788 Ga0495630_0027453 3300046517 Bacteria 4224
789 Ga0495630_0251156 3300046517 Bacteria 1351
790 Ga0495630_0643041 3300046517 Bacteria 812
791 Ga0495644_0074041 3300046523 Bacteria 1281
792 Ga0495652_0050156 3300046529 Bacteria 3570
793 Ga0495652_0052635 3300046529 Bacteria 3471
794 Ga0495654_0197639 3300046530 Bacteria 862
795 Ga0495665_0002954 3300046531 Bacteria 9179
796 Ga0495665_0003630 3300046531 Bacteria 8374
797 Ga0495640_0085787 3300046533 Bacteria 2086
798 Ga0495587_0040206 3300046536 Bacteria 2796
799 Ga0495587_0053611 3300046536 Bacteria 2377
800 Ga0495645_0100297 3300046543 Bacteria 2059
801 Ga0495645_0116450 3300046543 Bacteria 1886
802 Ga0495645_0420540 3300046543 Bacteria 848
803 Ga0495667_0005958 3300046559 Bacteria 8242
804 Ga0495667_0010235 3300046559 Bacteria 6344
805 Ga0495667_0031038 3300046559 Bacteria 3588
806 Ga0495667_0116483 3300046559 Bacteria 1726
807 Ga0495634_0028024 3300046642 Bacteria 3913
808 Ga0495634_0207242 3300046642 Bacteria 1215
809 Ga0495634_0215788 3300046642 Bacteria 1186
810 Ga0495625_0273930 3300046660 Bacteria 1088
811 Ga0495635_0001859 3300046663 Bacteria 14293
812 Ga0495635_0019489 3300046663 Bacteria 4728
813 Ga0495635_0029558 3300046663 Bacteria 3811
814 Ga0495635_0034826 3300046663 Bacteria 3492
815 Ga0495657_0009701 3300046675 Bacteria 7279
816 Ga0495657_0043596 3300046675 Bacteria 3058
817 Ga0495657_0084786 3300046675 Bacteria 2043
818 Ga0495599_0052805 3300046678 Bacteria 2546
819 Ga0495599_0061181 3300046678 Bacteria 2353
820 Ga0495623_0108871 3300046679 Bacteria 1681
821 Ga0495613_0155784 3300046689 Bacteria 1628
822 Ga0495624_0002363 3300046690 Bacteria 14327
823 Ga0495600_0219197 3300046809 Bacteria 1217
824 Ga0495600_0225025 3300046809 Bacteria 1199
825 Ga0495581_0020267 3300047315 Bacteria 3860
826 Ga0495581_0085238 3300047315 Bacteria 1831
827 Ga0495604_0107154 3300047317 Bacteria 2043
828 Ga0495604_0220813 3300047317 Bacteria 1305
829 Ga0495674_0001119 3300047319 Bacteria 25781
830 Ga0495674_0028758 3300047319 Bacteria 5064
831 Ga0495674_0524890 3300047319 Bacteria 945
832 Ga0495672_0012959 3300047320 Bacteria 5778
833 Ga0495672_0015435 3300047320 Bacteria 5186
834 Ga0495672_0207443 3300047320 Bacteria 976
835 Ga0495676_0052512 3300047321 Bacteria 3253
836 Ga0495680_0050452 3300047322 Bacteria 3254
837 Ga0495680_0053811 3300047322 Bacteria 3129
838 Ga0495675_0039590 3300047444 Bacteria 3002
839 Ga0495675_0060719 3300047444 Bacteria 2396
840 Ga0495673_0000640 3300047469 Bacteria 34402
841 Ga0495684_0002878 3300047471 Bacteria 13550
842 Ga0495684_0020977 3300047471 Bacteria 5032
843 Ga0495684_0045583 3300047471 Bacteria 3355
844 Ga0495593_0399587 3300047673 Bacteria 687
845 Ga0495602_0164985 3300048088 Bacteria 1725
846 Ga0496100_0001433 3300048903 Bacteria 11669
847 Ga0496100_0024697 3300048903 Bacteria 3668
848 Ga0496100_0084433 3300048903 Bacteria 2152
849 Ga0496100_0131253 3300048903 Bacteria 1765
850 Ga0496100_0166764 3300048903 Bacteria 1583
851 Ga0496101_0000878 3300048904 Bacteria 17724
852 Ga0496101_0004040 3300048904 Bacteria 9171
853 Ga0496101_0004844 3300048904 Bacteria 8536
854 Ga0496101_0018373 3300048904 Bacteria 4754
855 Ga0496102_0000131 3300048905 Bacteria 104032
856 Ga0496102_0009118 3300048905 Bacteria 8510
857 Ga0496102_0021846 3300048905 Bacteria 5664
858 Ga0496102_0051939 3300048905 Bacteria 3734
859 Ga0496102_0188374 3300048905 Bacteria 1944
860 Ga0496102_0257849 3300048905 Bacteria 1644
861 Ga0496102_0320987 3300048905 Bacteria 1459
862 Ga0496102_0488419 3300048905 Bacteria 1153
863 Ga0496103_0000584 3300048906 Bacteria 28834
864 Ga0496103_0000859 3300048906 Bacteria 22103
865 Ga0496103_0024140 3300048906 Bacteria 3667
866 Ga0496103_0063151 3300048906 Bacteria 2306
867 Ga0496103_0094575 3300048906 Bacteria 1888
868 Ga0496103_0156845 3300048906 Bacteria 1459
869 Ga0496103_0270566 3300048906 Bacteria 1093
870 Ga0496103_0348169 3300048906 Bacteria 953
871 Ga0496104_0002120 3300048907 Bacteria 17226
872 Ga0496104_0006446 3300048907 Bacteria 10317
873 Ga0496104_0030846 3300048907 Bacteria 4985
874 Ga0496104_0041539 3300048907 Bacteria 4312
875 Ga0496104_0060438 3300048907 Bacteria 3590
876 Ga0496104_0122217 3300048907 Bacteria 2500
877 Ga0496104_0157959 3300048907 Bacteria 2176
878 Ga0496104_0295543 3300048907 Bacteria 1532
879 Ga0496104_0401072 3300048907 Bacteria 1284
880 Ga0496105_0006239 3300048908 Bacteria 9152
881 Ga0496105_0017484 3300048908 Bacteria 5751
882 Ga0496105_0018109 3300048908 Bacteria 5653
883 Ga0496105_0045646 3300048908 Bacteria 3616
884 Ga0496105_0308435 3300048908 Bacteria 1271
885 Ga0496106_0000264 3300048909 Bacteria 36882
886 Ga0496106_0079176 3300048909 Bacteria 2523
887 Ga0496106_0200729 3300048909 Bacteria 1587
888 Ga0496106_0245935 3300048909 Bacteria 1429
889 Ga0496106_0246570 3300048909 Bacteria 1427
890 Ga0496106_0313844 3300048909 Bacteria 1258
891 Ga0496106_0940860 3300048909 Bacteria 681
892 Ga0496107_0002087 3300048910 Bacteria 12791
893 Ga0496107_0011379 3300048910 Bacteria 6194
894 Ga0496107_0028090 3300048910 Bacteria 3997
895 Ga0496107_0035884 3300048910 Bacteria 3556
