F488409

General Info

Members Datasets Scaffolds Average Seq Length
1022 563 886 39

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10266104|rootH1_102661041
Length 41
Sequence MARKKPLPSSFDVHGDLKTDYALIATGVGAALIALAYLLLI

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
5 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
6 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
7 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
8 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
9 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
10 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
11 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
12 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
13 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
14 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
15 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
16 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
17 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
18 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
19 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
20 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
21 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
22 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
23 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
24 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
25 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
26 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
27 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
28 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
29 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
30 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
31 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
32 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
33 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
34 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
35 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
36 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
37 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
38 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
39 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
40 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
41 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
42 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
43 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
44 2922368715
45 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
46 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
47 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
48 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
49 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
50 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
51 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
52 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
53 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
54 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
55 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
56 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
57 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
58 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
59 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
60 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
61 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
62 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
63 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
64 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
65 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
66 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
67 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
68 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
69 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
70 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
71 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
72 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
73 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
74 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
75 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
76 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
77 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
78 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
79 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
80 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
81 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
82 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
83 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
84 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
85 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
86 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
87 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
88 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
89 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
90 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
91 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
92 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
93 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
94 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
95 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
96 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
97 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
98 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
99 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
100 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
101 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
102 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
103 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
104 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
105 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
106 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
107 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
108 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
109 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
110 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
111 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
112 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
113 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
114 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
115 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
116 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
117 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
119 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
120 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
121 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
122 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
123 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
124 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
125 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
126 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
127 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
128 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
129 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
130 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
131 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
132 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
133 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
134 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
135 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
136 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
137 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
138 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
139 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
140 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
141 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
142 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
143 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
144 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
145 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
146 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
147 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
148 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
149 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
150 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
151 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
152 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
153 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
154 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
155 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
156 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
157 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
158 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
159 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
160 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
161 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
162 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
163 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
164 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
165 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
166 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
167 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
168 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
169 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
170 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
171 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
172 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
173 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
174 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
175 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
176 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
177 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
178 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
179 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
180 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
181 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
182 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
183 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
184 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
185 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
186 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
187 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
188 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
189 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
190 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
191 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
192 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
193 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
194 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
195 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
196 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
197 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
198 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
199 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
200 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
201 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
202 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
203 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
204 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
205 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
206 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
207 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
208 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
209 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
210 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
211 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
212 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
213 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
214 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
215 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
216 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
217 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
218 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
219 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
220 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
221 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
222 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
223 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
224 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
225 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
226 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
227 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
228 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
229 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
230 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
231 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
232 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
233 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
234 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
235 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
237 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
297 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
300 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
301 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300030942 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
304 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
305 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
306 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
307 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
308 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
309 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
310 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
311 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
312 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
313 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
314 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
315 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
316 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
317 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
318 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
319 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
320 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
321 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
322 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
323 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
324 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
325 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
326 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
327 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
328 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
329 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
330 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
331 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
332 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
333 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
334 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
335 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
336 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
337 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
338 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
339 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
340 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
341 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
342 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
343 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
344 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
345 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
346 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
