F488307
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1018 | 359 | 1002 | 141 |
Family's Representative Sequence
| Representative Sequence | 3300005467|Ga0070706_100066882|Ga0070706_1000668823 |
| Length | 156 |
| Sequence | MYRVLNAGGAGRRRVSDQVSYDDVEVGTELAAVSYPATRLSLVKYCGASGDFNVIHWNERIAKAVGLPDVIAHGMLTMAQAGRFVTDWAGLKATVVDFGVRFSSPVVVPDDDVGASITVSGQVEEKLDGQRVALALTARSADTKVLTRARAVVRLP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 3 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 4 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 5 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 6 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 7 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 8 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 9 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 10 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 11 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 12 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 13 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 14 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 15 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 16 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 17 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 18 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 19 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 82 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 84 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 89 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 96 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 97 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 112 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 113 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 114 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 131 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 132 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 134 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 135 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 188 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 190 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 191 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 192 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 193 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 194 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 195 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 196 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 197 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 198 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 199 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 200 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 201 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 202 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 203 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 204 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 206 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 207 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 209 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 210 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 211 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 213 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 214 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 215 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 217 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 218 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 219 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 221 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 224 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 225 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 226 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 227 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 228 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 229 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 232 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 233 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 234 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 235 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 236 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 237 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 238 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 239 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 240 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 241 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 242 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 243 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 244 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 245 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 246 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 247 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 248 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 249 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 250 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 251 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 252 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 253 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 254 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 255 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 256 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 257 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 258 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 259 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 260 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 