896 Ga0496107_0110024 3300048910 Bacteria 2024
897 Ga0496107_0192125 3300048910 Bacteria 1517
898 Ga0496108_0000246 3300048911 Bacteria 48269
899 Ga0496108_0004292 3300048911 Bacteria 11476
900 Ga0496108_0042719 3300048911 Bacteria 3785
901 Ga0496108_0096422 3300048911 Bacteria 2519
902 Ga0496108_0100491 3300048911 Bacteria 2467
903 Ga0496108_0182188 3300048911 Bacteria 1819
904 Ga0496108_0198094 3300048911 Bacteria 1742
905 Ga0496108_0236291 3300048911 Bacteria 1589
906 Ga0496109_0004032 3300048912 Bacteria 12266
907 Ga0496109_0005253 3300048912 Bacteria 10813
908 Ga0496109_0038359 3300048912 Bacteria 4331
909 Ga0496109_0038784 3300048912 Bacteria 4308
910 Ga0496109_0086397 3300048912 Bacteria 2897
911 Ga0496109_0129500 3300048912 Bacteria 2355
912 Ga0496109_0178112 3300048912 Bacteria 1996
913 Ga0496109_0409943 3300048912 Bacteria 1280
914 Ga0496109_0678687 3300048912 Bacteria 967
915 Ga0496109_0761813 3300048912 Bacteria 906
916 Ga0496110_0021997 3300048913 Bacteria 5409
917 Ga0496110_0023699 3300048913 Bacteria 5222
918 Ga0496110_0024081 3300048913 Bacteria 5187
919 Ga0496110_0124483 3300048913 Bacteria 2325
920 Ga0496110_0160975 3300048913 Bacteria 2035
921 Ga0496110_0196799 3300048913 Bacteria 1830
922 Ga0496110_0360661 3300048913 Bacteria 1324
923 Ga0496111_0014763 3300048914 Bacteria 5345
924 Ga0496111_0028674 3300048914 Bacteria 3946
925 Ga0496111_0053090 3300048914 Bacteria 2928
926 Ga0496111_0169926 3300048914 Bacteria 1620
927 Ga0496111_0254065 3300048914 Bacteria 1304
928 Ga0496111_0285548 3300048914 Bacteria 1224
929 Ga0496112_0008267 3300048915 Bacteria 9312
930 Ga0496112_0031603 3300048915 Bacteria 5136
931 Ga0496112_0058709 3300048915 Bacteria 3789
932 Ga0496112_0145847 3300048915 Bacteria 2335
933 Ga0496112_0221222 3300048915 Bacteria 1849
934 Ga0496112_0690967 3300048915 Bacteria 949
935 Ga0496112_0815583 3300048915 Bacteria 857
936 Ga0496112_0838482 3300048915 Bacteria 843
937 Ga0496113_0015679 3300048916 Bacteria 5218
938 Ga0496113_0016219 3300048916 Bacteria 5143
939 Ga0496113_0396777 3300048916 Bacteria 1107
940 Ga0496114_0006511 3300048917 Bacteria 9201
941 Ga0496114_0050846 3300048917 Bacteria 3450
942 Ga0496114_0088884 3300048917 Bacteria 2621
943 Ga0496114_0103965 3300048917 Bacteria 2428
944 Ga0496114_0312675 3300048917 Bacteria 1388
945 Ga0496114_0488034 3300048917 Bacteria 1090
946 Ga0496115_0002052 3300048918 Bacteria 14416
947 Ga0496115_0002133 3300048918 Bacteria 14141
948 Ga0496115_0013228 3300048918 Bacteria 6235
949 Ga0496115_0087064 3300048918 Bacteria 2549
950 Ga0496115_0113465 3300048918 Bacteria 2227
951 Ga0496115_0186352 3300048918 Bacteria 1715
952 Ga0496115_0277232 3300048918 Bacteria 1377
953 Ga0496115_0277607 3300048918 Bacteria 1376
954 Ga0496115_0592942 3300048918 Bacteria 882
955 Ga0496116_0002121 3300048919 Bacteria 21120
956 Ga0496117_0002770 3300048920 Bacteria 21471
957 Ga0496118_0002961 3300048921 Bacteria 21991
958 Ga0496120_0007762 3300048923 Bacteria 7925
959 Ga0496121_0010397 3300048924 Bacteria 10503
960 Ga0496126_0005120 3300048929 Bacteria 15192
961 Ga0496126_0033996 3300048929 Bacteria 4793
962 Ga0496126_0040721 3300048929 Bacteria 4306
963 Ga0496126_0057471 3300048929 Bacteria 3512
964 Ga0501032_0001494 3300049569 Bacteria 18671
965 Ga0501034_0016345 3300049571 Bacteria 7616
966 Ga0501034_0020028 3300049571 Bacteria 6833
967 Ga0501036_0007823 3300049572 Bacteria 8744
968 Ga0501037_0000711 3300049573 Bacteria 25295
969 Ga0501038_0000982 3300049574 Bacteria 25589
970 Ga0501038_0060667 3300049574 Bacteria 3236
971 Ga0501039_0000266 3300049575 Bacteria 37974
972 Ga0501039_0055849 3300049575 Bacteria 3059
973 Ga0501043_0000776 3300049579 Bacteria 28344
974 Ga0501043_0106925 3300049579 Bacteria 2197
975 Ga0501070_0001392 3300049586 Bacteria 21651
976 Ga0501077_0091838 3300049593 Bacteria 1924
977 Ga0501035_0086346 3300049822 Bacteria 2765
978 Ga0501044_0045334 3300049823 Bacteria 4556
979 Ga0501044_0125488 3300049823 Bacteria 2564
980 nmdc:mga00v17_1052_c1 3300050491 Bacteria 14588
981 nmdc:mga00v17_25637_c1 3300050491 Bacteria 3428
982 nmdc:mga00v17_353907_c1 3300050491 Bacteria 955
983 nmdc:mga0yw44_185007_c1 3300050492 Bacteria 1372
984 nmdc:mga0yw44_340609_c1 3300050492 Bacteria 1008
985 nmdc:mga05p37_10381_c1 3300050507 Bacteria 11056
986 nmdc:mga05p37_81024_c1 3300050507 Bacteria 3998
987 nmdc:mga05p37_900249_c1 3300050507 Bacteria 954
988 nmdc:mga0qj67_4056_c2 3300050509 Bacteria 4335
989 nmdc:mga0qj67_42026_c1 3300050509 Bacteria 3598
990 nmdc:mga06r32_11739_c1 3300050510 Bacteria 7887
991 nmdc:mga06r32_162452_c1 3300050510 Bacteria 2216
992 nmdc:mga08y16_137477_c1 3300050511 Bacteria 2540
993 nmdc:mga0n895_115915_c1 3300050512 Bacteria 2697
994 nmdc:mga0n895_180649_c1 3300050512 Bacteria 2141
995 nmdc:mga0rr50_626104_c1 3300050513 Bacteria 918
996 nmdc:mga08x19_472159_c1 3300050514 Bacteria 884
997 nmdc:mga08x19_715500_c1 3300050514 Bacteria 711
998 nmdc:mga0sz30_14057_c1 3300050516 Bacteria 3144
999 nmdc:mga0sz30_36736_c1 3300050516 Bacteria 2048
1000 nmdc:mga0sz30_4504_c1 3300050516 Bacteria 5040