347 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
348 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
349 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
350 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
351 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
352 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
353 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
354 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
355 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
356 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
357 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
358 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
359 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
360 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
361 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
362 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
363 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
364 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
365 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
366 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
367 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
368 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
369 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
370 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
371 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
372 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
373 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
374 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
375 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
376 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
377 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
378 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
379 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
380 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
381 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
382 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
383 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
384 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
385 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
386 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
387 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
388 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
389 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
390 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
391 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
392 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
393 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
394 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
395 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
396 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
397 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
398 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
399 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
400 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
401 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
402 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
403 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
404 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
405 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
406 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
407 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
408 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
409 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
410 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
411 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
412 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
413 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
414 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
415 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
416 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
417 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
418 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
419 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
420 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
421 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
422 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
423 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
424 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
425 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
426 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
427 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
428 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
429 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
430 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
431 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
432 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
433 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
434 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
435 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
436 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
437 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
438 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
439 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
440 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
441 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
442 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
443 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
444 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
445 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
446 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
447 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
448 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
449 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
450 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
451 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
452 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
453 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
454 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
455 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
456 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
457 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
458 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
459 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
460 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
461 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
462 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
463 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
464 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
465 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
466 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
467 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
468 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
469 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
470 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
471 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
472 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
473 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
474 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
475 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
476 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
477 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
478 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
479 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
480 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
481 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
482 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
483 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
484 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
485 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
486 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
487 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
488 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
489 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
490 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
491 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
492 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
493 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
494 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
495 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
496 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
497 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
498 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
499 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
500 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
501 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
502 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
503 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
504 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
505 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
506 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
507 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
508 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
509 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
510 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
511 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
512 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
513 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
514 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
515 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
516 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
517 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
518 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
519 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
520 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
521 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
522 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
523 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
524 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
525 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
526 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
527 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
528 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
529 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
530 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
531 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
532 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
533 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
534 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
535 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
536 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
537 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
538 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
539 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
540 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
541 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
542 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
543 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
544 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
545 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
546 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
547 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
548 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
549 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
550 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
551 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
552 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
553 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
554 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
555 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
556 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
557 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
558 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
559 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
560 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
561 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
562 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
563 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.01
Metatranscriptomes 1.67
Isolates 13.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.51
Nodule 11.15
Rhizoplane 7.14
Rhizosphere 55.38
Stem 0
Stem Tuber 0
Unclassified 8.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1018433 3300003214 Bacteria 924
2 JGI25153J46596_10001071 3300003215 Bacteria 16690
3 JGI25153J46596_10004997 3300003215 Bacteria 7038
4 JGI25153J46596_10018434 3300003215 Bacteria 2711
5 rootH2_10054880 3300003320 Bacteria 1020
6 rootH1_10075224 3300003316 Bacteria 2738
7 rootH1_10075224 3300003323 Bacteria 1036
8 rootH1_10266104 3300003323 Bacteria 1127
9 JGI25160J50197_1057316 3300003354 Bacteria 794
10 JGI25161J50226_1028467 3300003374 Bacteria 539
11 Ga0055526_1046218 3300003771 Bacteria 1034
12 Ga0055531_10008210 3300003794 Bacteria 5557
13 Ga0055543_1017391 3300004625 Bacteria 1354
14 Ga0058861_11227095 3300004800 Bacteria 502
15 Ga0065165_1002328 3300005262 Bacteria 16613
16 Ga0065165_1012598 3300005262 Bacteria 3430
17 Ga0070658_10215300 3300005327 Bacteria 1623
18 Ga0070670_100355359 3300005331 Bacteria 1288
19 Ga0070670_101528595 3300005331 Unclassified 613
20 Ga0070677_10378685 3300005333 Unclassified 740
21 Ga0068869_100144215 3300005334 Bacteria 1842
22 Ga0068869_100339000 3300005334 Bacteria 1223
23 Ga0070666_10536935 3300005335 Bacteria 850
24 Ga0070680_100104094 3300005336 Bacteria 2358
25 Ga0070660_100139746 3300005339 Bacteria 1942
26 Ga0070660_100201314 3300005339 Bacteria 1615
27 Ga0070689_100972202 3300005340 Bacteria 754
28 Ga0070661_100457795 3300005344 Bacteria 1016
29 Ga0070661_101108865 3300005344 Bacteria 659
30 Ga0070668_100048823 3300005347 Bacteria 3255
31 Ga0070668_100574313 3300005347 Bacteria 984
32 Ga0070668_101708912 3300005347 Bacteria 578
33 Ga0070669_101764984 3300005353 Bacteria 540
34 Ga0070675_100937704 3300005354 Bacteria 794
35 Ga0070671_100059212 3300005355 Bacteria 3187
36 Ga0070671_100455585 3300005355 Bacteria 1098
37 Ga0070671_100624758 3300005355 Bacteria 932
38 Ga0070671_101771964 3300005355 Bacteria 548
39 Ga0070688_100894441 3300005365 Bacteria 700
40 Ga0070659_101118309 3300005366 Bacteria 695
41 Ga0070667_100298370 3300005367 Bacteria 1451
42 Ga0070667_100411115 3300005367 Bacteria 1233
43 Ga0070667_100609095 3300005367 Bacteria 1007
44 Ga0070667_100914441 3300005367 Bacteria 817
45 Ga0070709_10246196 3300005434 Bacteria 1286
46 Ga0070709_11117264 3300005434 Bacteria 631
47 Ga0070714_100725651 3300005435 Bacteria 960
48 Ga0070713_100403471 3300005436 Bacteria 1277
49 Ga0070713_101016441 3300005436 Bacteria 800
50 Ga0070713_102162673 3300005436 Bacteria 539
51 Ga0070710_11192688 3300005437 Bacteria 562
52 Ga0070710_11284952 3300005437 Bacteria 544
53 Ga0070711_100006106 3300005439 Bacteria 7241
54 Ga0070711_100068751 3300005439 Bacteria 2490
55 Ga0070700_100462174 3300005441 Bacteria 968
56 Ga0070663_100102224 3300005455 Bacteria 2141
57 Ga0070663_100252024 3300005455 Bacteria 1397
58 Ga0070663_100348512 3300005455 Bacteria 1198
59 Ga0070663_100940328 3300005455 Bacteria 749
60 Ga0070678_100376237 3300005456 Bacteria 1228
61 Ga0070678_100746779 3300005456 Bacteria 885
62 Ga0070662_100301522 3300005457 Bacteria 1302
63 Ga0070681_10031339 3300005458 Bacteria 5338
64 Ga0070681_11516099 3300005458 Bacteria 595
65 Ga0068867_101073220 3300005459 Bacteria 734
66 Ga0070679_100056358 3300005530 Bacteria 3916
67 Ga0070684_100306176 3300005535 Bacteria 1459
68 Ga0070697_100050374 3300005536 Bacteria 3380
69 Ga0068853_100084585 3300005539 Bacteria 2780
70 Ga0068853_100251180 3300005539 Bacteria 1623
71 Ga0068853_101275445 3300005539 Bacteria 710
72 Ga0070672_100279548 3300005543 Bacteria 1411
73 Ga0070686_100334606 3300005544 Bacteria 1133
74 Ga0070693_100739954 3300005547 Bacteria 724