261 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 262 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 315 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 316 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 317 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 318 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 319 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 320 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 323 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 324 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 325 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 326 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 327 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 328 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 329 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 342 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 343 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 357 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 358 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 359 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.64 |
| Metatranscriptomes | 0.79 |
| Isolates | 1.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.29 |
| Nodule | 0 |
| Rhizoplane | 6.48 |
| Rhizosphere | 89.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214554149 | 2209111006 | Bacteria | 530 |
| 2 | JGI24739J22299_10189010 | 3300001989 | Bacteria | 605 |
| 3 | JGI24735J21928_10056808 | 3300002067 | Bacteria | 1127 |
| 4 | JGI24751J29686_10126986 | 3300002459 | Bacteria | 537 |
| 5 | rootL2_10142042 | 3300003322 | Bacteria | 10274 |
| 6 | Ga0070658_10032694 | 3300005327 | Bacteria | 4182 |
| 7 | Ga0070658_10044055 | 3300005327 | Bacteria | 3605 |
| 8 | Ga0070658_10225084 | 3300005327 | Bacteria | 1587 |
| 9 | Ga0070658_10253449 | 3300005327 | Bacteria | 1493 |
| 10 | Ga0070676_10092694 | 3300005328 | Bacteria | 1853 |
| 11 | Ga0070683_101018472 | 3300005329 | Unclassified | 795 |
| 12 | Ga0070690_101490551 | 3300005330 | Bacteria | 546 |
| 13 | Ga0070670_100007475 | 3300005331 | Bacteria | 9280 |
| 14 | Ga0070677_10211359 | 3300005333 | Bacteria | 942 |
| 15 | Ga0068869_100726819 | 3300005334 | Bacteria | 848 |
| 16 | Ga0070680_100004899 | 3300005336 | Bacteria | 10083 |
| 17 | Ga0070682_100009483 | 3300005337 | Bacteria | 5508 |
| 18 | Ga0070682_100150776 | 3300005337 | Bacteria | 1595 |
| 19 | Ga0070682_100493654 | 3300005337 | Bacteria | 947 |
| 20 | Ga0068868_100009185 | 3300005338 | Bacteria | 7101 |
| 21 | Ga0070660_100059595 | 3300005339 | Bacteria | 2960 |
| 22 | Ga0070689_100219489 | 3300005340 | Bacteria | 1559 |
| 23 | Ga0070689_101853195 | 3300005340 | Bacteria | 550 |
| 24 | Ga0070691_10011813 | 3300005341 | Bacteria | 3995 |
| 25 | Ga0070687_100346910 | 3300005343 | Bacteria | 957 |
| 26 | Ga0070661_100212484 | 3300005344 | Bacteria | 1481 |
| 27 | Ga0070692_10034240 | 3300005345 | Bacteria | 2564 |
| 28 | Ga0070692_10701504 | 3300005345 | Bacteria | 681 |
| 29 | Ga0070669_100878517 | 3300005353 | Bacteria | 765 |
| 30 | Ga0070675_100050464 | 3300005354 | Bacteria | 3416 |
| 31 | Ga0070671_100015144 | 3300005355 | Bacteria | 6228 |
| 32 | Ga0070671_100097248 | 3300005355 | Bacteria | 2469 |
| 33 | Ga0070671_100372804 | 3300005355 | Bacteria | 1219 |
| 34 | Ga0070671_101375458 | 3300005355 | Bacteria | 623 |
| 35 | Ga0070674_101378781 | 3300005356 | Bacteria | 631 |
| 36 | Ga0070673_100078474 | 3300005364 | Bacteria | 2671 |
| 37 | Ga0070659_100000294 | 3300005366 | Bacteria | 39077 |
| 38 | Ga0070659_100054304 | 3300005366 | Bacteria | 3155 |
| 39 | Ga0070659_100820742 | 3300005366 | Bacteria | 809 |
| 40 | Ga0070709_10000253 | 3300005434 | Bacteria | 34511 |
| 41 | Ga0070709_10000434 | 3300005434 | Bacteria | 25299 |
| 42 | Ga0070709_10025318 | 3300005434 | Bacteria | 3504 |
| 43 | Ga0070709_10054857 | 3300005434 | Bacteria | 2514 |
| 44 | Ga0070709_10079002 | 3300005434 | Bacteria | 2142 |
| 45 | Ga0070709_10116365 | 3300005434 | Bacteria | 1805 |
| 46 | Ga0070714_100000011 | 3300005435 | Bacteria | 231268 |
| 47 | Ga0070714_100000182 | 3300005435 | Bacteria | 50060 |
| 48 | Ga0070714_100004885 | 3300005435 | Bacteria | 10180 |
| 49 | Ga0070714_100008057 | 3300005435 | Bacteria | 8212 |
| 50 | Ga0070714_100242249 | 3300005435 | Bacteria | 1665 |
| 51 | Ga0070714_100251763 | 3300005435 | Bacteria | 1633 |
| 52 | Ga0070714_100262839 | 3300005435 | Bacteria | 1598 |
| 53 | Ga0070714_100343593 | 3300005435 | Bacteria | 1400 |
| 54 | Ga0070714_100407355 | 3300005435 | Bacteria | 1286 |
| 55 | Ga0070714_100483828 | 3300005435 | Bacteria | 1179 |
| 56 | Ga0070714_100513028 | 3300005435 | Bacteria | 1144 |
| 57 | Ga0070714_100598772 | 3300005435 | Bacteria | 1058 |
| 58 | Ga0070714_100685190 | 3300005435 | Bacteria | 988 |
| 59 | Ga0070714_101489855 | 3300005435 | Bacteria | 661 |
| 60 | Ga0070713_100018743 | 3300005436 | Bacteria | 5265 |
| 61 | Ga0070713_100020537 | 3300005436 | Bacteria | 5066 |
| 62 | Ga0070713_100058657 | 3300005436 | Bacteria | 3211 |
| 63 | Ga0070713_100064993 | 3300005436 | Bacteria | 3063 |
| 64 | Ga0070713_100096149 | 3300005436 | Bacteria | 2556 |
| 65 | Ga0070713_100105557 | 3300005436 | Bacteria | 2447 |
| 66 | Ga0070713_100117350 | 3300005436 | Bacteria | 2329 |
| 67 | Ga0070713_100149306 | 3300005436 | Bacteria | 2077 |
| 68 | Ga0070713_100187917 | 3300005436 | Bacteria | 1860 |
| 69 | Ga0070713_100253054 | 3300005436 | Bacteria | 1607 |
| 70 | Ga0070713_100354450 | 3300005436 | Bacteria | 1362 |
| 71 | Ga0070713_100401363 | 3300005436 | Bacteria | 1280 |
| 72 | Ga0070713_100414938 | 3300005436 | Bacteria | 1259 |
| 73 | Ga0070713_100585911 | 3300005436 | Bacteria | 1058 |