1001 nmdc:mga0sz30_91255_c1 3300050516 Bacteria 1325
1002 Ga0495601_0044270 3300053077 Bacteria 2798
1003 Ga0495601_0137338 3300053077 Bacteria 1594
1004 Ga0500635_0064116 3300053080 Bacteria 1290
1005 Ga0495619_0183079 3300053085 Bacteria 1449
1006 Ga0500643_002451 3300053087 Bacteria 9591
1007 Ga0500652_028231 3300053131 Bacteria 2178
1008 Ga0500559_0099413 3300053136 Bacteria 1339
1009 Ga0500604_0108565 3300053151 Bacteria 920
1010 Ga0500645_000004 3300053730 Bacteria 305014
1011 Ga0500645_009385 3300053730 Bacteria 3289
1012 Ga0466962_0083988 3300061719 Bacteria 1523
1013 2515853889 2515154155 Bacteria 7985436
1014 2676473170 2675903058 Bacteria 6822861
1015 2738703296 2738541274 Bacteria 6909446
1016 2738890002 2738541308 Bacteria 7020677
1017 2739329243 2738543028 Bacteria 6917070
1018 2827631765 2827628540 Bacteria 6858585
1019 2929216633 2929212328 Bacteria 7708288
1020 2939585574 2939582691 Bacteria 7088898
1021 Ga0436360_0523085
1022 LJNas_1001704
1023 JGI24746J21847_1006939
1024 JGI24737J22298_10080820
1025 JGI24743J22301_10005600
1026 JGI24750J21931_1006453
1027 JGI24745J21846_1014373
1028 JGI24748J21848_1002589
1029 JGI24749J21850_1004724
1030 JGI24744J21845_10001665
1031 JGI24744J21845_10002839
1032 JGI24742J22300_10000089
1033 JGI25407J50210_10035780
1034 Ga0070658_10720726
1035 Ga0070676_10003176
1036 Ga0070676_10161649
1037 Ga0070683_100072651
1038 Ga0070683_100743751
1039 Ga0070690_100007614
1040 Ga0070690_100053018
1041 Ga0070670_100241920
1042 Ga0068869_100005345
1043 Ga0068869_100007876
1044 Ga0068869_100683287
1045 Ga0070666_10015031
1046 Ga0070680_100169897
1047 Ga0070682_100008251
1048 Ga0070682_100086754
1049 Ga0070682_100101568
1050 Ga0070682_100407004
1051 Ga0070682_100423719
1052 Ga0068868_100000483
1053 Ga0068868_100061428
1054 Ga0068868_100100357
1055 Ga0068868_100187421
1056 Ga0070660_100223097
1057 Ga0070689_100026117
1058 Ga0070689_100131863
1059 Ga0070689_100191197
1060 Ga0070691_10096120
1061 Ga0070691_10171169
1062 Ga0070687_100081954
1063 Ga0070687_100517152
1064 Ga0070661_100016242
1065 Ga0070692_10238053
1066 Ga0070692_10504194
1067 Ga0070668_100000385
1068 Ga0070668_100000558
1069 Ga0070668_100076097
1070 Ga0070668_100114492
1071 Ga0070669_100000960
1072 Ga0070669_100006266
1073 Ga0070671_100006148
1074 Ga0070671_100093668
1075 Ga0070671_100217760
1076 Ga0070674_100004720
1077 Ga0070674_100008272
1078 Ga0070674_100474068
1079 Ga0070673_100058256
1080 Ga0070688_100011279
1081 Ga0070659_100005583
1082 Ga0070659_100154297
1083 Ga0070659_100665490
1084 Ga0070667_100001425
1085 Ga0070667_100002282
1086 Ga0070667_100025244
1087 Ga0070667_100037980
1088 Ga0070667_100166766
1089 Ga0070667_100243518
1090 Ga0070709_10006066
1091 Ga0070709_10010319
1092 Ga0070709_10016027
1093 Ga0070709_10091419
1094 Ga0070709_10265994
1095 Ga0070714_100000805
1096 Ga0070714_100005264
1097 Ga0070714_100069064
1098 Ga0070714_100118280
1099 Ga0070714_100252388
1100 Ga0070714_100342789
1101 Ga0070714_100362049
1102 Ga0070714_100436991
1103 Ga0070713_100000392
1104 Ga0070713_100002559
1105 Ga0070713_100004531
1106 Ga0070713_100042889
1107 Ga0070713_100247106
1108 Ga0070713_100487845
1109 Ga0070713_100670914
1110 Ga0070713_100793720
1111 Ga0070713_100864539
1112 Ga0070713_100942154
1113 Ga0070710_10000240
1114 Ga0070710_10001472
1115 Ga0070710_10003905
1116 Ga0070710_10006432
1117 Ga0070710_10036292
1118 Ga0070710_10064656
1119 Ga0070710_10072604
1120 Ga0070710_10077457
1121 Ga0070701_10001759
1122 Ga0070701_10056189
1123 Ga0070701_10084515
1124 Ga0070711_100000197
1125 Ga0070711_100002538
1126 Ga0070711_100013514
1127 Ga0070711_100017712
1128 Ga0070711_100021255
1129 Ga0070711_100035400
1130 Ga0070711_100037812
1131 Ga0070711_100056451
1132 Ga0070711_100070841
1133 Ga0070711_100088588
1134 Ga0070711_100197176
1135 Ga0070711_100261492
1136 Ga0070711_100336887
1137 Ga0070705_100550294
1138 Ga0070700_100001630
1139 Ga0070708_100035130
1140 Ga0070708_100064357
1141 Ga0070708_100259120
1142 Ga0070708_100398519
1143 Ga0070663_100008356
1144 Ga0070663_100015423
1145 Ga0070663_100072983
1146 Ga0070663_100153793
1147 Ga0070678_100039972
1148 Ga0070662_100013356
1149 Ga0070662_100024583
1150 Ga0070662_100308937
1151 Ga0070681_10100810
1152 Ga0070681_10573554
1153 Ga0068867_100002073
1154 Ga0068867_100170907
1155 Ga0068867_100209512
1156 Ga0070685_10021109
1157 Ga0070685_10038246
1158 Ga0070685_10066726
1159 Ga0070685_10131749
1160 Ga0070706_100066559
1161 Ga0070706_100072683
1162 Ga0070706_100310021
1163 Ga0070707_100072548
1164 Ga0070707_100168156
1165 Ga0070707_100258890
1166 Ga0070707_100416688
1167 Ga0070698_100026365
1168 Ga0070698_100118676
1169 Ga0070698_100492266
1170 Ga0070698_100545338
1171 Ga0070699_100095029
1172 Ga0070679_100100988
1173 Ga0070697_100052226
1174 Ga0068853_100029215
1175 Ga0068853_100135999
1176 Ga0070672_100159837
1177 Ga0070686_100160315
1178 Ga0070686_100176158
1179 Ga0070695_100025441
1180 Ga0070695_100070423
1181 Ga0070696_100016686
1182 Ga0070696_100082778
1183 Ga0070696_100265618
1184 Ga0070693_100006772
1185 Ga0070693_100059516