75 Ga0070665_100024063 3300005548 Bacteria 6133
76 Ga0070665_100275686 3300005548 Bacteria 1684
77 Ga0070665_101143462 3300005548 Bacteria 790
78 Ga0068855_100015059 3300005563 Bacteria 9312
79 Ga0068855_100158681 3300005563 Bacteria 2568
80 Ga0068855_101392932 3300005563 Bacteria 723
81 Ga0068855_102267429 3300005563 Bacteria 544
82 Ga0068857_100064058 3300005577 Bacteria 3268
83 Ga0068857_100236223 3300005577 Bacteria 1672
84 Ga0068857_100840507 3300005577 Bacteria 878
85 Ga0068857_101983957 3300005577 Bacteria 571
86 Ga0068854_100374514 3300005578 Bacteria 1172
87 Ga0068856_100166192 3300005614 Bacteria 2218
88 Ga0068856_100176096 3300005614 Bacteria 2151
89 Ga0068856_100526887 3300005614 Bacteria 1203
90 Ga0068856_100555311 3300005614 Bacteria 1169
91 Ga0068856_100864052 3300005614 Bacteria 924
92 Ga0070702_100078855 3300005615 Bacteria 1967
93 Ga0068852_100034922 3300005616 Bacteria 4188
94 Ga0068852_100092518 3300005616 Bacteria 2708
95 Ga0068852_100651359 3300005616 Bacteria 1061
96 Ga0068859_101773417 3300005617 Bacteria 682
97 Ga0068864_100965637 3300005618 Bacteria 844
98 Ga0068866_10094579 3300005718 Bacteria 1635
99 Ga0068866_10548009 3300005718 Bacteria 773
100 Ga0068866_11417482 3300005718 Unclassified 508
101 Ga0068861_100470691 3300005719 Bacteria 1130
102 Ga0068861_100890463 3300005719 Bacteria 842
103 Ga0068861_102291323 3300005719 Unclassified 542
104 Ga0068851_10381726 3300005834 Bacteria 826
105 Ga0068863_101373986 3300005841 Bacteria 714
106 Ga0068858_100556374 3300005842 Bacteria 1111
107 Ga0068858_101567888 3300005842 Bacteria 650
108 Ga0068858_102596385 3300005842 Unclassified 500
109 Ga0068860_100884634 3300005843 Bacteria 909
110 Ga0068860_100886516 3300005843 Bacteria 908
111 Ga0068860_101092729 3300005843 Bacteria 817
112 Ga0068862_101001200 3300005844 Bacteria 826
113 Ga0081540_1022845 3300005983 Bacteria 3681
114 Ga0081539_10023428 3300005985 Bacteria 4046
115 Ga0070717_10004684 3300006028 Bacteria 9932
116 Ga0070717_10322240 3300006028 Bacteria 1377
117 Ga0070717_10436720 3300006028 Bacteria 1179
118 Ga0070717_10462797 3300006028 Bacteria 1144
119 Ga0075365_10017476 3300006038 Bacteria 4388
120 Ga0075365_10081343 3300006038 Bacteria 2194
121 Ga0075365_10250550 3300006038 Bacteria 1244
122 Ga0075365_10267775 3300006038 Bacteria 1201
123 Ga0075365_10645009 3300006038 Bacteria 748
124 Ga0075368_10017546 3300006042 Bacteria 2680
125 Ga0075368_10139536 3300006042 Bacteria 1010
126 Ga0075368_10420419 3300006042 Bacteria 589
127 Ga0075363_100011164 3300006048 Bacteria 4293
128 Ga0075363_100611709 3300006048 Unclassified 653
129 Ga0075364_10005402 3300006051 Bacteria 7418
130 Ga0070716_100050506 3300006173 Bacteria 2361
131 Ga0070716_100451998 3300006173 Bacteria 937
132 Ga0070716_100862409 3300006173 Bacteria 706
133 Ga0070712_100069999 3300006175 Bacteria 2505
134 Ga0070712_100755855 3300006175 Bacteria 832
135 Ga0070712_101566473 3300006175 Bacteria 576
136 Ga0070712_101757244 3300006175 Bacteria 543
137 Ga0075362_10069751 3300006177 Bacteria 1603
138 Ga0075362_10137574 3300006177 Bacteria 1166
139 Ga0075362_10364475 3300006177 Bacteria 725
140 Ga0075367_10085093 3300006178 Bacteria 1918
141 Ga0075367_10144340 3300006178 Bacteria 1475
142 Ga0075367_11094552 3300006178 Unclassified 509
143 Ga0075369_10124865 3300006186 Bacteria 1167
144 Ga0075369_10318364 3300006186 Bacteria 728
145 Ga0075366_10017389 3300006195 Bacteria 4138
146 Ga0075366_10438209 3300006195 Unclassified 806
147 Ga0097621_100223218 3300006237 Bacteria 1642
148 Ga0097621_100564926 3300006237 Bacteria 1037
149 Ga0097621_101310086 3300006237 Bacteria 684
150 Ga0075370_10137202 3300006353 Bacteria 1429
151 Ga0075370_10194495 3300006353 Bacteria 1196
152 Ga0075370_11035441 3300006353 Bacteria 503
153 Ga0068871_101062395 3300006358 Bacteria 756
154 Ga0068865_100245430 3300006881 Bacteria 1411
155 Ga0068865_100268249 3300006881 Bacteria 1354
156 Ga0097620_101773082 3300006931 Bacteria 682
157 Ga0099794_10055377 3300007265 Bacteria 1916
158 Ga0099794_10086537 3300007265 Bacteria 1552
159 Ga0099794_10141116 3300007265 Bacteria 1220
160 Ga0099794_10233266 3300007265 Bacteria 947
161 Ga0099795_10078507 3300007788 Bacteria 1259
162 Ga0099795_10629042 3300007788 Bacteria 512
163 Ga0105240_10008011 3300009093 Bacteria 15216
164 Ga0105240_10151149 3300009093 Bacteria 2765
165 Ga0105240_10175583 3300009093 Bacteria 2533
166 Ga0105240_11194586 3300009093 Bacteria 806
167 Ga0105240_11440288 3300009093 Bacteria 723
168 Ga0105245_10053578 3300009098 Bacteria 3621
169 Ga0105245_10520911 3300009098 Bacteria 1207
170 Ga0105245_10932227 3300009098 Bacteria 911
171 Ga0105247_10077200 3300009101 Bacteria 2093
172 Ga0105247_10403566 3300009101 Bacteria 974
173 Ga0105247_11145086 3300009101 Bacteria 616
174 Ga0105243_10185598 3300009148 Bacteria 1812
175 Ga0105243_10760601 3300009148 Bacteria 951
176 Ga0105243_11021426 3300009148 Bacteria 831
177 Ga0105243_11589926 3300009148 Bacteria 680
178 Ga0105241_10017356 3300009174 Bacteria 5288
179 Ga0105241_10042315 3300009174 Bacteria 3445
180 Ga0105241_11675701 3300009174 Bacteria 617
181 Ga0105241_12622055 3300009174 Bacteria 506
182 Ga0105242_10560358 3300009176 Bacteria 1097
183 Ga0105242_11738967 3300009176 Bacteria 661
184 Ga0105248_11155719 3300009177 Bacteria 875
185 Ga0105248_11233255 3300009177 Bacteria 846
186 Ga0105248_11620402 3300009177 Bacteria 733
187 Ga0105248_11863307 3300009177 Bacteria 682
188 Ga0105237_10013056 3300009545 Bacteria 8722
189 Ga0105237_10023723 3300009545 Bacteria 6280
190 Ga0105237_10076753 3300009545 Bacteria 3331
191 Ga0105237_10314906 3300009545 Unclassified 1568
192 Ga0105237_10892252 3300009545 Bacteria 896
193 Ga0105237_11244502 3300009545 Bacteria 751
194 Ga0105237_12423189 3300009545 Bacteria 535
195 Ga0105238_10072235 3300009551 Bacteria 3447
196 Ga0105238_10206265 3300009551 Bacteria 1941
197 Ga0105238_10282173 3300009551 Bacteria 1642
198 Ga0105238_10455331 3300009551 Bacteria 1277
199 Ga0105238_10456298 3300009551 Bacteria 1275
200 Ga0105238_10552672 3300009551 Bacteria 1156
201 Ga0105238_11348580 3300009551 Bacteria 740
202 Ga0105238_12528825 3300009551 Bacteria 549
203 Ga0105249_10393071 3300009553 Bacteria 1415
204 Ga0105249_10659029 3300009553 Bacteria 1105
205 Ga0105249_12571103 3300009553 Bacteria 581
206 Ga0099796_10036158 3300010159 Bacteria 1643
207 Ga0099796_10139889 3300010159 Bacteria 945
208 Ga0099796_10260578 3300010159 Unclassified 723
209 Ga0105239_10083468 3300010375 Bacteria 3518
210 Ga0105239_10090326 3300010375 Bacteria 3379
211 Ga0105239_10126165 3300010375 Bacteria 2844
212 Ga0105239_10570676 3300010375 Bacteria 1289
213 Ga0105239_11343105 3300010375 Bacteria 825
214 Ga0105239_11652019 3300010375 Bacteria 741
215 Ga0105239_11991811 3300010375 Bacteria 674
216 Ga0105239_12720789 3300010375 Bacteria 577
217 Ga0105239_13234032 3300010375 Bacteria 530
218 Ga0105246_10009410 3300011119 Bacteria 6021
219 Ga0105246_10528937 3300011119 Bacteria 1006
220 Ga0105246_11755427 3300011119 Bacteria 591
221 Ga0105246_12184952 3300011119 Bacteria 538
222 Ga0157370_10055546 3300013104 Bacteria 3771
223 Ga0157370_10147989 3300013104 Bacteria 2186
224 Ga0157370_10539943 3300013104 Bacteria 1069
225 Ga0157370_10641278 3300013104 Bacteria 971
226 Ga0157369_10328129 3300013105 Bacteria 1590
227 Ga0157369_10447292 3300013105 Bacteria 1338
228 Ga0157369_10762962 3300013105 Bacteria 995
229 Ga0157369_11106689 3300013105 Bacteria 810
230 Ga0157369_11477814 3300013105 Bacteria 691
231 Ga0157374_10172284 3300013296 Bacteria 2112
232 Ga0157374_10699457 3300013296 Bacteria 1027
233 Ga0157374_11698538 3300013296 Bacteria 656
234 Ga0157374_12713958 3300013296 Unclassified 523
235 Ga0157378_10021966 3300013297 Bacteria 5612
236 Ga0157378_11518386 3300013297 Bacteria 715
237 Ga0157378_13036553 3300013297 Bacteria 521
238 Ga0163162_10211021 3300013306 Bacteria 2071
239 Ga0163162_10363237 3300013306 Bacteria 1581
240 Ga0163162_12331518 3300013306 Bacteria 615
241 Ga0157372_10858685 3300013307 Bacteria 1053
242 Ga0157372_11419015 3300013307 Bacteria 800
243 Ga0157372_11863521 3300013307 Bacteria 691
244 Ga0157372_13010305 3300013307 Bacteria 539
245 Ga0157375_10022651 3300013308 Bacteria 5784
246 Ga0157375_11040967 3300013308 Bacteria 957
247 Ga0163163_10058843 3300014325 Bacteria 3799
248 Ga0163163_10204672 3300014325 Bacteria 2022
249 Ga0163163_10206996 3300014325 Bacteria 2010
250 Ga0163163_11820257 3300014325 Bacteria 669
251 Ga0157380_10180008 3300014326 Bacteria 1856
252 Ga0157380_12934799 3300014326 Bacteria 543
253 Ga0182008_10642900 3300014497 Bacteria 600
254 Ga0157377_11095706 3300014745 Bacteria 610
255 Ga0157379_10375604 3300014968 Bacteria 1304
256 Ga0157379_11252818 3300014968 Bacteria 715
257 Ga0157379_12600858 3300014968 Unclassified 507
258 Ga0157376_10119929 3300014969 Bacteria 2329
259 Ga0157376_10134165 3300014969 Bacteria 2213
260 Ga0157376_11757852 3300014969 Bacteria 656
261 Ga0157376_11800390 3300014969 Bacteria 648
262 Ga0182007_10407858 3300015262 Bacteria 519
263 Ga0182007_10442664 3300015262 Bacteria 500
264 Ga0163161_10113151 3300017792 Bacteria 2031
265 Ga0163161_10176887 3300017792 Bacteria 1634
266 Ga0163161_10509223 3300017792 Bacteria 981
267 Ga0163161_11924211 3300017792 Bacteria 526
268 Ga0197907_10949867 3300020069 Bacteria 700
269 Ga0206356_10023491 3300020070 Bacteria 1268
270 Ga0206355_1036216 3300020076 Bacteria 1223
271 Ga0206355_1650325 3300020076 Bacteria 827
272 Ga0206352_10589176 3300020078 Bacteria 957
273 Ga0206352_10777017 3300020078 Bacteria 1001
274 Ga0206354_11428395 3300020081 Bacteria 671
275 Ga0213874_10072499 3300021377 Bacteria 1101
276 Ga0213874_10407269 3300021377 Unclassified 530
277 Ga0213876_10178949 3300021384 Bacteria 1128
278 Ga0224712_10458695 3300022467 Bacteria 612
279 Ga0224712_10680198 3300022467 Bacteria 505
280 Ga0209563_102215 3300025230 Bacteria 4518
281 Ga0207425_1006516 3300025245 Bacteria 3184
282 Ga0209677_103623 3300025253 Bacteria 4879
283 Ga0209148_1000613 3300025254 Bacteria 31818
284 Ga0209233_1002145 3300025261 Bacteria 7416
285 Ga0209233_1050754 3300025261 Bacteria 845
286 Ga0209233_1056370 3300025261 Bacteria 775
287 Ga0209455_1006815 3300025272 Bacteria 3322
288 Ga0209455_1026502 3300025272 Bacteria 1038
289 Ga0209564_1029273 3300025295 Bacteria 1737
290 Ga0209758_1000140 3300025297 Bacteria 174267
291 Ga0209758_1000947 3300025297 Bacteria 39101
292 Ga0209758_1003609 3300025297 Bacteria 13852
293 Ga0209758_1005374 3300025297 Bacteria 9922
294 Ga0209758_1042318 3300025297 Bacteria 1691
295 Ga0209758_1051423 3300025297 Bacteria 1434
296 Ga0209758_1175703 3300025297 Bacteria 519
297 Ga0209256_1002028 3300025299 Bacteria 18027
298 Ga0209256_1024617 3300025299 Bacteria 1769
299 Ga0207426_1015110 3300025302 Bacteria 2810
300 Ga0207426_1068022 3300025302 Bacteria 1002
301 Ga0207426_1159330 3300025302 Bacteria 518
302 Ga0209051_1128377 3300025303 Bacteria 631
303 Ga0209257_1002350 3300025304 Bacteria 19025
304 Ga0207697_10119911 3300025315 Bacteria 1131
305 Ga0207692_10161298 3300025898 Bacteria 1292
306 Ga0207692_10562369 3300025898 Bacteria 730
307 Ga0207692_10672494 3300025898 Unclassified 670
308 Ga0207642_10231489 3300025899 Bacteria 1038
309 Ga0207710_10105898 3300025900 Bacteria 1331
310 Ga0207688_10337669 3300025901 Bacteria 926
311 Ga0207680_10503796 3300025903 Bacteria 862
312 Ga0207647_10248501 3300025904 Bacteria 1021
313 Ga0207685_10710879 3300025905 Bacteria 548
314 Ga0207699_10371236 3300025906 Bacteria 1014
315 Ga0207699_10468957 3300025906 Bacteria 905
316 Ga0207705_10047582 3300025909 Bacteria 3084
317 Ga0207705_10256800 3300025909 Bacteria 1334
318 Ga0207654_10013515 3300025911 Bacteria 4201
319 Ga0207654_10120272 3300025911 Bacteria 1648
320 Ga0207707_10052825 3300025912 Bacteria 3537
321 Ga0207707_10056631 3300025912 Bacteria 3411
322 Ga0207707_11158837 3300025912 Bacteria 627
323 Ga0207695_10001812 3300025913 Bacteria 33654
324 Ga0207695_10083692 3300025913 Bacteria 3223
325 Ga0207695_10216512 3300025913 Bacteria 1824
326 Ga0207695_10367187 3300025913 Bacteria 1325
327 Ga0207695_10623274 3300025913 Bacteria 960
328 Ga0207671_10008448 3300025914 Bacteria 8729
329 Ga0207671_10015673 3300025914 Bacteria 5925
330 Ga0207671_11043932 3300025914 Bacteria 643
331 Ga0207693_10023161 3300025915 Bacteria 4932
332 Ga0207693_10196466 3300025915 Bacteria 1587
333 Ga0207693_10345367 3300025915 Bacteria 1165
334 Ga0207693_10874706 3300025915 Bacteria 690
335 Ga0207663_10014304 3300025916 Bacteria 4339
336 Ga0207663_10055178 3300025916 Bacteria 2492
337 Ga0207663_11349282 3300025916 Unclassified 574
338 Ga0207660_10184066 3300025917 Bacteria 1624
339 Ga0207660_10400255 3300025917 Bacteria 1106
340 Ga0207657_10431570 3300025919 Bacteria 1035
341 Ga0207657_10661083 3300025919 Bacteria 813
342 Ga0207657_10890799 3300025919 Bacteria 686
343 Ga0207649_10534085 3300025920 Bacteria 896
344 Ga0207652_10168347 3300025921 Bacteria 1966
345 Ga0207652_10181862 3300025921 Bacteria 1889
346 Ga0207681_11311689 3300025923 Bacteria 608
347 Ga0207694_10127659 3300025924 Bacteria 2036
348 Ga0207694_10310607 3300025924 Bacteria 1299
349 Ga0207694_10540814 3300025924 Bacteria 977
350 Ga0207694_11057825 3300025924 Bacteria 687
351 Ga0207650_10402064 3300025925 Bacteria 1134
352 Ga0207650_11185073 3300025925 Unclassified 650
353 Ga0207687_10588117 3300025927 Bacteria 937
354 Ga0207687_11695626 3300025927 Bacteria 542
355 Ga0207700_10028875 3300025928 Bacteria 3908
356 Ga0207700_10077353 3300025928 Bacteria 2584
357 Ga0207700_10453969 3300025928 Bacteria 1130
358 Ga0207700_11795731 3300025928 Bacteria 539
359 Ga0207664_10058142 3300025929 Bacteria 3075
360 Ga0207644_10050732 3300025931 Bacteria 2975
361 Ga0207690_11851772 3300025932 Bacteria 504
362 Ga0207706_10040465 3300025933 Bacteria 4130
363 Ga0207706_10211044 3300025933 Bacteria 1702
364 Ga0207686_10187908 3300025934 Bacteria 1470
365 Ga0207686_10377844 3300025934 Bacteria 1074
366 Ga0207709_11015374 3300025935 Bacteria 678
367 Ga0207709_11853856 3300025935 Bacteria 502
368 Ga0207670_10668964 3300025936 Bacteria 857
369 Ga0207669_10050701 3300025937 Bacteria 2483
370 Ga0207669_10376221 3300025937 Bacteria 1105
371 Ga0207669_11094978 3300025937 Bacteria 672
372 Ga0207704_10092091 3300025938 Bacteria 1994
373 Ga0207665_10087909 3300025939 Bacteria 2149
374 Ga0207665_10327895 3300025939 Bacteria 1150
375 Ga0207665_10372525 3300025939 Bacteria 1082
376 Ga0207691_10272988 3300025940 Bacteria 1456
377 Ga0207691_10465829 3300025940 Bacteria 1075
378 Ga0207711_11021772 3300025941 Bacteria 766
379 Ga0207689_10319024 3300025942 Bacteria 1289
380 Ga0207661_10001362 3300025944 Bacteria 16378
381 Ga0207679_11072895 3300025945 Bacteria 739
382 Ga0207667_10025641 3300025949 Bacteria 6451
383 Ga0207667_10329363 3300025949 Bacteria 1559
384 Ga0207667_11673645 3300025949 Bacteria 603
385 Ga0207667_11962640 3300025949 Bacteria 546
386 Ga0207651_12109938 3300025960 Bacteria 506
387 Ga0207712_10161164 3300025961 Bacteria 1743
388 Ga0207712_10504353 3300025961 Bacteria 1035
389 Ga0207668_10342914 3300025972 Bacteria 1247
390 Ga0207668_11324050 3300025972 Unclassified 649
391 Ga0207640_10139297 3300025981 Bacteria 1766
392 Ga0207640_11246714 3300025981 Bacteria 662
393 Ga0207658_10943062 3300025986 Bacteria 787
394 Ga0207658_11187351 3300025986 Bacteria 697
395 Ga0207658_11824967 3300025986 Bacteria 555
396 Ga0207677_10629850 3300026023 Bacteria 944
397 Ga0207703_10209586 3300026035 Bacteria 1737
398 Ga0207703_10236733 3300026035 Bacteria 1639
399 Ga0207639_10064032 3300026041 Bacteria 2850
400 Ga0207639_10326860 3300026041 Bacteria 1363
401 Ga0207639_10737155 3300026041 Bacteria 916
402 Ga0207639_10795085 3300026041 Bacteria 881
403 Ga0207639_10910608 3300026041 Bacteria 822
404 Ga0207678_10023810 3300026067 Bacteria 5355
405 Ga0207678_10042633 3300026067 Bacteria 3930
406 Ga0207678_10257339 3300026067 Bacteria 1496
407 Ga0207678_10534746 3300026067 Bacteria 1024
408 Ga0207678_11593449 3300026067 Unclassified 575
409 Ga0207702_10295425 3300026078 Bacteria 1536
410 Ga0207702_10468033 3300026078 Bacteria 1225
411 Ga0207702_10603387 3300026078 Bacteria 1077
412 Ga0207702_10886341 3300026078 Bacteria 884
413 Ga0207641_10118910 3300026088 Bacteria 2355
414 Ga0207641_10319091 3300026088 Bacteria 1473
415 Ga0207648_10078966 3300026089 Bacteria 2871