| 74 | Ga0070713_100783133 | 3300005436 | Bacteria | 914 |
| 75 | Ga0070713_102043879 | 3300005436 | Bacteria | 556 |
| 76 | Ga0070710_10000086 | 3300005437 | Bacteria | 41898 |
| 77 | Ga0070710_10004266 | 3300005437 | Bacteria | 6777 |
| 78 | Ga0070710_10010762 | 3300005437 | Bacteria | 4499 |
| 79 | Ga0070710_10027908 | 3300005437 | Bacteria | 3015 |
| 80 | Ga0070710_10060201 | 3300005437 | Bacteria | 2159 |
| 81 | Ga0070701_10107135 | 3300005438 | Bacteria | 1556 |
| 82 | Ga0070711_100004357 | 3300005439 | Bacteria | 8338 |
| 83 | Ga0070711_100020955 | 3300005439 | Bacteria | 4221 |
| 84 | Ga0070711_100094409 | 3300005439 | Bacteria | 2162 |
| 85 | Ga0070711_100122193 | 3300005439 | Bacteria | 1928 |
| 86 | Ga0070711_100402771 | 3300005439 | Bacteria | 1111 |
| 87 | Ga0070700_100030557 | 3300005441 | Bacteria | 3221 |
| 88 | Ga0070708_100006459 | 3300005445 | Bacteria | 9333 |
| 89 | Ga0070708_100007516 | 3300005445 | Bacteria | 8725 |
| 90 | Ga0070708_100026768 | 3300005445 | Bacteria | 4940 |
| 91 | Ga0070708_100274818 | 3300005445 | Bacteria | 1585 |
| 92 | Ga0070708_100290409 | 3300005445 | Bacteria | 1539 |
| 93 | Ga0070708_100407327 | 3300005445 | Bacteria | 1282 |
| 94 | Ga0070678_100013171 | 3300005456 | Bacteria | 5174 |
| 95 | Ga0070662_101084040 | 3300005457 | Bacteria | 687 |
| 96 | Ga0070681_10025428 | 3300005458 | Bacteria | 5955 |
| 97 | Ga0070681_10091686 | 3300005458 | Bacteria | 2989 |
| 98 | Ga0070681_10276603 | 3300005458 | Bacteria | 1590 |
| 99 | Ga0070681_11031941 | 3300005458 | Bacteria | 742 |
| 100 | Ga0068867_101061770 | 3300005459 | Bacteria | 737 |
| 101 | Ga0070685_10241303 | 3300005466 | Bacteria | 1193 |
| 102 | Ga0070685_10677311 | 3300005466 | Bacteria | 750 |
| 103 | Ga0070706_100007714 | 3300005467 | Bacteria | 10063 |
| 104 | Ga0070706_100020152 | 3300005467 | Bacteria | 6145 |
| 105 | Ga0070706_100032034 | 3300005467 | Bacteria | 4848 |
| 106 | Ga0070706_100048682 | 3300005467 | Bacteria | 3911 |
| 107 | Ga0070706_100066882 | 3300005467 | Bacteria | 3324 |
| 108 | Ga0070706_100067898 | 3300005467 | Bacteria | 3297 |
| 109 | Ga0070706_100111055 | 3300005467 | Bacteria | 2551 |
| 110 | Ga0070706_100142874 | 3300005467 | Bacteria | 2234 |
| 111 | Ga0070706_100269595 | 3300005467 | Bacteria | 1589 |
| 112 | Ga0070706_100270657 | 3300005467 | Bacteria | 1585 |
| 113 | Ga0070706_100287155 | 3300005467 | Bacteria | 1535 |
| 114 | Ga0070706_100428562 | 3300005467 | Bacteria | 1231 |
| 115 | Ga0070707_100001773 | 3300005468 | Bacteria | 20734 |
| 116 | Ga0070707_100006610 | 3300005468 | Bacteria | 10757 |
| 117 | Ga0070707_100014179 | 3300005468 | Bacteria | 7468 |
| 118 | Ga0070707_100031061 | 3300005468 | Bacteria | 5086 |
| 119 | Ga0070707_100050076 | 3300005468 | Bacteria | 4004 |
| 120 | Ga0070707_100227922 | 3300005468 | Bacteria | 1814 |
| 121 | Ga0070707_100300648 | 3300005468 | Bacteria | 1559 |
| 122 | Ga0070707_100392109 | 3300005468 | Bacteria | 1348 |
| 123 | Ga0070707_101383604 | 3300005468 | Bacteria | 670 |
| 124 | Ga0070707_101617993 | 3300005468 | Bacteria | 615 |
| 125 | Ga0070698_100000667 | 3300005471 | Bacteria | 36601 |
| 126 | Ga0070698_100001429 | 3300005471 | Bacteria | 26454 |
| 127 | Ga0070698_100002054 | 3300005471 | Bacteria | 22371 |
| 128 | Ga0070698_100002497 | 3300005471 | Bacteria | 20270 |
| 129 | Ga0070698_100035947 | 3300005471 | Bacteria | 5120 |
| 130 | Ga0070698_100140483 | 3300005471 | Bacteria | 2366 |
| 131 | Ga0070698_100227011 | 3300005471 | Bacteria | 1801 |
| 132 | Ga0070698_100248998 | 3300005471 | Bacteria | 1710 |
| 133 | Ga0070698_101202636 | 3300005471 | Bacteria | 707 |
| 134 | Ga0070699_100274833 | 3300005518 | Bacteria | 1508 |
| 135 | Ga0070699_100535832 | 3300005518 | Bacteria | 1065 |
| 136 | Ga0070679_100014886 | 3300005530 | Bacteria | 7474 |
| 137 | Ga0070679_101016526 | 3300005530 | Bacteria | 773 |
| 138 | Ga0070684_100260300 | 3300005535 | Bacteria | 1587 |
| 139 | Ga0070697_100083774 | 3300005536 | Bacteria | 2630 |
| 140 | Ga0070697_100278305 | 3300005536 | Bacteria | 1435 |
| 141 | Ga0070686_100215457 | 3300005544 | Bacteria | 1385 |
| 142 | Ga0070686_100278301 | 3300005544 | Bacteria | 1233 |
| 143 | Ga0070695_100073990 | 3300005545 | Bacteria | 2238 |
| 144 | Ga0070696_100852164 | 3300005546 | Bacteria | 753 |
| 145 | Ga0070696_101556981 | 3300005546 | Bacteria | 567 |
| 146 | Ga0070693_100003391 | 3300005547 | Bacteria | 7415 |
| 147 | Ga0070693_100180665 | 3300005547 | Bacteria | 1358 |
| 148 | Ga0070665_100225339 | 3300005548 | Bacteria | 1875 |
| 149 | Ga0070665_100403097 | 3300005548 | Bacteria | 1376 |
| 150 | Ga0070665_100410976 | 3300005548 | Bacteria | 1362 |
| 151 | Ga0070665_100416654 | 3300005548 | Bacteria | 1352 |
| 152 | Ga0070665_100785593 | 3300005548 | Bacteria | 965 |
| 153 | Ga0068854_100104028 | 3300005578 | Bacteria | 2132 |
| 154 | Ga0068856_100008148 | 3300005614 | Bacteria | 10222 |
| 155 | Ga0068856_100049636 | 3300005614 | Bacteria | 4136 |
| 156 | Ga0068856_100186630 | 3300005614 | Bacteria | 2087 |
| 157 | Ga0068856_100408967 | 3300005614 | Bacteria | 1376 |
| 158 | Ga0068856_101064683 | 3300005614 | Bacteria | 826 |
| 159 | Ga0068856_101425191 | 3300005614 | Bacteria | 707 |
| 160 | Ga0070702_100032698 | 3300005615 | Bacteria | 2856 |
| 161 | Ga0068852_100010858 | 3300005616 | Bacteria | 6825 |
| 162 | Ga0068852_102027209 | 3300005616 | Bacteria | 597 |
| 163 | Ga0068859_100183303 | 3300005617 | Bacteria | 2177 |
| 164 | Ga0068864_100036758 | 3300005618 | Bacteria | 4176 |
| 165 | Ga0068864_100434046 | 3300005618 | Bacteria | 1254 |
| 166 | Ga0068864_100743937 | 3300005618 | Bacteria | 960 |
| 167 | Ga0068866_10371841 | 3300005718 | Bacteria | 914 |
| 168 | Ga0068866_10655703 | 3300005718 | Bacteria | 715 |