1186 Ga0070693_100190642
1187 Ga0070693_100330094
1188 Ga0070665_100024629
1189 Ga0070665_100030158
1190 Ga0070665_100045778
1191 Ga0070665_100049147
1192 Ga0070665_100064333
1193 Ga0070665_100102507
1194 Ga0070665_100161578
1195 Ga0070665_100323313
1196 Ga0070704_100000219
1197 Ga0070704_100122631
1198 Ga0070704_100291480
1199 Ga0068855_100414973
1200 Ga0068857_100117496
1201 Ga0068854_100524179
1202 Ga0068856_100867339
1203 Ga0070702_100002876
1204 Ga0070702_100099352
1205 Ga0070702_100151373
1206 Ga0068852_100094596
1207 Ga0068852_100568448
1208 Ga0068859_100004636
1209 Ga0068859_100028702
1210 Ga0068859_100075497
1211 Ga0068859_100579726
1212 Ga0068859_100768976
1213 Ga0068864_100027786
1214 Ga0068864_100563305
1215 Ga0068864_101150187
1216 Ga0068866_10000870
1217 Ga0068861_100002108
1218 Ga0068861_100041041
1219 Ga0068861_100079048
1220 Ga0068851_10157067
1221 Ga0068863_100001428
1222 Ga0068863_100023450
1223 Ga0068863_100067753
1224 Ga0068863_100765393
1225 Ga0068858_100004100
1226 Ga0068858_100051932
1227 Ga0068858_100197757
1228 Ga0068858_100913898
1229 Ga0068860_100002016
1230 Ga0068860_100309536
1231 Ga0068860_100596966
1232 Ga0068860_100710674
1233 Ga0068862_100000035
1234 Ga0068862_100031914
1235 Ga0068862_100146506
1236 Ga0068862_100507602
1237 Ga0081455_10018519
1238 Ga0081455_10087009
1239 Ga0081455_10228632
1240 Ga0081455_10233712
1241 Ga0081538_10007006
1242 Ga0081538_10043959
1243 Ga0081538_10045432
1244 Ga0081540_1000009
1245 Ga0081539_10000062
1246 Ga0070717_10004522
1247 Ga0070717_10051350
1248 Ga0070717_10055216
1249 Ga0070717_10059483
1250 Ga0070717_10144573
1251 Ga0070717_10280244
1252 Ga0070717_10402902
1253 Ga0070717_10427115
1254 Ga0070717_10515281
1255 Ga0075365_10384636
1256 Ga0075364_10003712
1257 Ga0070715_10004251
1258 Ga0070715_10015088
1259 Ga0070715_10032910
1260 Ga0070715_10042024
1261 Ga0070716_100000575
1262 Ga0070716_100003527
1263 Ga0070716_100033836
1264 Ga0070716_100034863
1265 Ga0070716_100050846
1266 Ga0070716_100127413
1267 Ga0070716_100401132
1268 Ga0070712_100000786
1269 Ga0070712_100003582
1270 Ga0070712_100012910
1271 Ga0070712_100064838
1272 Ga0070712_100125473
1273 Ga0070712_100190405
1274 Ga0070712_100207045
1275 Ga0070712_100213747
1276 Ga0070712_100308529
1277 Ga0070712_100806827
1278 Ga0075369_10001795
1279 Ga0075369_10007848
1280 Ga0075369_10081123
1281 Ga0097621_100034412
1282 Ga0097621_100145757
1283 Ga0075370_10104698
1284 Ga0068871_100092288
1285 Ga0075428_100011120
1286 Ga0075428_100089634
1287 Ga0075428_101123179
1288 Ga0075430_100008192
1289 Ga0075430_100062522
1290 Ga0075430_100746655
1291 Ga0075431_100009394
1292 Ga0075434_100123168
1293 Ga0075434_100762108
1294 Ga0068865_100002144
1295 Ga0068865_100171913
1296 Ga0068865_100856540
1297 Ga0075436_100166312
1298 Ga0097620_100004636
1299 Ga0097620_100028703
1300 Ga0097620_100075497
1301 Ga0097620_100579727
1302 Ga0097620_100768963
1303 Ga0075435_100483832
1304 Ga0099795_10096589
1305 Ga0105251_10078044
1306 Ga0105250_10129087
1307 Ga0105240_10143743
1308 Ga0105240_10162993
1309 Ga0111539_10158605
1310 Ga0105245_10012028
1311 Ga0105245_10026860
1312 Ga0105245_10116451
1313 Ga0105245_10157101
1314 Ga0105245_10251556
1315 Ga0105245_10389688
1316 Ga0105245_10467739
1317 Ga0105247_10000952
1318 Ga0105247_10005574
1319 Ga0114129_10001008
1320 Ga0114129_10377857
1321 Ga0114129_10378107
1322 Ga0114129_10467018
1323 Ga0114129_10658569
1324 Ga0114129_11244674
1325 Ga0114129_11438542
1326 Ga0114129_11595288
1327 Ga0105243_10002044
1328 Ga0105243_10099360
1329 Ga0105243_10422431
1330 Ga0105241_10032842
1331 Ga0105241_10314121
1332 Ga0105241_10544282
1333 Ga0105242_10000373
1334 Ga0105242_10081903
1335 Ga0105242_10304416
1336 Ga0105242_10370373
1337 Ga0105242_10632427
1338 Ga0105248_10002237
1339 Ga0105248_10025822
1340 Ga0105248_10917920
1341 Ga0105248_11633343
1342 Ga0105237_10122503
1343 Ga0105237_10172256
1344 Ga0105237_10718738
1345 Ga0105237_11138217
1346 Ga0105249_10000046
1347 Ga0105249_10002144
1348 Ga0105249_10021311
1349 Ga0105249_10055721
1350 Ga0105249_10275817
1351 Ga0105249_10291520
1352 Ga0105249_10566629
1353 Ga0105249_10707101
1354 Ga0105239_10031982
1355 Ga0105239_10229779
1356 Ga0105239_10461828
1357 Ga0105239_10620477
1358 Ga0105239_10804595
1359 Ga0105239_11426624
1360 Ga0157329_1002048
1361 Ga0157341_1003699
1362 Ga0157313_1001835
1363 Ga0157342_1000461
1364 Ga0157373_10248874
1365 Ga0157371_10221018
1366 Ga0157371_10506486
1367 Ga0157369_10091807
1368 Ga0157369_10435526
1369 Ga0157369_10860336
1370 Ga0157374_10112070
1371 Ga0157374_10855036
1372 Ga0157378_10003240
1373 Ga0157378_10040034
1374 Ga0157378_10185843
1375 Ga0157378_10742103
1376 Ga0163162_10007730
1377 Ga0163162_10107172
1378 Ga0163162_10427716
1379 Ga0163162_10680281
1380 Ga0157372_10012120
1381 Ga0157372_10348223
1382 Ga0157372_10490706
1383 Ga0157372_10819347
1384 Ga0157375_10000487
1385 Ga0157375_10114525
1386 Ga0157375_10220901
1387 Ga0157375_10317600
1388 Ga0157375_10730282
1389 Ga0157375_10923453
1390 Ga0157375_11100176
1391 Ga0157375_11799280
1392 Ga0163163_10020015
1393 Ga0163163_10030667