416 Ga0207648_11918656 3300026089 Bacteria 554
417 Ga0207676_10145307 3300026095 Bacteria 2036
418 Ga0207676_12080313 3300026095 Unclassified 566
419 Ga0207674_10023499 3300026116 Bacteria 6601
420 Ga0207674_10025096 3300026116 Bacteria 6362
421 Ga0207674_10689302 3300026116 Bacteria 986
422 Ga0207674_10768339 3300026116 Bacteria 930
423 Ga0207675_101237110 3300026118 Unclassified 767
424 Ga0207675_101877065 3300026118 Bacteria 618
425 Ga0207683_10017928 3300026121 Bacteria 6038
426 Ga0207683_10081626 3300026121 Bacteria 2870
427 Ga0207698_10054848 3300026142 Bacteria 3068
428 Ga0207698_12440783 3300026142 Bacteria 534
429 Ga0209588_1002844 3300027671 Bacteria 4744
430 Ga0209588_1036401 3300027671 Bacteria 1584
431 Ga0209813_10007941 3300027866 Bacteria 2662
432 Ga0268266_10075776 3300028379 Bacteria 2922
433 Ga0268266_10297501 3300028379 Bacteria 1505
434 Ga0268266_10626397 3300028379 Bacteria 1034
435 Ga0268266_11670586 3300028379 Unclassified 612
436 Ga0268264_10171189 3300028381 Bacteria 1964
437 Ga0307517_10000772 3300028786 Bacteria 55020
438 Ga0307517_10515920 3300028786 Bacteria 605
439 Ga0307517_10578149 3300028786 Bacteria 557
440 Ga0307515_10016501 3300028794 Bacteria 13511
441 Ga0307515_10408187 3300028794 Bacteria 982
442 Ga0265769_118030 3300030888 Unclassified 543
443 Ga0247549_105379 3300030942 Bacteria 510
444 Ga0265330_10149056 3300031235 Bacteria 994
445 Ga0265339_10384633 3300031249 Bacteria 657
446 Ga0265331_10501204 3300031250 Bacteria 546
447 Ga0307513_10181175 3300031456 Bacteria 1970
448 Ga0307509_10517708 3300031507 Bacteria 875
449 Ga0307408_100287753 3300031548 Bacteria 1371
450 Ga0307508_10014943 3300031616 Bacteria 7079
451 Ga0307508_10456160 3300031616 Bacteria 871
452 Ga0307508_10502964 3300031616 Bacteria 807
453 Ga0307516_10073807 3300031730 Bacteria 3268
454 Ga0307516_10305071 3300031730 Bacteria 1267
455 Ga0307516_10546611 3300031730 Unclassified 812
456 Ga0307412_10301226 3300031911 Bacteria 1267
457 Ga0307412_12045166 3300031911 Bacteria 531
458 Ga0307416_100136404 3300032002 Bacteria 2221
459 Ga0307415_102010304 3300032126 Unclassified 563
460 Ga0307510_10020232 3300033180 Bacteria 7783
461 Ga0307510_10073103 3300033180 Bacteria 3400
462 Ga0307510_10184331 3300033180 Bacteria 1645
463 Ga0307510_10227114 3300033180 Bacteria 1373
464 Ga0373944_0029919 3300035089 Bacteria 1631
465 Ga0373936_0097953 3300035113 Bacteria 1235
466 Ga0373954_0259264 3300035118 Bacteria 856
467 Ga0373943_0913522 3300035170 Bacteria 525
468 Ga0373946_0699040 3300035171 Bacteria 530
469 Ga0373962_0157354 3300035242 Bacteria 748
470 Ga0373935_0988566 3300035692 Bacteria 625
471 Ga0373927_0015643 3300035695 Bacteria 5011
472 Ga0373947_0138338 3300035725 Bacteria 1560
473 Ga0373925_0092600 3300037068 Bacteria 2312
474 Ga0373925_0252100 3300037068 Bacteria 1416
475 Ga0395899_0279076 3300037312 Bacteria 1137
476 Ga0395899_0411700 3300037312 Bacteria 893
477 Ga0395900_0001120 3300037418 Bacteria 33947
478 Ga0395900_0418013 3300037418 Bacteria 1302
479 Ga0395898_0213378 3300037466 Bacteria 1841
480 Ga0395898_0622634 3300037466 Bacteria 1022
481 Ga0395905_0284985 3300037471 Bacteria 1538
482 Ga0395905_0344769 3300037471 Bacteria 1381
483 Ga0395905_0932708 3300037471 Bacteria 771
484 Ga0436364_0583338 3300037853 Bacteria 707
485 Ga0395901_0047401 3300038443 Bacteria 4462
486 Ga0395901_0325049 3300038443 Bacteria 1591
487 Ga0436365_0622298 3300039437 Bacteria 583
488 Ga0436365_0920165 3300039437 Bacteria 1285
489 Ga0436365_1036456 3300039437 Bacteria 1045
490 Ga0436363_0668042 3300039450 Bacteria 1161
491 Ga0436363_0693480 3300039450 Unclassified 530
492 Ga0451787_196962 3300041441 Bacteria 1115
493 Ga0451789_0693148 3300041443 Bacteria 796
494 Ga0451791_0154257 3300041451 Bacteria 853
495 Ga0451793_1762582 3300041452 Bacteria 610
496 Ga0451797_0880328 3300041453 Unclassified 551
497 Ga0451795_1706771 3300041456 Bacteria 746
498 Ga0451800_1282933 3300041459 Bacteria 537
499 Ga0451800_1540693 3300041459 Bacteria 583
500 Ga0451802_2024691 3300041460 Bacteria 1272
501 Ga0451804_0554310 3300041463 Bacteria 950
502 Ga0451807_2642741 3300041486 Bacteria 867
503 Ga0451835_0179581 3300041492 Bacteria 1084
504 Ga0451839_1012687 3300041496 Bacteria 898
505 Ga0451839_1528042 3300041496 Unclassified 750
506 Ga0451846_40364 3300041502 Bacteria 544
507 Ga0451847_0344410 3300041503 Bacteria 891
508 Ga0451849_0393855 3300041505 Bacteria 670
509 Ga0451843_0876415 3300041509 Bacteria 563
510 Ga0451854_13610 3300041510 Bacteria 537
511 Ga0451853_2531308 3300041512 Bacteria 809
512 Ga0451853_3983708 3300041512 Bacteria 627
513 Ga0466969_0156722 3300044656 Bacteria 1047
514 Ga0466972_0001305 3300044658 Bacteria 12063
515 Ga0466966_0016619 3300044684 Bacteria 4860
516 Ga0466961_0000824 3300044693 Bacteria 19377
517 Ga0466961_0722709 3300044693 Bacteria 596
518 Ga0466963_0044960 3300044694 Bacteria 2907
519 Ga0466963_0265599 3300044694 Bacteria 1205
520 Ga0466964_0132903 3300044706 Bacteria 1135
521 Ga0466964_0499895 3300044706 Bacteria 653
522 Ga0466968_0007808 3300044735 Bacteria 4081
523 Ga0466968_0041096 3300044735 Bacteria 1951
524 Ga0466957_0293103 3300044842 Bacteria 1092
525 Ga0466957_0463426 3300044842 Bacteria 875
526 Ga0466959_0030355 3300045049 Bacteria 4002
527 Ga0466967_0393415 3300045976 Bacteria 1347
528 Ga0466967_0531845 3300045976 Bacteria 1156
529 Ga0495617_108104 3300046452 Bacteria 901
530 Ga0495592_0480942 3300046454 Bacteria 773
531 Ga0495603_0192639 3300046455 Bacteria 1179
532 Ga0495603_0732924 3300046455 Unclassified 565
533 Ga0495590_0019556 3300046457 Bacteria 2411
534 Ga0495629_0064554 3300046459 Bacteria 2556
535 Ga0495629_0564113 3300046459 Bacteria 763
536 Ga0495638_0007084 3300046460 Bacteria 8087
537 Ga0495638_0331963 3300046460 Bacteria 809
538 Ga0495641_0194500 3300046461 Bacteria 909
539 Ga0495651_0000395 3300046462 Bacteria 33751
540 Ga0495651_0073861 3300046462 Bacteria 2588
541 Ga0495653_0018118 3300046463 Bacteria 5725
542 Ga0495582_0877697 3300046473 Bacteria 519
543 Ga0495605_0023708 3300046474 Bacteria 3223
544 Ga0495605_0039659 3300046474 Bacteria 2358
545 Ga0495639_0094261 3300046475 Bacteria 1408
546 Ga0495639_0261787 3300046475 Bacteria 857
547 Ga0495662_0511907 3300046476 Bacteria 588
548 Ga0495664_0011185 3300046477 Bacteria 5054
549 Ga0495664_0730469 3300046477 Bacteria 584
550 Ga0495584_0167515 3300046491 Bacteria 1117
551 Ga0495584_0507315 3300046491 Bacteria 614
552 Ga0495585_0372368 3300046492 Bacteria 691
553 Ga0495607_0076201 3300046501 Bacteria 1856
554 Ga0495607_0190493 3300046501 Bacteria 1022
555 Ga0495583_0029773 3300046506 Bacteria 2668
556 Ga0495606_0005408 3300046507 Bacteria 12237
557 Ga0495606_0130110 3300046507 Bacteria 1497
558 Ga0495606_0535958 3300046507 Bacteria 585
559 Ga0495606_0565615 3300046507 Bacteria 563
560 Ga0495608_0044734 3300046511 Bacteria 2954
561 Ga0495608_0110092 3300046511 Bacteria 1771
562 Ga0495610_0073720 3300046512 Bacteria 1585
563 Ga0495610_0378719 3300046512 Bacteria 527
564 Ga0495616_0075021 3300046513 Bacteria 1628
565 Ga0495616_0077386 3300046513 Bacteria 1597
566 Ga0495618_0185214 3300046514 Bacteria 1322
567 Ga0495620_0189467 3300046515 Bacteria 793
568 Ga0495628_0083056 3300046516 Bacteria 2488
569 Ga0495628_0211379 3300046516 Bacteria 1459
570 Ga0495630_1250505 3300046517 Bacteria 560
571 Ga0495632_0099585 3300046519 Bacteria 1371
572 Ga0495643_0014352 3300046522 Bacteria 4714
573 Ga0495643_0147191 3300046522 Bacteria 1169
574 Ga0495648_0022804 3300046524 Bacteria 4299
575 Ga0495648_0040800 3300046524 Bacteria 2938
576 Ga0495648_0074846 3300046524 Bacteria 1949
577 Ga0495648_0142818 3300046524 Bacteria 1258
578 Ga0495648_0207514 3300046524 Bacteria 976
579 Ga0495652_0007066 3300046529 Bacteria 10374
580 Ga0495652_0095231 3300046529 Bacteria 2426
581 Ga0495652_0119535 3300046529 Bacteria 2104
582 Ga0495652_0746167 3300046529 Bacteria 655
583 Ga0495640_0098157 3300046533 Bacteria 1925
584 Ga0495586_0483009 3300046535 Bacteria 715
585 Ga0495587_0040181 3300046536 Bacteria 2797
586 Ga0495609_0156101 3300046538 Bacteria 969
587 Ga0495597_0168223 3300046542 Bacteria 891
588 Ga0495645_0005486 3300046543 Bacteria 8714
589 Ga0495645_0915332 3300046543 Bacteria 520
590 Ga0495622_0006800 3300046557 Bacteria 5306
591 Ga0495622_0044077 3300046557 Bacteria 2073
592 Ga0495667_0028916 3300046559 Bacteria 3730
593 Ga0495668_0035794 3300046616 Bacteria 2782
594 Ga0495668_0112222 3300046616 Bacteria 1491
595 Ga0495668_0246755 3300046616 Bacteria 978
596 Ga0495668_0474681 3300046616 Bacteria 689
597 Ga0495668_0701712 3300046616 Bacteria 560
598 Ga0495668_0779795 3300046616 Bacteria 529
599 Ga0495668_0861282 3300046616 Bacteria 502
600 Ga0495634_0057331 3300046642 Bacteria 2601
601 Ga0495611_0154240 3300046648 Bacteria 1072
602 Ga0495611_0241284 3300046648 Bacteria 839
603 Ga0495625_0052611 3300046660 Bacteria 2915
604 Ga0495625_0076815 3300046660 Bacteria 2334
605 Ga0495625_0225520 3300046660 Bacteria 1226
606 Ga0495625_0283928 3300046660 Bacteria 1064
607 Ga0495635_0019775 3300046663 Bacteria 4691
608 Ga0495635_0159376 3300046663 Bacteria 1535
609 Ga0495635_0398215 3300046663 Bacteria 915
610 Ga0495635_0873062 3300046663 Bacteria 577
611 Ga0495588_0010601 3300046674 Bacteria 4292
612 Ga0495588_0212270 3300046674 Bacteria 1022
613 Ga0495657_0006948 3300046675 Bacteria 8787
614 Ga0495657_0049522 3300046675 Bacteria 2829
615 Ga0495599_0007121 3300046678 Bacteria 6771
616 Ga0495623_0020182 3300046679 Bacteria 4306
617 Ga0495646_0035065 3300046680 Bacteria 3113
618 Ga0495646_0402961 3300046680 Bacteria 711
619 Ga0495669_0274679 3300046684 Bacteria 810
620 Ga0495669_0654054 3300046684 Bacteria 511
621 Ga0495613_0286788 3300046689 Bacteria 1142
622 Ga0495624_0031406 3300046690 Bacteria 3453
623 Ga0495671_0149254 3300046692 Bacteria 1138
624 Ga0495649_0005752 3300046694 Bacteria 7815
625 Ga0495649_0642903 3300046694 Bacteria 522
626 Ga0495600_0000352 3300046809 Bacteria 24397
627 Ga0495600_0020574 3300046809 Bacteria 4219
628 Ga0495600_0600682 3300046809 Bacteria 669
629 Ga0495660_0080351 3300046810 Bacteria 1711
630 Ga0495581_0172984 3300047315 Bacteria 1263
631 Ga0495604_0094238 3300047317 Bacteria 2213
632 Ga0495604_0435412 3300047317 Bacteria 859
633 Ga0495604_0991363 3300047317 Unclassified 520
634 Ga0495674_0655453 3300047319 Bacteria 827
635 Ga0495674_0916254 3300047319 Bacteria 676
636 Ga0495674_1266743 3300047319 Bacteria 555
637 Ga0495672_0148720 3300047320 Bacteria 1217
638 Ga0495676_0094099 3300047321 Bacteria 2233
639 Ga0495680_0006443 3300047322 Bacteria 10909
640 Ga0495683_0208286 3300047323 Bacteria 878
641 Ga0495683_0341654 3300047323 Bacteria 633
642 Ga0495683_0425760 3300047323 Bacteria 548
643 Ga0495687_074897 3300047443 Bacteria 1344
644 Ga0495675_0011402 3300047444 Bacteria 5578
645 Ga0495673_0030416 3300047469 Bacteria 2535
646 Ga0495673_0034560 3300047469 Bacteria 2336
647 Ga0495673_0067183 3300047469 Bacteria 1518
648 Ga0495673_0285812 3300047469 Bacteria 594
649 Ga0495684_0030660 3300047471 Bacteria 4129
650 Ga0495684_0513829 3300047471 Bacteria 821
651 Ga0495686_0030480 3300047472 Bacteria 3503
652 Ga0495686_0172808 3300047472 Bacteria 1256
653 Ga0495593_0032414 3300047673 Bacteria 2849
654 Ga0495602_0038238 3300048088 Bacteria 4441
655 Ga0495614_0136205 3300048089 Bacteria 1089
656 Ga0495615_0282951 3300048090 Bacteria 533
657 Ga0495626_0113018 3300048091 Bacteria 1174
658 Ga0495626_0415393 3300048091 Bacteria 519
659 Ga0496100_0034879 3300048903 Bacteria 3161
660 Ga0496100_0039191 3300048903 Bacteria 3008
661 Ga0496100_0867304 3300048903 Bacteria 708
662 Ga0496100_0973547 3300048903 Bacteria 667
663 Ga0496101_0077194 3300048904 Bacteria 2455
664 Ga0496101_0080077 3300048904 Bacteria 2412
665 Ga0496101_0089989 3300048904 Bacteria 2282
666 Ga0496101_0106798 3300048904 Bacteria 2103
667 Ga0496101_0396158 3300048904 Bacteria 1087
668 Ga0496101_0837558 3300048904 Bacteria 725
669 Ga0496101_1505585 3300048904 Bacteria 524
670 Ga0496102_0018854 3300048905 Bacteria 6069
671 Ga0496102_0065672 3300048905 Bacteria 3326
672 Ga0496102_0372784 3300048905 Bacteria 1343
673 Ga0496102_0561482 3300048905 Bacteria 1064
674 Ga0496102_1515664 3300048905 Bacteria 589
675 Ga0496103_0036395 3300048906 Bacteria 3014
676 Ga0496103_0085278 3300048906 Bacteria 1990
677 Ga0496103_0913393 3300048906 Bacteria 550
678 Ga0496104_0023388 3300048907 Bacteria 5681
679 Ga0496104_0055824 3300048907 Bacteria 3734
680 Ga0496104_0064686 3300048907 Bacteria 3469
681 Ga0496104_0253847 3300048907 Bacteria 1671
682 Ga0496104_1054196 3300048907 Bacteria 717
683 Ga0496105_0039768 3300048908 Bacteria 3877
684 Ga0496105_0111956 3300048908 Bacteria 2252
685 Ga0496105_0355633 3300048908 Bacteria 1169
686 Ga0496106_0044113 3300048909 Bacteria 3346
687 Ga0496106_0163181 3300048909 Bacteria 1763
688 Ga0496106_0990198 3300048909 Bacteria 661
689 Ga0496107_0036893 3300048910 Bacteria 3507
690 Ga0496107_0536006 3300048910 Bacteria 867
691 Ga0496108_0200728 3300048911 Bacteria 1731
692 Ga0496108_0240805 3300048911 Bacteria 1574
693 Ga0496108_0455875 3300048911 Bacteria 1117
694 Ga0496108_0465179 3300048911 Bacteria 1105
695 Ga0496109_0688340 3300048912 Bacteria 960
696 Ga0496109_1897075 3300048912 Bacteria 528
697 Ga0496110_0060268 3300048913 Bacteria 3346
698 Ga0496110_0112463 3300048913 Bacteria 2448
699 Ga0496110_0792671 3300048913 Bacteria 852
700 Ga0496110_0984647 3300048913 Bacteria 750
701 Ga0496111_0205817 3300048914 Bacteria 1462
702 Ga0496111_0265716 3300048914 Bacteria 1273
703 Ga0496112_0089829 3300048915 Bacteria 3040
704 Ga0496112_0131611 3300048915 Bacteria 2472
705 Ga0496112_0991516 3300048915 Bacteria 760
706 Ga0496112_1828797 3300048915 Bacteria 519
707 Ga0496113_0022035 3300048916 Bacteria 4500
708 Ga0496113_0129693 3300048916 Bacteria 1977
709 Ga0496113_1281890 3300048916 Bacteria 570
710 Ga0496114_0151126 3300048917 Bacteria 2014
711 Ga0496114_0254093 3300048917 Bacteria 1547
712 Ga0496114_0313388 3300048917 Bacteria 1386
713 Ga0496114_0368032 3300048917 Bacteria 1272
714 Ga0496114_0492315 3300048917 Bacteria 1085
715 Ga0496114_0644909 3300048917 Bacteria 932
716 Ga0496115_0049501 3300048918 Bacteria 3364
717 Ga0496115_0106003 3300048918 Bacteria 2307
718 Ga0496115_0125282 3300048918 Bacteria 2116
719 Ga0496115_0269557 3300048918 Bacteria 1399
720 Ga0496115_0292383 3300048918 Bacteria 1336
721 Ga0496116_0060976 3300048919 Bacteria 2444
722 Ga0496116_0181497 3300048919 Bacteria 1126
723 Ga0496117_0077767 3300048920 Bacteria 2194
724 Ga0496117_0238454 3300048920 Bacteria 1000
725 Ga0496117_0342127 3300048920 Bacteria 776
726 Ga0496117_0358701 3300048920 Bacteria 750
727 Ga0496118_0033894 3300048921 Bacteria 4179
728 Ga0496118_0041524 3300048921 Bacteria 3641
729 Ga0496118_0141702 3300048921 Bacteria 1522
730 Ga0496118_0143405 3300048921 Bacteria 1509
731 Ga0496119_0059606 3300048922 Bacteria 2291
732 Ga0496119_0082878 3300048922 Bacteria 1843
733 Ga0496119_0539565 3300048922 Unclassified 538
734 Ga0496120_0031804 3300048923 Bacteria 3189
735 Ga0496120_0411272 3300048923 Bacteria 596
736 Ga0496121_0011802 3300048924 Bacteria 9627
737 Ga0496121_0402778 3300048924 Bacteria 895
738 Ga0496121_0522977 3300048924 Bacteria 748
739 Ga0496121_0583707 3300048924 Bacteria 693
740 Ga0496122_0579947 3300048925 Bacteria 528
741 Ga0496124_0301230 3300048927 Bacteria 1158
742 Ga0496124_0480453 3300048927 Bacteria 839
743 Ga0496126_0012312 3300048929 Bacteria 8776
744 Ga0496126_0042501 3300048929 Bacteria 4197
745 Ga0496126_0054753 3300048929 Bacteria 3611
746 Ga0496126_0323013 3300048929 Bacteria 1268
747 Ga0496126_0369555 3300048929 Bacteria 1170
748 Ga0496126_0922879 3300048929 Bacteria 660
749 Ga0495678_088041 3300049459 Bacteria 1100
750 Ga0495678_260731 3300049459 Bacteria 512
751 Ga0495682_0007934 3300049460 Bacteria 4200
752 Ga0495682_0249196 3300049460 Bacteria 628
753 nmdc:mga03683_118160_c1 3300050489 Bacteria 1177
754 nmdc:mga03n38_194181_c1 3300050490 Bacteria 1047
755 nmdc:mga03n38_6762_c1 3300050490 Bacteria 4011
756 nmdc:mga00v17_252367_c1 3300050491 Bacteria 1144
757 nmdc:mga00v17_308364_c1 3300050491 Bacteria 1028
758 nmdc:mga0yw44_128887_c1 3300050492 Bacteria 1636
759 nmdc:mga0yw44_219174_c1 3300050492 Bacteria 1261
760 nmdc:mga0yw44_262153_c1 3300050492 Bacteria 1152
761 nmdc:mga0yw44_617646_c1 3300050492 Bacteria 737