| 169 | Ga0068861_101612378 | 3300005719 | Bacteria | 640 |
| 170 | Ga0068851_10038963 | 3300005834 | Bacteria | 2386 |
| 171 | Ga0068870_10000616 | 3300005840 | Bacteria | 13532 |
| 172 | Ga0068863_100005041 | 3300005841 | Bacteria | 13018 |
| 173 | Ga0068863_100022217 | 3300005841 | Bacteria | 6058 |
| 174 | Ga0068858_100042199 | 3300005842 | Bacteria | 4230 |
| 175 | Ga0068858_100656683 | 3300005842 | Bacteria | 1019 |
| 176 | Ga0068862_102116551 | 3300005844 | Bacteria | 574 |
| 177 | Ga0081455_10000126 | 3300005937 | Bacteria | 88702 |
| 178 | Ga0081455_10000262 | 3300005937 | Bacteria | 69313 |
| 179 | Ga0081455_10002734 | 3300005937 | Bacteria | 20806 |
| 180 | Ga0081455_10041473 | 3300005937 | Bacteria | 4047 |
| 181 | Ga0081455_10078282 | 3300005937 | Bacteria | 2717 |
| 182 | Ga0081455_10688392 | 3300005937 | Bacteria | 653 |
| 183 | Ga0081540_1000101 | 3300005983 | Bacteria | 91600 |
| 184 | Ga0081540_1000843 | 3300005983 | Bacteria | 27907 |
| 185 | Ga0081540_1020980 | 3300005983 | Bacteria | 3909 |
| 186 | Ga0070717_10006245 | 3300006028 | Bacteria | 8751 |
| 187 | Ga0070717_10022373 | 3300006028 | Bacteria | 4995 |
| 188 | Ga0070717_10031631 | 3300006028 | Bacteria | 4259 |
| 189 | Ga0070717_10073876 | 3300006028 | Bacteria | 2850 |
| 190 | Ga0070717_10175280 | 3300006028 | Bacteria | 1867 |
| 191 | Ga0070717_10202456 | 3300006028 | Bacteria | 1739 |
| 192 | Ga0070717_10367575 | 3300006028 | Bacteria | 1288 |
| 193 | Ga0070717_10436855 | 3300006028 | Bacteria | 1178 |
| 194 | Ga0070717_10609427 | 3300006028 | Bacteria | 990 |
| 195 | Ga0070717_10613218 | 3300006028 | Bacteria | 987 |
| 196 | Ga0070717_10843042 | 3300006028 | Bacteria | 834 |
| 197 | Ga0070717_10845137 | 3300006028 | Bacteria | 833 |
| 198 | Ga0070717_10957675 | 3300006028 | Bacteria | 779 |
| 199 | Ga0070717_11031608 | 3300006028 | Bacteria | 749 |
| 200 | Ga0070717_11522283 | 3300006028 | Bacteria | 607 |
| 201 | Ga0075363_100780997 | 3300006048 | Bacteria | 580 |
| 202 | Ga0070716_100000949 | 3300006173 | Bacteria | 12560 |
| 203 | Ga0070716_100010154 | 3300006173 | Bacteria | 4714 |
| 204 | Ga0070716_100028930 | 3300006173 | Bacteria | 2990 |
| 205 | Ga0070716_100340965 | 3300006173 | Bacteria | 1057 |
| 206 | Ga0070712_100000932 | 3300006175 | Bacteria | 17601 |
| 207 | Ga0070712_100001419 | 3300006175 | Bacteria | 14579 |
| 208 | Ga0070712_100029137 | 3300006175 | Bacteria | 3699 |
| 209 | Ga0070712_100057082 | 3300006175 | Bacteria | 2741 |
| 210 | Ga0070712_100108911 | 3300006175 | Bacteria | 2063 |
| 211 | Ga0070712_100170392 | 3300006175 | Bacteria | 1689 |
| 212 | Ga0070712_100288843 | 3300006175 | Bacteria | 1323 |
| 213 | Ga0070712_100391069 | 3300006175 | Bacteria | 1146 |
| 214 | Ga0097621_100006861 | 3300006237 | Bacteria | 8099 |
| 215 | Ga0097621_100106893 | 3300006237 | Bacteria | 2361 |
| 216 | Ga0068871_100822981 | 3300006358 | Bacteria | 857 |
| 217 | Ga0075431_100317545 | 3300006847 | Bacteria | 1571 |
| 218 | Ga0075433_10005917 | 3300006852 | Bacteria | 9635 |
| 219 | Ga0075433_10144476 | 3300006852 | Bacteria | 2115 |
| 220 | Ga0075433_10207675 | 3300006852 | Bacteria | 1741 |
| 221 | Ga0075434_100017763 | 3300006871 | Bacteria | 6859 |
| 222 | Ga0075434_100029062 | 3300006871 | Bacteria | 5436 |
| 223 | Ga0075434_100032095 | 3300006871 | Bacteria | 5178 |
| 224 | Ga0075434_100190107 | 3300006871 | Bacteria | 2073 |
| 225 | Ga0075434_100504867 | 3300006871 | Bacteria | 1230 |
| 226 | Ga0075429_100031894 | 3300006880 | Bacteria | 4581 |
| 227 | Ga0068865_100123585 | 3300006881 | Bacteria | 1928 |
| 228 | Ga0075436_100007917 | 3300006914 | Bacteria | 7274 |
| 229 | Ga0075436_100047869 | 3300006914 | Bacteria | 2950 |
| 230 | Ga0075436_100051647 | 3300006914 | Bacteria | 2837 |
| 231 | Ga0075436_100085466 | 3300006914 | Bacteria | 2190 |
| 232 | Ga0075436_100086513 | 3300006914 | Bacteria | 2177 |
| 233 | Ga0075436_100868649 | 3300006914 | Bacteria | 674 |
| 234 | Ga0097620_100183303 | 3300006931 | Bacteria | 2177 |
| 235 | Ga0075435_100020308 | 3300007076 | Bacteria | 5087 |
| 236 | Ga0075435_100095370 | 3300007076 | Bacteria | 2460 |
| 237 | Ga0075435_100098424 | 3300007076 | Bacteria | 2421 |
| 238 | Ga0075435_101505836 | 3300007076 | Bacteria | 590 |
| 239 | Ga0075435_101947684 | 3300007076 | Bacteria | 516 |
| 240 | Ga0099794_10049578 | 3300007265 | Bacteria | 2018 |
| 241 | Ga0099794_10338708 | 3300007265 | Bacteria | 781 |
| 242 | Ga0105244_10384026 | 3300009036 | Bacteria | 646 |
| 243 | Ga0105240_10176563 | 3300009093 | Bacteria | 2525 |
| 244 | Ga0111539_10251029 | 3300009094 | Bacteria | 2060 |
| 245 | Ga0111539_10653180 | 3300009094 | Bacteria | 1225 |
| 246 | Ga0111539_12470007 | 3300009094 | Bacteria | 603 |
| 247 | Ga0105245_10021492 | 3300009098 | Bacteria | 5661 |
| 248 | Ga0105245_10097796 | 3300009098 | Bacteria | 2711 |
| 249 | Ga0105245_10115944 | 3300009098 | Bacteria | 2497 |
| 250 | Ga0105247_10011206 | 3300009101 | Bacteria | 5407 |
| 251 | Ga0114129_10030888 | 3300009147 | Bacteria | 7576 |
| 252 | Ga0114129_10066059 | 3300009147 | Bacteria | 5045 |
| 253 | Ga0105243_12639048 | 3300009148 | Bacteria | 542 |
| 254 | Ga0105241_10030008 | 3300009174 | Bacteria | 4061 |
| 255 | Ga0105241_11417065 | 3300009174 | Bacteria | 666 |
| 256 | Ga0105248_10084729 | 3300009177 | Bacteria | 3566 |
| 257 | Ga0105248_10167208 | 3300009177 | Bacteria | 2478 |
| 258 | Ga0105248_11820443 | 3300009177 | Bacteria | 691 |
| 259 | Ga0105237_10581341 | 3300009545 | Bacteria | 1127 |
| 260 | Ga0105237_10895643 | 3300009545 | Bacteria | 894 |
| 261 | Ga0105237_11078751 | 3300009545 | Bacteria | 810 |
| 262 | Ga0105237_11286717 | 3300009545 | Bacteria | 738 |
| 263 | Ga0105238_10969213 | 3300009551 | Bacteria | 871 |