1394 Ga0163163_10087848
1395 Ga0157380_10000989
1396 Ga0157380_10053351
1397 Ga0157377_10153706
1398 Ga0157379_10136346
1399 Ga0157379_10271024
1400 Ga0157376_10022726
1401 Ga0182005_1032735
1402 Ga0163161_10005652
1403 Ga0163161_10007739
1404 Ga0163161_10336651
1405 Ga0206354_11547857
1406 Ga0213875_10041147
1407 Ga0213875_10069811
1408 Ga0224712_10023447
1409 Ga0224572_1002087
1410 Ga0207653_10017017
1411 Ga0207692_10000678
1412 Ga0207692_10000889
1413 Ga0207692_10004462
1414 Ga0207692_10026141
1415 Ga0207692_10077385
1416 Ga0207692_10087266
1417 Ga0207692_10097273
1418 Ga0207692_10254748
1419 Ga0207642_10000231
1420 Ga0207642_10028634
1421 Ga0207642_10030983
1422 Ga0207710_10000153
1423 Ga0207710_10007850
1424 Ga0207710_10055404
1425 Ga0207688_10003373
1426 Ga0207688_10003437
1427 Ga0207688_10005363
1428 Ga0207688_10010533
1429 Ga0207688_10028536
1430 Ga0207688_10084926
1431 Ga0207680_10163742
1432 Ga0207647_10007734
1433 Ga0207647_10031359
1434 Ga0207647_10071882
1435 Ga0207685_10023232
1436 Ga0207685_10034954
1437 Ga0207685_10036183
1438 Ga0207685_10129877
1439 Ga0207699_10000205
1440 Ga0207699_10002986
1441 Ga0207699_10012801
1442 Ga0207699_10027176
1443 Ga0207699_10033147
1444 Ga0207699_10136811
1445 Ga0207699_10142157
1446 Ga0207699_10330717
1447 Ga0207645_10036125
1448 Ga0207645_10112267
1449 Ga0207643_10001272
1450 Ga0207684_10057381
1451 Ga0207684_10487879
1452 Ga0207654_10025312
1453 Ga0207654_10098494
1454 Ga0207671_10015516
1455 Ga0207671_10263383
1456 Ga0207671_10707001
1457 Ga0207693_10000355
1458 Ga0207693_10002200
1459 Ga0207693_10006667
1460 Ga0207693_10008293
1461 Ga0207693_10008945
1462 Ga0207693_10027108
1463 Ga0207693_10079956
1464 Ga0207693_10092279
1465 Ga0207693_10100871
1466 Ga0207693_10235819
1467 Ga0207693_10341396
1468 Ga0207663_10004333
1469 Ga0207663_10012575
1470 Ga0207663_10013199
1471 Ga0207663_10020576
1472 Ga0207663_10027871
1473 Ga0207663_10028380
1474 Ga0207663_10046506
1475 Ga0207663_10057636
1476 Ga0207663_10116797
1477 Ga0207660_10352138
1478 Ga0207662_10025722
1479 Ga0207662_10310882
1480 Ga0207657_10191457
1481 Ga0207657_10194640
1482 Ga0207649_10694601
1483 Ga0207646_10010946
1484 Ga0207646_10053722
1485 Ga0207646_10076070
1486 Ga0207646_10112214
1487 Ga0207646_10213347
1488 Ga0207646_10351443
1489 Ga0207646_10654147
1490 Ga0207681_10000615
1491 Ga0207681_10007134
1492 Ga0207681_10370496
1493 Ga0207681_10384161
1494 Ga0207650_10734643
1495 Ga0207687_10001302
1496 Ga0207687_10037386
1497 Ga0207687_10057611
1498 Ga0207687_10062671
1499 Ga0207687_10082234
1500 Ga0207687_10113333
1501 Ga0207687_10755419
1502 Ga0207700_10000171
1503 Ga0207700_10047773
1504 Ga0207700_10050731
1505 Ga0207700_10057550
1506 Ga0207700_10108780
1507 Ga0207700_10118770
1508 Ga0207700_10179637
1509 Ga0207700_10212207
1510 Ga0207700_10589015
1511 Ga0207664_10001768
1512 Ga0207664_10014960
1513 Ga0207664_10021138
1514 Ga0207664_10035023
1515 Ga0207664_10041588
1516 Ga0207664_10044912
1517 Ga0207664_10054296
1518 Ga0207664_10060648
1519 Ga0207664_10080310
1520 Ga0207664_10105222
1521 Ga0207664_10377789
1522 Ga0207644_10331031
1523 Ga0207644_10415168
1524 Ga0207690_10040271
1525 Ga0207690_10218791
1526 Ga0207706_10006718
1527 Ga0207706_10027319
1528 Ga0207706_10041447
1529 Ga0207706_10044707
1530 Ga0207686_10008241
1531 Ga0207686_10178073
1532 Ga0207709_10002257
1533 Ga0207709_10163190
1534 Ga0207709_10206561
1535 Ga0207670_10133049
1536 Ga0207669_10057151
1537 Ga0207669_10063093
1538 Ga0207669_10454445
1539 Ga0207704_10001019
1540 Ga0207704_10206690
1541 Ga0207704_10217541
1542 Ga0207665_10001616
1543 Ga0207665_10004106
1544 Ga0207665_10004322
1545 Ga0207665_10017844
1546 Ga0207665_10030413
1547 Ga0207665_10040916
1548 Ga0207665_10110673
1549 Ga0207691_10005983
1550 Ga0207691_10063467
1551 Ga0207711_10001535
1552 Ga0207711_10012911
1553 Ga0207711_10410687
1554 Ga0207689_10001836
1555 Ga0207689_10003085
1556 Ga0207689_10009603
1557 Ga0207689_10079292
1558 Ga0207661_10085125
1559 Ga0207661_10476611
1560 Ga0207651_10132741
1561 Ga0207651_10212092
1562 Ga0207712_10000042
1563 Ga0207712_10003564
1564 Ga0207712_10100331
1565 Ga0207712_10187069
1566 Ga0207712_10197764
1567 Ga0207668_10001287
1568 Ga0207668_10011615
1569 Ga0207668_10212358
1570 Ga0207668_10288767
1571 Ga0207640_10012123
1572 Ga0207640_10069835
1573 Ga0207658_10000377
1574 Ga0207658_10001454
1575 Ga0207658_10006137
1576 Ga0207658_10201140
1577 Ga0207658_10336987
1578 Ga0207677_10000670
1579 Ga0207677_10035276
1580 Ga0207677_10084246
1581 Ga0207677_10665922
1582 Ga0207703_10004329
1583 Ga0207703_10005964
1584 Ga0207703_10047195
1585 Ga0207703_10190521
1586 Ga0207639_10024650
1587 Ga0207678_10005601
1588 Ga0207678_10010855
1589 Ga0207678_10013818
1590 Ga0207678_10176415
1591 Ga0207708_10003270
1592 Ga0207708_10011001
1593 Ga0207708_10028032
1594 Ga0207708_10072259
1595 Ga0207702_10072036
1596 Ga0207702_10192978
1597 Ga0207702_10260053
1598 Ga0207641_10001215
1599 Ga0207641_10008290
1600 Ga0207641_10032028
1601 Ga0207641_10051429
1602 Ga0207641_10198841
1603 Ga0207648_10000671
1604 Ga0207648_10035258