762 nmdc:mga0yw44_909917_c1 3300050492 Bacteria 596
763 nmdc:mga0k408_32765_c1 3300050493 Bacteria 2969
764 nmdc:mga06z11_168644_c1 3300050494 Bacteria 1256
765 nmdc:mga06z11_601598_c1 3300050494 Bacteria 669
766 nmdc:mga04h51_146790_c1 3300050495 Bacteria 899
767 nmdc:mga07m45_601456_c1 3300050496 Unclassified 635
768 nmdc:mga07m45_96163_c1 3300050496 Bacteria 1700
769 nmdc:mga0sz30_124101_c1 3300050516 Bacteria 1136
770 nmdc:mga0sz30_192610_c1 3300050516 Bacteria 905
771 nmdc:mga0sz30_284371_c1 3300050516 Bacteria 737
772 nmdc:mga0sz30_496514_c1 3300050516 Bacteria 549
773 Ga0495601_0561952 3300053077 Bacteria 734
774 Ga0495601_0899737 3300053077 Bacteria 559
775 Ga0495612_0524226 3300053078 Bacteria 545
776 Ga0500610_0149310 3300053079 Bacteria 1173
777 Ga0500635_0003732 3300053080 Bacteria 3857
778 Ga0500635_0050047 3300053080 Bacteria 1428
779 Ga0495655_0065267 3300053083 Bacteria 1004
780 Ga0495655_0181349 3300053083 Bacteria 679
781 Ga0495655_0194435 3300053083 Bacteria 660
782 Ga0495595_0022735 3300053084 Bacteria 2755
783 Ga0495595_0529977 3300053084 Bacteria 601
784 Ga0495619_0014942 3300053085 Bacteria 4904
785 Ga0495619_0060436 3300053085 Bacteria 2519
786 Ga0495619_0192716 3300053085 Bacteria 1411
787 Ga0500578_0094297 3300053086 Bacteria 1899
788 Ga0500578_0185475 3300053086 Bacteria 1280
789 Ga0500578_0465282 3300053086 Bacteria 717
790 Ga0500643_000032 3300053087 Bacteria 200350
791 Ga0500644_0214858 3300053088 Bacteria 800
792 Ga0500646_0111410 3300053090 Bacteria 870
793 Ga0500647_0123909 3300053091 Bacteria 1222
794 Ga0500583_0409819 3300053092 Bacteria 649
795 Ga0500583_0533224 3300053092 Bacteria 547
796 Ga0500651_0014192 3300053093 Bacteria 4872
797 Ga0500651_0623455 3300053093 Bacteria 583
798 Ga0500651_0645500 3300053093 Bacteria 570
799 Ga0500566_0028245 3300053094 Bacteria 3279
800 Ga0500566_0156925 3300053094 Bacteria 1190
801 Ga0500566_0241002 3300053094 Bacteria 886
802 Ga0500648_071429 3300053097 Bacteria 1962
803 Ga0500650_0019754 3300053098 Bacteria 2946
804 Ga0500650_0182741 3300053098 Bacteria 960
805 Ga0500650_0225366 3300053098 Bacteria 847
806 Ga0500554_003147 3300053102 Bacteria 3337
807 Ga0500554_026215 3300053102 Bacteria 1672
808 Ga0500554_112937 3300053102 Bacteria 914
809 Ga0500555_000661 3300053103 Bacteria 13191
810 Ga0500556_0076663 3300053104 Bacteria 1257
811 Ga0500557_000087 3300053105 Bacteria 32155
812 Ga0500562_006763 3300053108 Bacteria 2892
813 Ga0500569_000787 3300053109 Bacteria 5555
814 Ga0500569_101281 3300053109 Bacteria 944
815 Ga0500569_314882 3300053109 Bacteria 525
816 Ga0500592_006606 3300053116 Bacteria 1847
817 Ga0500594_0040806 3300053118 Bacteria 1269
818 Ga0500595_000688 3300053119 Bacteria 20224
819 Ga0500595_011655 3300053119 Bacteria 3429
820 Ga0500595_030545 3300053119 Bacteria 1814
821 Ga0500595_146646 3300053119 Bacteria 660
822 Ga0500597_359795 3300053120 Bacteria 564
823 Ga0500607_068945 3300053121 Bacteria 1829
824 Ga0500608_077913 3300053122 Bacteria 1568
825 Ga0500608_367401 3300053122 Bacteria 503
826 Ga0500621_076881 3300053126 Bacteria 1342
827 Ga0500621_138711 3300053126 Bacteria 925
828 Ga0500626_320344 3300053128 Bacteria 536
829 Ga0500642_0199517 3300053130 Bacteria 931
830 Ga0500658_0057910 3300053134 Bacteria 1603
831 Ga0500658_0246862 3300053134 Bacteria 820
832 Ga0500658_0265526 3300053134 Bacteria 789
833 Ga0500559_0049609 3300053136 Bacteria 1849
834 Ga0500559_0184703 3300053136 Bacteria 982
835 Ga0500564_357201 3300053138 Bacteria 541
836 Ga0500568_0027539 3300053139 Bacteria 2375
837 Ga0500568_0385734 3300053139 Bacteria 507
838 Ga0500577_0009040 3300053142 Bacteria 2875
839 Ga0500577_0337467 3300053142 Bacteria 658
840 Ga0500577_0354504 3300053142 Bacteria 641
841 Ga0500588_0009892 3300053146 Bacteria 2284
842 Ga0500588_0055914 3300053146 Bacteria 1247
843 Ga0500589_063122 3300053147 Bacteria 1692
844 Ga0500590_152566 3300053148 Bacteria 1040
845 Ga0500603_000982 3300053150 Bacteria 6739
846 Ga0500603_115678 3300053150 Bacteria 809
847 Ga0500604_0094810 3300053151 Bacteria 978
848 Ga0500604_0100494 3300053151 Bacteria 953
849 Ga0500616_0032567 3300053153 Bacteria 2849
850 Ga0500616_0103580 3300053153 Bacteria 1387
851 Ga0500619_157079 3300053154 Bacteria 773
852 Ga0500619_269965 3300053154 Bacteria 555
853 Ga0500620_001157 3300053155 Bacteria 4692
854 Ga0500622_0020075 3300053156 Bacteria 3547
855 Ga0500627_0055647 3300053158 Bacteria 1733
856 Ga0500633_0133713 3300053160 Bacteria 926
857 Ga0500638_000085 3300053162 Bacteria 16902
858 Ga0500638_064386 3300053162 Bacteria 1758
859 Ga0500638_086230 3300053162 Bacteria 1485
860 Ga0500638_125012 3300053162 Bacteria 1172
861 Ga0500638_163256 3300053162 Bacteria 978
862 Ga0500636_0000276 3300053177 Bacteria 28456
863 Ga0500636_0117824 3300053177 Bacteria 1493
864 Ga0500636_0443820 3300053177 Bacteria 589
865 Ga0500637_0000450 3300053178 Bacteria 15794
866 Ga0500637_0000565 3300053178 Bacteria 14522
867 Ga0500649_205343 3300053722 Bacteria 631
868 Ga0500576_264201 3300053725 Bacteria 524
869 Ga0500625_010065 3300053729 Bacteria 4236
870 Ga0500625_139831 3300053729 Bacteria 933
871 Ga0500645_053522 3300053730 Bacteria 1174
872 Ga0500645_065548 3300053730 Bacteria 1046
873 Ga0500609_003678 3300053731 Bacteria 2138
874 Ga0500552_068480 3300053733 Bacteria 633
875 Ga0500596_079240 3300053735 Bacteria 570
876 Ga0500599_000091 3300053736 Bacteria 8449
877 Ga0500601_000379 3300053737 Bacteria 7919
878 Ga0500601_011521 3300053737 Bacteria 994
879 Ga0500661_001547 3300055283 Bacteria 4329
880 Ga0500661_006381 3300055283 Bacteria 2194
881 Ga0500661_037691 3300055283 Bacteria 855
882 Ga0500661_070437 3300055283 Bacteria 639
883 Ga0587077_054218 3300059493 Bacteria 849
884 Ga0587072_175765 3300059643 Bacteria 531
885 Ga0587076_053387 3300059645 Bacteria 795
886 Ga0466962_0123467 3300061719 Bacteria 1250

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005985 Ga0081539_10023428 Ga0081539_100234282 33
2 3300006028 Ga0070717_10004684 Ga0070717_100046842 35
3 3300006173 Ga0070716_100050506 Ga0070716_1000505062 35
4 3300006175 Ga0070712_100755855 Ga0070712_1007558551 35
5 3300025915 Ga0207693_10874706 Ga0207693_108747062 35
6 3300025928 Ga0207700_10077353 Ga0207700_100773531 35
7 3300025929 Ga0207664_10058142 Ga0207664_100581423 35
8 3300025939 Ga0207665_10087909 Ga0207665_100879092 35
9 iso_pu_bacteria 2507262055 2507508446 35
10 iso_pu_bacteria 2508501009 2508542515 35
11 iso_pu_bacteria 2508501042 2508691712 35
12 iso_pu_bacteria 2513237092 2513625516 35
13 iso_pu_bacteria 2513237094 2513644489 35
14 iso_pu_bacteria 2513237095 2513645703 35
15 iso_pu_bacteria 2513237104 2513717160 35
16 iso_pu_bacteria 2517093001 2517107439 35
17 iso_pu_bacteria 2524023205 2524437483 35
18 iso_pu_bacteria 2528768022 2528852360 35
19 iso_pu_bacteria 2744054633 2745076525 35
20 iso_pu_bacteria 2816332527 2818238748 35
21 iso_pu_bacteria 2824600985 2824608140 35
22 iso_pu_bacteria 2824609381 2824610274 35
23 iso_pu_bacteria 2824653114 2824660144 35
24 iso_pu_bacteria 2824661429 2824669274 35
25 iso_pu_bacteria 2824704595 2824709070 35
26 iso_pu_bacteria 2824753945 2824761784 35
27 iso_pu_bacteria 2824763712 2824769977 35
28 iso_pu_bacteria 2844315083 2844319212 35
29 iso_pu_bacteria 2849076700 2849079174 35
30 iso_pu_bacteria 2874590934 2874598191 35
31 iso_pu_bacteria 2874612657 2874615067 35
32 iso_pu_bacteria 2874628541 2874631992 35
33 iso_pu_bacteria 2874645413 2874652753 35
34 iso_pu_bacteria 2876761206 2876764650 35
35 iso_pu_bacteria 2876771140 2876778331 35
36 iso_pu_bacteria 2876818435 2876825800 35
37 iso_pu_bacteria 2879074833 2879082125 35
38 iso_pu_bacteria 2879099564 2879105769 35
39 iso_pu_bacteria 2879127579 2879135272 35
40 iso_pu_bacteria 2879142872 2879150481 35
41 iso_pu_bacteria 2881364244 2881368694 35
42 iso_pu_bacteria 2885366525 2885373016 35
43 iso_pu_bacteria 2885409591 2885411364 35
44 iso_pu_bacteria 2888378607 2888384206 35
45 iso_pu_bacteria 2888388044 2888393669 35
46 iso_pu_bacteria 2888419890 2888424674 35
47 iso_pu_bacteria 2903727486 2903731054 35
48 iso_pu_bacteria 2903768456 2903776878 35
49 iso_pu_bacteria 2904711408 2904714802 35
50 iso_pu_bacteria 2906602504 2906607439 35
51 iso_pu_bacteria 2906626472 2906626948 35
52 iso_pu_bacteria 2922368715 2922374546 35
53 iso_pu_bacteria 2929615660 2929618212 35
54 iso_pu_bacteria 2929624759 2929632400 35
55 iso_pu_bacteria 2932784394 2932790506 35
56 iso_pu_bacteria 2932794094 2932799815 35
57 iso_pu_bacteria 2932801729 2932802656 35
58 iso_pu_bacteria 2932809354 2932810927 35
59 iso_pu_bacteria 2932818245 2932823743 35
60 iso_pu_bacteria 2932828146 2932830137 35
61 iso_pu_bacteria 2933577622 2933580140 35
62 iso_pu_bacteria 2935608549 2935609016 35
63 iso_pu_bacteria 2935616580 2935622637 35
64 iso_pu_bacteria 2935638405 2935642563 35
65 iso_pu_bacteria 2935648319 2935653278 35
66 iso_pu_bacteria 2935656913 2935660251 35
67 iso_pu_bacteria 2935665750 2935668133 35
68 iso_pu_bacteria 2935675223 2935676167 35
69 iso_pu_bacteria 2935684952 2935686149 35
70 iso_pu_bacteria 2935694250 2935701224 35
71 iso_pu_bacteria 2935703347 2935705993 35
72 iso_pu_bacteria 2935713505 2935714701 35
73 iso_pu_bacteria 2935722832 2935725320 35
74 iso_pu_bacteria 2935732158 2935732320 35
75 iso_pu_bacteria 2935741537 2935741699 35
76 iso_pu_bacteria 2935750917 2935752114 35
77 iso_pu_bacteria 2935760218 2935766463 35
78 iso_pu_bacteria 2935769743 2935771910 35
79 iso_pu_bacteria 2935777560 2935778659 35
80 iso_pu_bacteria 2935785616 2935788956 35
81 iso_pu_bacteria 2935793552 2935795244 35
82 iso_pu_bacteria 2935801545 2935802992 35
83 iso_pu_bacteria 2935810662 2935814309 35
84 iso_pu_bacteria 2935819856 2935822176 35
85 iso_pu_bacteria 2935827899 2935831446 35
86 iso_pu_bacteria 2935837841 2935838306 35
87 iso_pu_bacteria 2935847175 2935847758 35
88 iso_pu_bacteria 2935855204 2935860886 35
89 iso_pu_bacteria 2935864058 2935869777 35
90 iso_pu_bacteria 2935873716 2935878804 35
91 iso_pu_bacteria 2935883170 2935886942 35
92 iso_pu_bacteria 2935908558 2935908970 35
93 iso_pu_bacteria 2935916978 2935919688 35
94 iso_pu_bacteria 2935926038 2935926456 35
95 iso_pu_bacteria 2935934488 2935934906 35
96 iso_pu_bacteria 2935942939 2935943356 35
97 iso_pu_bacteria 2935951376 2935951794 35
98 iso_pu_bacteria 2935967501 2935967919 35
99 iso_pu_bacteria 2935975950 2935978543 35
100 iso_pu_bacteria 2935984226 2935991259 35
101 iso_pu_bacteria 2935992306 2935994800 35
102 iso_pu_bacteria 2936002035 2936003442 35
103 iso_pu_bacteria 2936011229 2936016148 35
104 iso_pu_bacteria 2936019824 2936024781 35
105 iso_pu_bacteria 2936028420 2936032029 35
106 iso_pu_bacteria 2936037263 2936039865 35
107 iso_pu_bacteria 2936046547 2936049890 35
108 iso_pu_bacteria 2936055302 2936060842 35
109 iso_pu_bacteria 2940556831 2940557083 35
110 iso_pu_bacteria 2941531003 2941532957 35
111 iso_pu_bacteria 2941538514 2941539026 35
112 iso_pu_bacteria 3005594810 3005599380 35
113 iso_pu_bacteria 3005710791 3005715044 35
114 iso_pu_bacteria 3005718088 3005722457 35
115 iso_pu_bacteria 8016511872 8016522176 35
116 iso_pu_bacteria 8016522445 8016529482 35
117 iso_pu_bacteria 8016530956 8016534693 35
118 iso_pu_bacteria 8016539877 8016547910 35
119 iso_pu_bacteria 8016548790 8016554219 35
120 iso_pu_bacteria 8016557553 8016562595 35
121 iso_pu_bacteria 8016566248 8016573043 35
122 iso_pu_bacteria 8016575299 8016577190 35
123 iso_pu_bacteria 8016583857 8016591591 35
124 iso_pu_bacteria 8016595262 8016600383 35
125 iso_pu_bacteria 8016603502 8016610357 35
126 iso_pu_bacteria 8016622563 8016626424 35
127 iso_pu_bacteria 8016630954 8016640181 35
128 iso_pu_bacteria 8017057580 8017063495 35
129 iso_pu_bacteria 8019530166 8019534460 35
130 iso_pu_bacteria 8019538911 8019545010 35
131 iso_pu_bacteria 8019547302 8019553516 35
132 iso_pu_bacteria 8019576017 8019582814 35
133 iso_pu_bacteria 8019586578 8019590606 35
134 iso_pu_bacteria 8019597564 8019600747 35
135 iso_pu_bacteria 8019608314 8019617805 35
136 iso_pu_bacteria 8019619141 8019628324 35
137 iso_pu_bacteria 8019629233 8019634305 35
138 iso_pu_bacteria 8019638758 8019645432 35
139 iso_pu_bacteria 8019648815 8019658550 35
140 iso_pu_bacteria 8019659431 8019662178 35
141 iso_pu_bacteria 8019678201 8019684403 35
142 iso_pu_bacteria 8019687851 8019690216 35
143 iso_pu_bacteria 8055742211 8055746199 35
144 iso_pu_bacteria 8056967851 8056968171 35
145 3300025905 Ga0207685_10710879 Ga0207685_107108793 36
146 3300031235 Ga0265330_10149056 Ga0265330_101490562 36
147 3300005563 Ga0068855_101392932 Ga0068855_1013929321 37
148 3300013104 Ga0157370_10539943 Ga0157370_105399433 37
149 3300013105 Ga0157369_11106689 Ga0157369_111066892 37
150 3300020069 Ga0197907_10949867 Ga0197907_109498673 37
151 3300020076 Ga0206355_1650325 Ga0206355_16503251 37
152 3300020078 Ga0206352_10777017 Ga0206352_107770173 37
153 3300020081 Ga0206354_11428395 Ga0206354_114283953 37
154 3300021377 Ga0213874_10072499 Ga0213874_100724991 37
155 3300021384 Ga0213876_10178949 Ga0213876_101789492 37
156 3300022467 Ga0224712_10458695 Ga0224712_104586951 37
157 3300025909 Ga0207705_10256800 Ga0207705_102568003 37
158 3300025912 Ga0207707_10056631 Ga0207707_100566311 37
159 3300025913 Ga0207695_10216512 Ga0207695_102165122 37
160 3300025917 Ga0207660_10400255 Ga0207660_104002552 37
161 3300025921 Ga0207652_10168347 Ga0207652_101683473 37
162 3300025944 Ga0207661_10001362 Ga0207661_100013622 37
163 3300032126 Ga0307415_102010304 Ga0307415_1020103041 37
164 3300039437 Ga0436365_0920165 Ga0436365_0920165_1003_1119 37
165 3300039450 Ga0436363_0668042 Ga0436363_0668042_825_941 37
166 3300004800 Ga0058861_11227095 Ga0058861_112270952 38
167 3300005331 Ga0070670_101528595 Ga0070670_1015285952 38
168 3300005333 Ga0070677_10378685 Ga0070677_103786853 38
169 3300005336 Ga0070680_100104094 Ga0070680_1001040941 38
170 3300005339 Ga0070660_100201314 Ga0070660_1002013141 38
171 3300005355 Ga0070671_100455585 Ga0070671_1004555851 38
172 3300005367 Ga0070667_100411115 Ga0070667_1004111152 38
173 3300005456 Ga0070678_100746779 Ga0070678_1007467792 38
174 3300005458 Ga0070681_10031339 Ga0070681_100313394 38
175 3300005530 Ga0070679_100056358 Ga0070679_1000563582 38
176 3300005539 Ga0068853_101275445 Ga0068853_1012754451 38
177 3300005544 Ga0070686_100334606 Ga0070686_1003346062 38
178 3300005548 Ga0070665_100275686 Ga0070665_1002756861 38
179 3300005548 Ga0070665_101143462 Ga0070665_1011434622 38
180 3300005563 Ga0068855_100015059 Ga0068855_1000150593 38
181 3300005614 Ga0068856_100166192 Ga0068856_1001661922 38
182 3300005718 Ga0068866_10094579 Ga0068866_100945792 38
183 3300005719 Ga0068861_102291323 Ga0068861_1022913232 38
184 3300005843 Ga0068860_100884634 Ga0068860_1008846342 38
185 3300006038 Ga0075365_10645009 Ga0075365_106450092 38
186 3300006042 Ga0075368_10139536 Ga0075368_101395363 38
187 3300006048 Ga0075363_100611709 Ga0075363_1006117091 38
188 3300006177 Ga0075362_10364475 Ga0075362_103644752 38
189 3300006178 Ga0075367_10144340 Ga0075367_101443402 38
190 3300006178 Ga0075367_11094552 Ga0075367_110945521 38
191 3300006186 Ga0075369_10124865 Ga0075369_101248652 38
192 3300006195 Ga0075366_10438209 Ga0075366_104382091 38
193 3300007788 Ga0099795_10629042 Ga0099795_106290422 38
194 3300009093 Ga0105240_10151149 Ga0105240_101511492 38
195 3300009545 Ga0105237_10892252 Ga0105237_108922521 38
196 3300009551 Ga0105238_10552672 Ga0105238_105526723 38
197 3300013104 Ga0157370_10055546 Ga0157370_100555463 38
198 3300013105 Ga0157369_11477814 Ga0157369_114778141 38
199 3300021377 Ga0213874_10407269 Ga0213874_104072692 38
200 3300025903 Ga0207680_10503796 Ga0207680_105037963 38
201 3300025912 Ga0207707_10052825 Ga0207707_100528252 38
202 3300025913 Ga0207695_10623274 Ga0207695_106232743 38
203 3300025917 Ga0207660_10184066 Ga0207660_101840663 38
204 3300025921 Ga0207652_10181862 Ga0207652_101818623 38
205 3300025924 Ga0207694_11057825 Ga0207694_110578252 38
206 3300025925 Ga0207650_11185073 Ga0207650_111850731 38
207 3300025949 Ga0207667_10025641 Ga0207667_100256414 38
208 3300025972 Ga0207668_10342914 Ga0207668_103429141 38
209 3300025986 Ga0207658_10943062 Ga0207658_109430622 38
210 3300026041 Ga0207639_10737155 Ga0207639_107371552 38
211 3300026067 Ga0207678_10534746 Ga0207678_105347461 38
212 3300026078 Ga0207702_10295425 Ga0207702_102954253 38