| 264 | Ga0105249_10202647 | 3300009553 | Bacteria | 1942 |
| 265 | Ga0105249_10642107 | 3300009553 | Bacteria | 1119 |
| 266 | Ga0105249_11515264 | 3300009553 | Bacteria | 743 |
| 267 | Ga0105239_10794532 | 3300010375 | Bacteria | 1084 |
| 268 | Ga0105239_11213939 | 3300010375 | Bacteria | 869 |
| 269 | Ga0105246_10008603 | 3300011119 | Bacteria | 6276 |
| 270 | Ga0157317_1033960 | 3300012475 | Bacteria | 508 |
| 271 | Ga0157313_1000372 | 3300012503 | Bacteria | 2035 |
| 272 | Ga0157326_1037816 | 3300012513 | Bacteria | 666 |
| 273 | Ga0157371_10019524 | 3300013102 | Bacteria | 4996 |
| 274 | Ga0157370_10264165 | 3300013104 | Bacteria | 1590 |
| 275 | Ga0157370_11292721 | 3300013104 | Bacteria | 657 |
| 276 | Ga0157369_10001599 | 3300013105 | Bacteria | 27722 |
| 277 | Ga0157369_10014305 | 3300013105 | Bacteria | 8963 |
| 278 | Ga0157369_10042657 | 3300013105 | Bacteria | 4949 |
| 279 | Ga0157369_12577353 | 3300013105 | Bacteria | 514 |
| 280 | Ga0157374_10071283 | 3300013296 | Bacteria | 3276 |
| 281 | Ga0157374_10698261 | 3300013296 | Bacteria | 1027 |
| 282 | Ga0157374_11142788 | 3300013296 | Bacteria | 800 |
| 283 | Ga0157374_12757314 | 3300013296 | Bacteria | 519 |
| 284 | Ga0157378_10053740 | 3300013297 | Bacteria | 3586 |
| 285 | Ga0157372_10040844 | 3300013307 | Bacteria | 5127 |
| 286 | Ga0157375_10042216 | 3300013308 | Bacteria | 4413 |
| 287 | Ga0157375_10126714 | 3300013308 | Bacteria | 2669 |
| 288 | Ga0157375_10986929 | 3300013308 | Bacteria | 982 |
| 289 | Ga0157375_11485342 | 3300013308 | Bacteria | 800 |
| 290 | Ga0163163_10024628 | 3300014325 | Bacteria | 5729 |
| 291 | Ga0163163_10126280 | 3300014325 | Bacteria | 2596 |
| 292 | Ga0163163_10657420 | 3300014325 | Bacteria | 1111 |
| 293 | Ga0163163_10774635 | 3300014325 | Bacteria | 1023 |
| 294 | Ga0163163_11484300 | 3300014325 | Bacteria | 739 |
| 295 | Ga0163163_11715215 | 3300014325 | Bacteria | 689 |
| 296 | Ga0182008_10214915 | 3300014497 | Bacteria | 982 |
| 297 | Ga0157377_10014244 | 3300014745 | Bacteria | 4042 |
| 298 | Ga0157377_11146061 | 3300014745 | Bacteria | 598 |
| 299 | Ga0157379_10060646 | 3300014968 | Bacteria | 3382 |
| 300 | Ga0157376_10235371 | 3300014969 | Bacteria | 1703 |
| 301 | Ga0157376_10338798 | 3300014969 | Bacteria | 1436 |
| 302 | Ga0157376_11044398 | 3300014969 | Bacteria | 841 |
| 303 | Ga0197907_10920250 | 3300020069 | Bacteria | 3755 |
| 304 | Ga0197907_11222404 | 3300020069 | Bacteria | 954 |
| 305 | Ga0206356_11243439 | 3300020070 | Bacteria | 2032 |
| 306 | Ga0206354_11131740 | 3300020081 | Bacteria | 1131 |
| 307 | Ga0206353_11710499 | 3300020082 | Bacteria | 805 |
| 308 | Ga0213874_10055042 | 3300021377 | Bacteria | 1231 |
| 309 | Ga0213875_10000362 | 3300021388 | Bacteria | 42266 |
| 310 | Ga0213875_10052768 | 3300021388 | Bacteria | 1904 |
| 311 | Ga0213875_10128443 | 3300021388 | Bacteria | 1185 |
| 312 | Ga0224712_10070335 | 3300022467 | Bacteria | 1419 |
| 313 | Ga0224712_10155038 | 3300022467 | Bacteria | 1018 |
| 314 | Ga0224569_112527 | 3300022732 | Bacteria | 594 |
| 315 | Ga0224572_1000726 | 3300024225 | Bacteria | 4266 |
| 316 | Ga0207656_10053913 | 3300025321 | Bacteria | 1746 |
| 317 | Ga0207656_10215984 | 3300025321 | Bacteria | 931 |
| 318 | Ga0207692_10000423 | 3300025898 | Bacteria | 14836 |
| 319 | Ga0207692_10007321 | 3300025898 | Bacteria | 4519 |
| 320 | Ga0207692_10010821 | 3300025898 | Bacteria | 3859 |
| 321 | Ga0207692_10061574 | 3300025898 | Bacteria | 1945 |
| 322 | Ga0207688_10003789 | 3300025901 | Bacteria | 8246 |
| 323 | Ga0207688_10463221 | 3300025901 | Bacteria | 791 |
| 324 | Ga0207680_10217205 | 3300025903 | Bacteria | 1309 |
| 325 | Ga0207685_10003834 | 3300025905 | Bacteria | 3721 |
| 326 | Ga0207685_10016177 | 3300025905 | Bacteria | 2382 |
| 327 | Ga0207685_10087272 | 3300025905 | Bacteria | 1305 |
| 328 | Ga0207685_10104796 | 3300025905 | Bacteria | 1216 |
| 329 | Ga0207699_10023198 | 3300025906 | Bacteria | 3374 |
| 330 | Ga0207699_10024559 | 3300025906 | Bacteria | 3297 |
| 331 | Ga0207699_10078888 | 3300025906 | Bacteria | 2035 |
| 332 | Ga0207699_10268236 | 3300025906 | Bacteria | 1182 |
| 333 | Ga0207699_10581790 | 3300025906 | Bacteria | 814 |
| 334 | Ga0207699_10636547 | 3300025906 | Bacteria | 778 |
| 335 | Ga0207699_11170277 | 3300025906 | Bacteria | 569 |
| 336 | Ga0207699_11221291 | 3300025906 | Bacteria | 557 |
| 337 | Ga0207645_10075722 | 3300025907 | Bacteria | 2154 |
| 338 | Ga0207643_10000633 | 3300025908 | Bacteria | 22093 |
| 339 | Ga0207705_10010346 | 3300025909 | Bacteria | 6785 |
| 340 | Ga0207705_10014692 | 3300025909 | Bacteria | 5631 |
| 341 | Ga0207684_10001554 | 3300025910 | Bacteria | 24539 |
| 342 | Ga0207684_10003021 | 3300025910 | Bacteria | 16674 |
| 343 | Ga0207684_10013354 | 3300025910 | Bacteria | 7105 |
| 344 | Ga0207684_10016493 | 3300025910 | Bacteria | 6343 |
| 345 | Ga0207684_10017733 | 3300025910 | Bacteria | 6107 |
| 346 | Ga0207684_10019368 | 3300025910 | Bacteria | 5823 |
| 347 | Ga0207684_10036944 | 3300025910 | Bacteria | 4146 |
| 348 | Ga0207684_10076912 | 3300025910 | Bacteria | 2837 |
| 349 | Ga0207684_10077117 | 3300025910 | Bacteria | 2833 |
| 350 | Ga0207684_10166293 | 3300025910 | Bacteria | 1901 |
| 351 | Ga0207684_10338591 | 3300025910 | Bacteria | 1296 |
| 352 | Ga0207684_10354702 | 3300025910 | Bacteria | 1262 |
| 353 | Ga0207684_10467051 | 3300025910 | Bacteria | 1083 |
| 354 | Ga0207684_10478642 | 3300025910 | Bacteria | 1068 |
| 355 | Ga0207684_10885942 | 3300025910 | Bacteria | 751 |
| 356 | Ga0207654_10002204 | 3300025911 | Bacteria | 9984 |
| 357 | Ga0207707_10019993 | 3300025912 | Bacteria | 5843 |
| 358 | Ga0207695_10292433 | 3300025913 | Bacteria | 1521 |
| 359 | Ga0207695_10362363 | 3300025913 | Bacteria | 1336 |