1605 Ga0207648_10309793
1606 Ga0207676_10074756
1607 Ga0207676_10296180
1608 Ga0207676_10374935
1609 Ga0207674_10161727
1610 Ga0207674_10394680
1611 Ga0207675_100000388
1612 Ga0207675_100019325
1613 Ga0207675_100120596
1614 Ga0207683_10006709
1615 Ga0207683_10006989
1616 Ga0207683_10086132
1617 Ga0207683_10236611
1618 Ga0207698_10053929
1619 Ga0207698_10127881
1620 Ga0207698_10530574
1621 Ga0268266_10013359
1622 Ga0268266_10021397
1623 Ga0268266_10035706
1624 Ga0268265_10000051
1625 Ga0268265_10022066
1626 Ga0268265_10098077
1627 Ga0268265_10153781
1628 Ga0268265_10334430
1629 Ga0268265_10608311
1630 Ga0268264_10000108
1631 Ga0268264_10091040
1632 Ga0265327_10011353
1633 Ga0307513_10045574
1634 Ga0307513_10226026
1635 Ga0307408_100031410
1636 Ga0307408_100409066
1637 Ga0307405_10056800
1638 Ga0307405_10072792
1639 Ga0307413_10064657
1640 Ga0307413_10141922
1641 Ga0307410_10045488
1642 Ga0307410_10124108
1643 Ga0307406_10023171
1644 Ga0307407_10465665
1645 Ga0307412_10009683
1646 Ga0307412_10250032
1647 Ga0307409_100004802
1648 Ga0307416_100006312
1649 Ga0307416_100288254
1650 Ga0307416_100947558
1651 Ga0307414_10161705
1652 Ga0307411_10127113
1653 Ga0307411_10365507
1654 Ga0307415_100019600
1655 Ga0307415_100041593
1656 Ga0307415_100079663
1657 Ga0373950_0024350
1658 Ga0373926_0003753
1659 Ga0373926_0047736
1660 Ga0373928_0033975
1661 Ga0373929_0029965
1662 Ga0373934_0019071
1663 Ga0373934_0073268
1664 Ga0373940_0017273
1665 Ga0373944_0005556
1666 Ga0373923_0010842
1667 Ga0373923_0035279
1668 Ga0373923_0159153
1669 Ga0373932_0063305
1670 Ga0373936_0007284
1671 Ga0373939_0003646
1672 Ga0373945_0006316
1673 Ga0373953_0015691
1674 Ga0373953_0129371
1675 Ga0373956_0020753
1676 Ga0373957_0018421
1677 Ga0373957_0065598
1678 Ga0373943_0000792
1679 Ga0373943_0174365
1680 Ga0373946_0000743
1681 Ga0373946_0064031
1682 Ga0373955_0010188
1683 Ga0373955_0021302
1684 Ga0373955_0152074
1685 Ga0373962_0059804
1686 Ga0373924_0060383
1687 Ga0373931_0011349
1688 Ga0373931_0131659
1689 Ga0373931_0138039
1690 Ga0373931_0267841
1691 Ga0373935_0004837
1692 Ga0373935_0083939
1693 Ga0373935_0125177
1694 Ga0373927_0005172
1695 Ga0373933_0017926
1696 Ga0373933_0044510
1697 Ga0373947_0005102
1698 Ga0373937_0018158
1699 Ga0373937_0026771
1700 Ga0373937_0255278
1701 Ga0373925_0003276
1702 Ga0373925_0135900
1703 Ga0373925_0573789
1704 Ga0395899_0033538
1705 Ga0395900_0006143
1706 Ga0395900_0029126
1707 Ga0395900_0094100
1708 Ga0395900_0143943
1709 Ga0395898_0653047
1710 Ga0395898_1045153
1711 Ga0395905_0019411
1712 Ga0395905_0812078
1713 Ga0436364_0280192
1714 Ga0436364_0563277
1715 Ga0436364_0707129
1716 Ga0436364_0900715
1717 Ga0395901_0002571
1718 Ga0395901_0155900
1719 Ga0395901_0272469
1720 Ga0436363_0833973
1721 Ga0436362_0856774
1722 Ga0439461_0002411
1723 Ga0439466_0011732
1724 Ga0439466_0012636
1725 Ga0439466_0099318
1726 Ga0439465_0004694
1727 Ga0439465_0005800
1728 Ga0439465_0046231
1729 Ga0451837_0445302
1730 Ga0439431_0022379
1731 Ga0439431_0034190
1732 Ga0439442_027703
1733 Ga0439445_0005864
1734 Ga0439448_0015918
1735 Ga0439448_0104706
1736 Ga0439450_054337
1737 Ga0439451_018400
1738 Ga0439454_007151
1739 Ga0439455_0018222
1740 Ga0439463_012673
1741 Ga0439463_041305
1742 Ga0439463_046496
1743 Ga0439463_062357
1744 Ga0450902_021180
1745 Ga0450910_043965
1746 Ga0439434_0045819
1747 Ga0439444_0008585
1748 Ga0439464_0015335
1749 Ga0439464_0028315
1750 Ga0439460_0068431
1751 Ga0466972_0051121
1752 Ga0466972_0136600
1753 Ga0466972_0148245
1754 Ga0466965_0008107
1755 Ga0466965_0073507
1756 Ga0466965_0088331
1757 Ga0466966_0076967
1758 Ga0466966_0083159
1759 Ga0466961_0002733
1760 Ga0466961_0077260
1761 Ga0466968_0013935
1762 Ga0466968_0036733
1763 Ga0466970_0045395
1764 Ga0466970_0054011
1765 Ga0466970_0072757
1766 Ga0466970_0076952
1767 Ga0466957_0012179
1768 Ga0466957_0022295
1769 Ga0466957_0176516
1770 Ga0466960_0000113
1771 Ga0466960_0021687
1772 Ga0466960_0171124
1773 Ga0466960_0172022
1774 Ga0466959_0004571
1775 Ga0466959_0006274
1776 Ga0466959_0010862
1777 Ga0466959_0200347
1778 Ga0466958_0109914
1779 Ga0466958_0115277
1780 Ga0466958_0330364
1781 Ga0466967_0117224
1782 Ga0495592_0122873
1783 Ga0495592_0163625
1784 Ga0495603_0433663
1785 Ga0495638_0000446
1786 Ga0495641_0041566
1787 Ga0495641_0155630
1788 Ga0495651_0020376
1789 Ga0495651_0042965
1790 Ga0495651_0062515
1791 Ga0495651_0159977
1792 Ga0495653_0012013
1793 Ga0495653_0028807
1794 Ga0495580_0302318
1795 Ga0495582_0144865
1796 Ga0495664_0002773
1797 Ga0495664_0050945
1798 Ga0495596_0121585
1799 Ga0495608_0028095
1800 Ga0495608_0072530
1801 Ga0495618_0024728
1802 Ga0495618_0042412
1803 Ga0495618_0156086
1804 Ga0495628_0058918
1805 Ga0495628_0080519
1806 Ga0495628_0133166
1807 Ga0495628_0221016
1808 Ga0495630_0027453
1809 Ga0495630_0251156
1810 Ga0495630_0643041
1811 Ga0495644_0074041
1812 Ga0495652_0050156
1813 Ga0495652_0052635
1814 Ga0495654_0197639
1815 Ga0495665_0002954
1816 Ga0495665_0003630
1817 Ga0495640_0085787
1818 Ga0495587_0040206
1819 Ga0495587_0053611
1820 Ga0495645_0100297
1821 Ga0495645_0116450
1822 Ga0495645_0420540