213 3300028379 Ga0268266_11670586 Ga0268266_116705862 38
214 3300028786 Ga0307517_10000772 Ga0307517_1000077222 38
215 3300028794 Ga0307515_10016501 Ga0307515_100165017 38
216 3300028794 Ga0307515_10408187 Ga0307515_104081872 38
217 3300031507 Ga0307509_10517708 Ga0307509_105177082 38
218 3300031616 Ga0307508_10502964 Ga0307508_105029642 38
219 3300031730 Ga0307516_10305071 Ga0307516_103050713 38
220 3300031730 Ga0307516_10546611 Ga0307516_105466112 38
221 3300037853 Ga0436364_0583338 Ga0436364_0583338_342_458 38
222 3300039450 Ga0436363_0693480 Ga0436363_0693480_336_455 38
223 3300041451 Ga0451791_0154257 Ga0451791_0154257_219_338 38
224 3300041453 Ga0451797_0880328 Ga0451797_0880328_65_184 38
225 3300041496 Ga0451839_1528042 Ga0451839_1528042_78_197 38
226 3300041512 Ga0451853_3983708 Ga0451853_3983708_287_406 38
227 3300046460 Ga0495638_0331963 Ga0495638_0331963_197_316 38
228 3300046524 Ga0495648_0207514 Ga0495648_0207514_280_399 38
229 3300046616 Ga0495668_0474681 Ga0495668_0474681_392_511 38
230 3300046616 Ga0495668_0701712 Ga0495668_0701712_16_135 38
231 3300046616 Ga0495668_0779795 Ga0495668_0779795_81_200 38
232 3300046660 Ga0495625_0225520 Ga0495625_0225520_476_595 38
233 3300046684 Ga0495669_0654054 Ga0495669_0654054_108_227 38
234 3300047317 Ga0495604_0991363 Ga0495604_0991363_140_259 38
235 3300048922 Ga0496119_0539565 Ga0496119_0539565_400_519 38
236 3300050490 nmdc:mga03n38_194181_c1 nmdc:mga03n38_194181_c1_261_380 38
237 3300050491 nmdc:mga00v17_308364_c1 nmdc:mga00v17_308364_c1_896_1015 38
238 3300050492 nmdc:mga0yw44_262153_c1 nmdc:mga0yw44_262153_c1_20_139 38
239 3300050494 nmdc:mga06z11_168644_c1 nmdc:mga06z11_168644_c1_888_1007 38
240 3300050494 nmdc:mga06z11_601598_c1 nmdc:mga06z11_601598_c1_42_161 38
241 3300050496 nmdc:mga07m45_601456_c1 nmdc:mga07m45_601456_c1_181_300 38
242 3300050516 nmdc:mga0sz30_192610_c1 nmdc:mga0sz30_192610_c1_737_856 38
243 3300050516 nmdc:mga0sz30_284371_c1 nmdc:mga0sz30_284371_c1_603_722 38
244 3300053083 Ga0495655_0194435 Ga0495655_0194435_344_463 38
245 3300053084 Ga0495595_0022735 Ga0495595_0022735_1603_1722 38
246 3300053085 Ga0495619_0014942 Ga0495619_0014942_690_809 38
247 3300053134 Ga0500658_0265526 Ga0500658_0265526_557_676 38
248 3300053151 Ga0500604_0100494 Ga0500604_0100494_434_553 38
249 3300053158 Ga0500627_0055647 Ga0500627_0055647_89_208 38
250 3300053162 Ga0500638_064386 Ga0500638_064386_989_1108 38
251 iso_pu_bacteria 2935959822 2935960547 38
252 3300003214 JGI25165J46597_1018433 JGI25165J46597_10184332 39
253 3300003215 JGI25153J46596_10001071 JGI25153J46596_100010718 39
254 3300003215 JGI25153J46596_10004997 JGI25153J46596_100049972 39
255 3300003215 JGI25153J46596_10018434 JGI25153J46596_100184343 39
256 3300003320 rootH2_10054880 rootH2_100548801 39
257 3300003323 rootH1_10075224 rootH1_100752243 39
258 3300003323 rootH1_10266104 rootH1_102661041 39
259 3300003354 JGI25160J50197_1057316 JGI25160J50197_10573161 39
260 3300003374 JGI25161J50226_1028467 JGI25161J50226_10284672 39
261 3300003771 Ga0055526_1046218 Ga0055526_10462182 39
262 3300003794 Ga0055531_10008210 Ga0055531_100082102 39
263 3300004625 Ga0055543_1017391 Ga0055543_10173912 39
264 3300005262 Ga0065165_1002328 Ga0065165_100232815 39
265 3300005262 Ga0065165_1012598 Ga0065165_10125982 39
266 3300005327 Ga0070658_10215300 Ga0070658_102153002 39
267 3300005331 Ga0070670_100355359 Ga0070670_1003553592 39
268 3300005334 Ga0068869_100144215 Ga0068869_1001442152 39
269 3300005334 Ga0068869_100339000 Ga0068869_1003390002 39
270 3300005335 Ga0070666_10536935 Ga0070666_105369351 39
271 3300005339 Ga0070660_100139746 Ga0070660_1001397462 39
272 3300005340 Ga0070689_100972202 Ga0070689_1009722021 39
273 3300005344 Ga0070661_100457795 Ga0070661_1004577951 39
274 3300005344 Ga0070661_101108865 Ga0070661_1011088651 39
275 3300005347 Ga0070668_100048823 Ga0070668_1000488233 39
276 3300005347 Ga0070668_100574313 Ga0070668_1005743133 39
277 3300005347 Ga0070668_101708912 Ga0070668_1017089121 39
278 3300005353 Ga0070669_101764984 Ga0070669_1017649841 39
279 3300005354 Ga0070675_100937704 Ga0070675_1009377043 39
280 3300005355 Ga0070671_100059212 Ga0070671_1000592122 39
281 3300005355 Ga0070671_100624758 Ga0070671_1006247582 39
282 3300005355 Ga0070671_101771964 Ga0070671_1017719641 39
283 3300005365 Ga0070688_100894441 Ga0070688_1008944412 39
284 3300005366 Ga0070659_101118309 Ga0070659_1011183092 39
285 3300005367 Ga0070667_100298370 Ga0070667_1002983702 39
286 3300005367 Ga0070667_100609095 Ga0070667_1006090953 39
287 3300005367 Ga0070667_100914441 Ga0070667_1009144412 39
288 3300005434 Ga0070709_10246196 Ga0070709_102461963 39
289 3300005434 Ga0070709_11117264 Ga0070709_111172641 39
290 3300005435 Ga0070714_100725651 Ga0070714_1007256513 39
291 3300005436 Ga0070713_100403471 Ga0070713_1004034712 39
292 3300005436 Ga0070713_101016441 Ga0070713_1010164412 39
293 3300005436 Ga0070713_102162673 Ga0070713_1021626731 39
294 3300005437 Ga0070710_11192688 Ga0070710_111926881 39
295 3300005437 Ga0070710_11284952 Ga0070710_112849521 39
296 3300005439 Ga0070711_100006106 Ga0070711_1000061067 39
297 3300005439 Ga0070711_100068751 Ga0070711_1000687512 39
298 3300005441 Ga0070700_100462174 Ga0070700_1004621743 39
299 3300005455 Ga0070663_100102224 Ga0070663_1001022243 39
300 3300005455 Ga0070663_100252024 Ga0070663_1002520243 39
301 3300005455 Ga0070663_100348512 Ga0070663_1003485122 39
302 3300005455 Ga0070663_100940328 Ga0070663_1009403282 39
303 3300005456 Ga0070678_100376237 Ga0070678_1003762373 39
304 3300005457 Ga0070662_100301522 Ga0070662_1003015221 39
305 3300005458 Ga0070681_11516099 Ga0070681_115160991 39
306 3300005459 Ga0068867_101073220 Ga0068867_1010732201 39
307 3300005535 Ga0070684_100306176 Ga0070684_1003061762 39
308 3300005536 Ga0070697_100050374 Ga0070697_1000503743 39
309 3300005539 Ga0068853_100084585 Ga0068853_1000845853 39
310 3300005539 Ga0068853_100251180 Ga0068853_1002511803 39
311 3300005543 Ga0070672_100279548 Ga0070672_1002795483 39
312 3300005547 Ga0070693_100739954 Ga0070693_1007399542 39
313 3300005548 Ga0070665_100024063 Ga0070665_1000240632 39
314 3300005563 Ga0068855_100158681 Ga0068855_1001586811 39
315 3300005563 Ga0068855_102267429 Ga0068855_1022674292 39
316 3300005577 Ga0068857_100064058 Ga0068857_1000640583 39
317 3300005577 Ga0068857_100236223 Ga0068857_1002362232 39
318 3300005577 Ga0068857_100840507 Ga0068857_1008405073 39
319 3300005577 Ga0068857_101983957 Ga0068857_1019839571 39
320 3300005578 Ga0068854_100374514 Ga0068854_1003745142 39
321 3300005614 Ga0068856_100176096 Ga0068856_1001760963 39
322 3300005614 Ga0068856_100526887 Ga0068856_1005268871 39
323 3300005614 Ga0068856_100555311 Ga0068856_1005553113 39
324 3300005614 Ga0068856_100864052 Ga0068856_1008640522 39
325 3300005615 Ga0070702_100078855 Ga0070702_1000788551 39
326 3300005616 Ga0068852_100034922 Ga0068852_1000349222 39
327 3300005616 Ga0068852_100092518 Ga0068852_1000925182 39
328 3300005616 Ga0068852_100651359 Ga0068852_1006513591 39
329 3300005617 Ga0068859_101773417 Ga0068859_1017734172 39
330 3300005618 Ga0068864_100965637 Ga0068864_1009656371 39
331 3300005718 Ga0068866_10548009 Ga0068866_105480091 39
332 3300005718 Ga0068866_11417482 Ga0068866_114174821 39
333 3300005719 Ga0068861_100470691 Ga0068861_1004706912 39
334 3300005719 Ga0068861_100890463 Ga0068861_1008904631 39
335 3300005834 Ga0068851_10381726 Ga0068851_103817263 39
336 3300005841 Ga0068863_101373986 Ga0068863_1013739861 39
337 3300005842 Ga0068858_100556374 Ga0068858_1005563742 39
338 3300005842 Ga0068858_101567888 Ga0068858_1015678883 39
339 3300005842 Ga0068858_102596385 Ga0068858_1025963852 39
340 3300005843 Ga0068860_100886516 Ga0068860_1008865161 39
341 3300005843 Ga0068860_101092729 Ga0068860_1010927292 39
342 3300005844 Ga0068862_101001200 Ga0068862_1010012003 39
343 3300005983 Ga0081540_1022845 Ga0081540_10228453 39
344 3300006028 Ga0070717_10322240 Ga0070717_103222402 39
345 3300006028 Ga0070717_10436720 Ga0070717_104367203 39
346 3300006028 Ga0070717_10462797 Ga0070717_104627973 39
347 3300006038 Ga0075365_10017476 Ga0075365_100174763 39
348 3300006038 Ga0075365_10081343 Ga0075365_100813432 39
349 3300006038 Ga0075365_10250550 Ga0075365_102505502 39
350 3300006038 Ga0075365_10267775 Ga0075365_102677751 39
351 3300006042 Ga0075368_10017546 Ga0075368_100175463 39
352 3300006042 Ga0075368_10420419 Ga0075368_104204191 39
353 3300006048 Ga0075363_100011164 Ga0075363_1000111643 39
354 3300006051 Ga0075364_10005402 Ga0075364_100054025 39
355 3300006173 Ga0070716_100451998 Ga0070716_1004519982 39
356 3300006173 Ga0070716_100862409 Ga0070716_1008624091 39
357 3300006175 Ga0070712_100069999 Ga0070712_1000699993 39
358 3300006175 Ga0070712_101566473 Ga0070712_1015664732 39
359 3300006175 Ga0070712_101757244 Ga0070712_1017572442 39
360 3300006177 Ga0075362_10069751 Ga0075362_100697513 39
361 3300006177 Ga0075362_10137574 Ga0075362_101375742 39
362 3300006178 Ga0075367_10085093 Ga0075367_100850932 39
363 3300006186 Ga0075369_10318364 Ga0075369_103183641 39
364 3300006195 Ga0075366_10017389 Ga0075366_100173892 39
365 3300006237 Ga0097621_100223218 Ga0097621_1002232182 39
366 3300006237 Ga0097621_100564926 Ga0097621_1005649263 39
367 3300006237 Ga0097621_101310086 Ga0097621_1013100862 39
368 3300006353 Ga0075370_10137202 Ga0075370_101372022 39
369 3300006353 Ga0075370_10194495 Ga0075370_101944952 39
370 3300006353 Ga0075370_11035441 Ga0075370_110354412 39
371 3300006358 Ga0068871_101062395 Ga0068871_1010623951 39
372 3300006881 Ga0068865_100245430 Ga0068865_1002454302 39
373 3300006881 Ga0068865_100268249 Ga0068865_1002682491 39
374 3300006931 Ga0097620_101773082 Ga0097620_1017730822 39
375 3300007265 Ga0099794_10055377 Ga0099794_100553772 39
376 3300007265 Ga0099794_10086537 Ga0099794_100865372 39
377 3300007265 Ga0099794_10141116 Ga0099794_101411162 39
378 3300007265 Ga0099794_10233266 Ga0099794_102332661 39
379 3300007788 Ga0099795_10078507 Ga0099795_100785072 39
380 3300009093 Ga0105240_10008011 Ga0105240_100080118 39
381 3300009093 Ga0105240_10175583 Ga0105240_101755832 39
382 3300009093 Ga0105240_11194586 Ga0105240_111945862 39
383 3300009093 Ga0105240_11440288 Ga0105240_114402881 39
384 3300009098 Ga0105245_10053578 Ga0105245_100535786 39
385 3300009098 Ga0105245_10520911 Ga0105245_105209112 39
386 3300009098 Ga0105245_10932227 Ga0105245_109322272 39
387 3300009101 Ga0105247_10077200 Ga0105247_100772003 39
388 3300009101 Ga0105247_10403566 Ga0105247_104035662 39
389 3300009101 Ga0105247_11145086 Ga0105247_111450862 39
390 3300009148 Ga0105243_10185598 Ga0105243_101855983 39
391 3300009148 Ga0105243_10760601 Ga0105243_107606012 39
392 3300009148 Ga0105243_11021426 Ga0105243_110214262 39
393 3300009148 Ga0105243_11589926 Ga0105243_115899261 39
394 3300009174 Ga0105241_10017356 Ga0105241_100173565 39
395 3300009174 Ga0105241_10042315 Ga0105241_100423152 39
396 3300009174 Ga0105241_11675701 Ga0105241_116757012 39
397 3300009174 Ga0105241_12622055 Ga0105241_126220551 39
398 3300009176 Ga0105242_10560358 Ga0105242_105603582 39
399 3300009176 Ga0105242_11738967 Ga0105242_117389672 39
400 3300009177 Ga0105248_11155719 Ga0105248_111557193 39
401 3300009177 Ga0105248_11233255 Ga0105248_112332553 39
402 3300009177 Ga0105248_11620402 Ga0105248_116204021 39
403 3300009177 Ga0105248_11863307 Ga0105248_118633071 39
404 3300009545 Ga0105237_10013056 Ga0105237_100130566 39
405 3300009545 Ga0105237_10023723 Ga0105237_100237238 39
406 3300009545 Ga0105237_10076753 Ga0105237_100767532 39
407 3300009545 Ga0105237_10314906 Ga0105237_103149064 39
408 3300009545 Ga0105237_11244502 Ga0105237_112445022 39
409 3300009545 Ga0105237_12423189 Ga0105237_124231891 39
410 3300009551 Ga0105238_10072235 Ga0105238_100722353 39
411 3300009551 Ga0105238_10206265 Ga0105238_102062652 39
412 3300009551 Ga0105238_10282173 Ga0105238_102821732 39
413 3300009551 Ga0105238_10455331 Ga0105238_104553312 39
414 3300009551 Ga0105238_10456298 Ga0105238_104562982 39
415 3300009551 Ga0105238_11348580 Ga0105238_113485801 39
416 3300009551 Ga0105238_12528825 Ga0105238_125288251 39
417 3300009553 Ga0105249_10393071 Ga0105249_103930711 39
418 3300009553 Ga0105249_10659029 Ga0105249_106590292 39
419 3300009553 Ga0105249_12571103 Ga0105249_125711031 39
420 3300010159 Ga0099796_10036158 Ga0099796_100361581 39
421 3300010159 Ga0099796_10139889 Ga0099796_101398891 39
422 3300010159 Ga0099796_10260578 Ga0099796_102605782 39
423 3300010375 Ga0105239_10083468 Ga0105239_100834682 39
424 3300010375 Ga0105239_10090326 Ga0105239_100903264 39
425 3300010375 Ga0105239_10126165 Ga0105239_101261652 39
426 3300010375 Ga0105239_10570676 Ga0105239_105706762 39
427 3300010375 Ga0105239_11343105 Ga0105239_113431051 39
428 3300010375 Ga0105239_11652019 Ga0105239_116520191 39
429 3300010375 Ga0105239_11991811 Ga0105239_119918112 39
430 3300010375 Ga0105239_12720789 Ga0105239_127207891 39
431 3300010375 Ga0105239_13234032 Ga0105239_132340321 39
432 3300011119 Ga0105246_10009410 Ga0105246_100094107 39
433 3300011119 Ga0105246_10528937 Ga0105246_105289372 39
434 3300011119 Ga0105246_11755427 Ga0105246_117554271 39
435 3300011119 Ga0105246_12184952 Ga0105246_121849521 39
436 3300013104 Ga0157370_10147989 Ga0157370_101479892 39
437 3300013104 Ga0157370_10641278 Ga0157370_106412781 39
438 3300013105 Ga0157369_10328129 Ga0157369_103281291 39
439 3300013105 Ga0157369_10447292 Ga0157369_104472922 39
440 3300013105 Ga0157369_10762962 Ga0157369_107629622 39
441 3300013296 Ga0157374_10172284 Ga0157374_101722843 39
442 3300013296 Ga0157374_10699457 Ga0157374_106994571 39
443 3300013296 Ga0157374_11698538 Ga0157374_116985382 39
444 3300013296 Ga0157374_12713958 Ga0157374_127139582 39
445 3300013297 Ga0157378_10021966 Ga0157378_100219666 39
446 3300013297 Ga0157378_11518386 Ga0157378_115183862 39
447 3300013297 Ga0157378_13036553 Ga0157378_130365531 39
448 3300013306 Ga0163162_10211021 Ga0163162_102110212 39
449 3300013306 Ga0163162_10363237 Ga0163162_103632372 39
450 3300013306 Ga0163162_12331518 Ga0163162_123315181 39
451 3300013307 Ga0157372_10858685 Ga0157372_108586852 39
452 3300013307 Ga0157372_11419015 Ga0157372_114190151 39
453 3300013307 Ga0157372_11863521 Ga0157372_118635212 39
454 3300013307 Ga0157372_13010305 Ga0157372_130103051 39
455 3300013308 Ga0157375_10022651 Ga0157375_100226519 39
456 3300013308 Ga0157375_11040967 Ga0157375_110409672 39
457 3300014325 Ga0163163_10058843 Ga0163163_100588434 39
458 3300014325 Ga0163163_10204672 Ga0163163_102046722 39
459 3300014325 Ga0163163_10206996 Ga0163163_102069964 39
460 3300014325 Ga0163163_11820257 Ga0163163_118202571 39
461 3300014326 Ga0157380_10180008 Ga0157380_101800083 39
462 3300014326 Ga0157380_12934799 Ga0157380_129347991 39
463 3300014497 Ga0182008_10642900 Ga0182008_106429002 39
464 3300014745 Ga0157377_11095706 Ga0157377_110957062 39
465 3300014968 Ga0157379_10375604 Ga0157379_103756041 39
466 3300014968 Ga0157379_11252818 Ga0157379_112528181 39
467 3300014968 Ga0157379_12600858 Ga0157379_126008582 39
468 3300014969 Ga0157376_10119929 Ga0157376_101199293 39
469 3300014969 Ga0157376_10134165 Ga0157376_101341653 39
470 3300014969 Ga0157376_11757852 Ga0157376_117578521 39
471 3300014969 Ga0157376_11800390 Ga0157376_118003901 39
472 3300015262 Ga0182007_10407858 Ga0182007_104078582 39
473 3300015262 Ga0182007_10442664 Ga0182007_104426642 39
474 3300017792 Ga0163161_10113151 Ga0163161_101131512 39
475 3300017792 Ga0163161_10176887 Ga0163161_101768872 39
476 3300017792 Ga0163161_10509223 Ga0163161_105092232 39
477 3300017792 Ga0163161_11924211 Ga0163161_119242111 39
478 3300020070 Ga0206356_10023491 Ga0206356_100234911 39
479 3300020076 Ga0206355_1036216 Ga0206355_10362161 39
480 3300020078 Ga0206352_10589176 Ga0206352_105891762 39
481 3300022467 Ga0224712_10680198 Ga0224712_106801981 39
482 3300025230 Ga0209563_102215 Ga0209563_1022157 39
483 3300025245 Ga0207425_1006516 Ga0207425_10065162 39
484 3300025253 Ga0209677_103623 Ga0209677_1036235 39
485 3300025254 Ga0209148_1000613 Ga0209148_100061313 39
486 3300025261 Ga0209233_1002145 Ga0209233_10021452 39
487 3300025261 Ga0209233_1050754 Ga0209233_10507541 39
488 3300025261 Ga0209233_1056370 Ga0209233_10563701 39
489 3300025272 Ga0209455_1006815 Ga0209455_10068153 39
490 3300025272 Ga0209455_1026502 Ga0209455_10265022 39
491 3300025295 Ga0209564_1029273 Ga0209564_10292732 39