| 360 | Ga0207671_10901874 | 3300025914 | Bacteria | 699 |
| 361 | Ga0207693_10001190 | 3300025915 | Bacteria | 23252 |
| 362 | Ga0207693_10050846 | 3300025915 | Bacteria | 3254 |
| 363 | Ga0207693_10082948 | 3300025915 | Bacteria | 2510 |
| 364 | Ga0207693_10325052 | 3300025915 | Bacteria | 1204 |
| 365 | Ga0207693_10997688 | 3300025915 | Bacteria | 639 |
| 366 | Ga0207663_10007512 | 3300025916 | Bacteria | 5656 |
| 367 | Ga0207663_10012646 | 3300025916 | Bacteria | 4569 |
| 368 | Ga0207663_10017302 | 3300025916 | Bacteria | 4013 |
| 369 | Ga0207663_10036765 | 3300025916 | Bacteria | 2947 |
| 370 | Ga0207663_10229549 | 3300025916 | Bacteria | 1355 |
| 371 | Ga0207663_10251938 | 3300025916 | Bacteria | 1300 |
| 372 | Ga0207663_10279435 | 3300025916 | Bacteria | 1240 |
| 373 | Ga0207660_10033257 | 3300025917 | Bacteria | 3565 |
| 374 | Ga0207662_10244160 | 3300025918 | Bacteria | 1176 |
| 375 | Ga0207657_10024422 | 3300025919 | Bacteria | 5595 |
| 376 | Ga0207657_10245597 | 3300025919 | Bacteria | 1428 |
| 377 | Ga0207649_10001763 | 3300025920 | Bacteria | 12405 |
| 378 | Ga0207652_10009911 | 3300025921 | Bacteria | 7667 |
| 379 | Ga0207646_10000416 | 3300025922 | Bacteria | 56976 |
| 380 | Ga0207646_10005930 | 3300025922 | Bacteria | 12744 |
| 381 | Ga0207646_10014174 | 3300025922 | Bacteria | 7579 |
| 382 | Ga0207646_10058150 | 3300025922 | Bacteria | 3454 |
| 383 | Ga0207646_10118832 | 3300025922 | Bacteria | 2374 |
| 384 | Ga0207646_10121188 | 3300025922 | Bacteria | 2350 |
| 385 | Ga0207646_10300735 | 3300025922 | Bacteria | 1450 |
| 386 | Ga0207646_10315221 | 3300025922 | Bacteria | 1413 |
| 387 | Ga0207646_11522556 | 3300025922 | Bacteria | 579 |
| 388 | Ga0207694_10557197 | 3300025924 | Bacteria | 962 |
| 389 | Ga0207650_10003245 | 3300025925 | Bacteria | 11202 |
| 390 | Ga0207650_10567148 | 3300025925 | Bacteria | 953 |
| 391 | Ga0207659_10058617 | 3300025926 | Bacteria | 2764 |
| 392 | Ga0207687_10060705 | 3300025927 | Bacteria | 2668 |
| 393 | Ga0207700_10000798 | 3300025928 | Bacteria | 18207 |
| 394 | Ga0207700_10001733 | 3300025928 | Bacteria | 12393 |
| 395 | Ga0207700_10005685 | 3300025928 | Bacteria | 7485 |
| 396 | Ga0207700_10006147 | 3300025928 | Bacteria | 7233 |
| 397 | Ga0207700_10006208 | 3300025928 | Bacteria | 7203 |
| 398 | Ga0207700_10032403 | 3300025928 | Bacteria | 3727 |
| 399 | Ga0207700_10061891 | 3300025928 | Bacteria | 2840 |
| 400 | Ga0207700_10121056 | 3300025928 | Bacteria | 2122 |
| 401 | Ga0207700_10256296 | 3300025928 | Bacteria | 1496 |
| 402 | Ga0207700_10257694 | 3300025928 | Bacteria | 1492 |
| 403 | Ga0207700_10264492 | 3300025928 | Bacteria | 1474 |
| 404 | Ga0207700_10458819 | 3300025928 | Bacteria | 1124 |
| 405 | Ga0207700_11876521 | 3300025928 | Bacteria | 525 |
| 406 | Ga0207664_10000001 | 3300025929 | Bacteria | 724213 |
| 407 | Ga0207664_10000312 | 3300025929 | Bacteria | 36120 |
| 408 | Ga0207664_10013970 | 3300025929 | Bacteria | 5788 |
| 409 | Ga0207664_10042710 | 3300025929 | Bacteria | 3541 |
| 410 | Ga0207664_10046972 | 3300025929 | Bacteria | 3390 |
| 411 | Ga0207664_10070125 | 3300025929 | Bacteria | 2820 |
| 412 | Ga0207664_10114702 | 3300025929 | Bacteria | 2245 |
| 413 | Ga0207664_10149920 | 3300025929 | Bacteria | 1980 |
| 414 | Ga0207664_10181856 | 3300025929 | Bacteria | 1805 |
| 415 | Ga0207664_10365069 | 3300025929 | Bacteria | 1280 |
| 416 | Ga0207664_10532416 | 3300025929 | Bacteria | 1053 |
| 417 | Ga0207664_10532457 | 3300025929 | Bacteria | 1053 |
| 418 | Ga0207664_10732425 | 3300025929 | Bacteria | 889 |
| 419 | Ga0207664_11084316 | 3300025929 | Bacteria | 716 |
| 420 | Ga0207664_11118270 | 3300025929 | Bacteria | 704 |
| 421 | Ga0207644_10010707 | 3300025931 | Bacteria | 6047 |
| 422 | Ga0207644_10293975 | 3300025931 | Bacteria | 1307 |
| 423 | Ga0207690_10001825 | 3300025932 | Bacteria | 13064 |
| 424 | Ga0207690_10011542 | 3300025932 | Bacteria | 5277 |
| 425 | Ga0207706_10159937 | 3300025933 | Bacteria | 1980 |
| 426 | Ga0207665_10000815 | 3300025939 | Bacteria | 21105 |
| 427 | Ga0207665_10001422 | 3300025939 | Bacteria | 16092 |
| 428 | Ga0207665_10105536 | 3300025939 | Bacteria | 1973 |
| 429 | Ga0207665_10308546 | 3300025939 | Bacteria | 1185 |
| 430 | Ga0207691_10022176 | 3300025940 | Bacteria | 5989 |
| 431 | Ga0207711_10110258 | 3300025941 | Bacteria | 2447 |
| 432 | Ga0207711_10211113 | 3300025941 | Bacteria | 1773 |
| 433 | Ga0207689_10024826 | 3300025942 | Bacteria | 5025 |
| 434 | Ga0207661_10011594 | 3300025944 | Bacteria | 6394 |
| 435 | Ga0207679_10003642 | 3300025945 | Bacteria | 9547 |
| 436 | Ga0207667_10080046 | 3300025949 | Bacteria | 3385 |
| 437 | Ga0207667_10453799 | 3300025949 | Bacteria | 1302 |
| 438 | Ga0207667_11472512 | 3300025949 | Bacteria | 653 |
| 439 | Ga0207651_10073792 | 3300025960 | Bacteria | 2427 |
| 440 | Ga0207712_10433582 | 3300025961 | Bacteria | 1111 |
| 441 | Ga0207712_11394972 | 3300025961 | Bacteria | 627 |
| 442 | Ga0207668_10375860 | 3300025972 | Bacteria | 1195 |
| 443 | Ga0207677_10004696 | 3300026023 | Bacteria | 7363 |
| 444 | Ga0207639_10123660 | 3300026041 | Bacteria | 2130 |
| 445 | Ga0207678_10003042 | 3300026067 | Bacteria | 15169 |
| 446 | Ga0207678_10553573 | 3300026067 | Bacteria | 1006 |
| 447 | Ga0207702_10005731 | 3300026078 | Bacteria | 10825 |
| 448 | Ga0207702_10019897 | 3300026078 | Bacteria | 5561 |
| 449 | Ga0207702_10035944 | 3300026078 | Bacteria | 4142 |
| 450 | Ga0207702_10637820 | 3300026078 | Bacteria | 1047 |
| 451 | Ga0207702_11545221 | 3300026078 | Bacteria | 657 |
| 452 | Ga0207641_10031395 | 3300026088 | Bacteria | 4406 |
| 453 | Ga0207641_10034914 | 3300026088 | Bacteria | 4185 |
| 454 | Ga0207641_10102827 | 3300026088 | Bacteria | 2520 |