1823 Ga0495667_0005958
1824 Ga0495667_0010235
1825 Ga0495667_0031038
1826 Ga0495667_0116483
1827 Ga0495634_0028024
1828 Ga0495634_0207242
1829 Ga0495634_0215788
1830 Ga0495625_0273930
1831 Ga0495635_0001859
1832 Ga0495635_0019489
1833 Ga0495635_0029558
1834 Ga0495635_0034826
1835 Ga0495657_0009701
1836 Ga0495657_0043596
1837 Ga0495657_0084786
1838 Ga0495599_0052805
1839 Ga0495599_0061181
1840 Ga0495623_0108871
1841 Ga0495613_0155784
1842 Ga0495624_0002363
1843 Ga0495600_0219197
1844 Ga0495600_0225025
1845 Ga0495581_0020267
1846 Ga0495581_0085238
1847 Ga0495604_0107154
1848 Ga0495604_0220813
1849 Ga0495674_0001119
1850 Ga0495674_0028758
1851 Ga0495674_0524890
1852 Ga0495672_0012959
1853 Ga0495672_0015435
1854 Ga0495672_0207443
1855 Ga0495676_0052512
1856 Ga0495680_0050452
1857 Ga0495680_0053811
1858 Ga0495675_0039590
1859 Ga0495675_0060719
1860 Ga0495673_0000640
1861 Ga0495684_0002878
1862 Ga0495684_0020977
1863 Ga0495684_0045583
1864 Ga0495593_0399587
1865 Ga0495602_0164985
1866 Ga0496100_0001433
1867 Ga0496100_0024697
1868 Ga0496100_0084433
1869 Ga0496100_0131253
1870 Ga0496100_0166764
1871 Ga0496101_0000878
1872 Ga0496101_0004040
1873 Ga0496101_0004844
1874 Ga0496101_0018373
1875 Ga0496102_0000131
1876 Ga0496102_0009118
1877 Ga0496102_0021846
1878 Ga0496102_0051939
1879 Ga0496102_0188374
1880 Ga0496102_0257849
1881 Ga0496102_0320987
1882 Ga0496102_0488419
1883 Ga0496103_0000584
1884 Ga0496103_0000859
1885 Ga0496103_0024140
1886 Ga0496103_0063151
1887 Ga0496103_0094575
1888 Ga0496103_0156845
1889 Ga0496103_0270566
1890 Ga0496103_0348169
1891 Ga0496104_0002120
1892 Ga0496104_0006446
1893 Ga0496104_0030846
1894 Ga0496104_0041539
1895 Ga0496104_0060438
1896 Ga0496104_0122217
1897 Ga0496104_0157959
1898 Ga0496104_0295543
1899 Ga0496104_0401072
1900 Ga0496105_0006239
1901 Ga0496105_0017484
1902 Ga0496105_0018109
1903 Ga0496105_0045646
1904 Ga0496105_0308435
1905 Ga0496106_0000264
1906 Ga0496106_0079176
1907 Ga0496106_0200729
1908 Ga0496106_0245935
1909 Ga0496106_0246570
1910 Ga0496106_0313844
1911 Ga0496106_0940860
1912 Ga0496107_0002087
1913 Ga0496107_0011379
1914 Ga0496107_0028090
1915 Ga0496107_0035884
1916 Ga0496107_0110024
1917 Ga0496107_0192125
1918 Ga0496108_0000246
1919 Ga0496108_0004292
1920 Ga0496108_0042719
1921 Ga0496108_0096422
1922 Ga0496108_0100491
1923 Ga0496108_0182188
1924 Ga0496108_0198094
1925 Ga0496108_0236291
1926 Ga0496109_0004032
1927 Ga0496109_0005253
1928 Ga0496109_0038359
1929 Ga0496109_0038784
1930 Ga0496109_0086397
1931 Ga0496109_0129500
1932 Ga0496109_0178112
1933 Ga0496109_0409943
1934 Ga0496109_0678687
1935 Ga0496109_0761813
1936 Ga0496110_0021997
1937 Ga0496110_0023699
1938 Ga0496110_0024081
1939 Ga0496110_0124483
1940 Ga0496110_0160975
1941 Ga0496110_0196799
1942 Ga0496110_0360661
1943 Ga0496111_0014763
1944 Ga0496111_0028674
1945 Ga0496111_0053090
1946 Ga0496111_0169926
1947 Ga0496111_0254065
1948 Ga0496111_0285548
1949 Ga0496112_0008267
1950 Ga0496112_0031603
1951 Ga0496112_0058709
1952 Ga0496112_0145847
1953 Ga0496112_0221222
1954 Ga0496112_0690967
1955 Ga0496112_0815583
1956 Ga0496112_0838482
1957 Ga0496113_0015679
1958 Ga0496113_0016219
1959 Ga0496113_0396777
1960 Ga0496114_0006511
1961 Ga0496114_0050846
1962 Ga0496114_0088884
1963 Ga0496114_0103965
1964 Ga0496114_0312675
1965 Ga0496114_0488034
1966 Ga0496115_0002052
1967 Ga0496115_0002133
1968 Ga0496115_0013228
1969 Ga0496115_0087064
1970 Ga0496115_0113465
1971 Ga0496115_0186352
1972 Ga0496115_0277232
1973 Ga0496115_0277607
1974 Ga0496115_0592942
1975 Ga0496116_0002121
1976 Ga0496117_0002770
1977 Ga0496118_0002961
1978 Ga0496120_0007762
1979 Ga0496121_0010397
1980 Ga0496126_0005120
1981 Ga0496126_0033996
1982 Ga0496126_0040721
1983 Ga0496126_0057471
1984 Ga0501032_0001494
1985 Ga0501034_0016345
1986 Ga0501034_0020028
1987 Ga0501036_0007823
1988 Ga0501037_0000711
1989 Ga0501038_0000982
1990 Ga0501038_0060667
1991 Ga0501039_0000266
1992 Ga0501039_0055849
1993 Ga0501043_0000776
1994 Ga0501043_0106925
1995 Ga0501070_0001392
1996 Ga0501077_0091838
1997 Ga0501035_0086346
1998 Ga0501044_0045334
1999 Ga0501044_0125488
2000 nmdc:mga00v17_1052_c1
2001 nmdc:mga00v17_25637_c1
2002 nmdc:mga00v17_353907_c1
2003 nmdc:mga0yw44_185007_c1
2004 nmdc:mga0yw44_340609_c1
2005 nmdc:mga05p37_10381_c1
2006 nmdc:mga05p37_81024_c1
2007 nmdc:mga05p37_900249_c1
2008 nmdc:mga0qj67_4056_c2
2009 nmdc:mga0qj67_42026_c1
2010 nmdc:mga06r32_11739_c1
2011 nmdc:mga06r32_162452_c1
2012 nmdc:mga08y16_137477_c1
2013 nmdc:mga0n895_115915_c1
2014 nmdc:mga0n895_180649_c1
2015 nmdc:mga0rr50_626104_c1
2016 nmdc:mga08x19_472159_c1
2017 nmdc:mga08x19_715500_c1
2018 nmdc:mga0sz30_14057_c1
2019 nmdc:mga0sz30_36736_c1
2020 nmdc:mga0sz30_4504_c1
2021 nmdc:mga0sz30_91255_c1
2022 Ga0495601_0044270
2023 Ga0495601_0137338
2024 Ga0500635_0064116
2025 Ga0495619_0183079
2026 Ga0500643_002451
2027 Ga0500652_028231
2028 Ga0500559_0099413
2029 Ga0500604_0108565
2030 Ga0500645_000004
2031 Ga0500645_009385
2032 Ga0466962_0083988
2033 2515853889
2034 2676473170
2035 2738703296
2036 2738890002
2037 2739329243
2038 2827631765
2039 2929216633
2040 2939585574