492 3300025297 Ga0209758_1000140 Ga0209758_1000140144 39
493 3300025297 Ga0209758_1000947 Ga0209758_100094712 39
494 3300025297 Ga0209758_1003609 Ga0209758_10036093 39
495 3300025297 Ga0209758_1005374 Ga0209758_100537411 39
496 3300025297 Ga0209758_1042318 Ga0209758_10423183 39
497 3300025297 Ga0209758_1051423 Ga0209758_10514232 39
498 3300025297 Ga0209758_1175703 Ga0209758_11757032 39
499 3300025299 Ga0209256_1002028 Ga0209256_100202815 39
500 3300025299 Ga0209256_1024617 Ga0209256_10246173 39
501 3300025302 Ga0207426_1015110 Ga0207426_10151104 39
502 3300025302 Ga0207426_1068022 Ga0207426_10680222 39
503 3300025302 Ga0207426_1159330 Ga0207426_11593301 39
504 3300025303 Ga0209051_1128377 Ga0209051_11283772 39
505 3300025304 Ga0209257_1002350 Ga0209257_10023506 39
506 3300025315 Ga0207697_10119911 Ga0207697_101199112 39
507 3300025898 Ga0207692_10161298 Ga0207692_101612981 39
508 3300025898 Ga0207692_10562369 Ga0207692_105623692 39
509 3300025898 Ga0207692_10672494 Ga0207692_106724942 39
510 3300025899 Ga0207642_10231489 Ga0207642_102314892 39
511 3300025900 Ga0207710_10105898 Ga0207710_101058983 39
512 3300025901 Ga0207688_10337669 Ga0207688_103376692 39
513 3300025904 Ga0207647_10248501 Ga0207647_102485013 39
514 3300025906 Ga0207699_10371236 Ga0207699_103712362 39
515 3300025906 Ga0207699_10468957 Ga0207699_104689572 39
516 3300025909 Ga0207705_10047582 Ga0207705_100475821 39
517 3300025911 Ga0207654_10013515 Ga0207654_100135152 39
518 3300025911 Ga0207654_10120272 Ga0207654_101202722 39
519 3300025912 Ga0207707_11158837 Ga0207707_111588371 39
520 3300025913 Ga0207695_10001812 Ga0207695_100018128 39
521 3300025913 Ga0207695_10083692 Ga0207695_100836924 39
522 3300025913 Ga0207695_10367187 Ga0207695_103671873 39
523 3300025914 Ga0207671_10008448 Ga0207671_100084488 39
524 3300025914 Ga0207671_10015673 Ga0207671_100156734 39
525 3300025914 Ga0207671_11043932 Ga0207671_110439322 39
526 3300025915 Ga0207693_10023161 Ga0207693_100231614 39
527 3300025915 Ga0207693_10196466 Ga0207693_101964662 39
528 3300025915 Ga0207693_10345367 Ga0207693_103453673 39
529 3300025916 Ga0207663_10014304 Ga0207663_100143042 39
530 3300025916 Ga0207663_10055178 Ga0207663_100551782 39
531 3300025916 Ga0207663_11349282 Ga0207663_113492821 39
532 3300025919 Ga0207657_10431570 Ga0207657_104315702 39
533 3300025919 Ga0207657_10661083 Ga0207657_106610832 39
534 3300025919 Ga0207657_10890799 Ga0207657_108907992 39
535 3300025920 Ga0207649_10534085 Ga0207649_105340852 39
536 3300025923 Ga0207681_11311689 Ga0207681_113116891 39
537 3300025924 Ga0207694_10127659 Ga0207694_101276593 39
538 3300025924 Ga0207694_10310607 Ga0207694_103106072 39
539 3300025924 Ga0207694_10540814 Ga0207694_105408143 39
540 3300025925 Ga0207650_10402064 Ga0207650_104020643 39
541 3300025927 Ga0207687_10588117 Ga0207687_105881174 39
542 3300025927 Ga0207687_11695626 Ga0207687_116956261 39
543 3300025928 Ga0207700_10028875 Ga0207700_100288753 39
544 3300025928 Ga0207700_10453969 Ga0207700_104539692 39
545 3300025928 Ga0207700_11795731 Ga0207700_117957312 39
546 3300025931 Ga0207644_10050732 Ga0207644_100507322 39
547 3300025932 Ga0207690_11851772 Ga0207690_118517721 39
548 3300025933 Ga0207706_10040465 Ga0207706_100404652 39
549 3300025933 Ga0207706_10211044 Ga0207706_102110443 39
550 3300025934 Ga0207686_10187908 Ga0207686_101879083 39
551 3300025934 Ga0207686_10377844 Ga0207686_103778441 39
552 3300025935 Ga0207709_11015374 Ga0207709_110153741 39
553 3300025935 Ga0207709_11853856 Ga0207709_118538562 39
554 3300025936 Ga0207670_10668964 Ga0207670_106689642 39
555 3300025937 Ga0207669_10050701 Ga0207669_100507012 39
556 3300025937 Ga0207669_10376221 Ga0207669_103762212 39
557 3300025937 Ga0207669_11094978 Ga0207669_110949781 39
558 3300025938 Ga0207704_10092091 Ga0207704_100920913 39
559 3300025939 Ga0207665_10327895 Ga0207665_103278952 39
560 3300025939 Ga0207665_10372525 Ga0207665_103725252 39
561 3300025940 Ga0207691_10272988 Ga0207691_102729882 39
562 3300025940 Ga0207691_10465829 Ga0207691_104658292 39
563 3300025941 Ga0207711_11021772 Ga0207711_110217723 39
564 3300025942 Ga0207689_10319024 Ga0207689_103190242 39
565 3300025945 Ga0207679_11072895 Ga0207679_110728953 39
566 3300025949 Ga0207667_10329363 Ga0207667_103293632 39
567 3300025949 Ga0207667_11673645 Ga0207667_116736452 39
568 3300025949 Ga0207667_11962640 Ga0207667_119626402 39
569 3300025960 Ga0207651_12109938 Ga0207651_121099382 39
570 3300025961 Ga0207712_10161164 Ga0207712_101611643 39
571 3300025961 Ga0207712_10504353 Ga0207712_105043532 39
572 3300025972 Ga0207668_11324050 Ga0207668_113240502 39
573 3300025981 Ga0207640_10139297 Ga0207640_101392972 39
574 3300025981 Ga0207640_11246714 Ga0207640_112467141 39
575 3300025986 Ga0207658_11187351 Ga0207658_111873511 39
576 3300025986 Ga0207658_11824967 Ga0207658_118249671 39
577 3300026023 Ga0207677_10629850 Ga0207677_106298502 39
578 3300026035 Ga0207703_10209586 Ga0207703_102095862 39
579 3300026035 Ga0207703_10236733 Ga0207703_102367333 39
580 3300026041 Ga0207639_10064032 Ga0207639_100640323 39
581 3300026041 Ga0207639_10326860 Ga0207639_103268601 39
582 3300026041 Ga0207639_10795085 Ga0207639_107950852 39
583 3300026041 Ga0207639_10910608 Ga0207639_109106081 39
584 3300026067 Ga0207678_10023810 Ga0207678_100238105 39
585 3300026067 Ga0207678_10042633 Ga0207678_100426334 39
586 3300026067 Ga0207678_10257339 Ga0207678_102573392 39
587 3300026067 Ga0207678_11593449 Ga0207678_115934492 39
588 3300026078 Ga0207702_10468033 Ga0207702_104680332 39
589 3300026078 Ga0207702_10603387 Ga0207702_106033872 39
590 3300026078 Ga0207702_10886341 Ga0207702_108863411 39
591 3300026088 Ga0207641_10118910 Ga0207641_101189103 39
592 3300026088 Ga0207641_10319091 Ga0207641_103190913 39
593 3300026089 Ga0207648_10078966 Ga0207648_100789663 39
594 3300026089 Ga0207648_11918656 Ga0207648_119186561 39
595 3300026095 Ga0207676_10145307 Ga0207676_101453072 39
596 3300026095 Ga0207676_12080313 Ga0207676_120803132 39
597 3300026116 Ga0207674_10023499 Ga0207674_100234993 39
598 3300026116 Ga0207674_10025096 Ga0207674_100250962 39
599 3300026116 Ga0207674_10689302 Ga0207674_106893021 39
600 3300026116 Ga0207674_10768339 Ga0207674_107683391 39
601 3300026118 Ga0207675_101237110 Ga0207675_1012371102 39
602 3300026118 Ga0207675_101877065 Ga0207675_1018770652 39
603 3300026121 Ga0207683_10017928 Ga0207683_100179286 39
604 3300026121 Ga0207683_10081626 Ga0207683_100816262 39
605 3300026142 Ga0207698_10054848 Ga0207698_100548482 39
606 3300026142 Ga0207698_12440783 Ga0207698_124407831 39
607 3300027671 Ga0209588_1002844 Ga0209588_10028442 39
608 3300027671 Ga0209588_1036401 Ga0209588_10364012 39
609 3300027866 Ga0209813_10007941 Ga0209813_100079411 39
610 3300028379 Ga0268266_10075776 Ga0268266_100757763 39
611 3300028379 Ga0268266_10297501 Ga0268266_102975013 39
612 3300028379 Ga0268266_10626397 Ga0268266_106263971 39
613 3300028381 Ga0268264_10171189 Ga0268264_101711893 39
614 3300028786 Ga0307517_10515920 Ga0307517_105159201 39
615 3300028786 Ga0307517_10578149 Ga0307517_105781491 39
616 3300030888 Ga0265769_118030 Ga0265769_1180302 39
617 3300030942 Ga0247549_105379 Ga0247549_1053791 39
618 3300031249 Ga0265339_10384633 Ga0265339_103846331 39
619 3300031250 Ga0265331_10501204 Ga0265331_105012042 39
620 3300031456 Ga0307513_10181175 Ga0307513_101811753 39
621 3300031548 Ga0307408_100287753 Ga0307408_1002877531 39
622 3300031616 Ga0307508_10014943 Ga0307508_100149438 39
623 3300031616 Ga0307508_10456160 Ga0307508_104561601 39
624 3300031730 Ga0307516_10073807 Ga0307516_100738073 39
625 3300031911 Ga0307412_10301226 Ga0307412_103012261 39
626 3300031911 Ga0307412_12045166 Ga0307412_120451662 39
627 3300032002 Ga0307416_100136404 Ga0307416_1001364043 39
628 3300033180 Ga0307510_10020232 Ga0307510_100202323 39
629 3300033180 Ga0307510_10073103 Ga0307510_100731033 39
630 3300033180 Ga0307510_10184331 Ga0307510_101843312 39
631 3300033180 Ga0307510_10227114 Ga0307510_102271143 39
632 3300035089 Ga0373944_0029919 Ga0373944_0029919_692_814 39
633 3300035113 Ga0373936_0097953 Ga0373936_0097953_1083_1205 39
634 3300035118 Ga0373954_0259264 Ga0373954_0259264_513_632 39
635 3300035170 Ga0373943_0913522 Ga0373943_0913522_175_294 39
636 3300035171 Ga0373946_0699040 Ga0373946_0699040_360_482 39
637 3300035242 Ga0373962_0157354 Ga0373962_0157354_81_200 39
638 3300035692 Ga0373935_0988566 Ga0373935_0988566_43_162 39
639 3300035695 Ga0373927_0015643 Ga0373927_0015643_4501_4623 39
640 3300035725 Ga0373947_0138338 Ga0373947_0138338_553_675 39
641 3300037068 Ga0373925_0092600 Ga0373925_0092600_1665_1787 39
642 3300037068 Ga0373925_0252100 Ga0373925_0252100_89_208 39
643 3300037312 Ga0395899_0279076 Ga0395899_0279076_1000_1119 39
644 3300037312 Ga0395899_0411700 Ga0395899_0411700_312_431 39
645 3300037418 Ga0395900_0001120 Ga0395900_0001120_16695_16814 39
646 3300037418 Ga0395900_0418013 Ga0395900_0418013_959_1081 39
647 3300037466 Ga0395898_0213378 Ga0395898_0213378_99_218 39
648 3300037466 Ga0395898_0622634 Ga0395898_0622634_863_982 39
649 3300037471 Ga0395905_0284985 Ga0395905_0284985_1262_1384 39
650 3300037471 Ga0395905_0344769 Ga0395905_0344769_808_927 39
651 3300037471 Ga0395905_0932708 Ga0395905_0932708_418_537 39
652 3300038443 Ga0395901_0047401 Ga0395901_0047401_700_819 39
653 3300038443 Ga0395901_0325049 Ga0395901_0325049_360_482 39
654 3300039437 Ga0436365_0622298 Ga0436365_0622298_184_303 39
655 3300039437 Ga0436365_1036456 Ga0436365_1036456_812_931 39
656 3300041441 Ga0451787_196962 Ga0451787_196962_591_710 39
657 3300041443 Ga0451789_0693148 Ga0451789_0693148_81_200 39
658 3300041452 Ga0451793_1762582 Ga0451793_1762582_123_242 39
659 3300041456 Ga0451795_1706771 Ga0451795_1706771_65_184 39
660 3300041459 Ga0451800_1282933 Ga0451800_1282933_76_198 39
661 3300041459 Ga0451800_1540693 Ga0451800_1540693_355_474 39
662 3300041460 Ga0451802_2024691 Ga0451802_2024691_131_250 39
663 3300041463 Ga0451804_0554310 Ga0451804_0554310_316_435 39
664 3300041486 Ga0451807_2642741 Ga0451807_2642741_242_361 39
665 3300041492 Ga0451835_0179581 Ga0451835_0179581_694_813 39
666 3300041496 Ga0451839_1012687 Ga0451839_1012687_331_450 39
667 3300041502 Ga0451846_40364 Ga0451846_40364_356_475 39
668 3300041503 Ga0451847_0344410 Ga0451847_0344410_74_193 39
669 3300041505 Ga0451849_0393855 Ga0451849_0393855_389_508 39
670 3300041509 Ga0451843_0876415 Ga0451843_0876415_385_504 39
671 3300041510 Ga0451854_13610 Ga0451854_13610_85_204 39
672 3300041512 Ga0451853_2531308 Ga0451853_2531308_510_629 39
673 3300044656 Ga0466969_0156722 Ga0466969_0156722_848_967 39
674 3300044658 Ga0466972_0001305 Ga0466972_0001305_2370_2489 39
675 3300044684 Ga0466966_0016619 Ga0466966_0016619_1162_1281 39
676 3300044693 Ga0466961_0000824 Ga0466961_0000824_6361_6480 39
677 3300044693 Ga0466961_0722709 Ga0466961_0722709_18_137 39
678 3300044694 Ga0466963_0044960 Ga0466963_0044960_1229_1348 39
679 3300044694 Ga0466963_0265599 Ga0466963_0265599_860_985 39
680 3300044706 Ga0466964_0132903 Ga0466964_0132903_59_178 39
681 3300044706 Ga0466964_0499895 Ga0466964_0499895_502_621 39
682 3300044735 Ga0466968_0007808 Ga0466968_0007808_249_368 39
683 3300044735 Ga0466968_0041096 Ga0466968_0041096_948_1067 39
684 3300044842 Ga0466957_0293103 Ga0466957_0293103_140_259 39
685 3300044842 Ga0466957_0463426 Ga0466957_0463426_719_844 39
686 3300045049 Ga0466959_0030355 Ga0466959_0030355_2194_2313 39
687 3300045976 Ga0466967_0393415 Ga0466967_0393415_1054_1173 39
688 3300045976 Ga0466967_0531845 Ga0466967_0531845_711_836 39
689 3300046452 Ga0495617_108104 Ga0495617_108104_686_805 39
690 3300046454 Ga0495592_0480942 Ga0495592_0480942_561_680 39
691 3300046455 Ga0495603_0192639 Ga0495603_0192639_484_603 39
692 3300046455 Ga0495603_0732924 Ga0495603_0732924_214_333 39
693 3300046457 Ga0495590_0019556 Ga0495590_0019556_465_584 39
694 3300046459 Ga0495629_0064554 Ga0495629_0064554_143_262 39
695 3300046459 Ga0495629_0564113 Ga0495629_0564113_511_630 39
696 3300046460 Ga0495638_0007084 Ga0495638_0007084_1592_1711 39
697 3300046461 Ga0495641_0194500 Ga0495641_0194500_379_498 39
698 3300046462 Ga0495651_0000395 Ga0495651_0000395_29430_29549 39
699 3300046462 Ga0495651_0073861 Ga0495651_0073861_250_369 39
700 3300046463 Ga0495653_0018118 Ga0495653_0018118_1135_1254 39
701 3300046473 Ga0495582_0877697 Ga0495582_0877697_61_183 39
702 3300046474 Ga0495605_0023708 Ga0495605_0023708_3027_3146 39
703 3300046474 Ga0495605_0039659 Ga0495605_0039659_306_425 39
704 3300046475 Ga0495639_0094261 Ga0495639_0094261_963_1085 39
705 3300046475 Ga0495639_0261787 Ga0495639_0261787_645_764 39
706 3300046476 Ga0495662_0511907 Ga0495662_0511907_131_250 39
707 3300046477 Ga0495664_0011185 Ga0495664_0011185_1171_1290 39
708 3300046477 Ga0495664_0730469 Ga0495664_0730469_177_299 39
709 3300046491 Ga0495584_0167515 Ga0495584_0167515_64_183 39
710 3300046491 Ga0495584_0507315 Ga0495584_0507315_350_469 39
711 3300046492 Ga0495585_0372368 Ga0495585_0372368_133_252 39
712 3300046501 Ga0495607_0076201 Ga0495607_0076201_1685_1804 39
713 3300046501 Ga0495607_0190493 Ga0495607_0190493_449_568 39
714 3300046506 Ga0495583_0029773 Ga0495583_0029773_1716_1835 39
715 3300046507 Ga0495606_0005408 Ga0495606_0005408_5728_5847 39
716 3300046507 Ga0495606_0130110 Ga0495606_0130110_1064_1183 39
717 3300046507 Ga0495606_0535958 Ga0495606_0535958_32_151 39
718 3300046507 Ga0495606_0565615 Ga0495606_0565615_270_389 39
719 3300046511 Ga0495608_0044734 Ga0495608_0044734_983_1102 39
720 3300046511 Ga0495608_0110092 Ga0495608_0110092_16_135 39
721 3300046512 Ga0495610_0073720 Ga0495610_0073720_1116_1235 39
722 3300046512 Ga0495610_0378719 Ga0495610_0378719_32_151 39
723 3300046513 Ga0495616_0075021 Ga0495616_0075021_1196_1315 39
724 3300046513 Ga0495616_0077386 Ga0495616_0077386_480_599 39
725 3300046514 Ga0495618_0185214 Ga0495618_0185214_595_714 39
726 3300046515 Ga0495620_0189467 Ga0495620_0189467_532_651 39
727 3300046516 Ga0495628_0083056 Ga0495628_0083056_408_527 39
728 3300046516 Ga0495628_0211379 Ga0495628_0211379_350_469 39
729 3300046517 Ga0495630_1250505 Ga0495630_1250505_196_315 39
730 3300046519 Ga0495632_0099585 Ga0495632_0099585_25_144 39
731 3300046522 Ga0495643_0014352 Ga0495643_0014352_1435_1554 39
732 3300046522 Ga0495643_0147191 Ga0495643_0147191_293_412 39
733 3300046524 Ga0495648_0022804 Ga0495648_0022804_1459_1578 39
734 3300046524 Ga0495648_0040800 Ga0495648_0040800_23_142 39
735 3300046524 Ga0495648_0074846 Ga0495648_0074846_355_474 39
736 3300046524 Ga0495648_0142818 Ga0495648_0142818_82_201 39
737 3300046529 Ga0495652_0007066 Ga0495652_0007066_6039_6158 39
738 3300046529 Ga0495652_0095231 Ga0495652_0095231_147_266 39
739 3300046529 Ga0495652_0119535 Ga0495652_0119535_1496_1615 39
740 3300046529 Ga0495652_0746167 Ga0495652_0746167_321_440 39
741 3300046533 Ga0495640_0098157 Ga0495640_0098157_961_1080 39
742 3300046535 Ga0495586_0483009 Ga0495586_0483009_571_690 39
743 3300046536 Ga0495587_0040181 Ga0495587_0040181_363_482 39
744 3300046538 Ga0495609_0156101 Ga0495609_0156101_420_539 39
745 3300046542 Ga0495597_0168223 Ga0495597_0168223_244_363 39
746 3300046543 Ga0495645_0005486 Ga0495645_0005486_7196_7315 39
747 3300046543 Ga0495645_0915332 Ga0495645_0915332_250_369 39
748 3300046557 Ga0495622_0006800 Ga0495622_0006800_3331_3450 39
749 3300046557 Ga0495622_0044077 Ga0495622_0044077_396_515 39
750 3300046559 Ga0495667_0028916 Ga0495667_0028916_664_783 39
751 3300046616 Ga0495668_0035794 Ga0495668_0035794_1406_1525 39
752 3300046616 Ga0495668_0112222 Ga0495668_0112222_732_851 39
753 3300046616 Ga0495668_0246755 Ga0495668_0246755_234_356 39
754 3300046616 Ga0495668_0861282 Ga0495668_0861282_291_410 39
755 3300046642 Ga0495634_0057331 Ga0495634_0057331_1836_1955 39
756 3300046648 Ga0495611_0154240 Ga0495611_0154240_340_462 39
757 3300046648 Ga0495611_0241284 Ga0495611_0241284_467_586 39
758 3300046660 Ga0495625_0052611 Ga0495625_0052611_2072_2191 39
759 3300046660 Ga0495625_0076815 Ga0495625_0076815_1174_1293 39
760 3300046660 Ga0495625_0283928 Ga0495625_0283928_753_872 39
761 3300046663 Ga0495635_0019775 Ga0495635_0019775_172_291 39
762 3300046663 Ga0495635_0159376 Ga0495635_0159376_407_526 39
763 3300046663 Ga0495635_0398215 Ga0495635_0398215_431_550 39
764 3300046663 Ga0495635_0873062 Ga0495635_0873062_321_443 39