| 455 | Ga0207648_10427487 | 3300026089 | Bacteria | 1203 |
| 456 | Ga0207648_11216410 | 3300026089 | Bacteria | 708 |
| 457 | Ga0207676_10005774 | 3300026095 | Bacteria | 8752 |
| 458 | Ga0207676_10363296 | 3300026095 | Bacteria | 1342 |
| 459 | Ga0207674_10044865 | 3300026116 | Bacteria | 4552 |
| 460 | Ga0207674_10394881 | 3300026116 | Bacteria | 1337 |
| 461 | Ga0207675_100683460 | 3300026118 | Bacteria | 1034 |
| 462 | Ga0207683_10001550 | 3300026121 | Bacteria | 20670 |
| 463 | Ga0207683_10276332 | 3300026121 | Bacteria | 1535 |
| 464 | Ga0207683_10424165 | 3300026121 | Bacteria | 1225 |
| 465 | Ga0207698_10004969 | 3300026142 | Bacteria | 8151 |
| 466 | Ga0207428_10010009 | 3300027907 | Bacteria | 8484 |
| 467 | Ga0268266_10099843 | 3300028379 | Bacteria | 2556 |
| 468 | Ga0268266_10130904 | 3300028379 | Bacteria | 2244 |
| 469 | Ga0268266_10342281 | 3300028379 | Bacteria | 1404 |
| 470 | Ga0268266_10479697 | 3300028379 | Bacteria | 1185 |
| 471 | Ga0265334_10010253 | 3300028573 | Bacteria | 3955 |
| 472 | Ga0265762_1020801 | 3300030760 | Bacteria | 1207 |
| 473 | Ga0316579_10000498 | 3300031691 | Bacteria | 12845 |
| 474 | Ga0316576_10296302 | 3300031727 | Bacteria | 1209 |
| 475 | Ga0307410_10067471 | 3300031852 | Bacteria | 2468 |
| 476 | Ga0326468_10008292 | 3300031889 | Bacteria | 1003 |
| 477 | Ga0307406_10914039 | 3300031901 | Bacteria | 748 |
| 478 | Ga0307407_10625259 | 3300031903 | Bacteria | 804 |
| 479 | Ga0307409_100080150 | 3300031995 | Bacteria | 2633 |
| 480 | Ga0307507_10009639 | 3300033179 | Bacteria | 12775 |
| 481 | Ga0307507_10081778 | 3300033179 | Bacteria | 2837 |
| 482 | Ga0307510_10130120 | 3300033180 | Bacteria | 2193 |
| 483 | Ga0373950_0003712 | 3300034818 | Bacteria | 2202 |
| 484 | Ga0373938_0008119 | 3300034957 | Bacteria | 1868 |
| 485 | Ga0373926_0004292 | 3300035083 | Bacteria | 4663 |
| 486 | Ga0373926_0017432 | 3300035083 | Bacteria | 2464 |
| 487 | Ga0373926_0280457 | 3300035083 | Bacteria | 649 |
| 488 | Ga0373929_0027779 | 3300035085 | Bacteria | 1191 |
| 489 | Ga0373934_0000674 | 3300035086 | Bacteria | 12102 |
| 490 | Ga0373934_0014530 | 3300035086 | Bacteria | 2984 |
| 491 | Ga0373934_0051912 | 3300035086 | Bacteria | 1625 |
| 492 | Ga0373934_0079784 | 3300035086 | Bacteria | 1314 |
| 493 | Ga0373934_0103757 | 3300035086 | Bacteria | 1150 |
| 494 | Ga0373940_0042379 | 3300035088 | Bacteria | 1254 |
| 495 | Ga0373949_0026609 | 3300035090 | Bacteria | 1356 |
| 496 | Ga0373951_0030870 | 3300035091 | Bacteria | 1263 |
| 497 | Ga0373923_0007318 | 3300035111 | Bacteria | 3875 |
| 498 | Ga0373923_0007399 | 3300035111 | Bacteria | 3858 |
| 499 | Ga0373923_0066149 | 3300035111 | Bacteria | 1544 |
| 500 | Ga0373923_0174313 | 3300035111 | Bacteria | 986 |
| 501 | Ga0373923_0199638 | 3300035111 | Bacteria | 924 |
| 502 | Ga0373936_0017038 | 3300035113 | Bacteria | 2794 |
| 503 | Ga0373936_0089158 | 3300035113 | Bacteria | 1292 |
| 504 | Ga0373936_0204095 | 3300035113 | Bacteria | 873 |
| 505 | Ga0373939_0006966 | 3300035114 | Bacteria | 2735 |
| 506 | Ga0373941_0005012 | 3300035115 | Bacteria | 3087 |
| 507 | Ga0373945_0021950 | 3300035116 | Bacteria | 2196 |
| 508 | Ga0373945_0185029 | 3300035116 | Bacteria | 859 |
| 509 | Ga0373953_0003697 | 3300035117 | Bacteria | 4803 |
| 510 | Ga0373953_0019283 | 3300035117 | Bacteria | 2535 |
| 511 | Ga0373953_0039276 | 3300035117 | Bacteria | 1875 |
| 512 | Ga0373953_0043412 | 3300035117 | Bacteria | 1794 |
| 513 | Ga0373954_0022036 | 3300035118 | Bacteria | 2888 |
| 514 | Ga0373954_0242820 | 3300035118 | Bacteria | 886 |
| 515 | Ga0373956_0000440 | 3300035119 | Bacteria | 16919 |
| 516 | Ga0373956_0007167 | 3300035119 | Bacteria | 4488 |
| 517 | Ga0373956_0014248 | 3300035119 | Bacteria | 3320 |
| 518 | Ga0373956_0089716 | 3300035119 | Bacteria | 1417 |
| 519 | Ga0373956_0124717 | 3300035119 | Bacteria | 1204 |
| 520 | Ga0373957_0000394 | 3300035120 | Bacteria | 11075 |
| 521 | Ga0373957_0017224 | 3300035120 | Bacteria | 2512 |
| 522 | Ga0373957_0042923 | 3300035120 | Bacteria | 1707 |
| 523 | Ga0373957_0084253 | 3300035120 | Bacteria | 1257 |
| 524 | Ga0373960_0021997 | 3300035121 | Bacteria | 1702 |
| 525 | Ga0373960_0112962 | 3300035121 | Bacteria | 893 |
| 526 | Ga0373943_0257486 | 3300035170 | Bacteria | 981 |
| 527 | Ga0373943_0702928 | 3300035170 | Bacteria | 599 |
| 528 | Ga0373946_0032311 | 3300035171 | Bacteria | 2101 |
| 529 | Ga0373946_0053773 | 3300035171 | Bacteria | 1692 |
| 530 | Ga0373946_0169421 | 3300035171 | Bacteria | 1030 |
| 531 | Ga0373946_0246891 | 3300035171 | Bacteria | 869 |
| 532 | Ga0373946_0312692 | 3300035171 | Bacteria | 779 |
| 533 | Ga0373946_0395060 | 3300035171 | Bacteria | 697 |
| 534 | Ga0373955_0001622 | 3300035172 | Bacteria | 9628 |
| 535 | Ga0373955_0009312 | 3300035172 | Bacteria | 4597 |
| 536 | Ga0373955_0019045 | 3300035172 | Bacteria | 3423 |
| 537 | Ga0373955_0168220 | 3300035172 | Bacteria | 1296 |
| 538 | Ga0373955_0213173 | 3300035172 | Bacteria | 1152 |
| 539 | Ga0373955_0335344 | 3300035172 | Bacteria | 915 |
| 540 | Ga0373955_0405635 | 3300035172 | Bacteria | 828 |
| 541 | Ga0373955_0562699 | 3300035172 | Bacteria | 698 |
| 542 | Ga0373942_0149361 | 3300035207 | Bacteria | 750 |
| 543 | Ga0373961_0166327 | 3300035241 | Bacteria | 760 |
| 544 | Ga0316574_0053529 | 3300035398 | Bacteria | 2520 |
| 545 | Ga0316574_0057056 | 3300035398 | Bacteria | 2444 |
| 546 | Ga0373924_0001446 | 3300035410 | Bacteria | 7709 |
| 547 | Ga0373924_0006288 | 3300035410 | Bacteria | 4248 |
| 548 | Ga0373924_0049616 | 3300035410 | Bacteria | 1737 |
| 549 | Ga0373924_0068341 | 3300035410 | Bacteria | 1495 |
| 550 | Ga0373924_0116013 | 3300035410 | Bacteria | 1160 |
| 551 | Ga0373931_0045472 | 3300035691 | Bacteria | 2318 |