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

22

122

0.95

PF00196

GerE

Bacterial regulatory proteins, luxR family

143

194

0.95

PF08281

Sigma70_r4_2

Sigma-70, region 4

141

187

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7x1k-assembly1.cif.gz_B crystal structure of the flagellar expression regulator degu from listeria monocytogenes 0.9682 153 215
4qic-assembly1.cif.gz_A co-crystal structure of anti-anti-sigma factor phyr complexed with anti-sigma factor nepr from bartonella quintana 0.9535 3 76
7ve5-assembly1.cif.gz_B c-terminal domain of vrar 0.9535 153 215
4wsz-assembly1.cif.gz_A crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9526 153 215
4wsz-assembly1.cif.gz_B crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9524 153 215
ID Description Score Start End Superfamily
4hyeB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9563 153 216 1.10.10.10
af_P06993_830_894_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9486 153 217 1.10.10.10
4qicC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9462 5 76 3.40.50.2300
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9458 4 87 3.40.50.2300
4if4B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9446 153 215 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1I2SCA5-F1-model_v4 Response regulator receiver domain-containing protein 0.9893 3 136 GO:0000160
GO:0003677
AF-A0A538JGH7-F1-model_v4 Response regulator 0.9835 1 134 GO:0000160
GO:0004016
GO:0009190
AF-A9WTE0-F1-model_v4 Two-component response regulator 0.983 1 92 GO:0000160
AF-A0A260LY16-F1-model_v4 Response regulatory domain-containing protein 0.9804 1 89 GO:0000160
GO:0003677
AF-A0A7Y5X430-F1-model_v4 Response regulator 0.9795 3 142 GO:0000160
GO:0004016
GO:0009190

Map