765 3300046674 Ga0495588_0010601 Ga0495588_0010601_3906_4025 39
766 3300046674 Ga0495588_0212270 Ga0495588_0212270_639_761 39
767 3300046675 Ga0495657_0006948 Ga0495657_0006948_1950_2069 39
768 3300046675 Ga0495657_0049522 Ga0495657_0049522_2264_2383 39
769 3300046678 Ga0495599_0007121 Ga0495599_0007121_3164_3283 39
770 3300046679 Ga0495623_0020182 Ga0495623_0020182_1591_1710 39
771 3300046680 Ga0495646_0035065 Ga0495646_0035065_849_968 39
772 3300046680 Ga0495646_0402961 Ga0495646_0402961_479_598 39
773 3300046684 Ga0495669_0274679 Ga0495669_0274679_397_516 39
774 3300046689 Ga0495613_0286788 Ga0495613_0286788_291_410 39
775 3300046690 Ga0495624_0031406 Ga0495624_0031406_135_254 39
776 3300046692 Ga0495671_0149254 Ga0495671_0149254_318_437 39
777 3300046694 Ga0495649_0005752 Ga0495649_0005752_6811_6930 39
778 3300046694 Ga0495649_0642903 Ga0495649_0642903_137_256 39
779 3300046809 Ga0495600_0000352 Ga0495600_0000352_11934_12053 39
780 3300046809 Ga0495600_0020574 Ga0495600_0020574_2631_2750 39
781 3300046809 Ga0495600_0600682 Ga0495600_0600682_418_537 39
782 3300046810 Ga0495660_0080351 Ga0495660_0080351_1403_1522 39
783 3300047315 Ga0495581_0172984 Ga0495581_0172984_1119_1238 39
784 3300047317 Ga0495604_0094238 Ga0495604_0094238_144_263 39
785 3300047317 Ga0495604_0435412 Ga0495604_0435412_156_275 39
786 3300047319 Ga0495674_0655453 Ga0495674_0655453_601_723 39
787 3300047319 Ga0495674_0916254 Ga0495674_0916254_155_274 39
788 3300047319 Ga0495674_1266743 Ga0495674_1266743_257_376 39
789 3300047320 Ga0495672_0148720 Ga0495672_0148720_365_484 39
790 3300047321 Ga0495676_0094099 Ga0495676_0094099_1417_1536 39
791 3300047322 Ga0495680_0006443 Ga0495680_0006443_2279_2398 39
792 3300047323 Ga0495683_0208286 Ga0495683_0208286_18_137 39
793 3300047323 Ga0495683_0341654 Ga0495683_0341654_258_377 39
794 3300047323 Ga0495683_0425760 Ga0495683_0425760_186_305 39
795 3300047443 Ga0495687_074897 Ga0495687_074897_438_557 39
796 3300047444 Ga0495675_0011402 Ga0495675_0011402_4482_4601 39
797 3300047469 Ga0495673_0030416 Ga0495673_0030416_2007_2126 39
798 3300047469 Ga0495673_0034560 Ga0495673_0034560_2080_2199 39
799 3300047469 Ga0495673_0067183 Ga0495673_0067183_1029_1151 39
800 3300047469 Ga0495673_0285812 Ga0495673_0285812_387_506 39
801 3300047471 Ga0495684_0030660 Ga0495684_0030660_3067_3186 39
802 3300047471 Ga0495684_0513829 Ga0495684_0513829_140_259 39
803 3300047472 Ga0495686_0030480 Ga0495686_0030480_3279_3398 39
804 3300047472 Ga0495686_0172808 Ga0495686_0172808_199_318 39
805 3300047673 Ga0495593_0032414 Ga0495593_0032414_2470_2589 39
806 3300048088 Ga0495602_0038238 Ga0495602_0038238_29_148 39
807 3300048089 Ga0495614_0136205 Ga0495614_0136205_782_901 39
808 3300048090 Ga0495615_0282951 Ga0495615_0282951_187_306 39
809 3300048091 Ga0495626_0113018 Ga0495626_0113018_919_1038 39
810 3300048091 Ga0495626_0415393 Ga0495626_0415393_371_490 39
811 3300048903 Ga0496100_0034879 Ga0496100_0034879_1220_1339 39
812 3300048903 Ga0496100_0039191 Ga0496100_0039191_2182_2304 39
813 3300048903 Ga0496100_0867304 Ga0496100_0867304_547_666 39
814 3300048903 Ga0496100_0973547 Ga0496100_0973547_292_411 39
815 3300048904 Ga0496101_0077194 Ga0496101_0077194_1477_1599 39
816 3300048904 Ga0496101_0080077 Ga0496101_0080077_1550_1669 39
817 3300048904 Ga0496101_0089989 Ga0496101_0089989_1169_1288 39
818 3300048904 Ga0496101_0106798 Ga0496101_0106798_509_628 39
819 3300048904 Ga0496101_0396158 Ga0496101_0396158_555_674 39
820 3300048904 Ga0496101_0837558 Ga0496101_0837558_441_563 39
821 3300048904 Ga0496101_1505585 Ga0496101_1505585_356_478 39
822 3300048905 Ga0496102_0018854 Ga0496102_0018854_1496_1615 39
823 3300048905 Ga0496102_0065672 Ga0496102_0065672_133_252 39
824 3300048905 Ga0496102_0372784 Ga0496102_0372784_1168_1290 39
825 3300048905 Ga0496102_0561482 Ga0496102_0561482_98_217 39
826 3300048905 Ga0496102_1515664 Ga0496102_1515664_39_158 39
827 3300048906 Ga0496103_0036395 Ga0496103_0036395_1340_1459 39
828 3300048906 Ga0496103_0085278 Ga0496103_0085278_1570_1689 39
829 3300048906 Ga0496103_0913393 Ga0496103_0913393_377_496 39
830 3300048907 Ga0496104_0023388 Ga0496104_0023388_2544_2663 39
831 3300048907 Ga0496104_0055824 Ga0496104_0055824_2251_2370 39
832 3300048907 Ga0496104_0064686 Ga0496104_0064686_470_589 39
833 3300048907 Ga0496104_0253847 Ga0496104_0253847_1386_1505 39
834 3300048907 Ga0496104_1054196 Ga0496104_1054196_531_650 39
835 3300048908 Ga0496105_0039768 Ga0496105_0039768_2161_2280 39
836 3300048908 Ga0496105_0111956 Ga0496105_0111956_294_413 39
837 3300048908 Ga0496105_0355633 Ga0496105_0355633_577_696 39
838 3300048909 Ga0496106_0044113 Ga0496106_0044113_2618_2737 39
839 3300048909 Ga0496106_0163181 Ga0496106_0163181_126_245 39
840 3300048909 Ga0496106_0990198 Ga0496106_0990198_60_182 39
841 3300048910 Ga0496107_0036893 Ga0496107_0036893_1122_1241 39
842 3300048910 Ga0496107_0536006 Ga0496107_0536006_320_439 39
843 3300048911 Ga0496108_0200728 Ga0496108_0200728_748_867 39
844 3300048911 Ga0496108_0240805 Ga0496108_0240805_231_353 39
845 3300048911 Ga0496108_0455875 Ga0496108_0455875_550_669 39
846 3300048911 Ga0496108_0465179 Ga0496108_0465179_741_860 39
847 3300048912 Ga0496109_0688340 Ga0496109_0688340_461_580 39
848 3300048912 Ga0496109_1897075 Ga0496109_1897075_277_396 39
849 3300048913 Ga0496110_0060268 Ga0496110_0060268_133_252 39
850 3300048913 Ga0496110_0112463 Ga0496110_0112463_2059_2178 39
851 3300048913 Ga0496110_0792671 Ga0496110_0792671_564_683 39
852 3300048913 Ga0496110_0984647 Ga0496110_0984647_560_679 39
853 3300048914 Ga0496111_0205817 Ga0496111_0205817_346_465 39
854 3300048914 Ga0496111_0265716 Ga0496111_0265716_832_951 39
855 3300048915 Ga0496112_0089829 Ga0496112_0089829_245_364 39
856 3300048915 Ga0496112_0131611 Ga0496112_0131611_351_470 39
857 3300048915 Ga0496112_0991516 Ga0496112_0991516_518_637 39
858 3300048915 Ga0496112_1828797 Ga0496112_1828797_109_228 39
859 3300048916 Ga0496113_0022035 Ga0496113_0022035_4358_4477 39
860 3300048916 Ga0496113_0129693 Ga0496113_0129693_1390_1509 39
861 3300048916 Ga0496113_1281890 Ga0496113_1281890_47_169 39
862 3300048917 Ga0496114_0151126 Ga0496114_0151126_1030_1149 39
863 3300048917 Ga0496114_0254093 Ga0496114_0254093_19_138 39
864 3300048917 Ga0496114_0313388 Ga0496114_0313388_704_826 39
865 3300048917 Ga0496114_0368032 Ga0496114_0368032_211_333 39
866 3300048917 Ga0496114_0492315 Ga0496114_0492315_715_834 39
867 3300048917 Ga0496114_0644909 Ga0496114_0644909_700_819 39
868 3300048918 Ga0496115_0049501 Ga0496115_0049501_1361_1480 39
869 3300048918 Ga0496115_0106003 Ga0496115_0106003_1712_1834 39
870 3300048918 Ga0496115_0125282 Ga0496115_0125282_772_891 39
871 3300048918 Ga0496115_0269557 Ga0496115_0269557_300_419 39
872 3300048918 Ga0496115_0292383 Ga0496115_0292383_998_1120 39
873 3300048919 Ga0496116_0060976 Ga0496116_0060976_1625_1744 39
874 3300048919 Ga0496116_0181497 Ga0496116_0181497_530_649 39
875 3300048920 Ga0496117_0077767 Ga0496117_0077767_14_133 39
876 3300048920 Ga0496117_0238454 Ga0496117_0238454_816_935 39
877 3300048920 Ga0496117_0342127 Ga0496117_0342127_15_134 39
878 3300048920 Ga0496117_0358701 Ga0496117_0358701_606_725 39
879 3300048921 Ga0496118_0033894 Ga0496118_0033894_2772_2891 39
880 3300048921 Ga0496118_0041524 Ga0496118_0041524_30_149 39
881 3300048921 Ga0496118_0141702 Ga0496118_0141702_125_244 39
882 3300048921 Ga0496118_0143405 Ga0496118_0143405_757_876 39
883 3300048922 Ga0496119_0059606 Ga0496119_0059606_1627_1746 39
884 3300048922 Ga0496119_0082878 Ga0496119_0082878_526_645 39
885 3300048923 Ga0496120_0031804 Ga0496120_0031804_1085_1204 39
886 3300048923 Ga0496120_0411272 Ga0496120_0411272_138_257 39
887 3300048924 Ga0496121_0011802 Ga0496121_0011802_2027_2152 39
888 3300048924 Ga0496121_0402778 Ga0496121_0402778_227_346 39
889 3300048924 Ga0496121_0522977 Ga0496121_0522977_509_628 39
890 3300048924 Ga0496121_0583707 Ga0496121_0583707_374_496 39
891 3300048925 Ga0496122_0579947 Ga0496122_0579947_235_354 39
892 3300048927 Ga0496124_0301230 Ga0496124_0301230_295_414 39
893 3300048927 Ga0496124_0480453 Ga0496124_0480453_449_568 39
894 3300048929 Ga0496126_0012312 Ga0496126_0012312_1522_1647 39
895 3300048929 Ga0496126_0042501 Ga0496126_0042501_2396_2515 39
896 3300048929 Ga0496126_0054753 Ga0496126_0054753_2649_2768 39
897 3300048929 Ga0496126_0323013 Ga0496126_0323013_432_551 39
898 3300048929 Ga0496126_0369555 Ga0496126_0369555_276_398 39
899 3300048929 Ga0496126_0922879 Ga0496126_0922879_278_400 39
900 3300049459 Ga0495678_088041 Ga0495678_088041_126_245 39
901 3300049459 Ga0495678_260731 Ga0495678_260731_343_462 39
902 3300049460 Ga0495682_0007934 Ga0495682_0007934_2875_2994 39
903 3300049460 Ga0495682_0249196 Ga0495682_0249196_232_351 39
904 3300050489 nmdc:mga03683_118160_c1 nmdc:mga03683_118160_c1_112_231 39
905 3300050490 nmdc:mga03n38_6762_c1 nmdc:mga03n38_6762_c1_1410_1529 39
906 3300050491 nmdc:mga00v17_252367_c1 nmdc:mga00v17_252367_c1_954_1073 39
907 3300050492 nmdc:mga0yw44_128887_c1 nmdc:mga0yw44_128887_c1_1270_1389 39
908 3300050492 nmdc:mga0yw44_219174_c1 nmdc:mga0yw44_219174_c1_239_358 39
909 3300050492 nmdc:mga0yw44_617646_c1 nmdc:mga0yw44_617646_c1_550_672 39
910 3300050492 nmdc:mga0yw44_909917_c1 nmdc:mga0yw44_909917_c1_159_278 39
911 3300050493 nmdc:mga0k408_32765_c1 nmdc:mga0k408_32765_c1_1501_1620 39
912 3300050495 nmdc:mga04h51_146790_c1 nmdc:mga04h51_146790_c1_624_743 39
913 3300050496 nmdc:mga07m45_96163_c1 nmdc:mga07m45_96163_c1_964_1083 39
914 3300050516 nmdc:mga0sz30_124101_c1 nmdc:mga0sz30_124101_c1_245_364 39
915 3300050516 nmdc:mga0sz30_496514_c1 nmdc:mga0sz30_496514_c1_371_490 39
916 3300053077 Ga0495601_0561952 Ga0495601_0561952_305_424 39
917 3300053077 Ga0495601_0899737 Ga0495601_0899737_71_190 39
918 3300053078 Ga0495612_0524226 Ga0495612_0524226_310_429 39
919 3300053079 Ga0500610_0149310 Ga0500610_0149310_489_608 39
920 3300053080 Ga0500635_0003732 Ga0500635_0003732_653_775 39
921 3300053080 Ga0500635_0050047 Ga0500635_0050047_351_470 39
922 3300053083 Ga0495655_0065267 Ga0495655_0065267_261_380 39
923 3300053083 Ga0495655_0181349 Ga0495655_0181349_536_655 39
924 3300053084 Ga0495595_0529977 Ga0495595_0529977_308_427 39
925 3300053085 Ga0495619_0060436 Ga0495619_0060436_449_568 39
926 3300053085 Ga0495619_0192716 Ga0495619_0192716_720_839 39
927 3300053086 Ga0500578_0094297 Ga0500578_0094297_1290_1409 39
928 3300053086 Ga0500578_0185475 Ga0500578_0185475_1113_1232 39
929 3300053086 Ga0500578_0465282 Ga0500578_0465282_569_688 39
930 3300053087 Ga0500643_000032 Ga0500643_000032_120575_120694 39
931 3300053088 Ga0500644_0214858 Ga0500644_0214858_433_552 39
932 3300053090 Ga0500646_0111410 Ga0500646_0111410_668_787 39
933 3300053091 Ga0500647_0123909 Ga0500647_0123909_577_696 39
934 3300053092 Ga0500583_0409819 Ga0500583_0409819_268_387 39
935 3300053092 Ga0500583_0533224 Ga0500583_0533224_165_284 39
936 3300053093 Ga0500651_0014192 Ga0500651_0014192_3177_3296 39
937 3300053093 Ga0500651_0623455 Ga0500651_0623455_17_136 39
938 3300053093 Ga0500651_0645500 Ga0500651_0645500_167_286 39
939 3300053094 Ga0500566_0028245 Ga0500566_0028245_1591_1713 39
940 3300053094 Ga0500566_0156925 Ga0500566_0156925_183_302 39
941 3300053094 Ga0500566_0241002 Ga0500566_0241002_73_195 39
942 3300053097 Ga0500648_071429 Ga0500648_071429_215_334 39
943 3300053098 Ga0500650_0019754 Ga0500650_0019754_2532_2651 39
944 3300053098 Ga0500650_0182741 Ga0500650_0182741_138_257 39
945 3300053098 Ga0500650_0225366 Ga0500650_0225366_296_415 39
946 3300053102 Ga0500554_003147 Ga0500554_003147_689_811 39
947 3300053102 Ga0500554_026215 Ga0500554_026215_1309_1431 39
948 3300053102 Ga0500554_112937 Ga0500554_112937_661_780 39
949 3300053103 Ga0500555_000661 Ga0500555_000661_2500_2619 39
950 3300053104 Ga0500556_0076663 Ga0500556_0076663_866_985 39
951 3300053105 Ga0500557_000087 Ga0500557_000087_19191_19310 39
952 3300053108 Ga0500562_006763 Ga0500562_006763_174_293 39
953 3300053109 Ga0500569_000787 Ga0500569_000787_2693_2812 39
954 3300053109 Ga0500569_101281 Ga0500569_101281_17_136 39
955 3300053109 Ga0500569_314882 Ga0500569_314882_273_392 39
956 3300053116 Ga0500592_006606 Ga0500592_006606_401_520 39
957 3300053118 Ga0500594_0040806 Ga0500594_0040806_641_760 39
958 3300053119 Ga0500595_000688 Ga0500595_000688_2934_3056 39
959 3300053119 Ga0500595_011655 Ga0500595_011655_1426_1545 39
960 3300053119 Ga0500595_030545 Ga0500595_030545_1414_1533 39
961 3300053119 Ga0500595_146646 Ga0500595_146646_22_141 39
962 3300053120 Ga0500597_359795 Ga0500597_359795_50_169 39
963 3300053121 Ga0500607_068945 Ga0500607_068945_1077_1196 39
964 3300053122 Ga0500608_077913 Ga0500608_077913_366_485 39
965 3300053122 Ga0500608_367401 Ga0500608_367401_298_417 39
966 3300053126 Ga0500621_076881 Ga0500621_076881_875_994 39
967 3300053126 Ga0500621_138711 Ga0500621_138711_616_735 39
968 3300053128 Ga0500626_320344 Ga0500626_320344_382_501 39
969 3300053130 Ga0500642_0199517 Ga0500642_0199517_112_231 39
970 3300053134 Ga0500658_0057910 Ga0500658_0057910_402_521 39
971 3300053134 Ga0500658_0246862 Ga0500658_0246862_206_325 39
972 3300053136 Ga0500559_0049609 Ga0500559_0049609_684_803 39
973 3300053136 Ga0500559_0184703 Ga0500559_0184703_466_585 39
974 3300053138 Ga0500564_357201 Ga0500564_357201_81_200 39
975 3300053139 Ga0500568_0027539 Ga0500568_0027539_785_904 39
976 3300053139 Ga0500568_0385734 Ga0500568_0385734_250_369 39
977 3300053142 Ga0500577_0009040 Ga0500577_0009040_848_967 39
978 3300053142 Ga0500577_0337467 Ga0500577_0337467_523_642 39
979 3300053142 Ga0500577_0354504 Ga0500577_0354504_226_345 39
980 3300053146 Ga0500588_0009892 Ga0500588_0009892_2075_2194 39
981 3300053146 Ga0500588_0055914 Ga0500588_0055914_1031_1150 39
982 3300053147 Ga0500589_063122 Ga0500589_063122_263_382 39
983 3300053148 Ga0500590_152566 Ga0500590_152566_252_371 39
984 3300053150 Ga0500603_000982 Ga0500603_000982_5179_5301 39
985 3300053150 Ga0500603_115678 Ga0500603_115678_400_522 39
986 3300053151 Ga0500604_0094810 Ga0500604_0094810_52_171 39
987 3300053153 Ga0500616_0032567 Ga0500616_0032567_1636_1755 39
988 3300053153 Ga0500616_0103580 Ga0500616_0103580_17_136 39
989 3300053154 Ga0500619_157079 Ga0500619_157079_355_477 39
990 3300053154 Ga0500619_269965 Ga0500619_269965_82_201 39
991 3300053155 Ga0500620_001157 Ga0500620_001157_249_368 39
992 3300053156 Ga0500622_0020075 Ga0500622_0020075_1004_1123 39
993 3300053160 Ga0500633_0133713 Ga0500633_0133713_728_847 39
994 3300053162 Ga0500638_000085 Ga0500638_000085_4924_5046 39
995 3300053162 Ga0500638_086230 Ga0500638_086230_139_258 39
996 3300053162 Ga0500638_125012 Ga0500638_125012_276_398 39
997 3300053162 Ga0500638_163256 Ga0500638_163256_462_581 39
998 3300053177 Ga0500636_0000276 Ga0500636_0000276_17263_17382 39
999 3300053177 Ga0500636_0117824 Ga0500636_0117824_443_565 39
1000 3300053177 Ga0500636_0443820 Ga0500636_0443820_414_536 39
1001 3300053178 Ga0500637_0000450 Ga0500637_0000450_11835_11957 39
1002 3300053178 Ga0500637_0000565 Ga0500637_0000565_9796_9918 39
1003 3300053722 Ga0500649_205343 Ga0500649_205343_469_588 39
1004 3300053725 Ga0500576_264201 Ga0500576_264201_249_368 39
1005 3300053729 Ga0500625_010065 Ga0500625_010065_1665_1784 39
1006 3300053729 Ga0500625_139831 Ga0500625_139831_799_918 39
1007 3300053730 Ga0500645_053522 Ga0500645_053522_698_817 39
1008 3300053730 Ga0500645_065548 Ga0500645_065548_496_615 39
1009 3300053731 Ga0500609_003678 Ga0500609_003678_1177_1296 39
1010 3300053733 Ga0500552_068480 Ga0500552_068480_127_246 39
1011 3300053735 Ga0500596_079240 Ga0500596_079240_86_205 39
1012 3300053736 Ga0500599_000091 Ga0500599_000091_2786_2905 39
1013 3300053737 Ga0500601_000379 Ga0500601_000379_4933_5052 39
1014 3300053737 Ga0500601_011521 Ga0500601_011521_775_894 39
1015 3300055283 Ga0500661_001547 Ga0500661_001547_1042_1164 39
1016 3300055283 Ga0500661_006381 Ga0500661_006381_1746_1865 39
1017 3300055283 Ga0500661_037691 Ga0500661_037691_168_287 39
1018 3300055283 Ga0500661_070437 Ga0500661_070437_328_447 39
1019 3300059493 Ga0587077_054218 Ga0587077_054218_114_233 39
1020 3300059643 Ga0587072_175765 Ga0587072_175765_114_239 39
1021 3300059645 Ga0587076_053387 Ga0587076_053387_56_175 39
1022 3300061719 Ga0466962_0123467 Ga0466962_0123467_76_195 39

Feature Viewer

pLDDT pTM Quality
77.78 0.4 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map