| 552 | Ga0373931_0064798 | 3300035691 | Bacteria | 1979 |
| 553 | Ga0373931_0110855 | 3300035691 | Bacteria | 1557 |
| 554 | Ga0373935_0014480 | 3300035692 | Bacteria | 4758 |
| 555 | Ga0373935_0034250 | 3300035692 | Bacteria | 3165 |
| 556 | Ga0373935_0143789 | 3300035692 | Bacteria | 1613 |
| 557 | Ga0373933_0000395 | 3300035724 | Bacteria | 27686 |
| 558 | Ga0373933_0001608 | 3300035724 | Bacteria | 13212 |
| 559 | Ga0373933_0011885 | 3300035724 | Bacteria | 4806 |
| 560 | Ga0373933_0046194 | 3300035724 | Bacteria | 2584 |
| 561 | Ga0373933_0050667 | 3300035724 | Bacteria | 2479 |
| 562 | Ga0373933_0057136 | 3300035724 | Bacteria | 2344 |
| 563 | Ga0373933_0336842 | 3300035724 | Bacteria | 979 |
| 564 | Ga0373947_0000004 | 3300035725 | Bacteria | 248228 |
| 565 | Ga0373947_0084539 | 3300035725 | Bacteria | 1969 |
| 566 | Ga0373947_0105811 | 3300035725 | Bacteria | 1773 |
| 567 | Ga0373947_0265423 | 3300035725 | Bacteria | 1138 |
| 568 | Ga0373947_0306613 | 3300035725 | Bacteria | 1059 |
| 569 | Ga0373937_0000112 | 3300036401 | Bacteria | 77473 |
| 570 | Ga0373937_0021836 | 3300036401 | Bacteria | 5746 |
| 571 | Ga0373937_0088112 | 3300036401 | Bacteria | 2873 |
| 572 | Ga0373937_0341344 | 3300036401 | Bacteria | 1418 |
| 573 | Ga0373937_0347766 | 3300036401 | Bacteria | 1404 |
| 574 | Ga0373925_0014724 | 3300037068 | Bacteria | 5650 |
| 575 | Ga0373925_0066450 | 3300037068 | Bacteria | 2718 |
| 576 | Ga0373925_0091250 | 3300037068 | Bacteria | 2329 |
| 577 | Ga0373925_0162179 | 3300037068 | Bacteria | 1761 |
| 578 | Ga0373925_0184564 | 3300037068 | Bacteria | 1653 |
| 579 | Ga0373925_0202570 | 3300037068 | Bacteria | 1578 |
| 580 | Ga0373925_0366965 | 3300037068 | Bacteria | 1171 |
| 581 | Ga0373925_0440518 | 3300037068 | Bacteria | 1066 |
| 582 | Ga0373925_0767328 | 3300037068 | Bacteria | 795 |
| 583 | Ga0373925_1375628 | 3300037068 | Bacteria | 578 |
| 584 | Ga0395900_0798179 | 3300037418 | Bacteria | 872 |
| 585 | Ga0436364_0497431 | 3300037853 | Bacteria | 888 |
| 586 | Ga0436364_0575601 | 3300037853 | Bacteria | 4772 |
| 587 | Ga0436364_0590629 | 3300037853 | Bacteria | 766 |
| 588 | Ga0436364_0750774 | 3300037853 | Bacteria | 1675 |
| 589 | Ga0436364_0804097 | 3300037853 | Bacteria | 39998 |
| 590 | Ga0436364_0845254 | 3300037853 | Bacteria | 1362 |
| 591 | Ga0436364_1042062 | 3300037853 | Bacteria | 2394 |
| 592 | Ga0436364_1241795 | 3300037853 | Bacteria | 1696 |
| 593 | Ga0395901_0115355 | 3300038443 | Bacteria | 2821 |
| 594 | Ga0436365_0020494 | 3300039437 | Bacteria | 967 |
| 595 | Ga0436365_1487927 | 3300039437 | Bacteria | 1062 |
| 596 | Ga0436360_0506992 | 3300039438 | Bacteria | 611 |
| 597 | Ga0436361_0218806 | 3300039447 | Bacteria | 1200 |
| 598 | Ga0436363_0367458 | 3300039450 | Bacteria | 1562 |
| 599 | Ga0436363_0685852 | 3300039450 | Bacteria | 1073 |
| 600 | Ga0436363_1307140 | 3300039450 | Bacteria | 515 |
| 601 | Ga0436363_1321302 | 3300039450 | Bacteria | 2222 |
| 602 | Ga0436363_1555992 | 3300039450 | Bacteria | 1290 |
| 603 | Ga0436363_1662743 | 3300039450 | Bacteria | 774 |
| 604 | Ga0436362_0041956 | 3300039453 | Bacteria | 671 |
| 605 | Ga0451793_0403868 | 3300041452 | Bacteria | 609 |
| 606 | Ga0451802_0252721 | 3300041460 | Bacteria | 734 |
| 607 | Ga0451802_0659795 | 3300041460 | Bacteria | 633 |
| 608 | Ga0451843_0620187 | 3300041509 | Bacteria | 548 |
| 609 | Ga0451853_2247606 | 3300041512 | Bacteria | 509 |
| 610 | Ga0439448_0114577 | 3300042005 | Bacteria | 923 |
| 611 | Ga0439455_0124192 | 3300042012 | Bacteria | 725 |
| 612 | Ga0439463_100419 | 3300042016 | Bacteria | 746 |
| 613 | Ga0439463_164444 | 3300042016 | Bacteria | 575 |
| 614 | Ga0439458_0161692 | 3300042157 | Bacteria | 603 |
| 615 | Ga0439459_0000753 | 3300042438 | Bacteria | 4446 |
| 616 | Ga0439459_0085020 | 3300042438 | Bacteria | 752 |
| 617 | Ga0466969_0195770 | 3300044656 | Bacteria | 923 |
| 618 | Ga0466969_0471313 | 3300044656 | Bacteria | 572 |
| 619 | Ga0466972_0056538 | 3300044658 | Bacteria | 1886 |
| 620 | Ga0466965_0189629 | 3300044683 | Bacteria | 1087 |
| 621 | Ga0466965_0723432 | 3300044683 | Bacteria | 572 |
| 622 | Ga0466966_0028253 | 3300044684 | Bacteria | 3655 |
| 623 | Ga0466966_0117809 | 3300044684 | Bacteria | 1633 |
| 624 | Ga0466966_0363822 | 3300044684 | Bacteria | 869 |
| 625 | Ga0466961_0050345 | 3300044693 | Bacteria | 2660 |
| 626 | Ga0466961_0188603 | 3300044693 | Bacteria | 1279 |
| 627 | Ga0466961_0209376 | 3300044693 | Bacteria | 1204 |
| 628 | Ga0466963_0010418 | 3300044694 | Bacteria | 5628 |
| 629 | Ga0466963_0038035 | 3300044694 | Bacteria | 3145 |
| 630 | Ga0466963_0191173 | 3300044694 | Bacteria | 1430 |
| 631 | Ga0466963_0194720 | 3300044694 | Bacteria | 1417 |
| 632 | Ga0466964_0097028 | 3300044706 | Bacteria | 1293 |
| 633 | Ga0466964_0114153 | 3300044706 | Bacteria | 1209 |
| 634 | Ga0466964_0308794 | 3300044706 | Bacteria | 800 |
| 635 | Ga0466971_0020889 | 3300044719 | Bacteria | 2911 |
| 636 | Ga0466971_0115010 | 3300044719 | Bacteria | 1243 |
| 637 | Ga0466971_0117611 | 3300044719 | Bacteria | 1229 |
| 638 | Ga0466970_0074630 | 3300044765 | Bacteria | 1826 |
| 639 | Ga0466957_0031665 | 3300044842 | Bacteria | 3162 |
| 640 | Ga0466957_0047275 | 3300044842 | Bacteria | 2614 |
| 641 | Ga0466957_0158693 | 3300044842 | Bacteria | 1468 |
| 642 | Ga0466960_0071412 | 3300044901 | Bacteria | 1729 |
| 643 | Ga0466960_0114236 | 3300044901 | Bacteria | 1407 |
| 644 | Ga0466960_0340273 | 3300044901 | Bacteria | 853 |
| 645 | Ga0466959_0034661 | 3300045049 | Bacteria | 3734 |
| 646 | Ga0466959_0198051 | 3300045049 | Bacteria | 1399 |
| 647 | Ga0466958_0049813 | 3300045836 | Bacteria | 2535 |
| 648 | Ga0466958_0061918 | 3300045836 | Bacteria | 2280 |
| 649 | Ga0466958_0107329 | 3300045836 | Bacteria | 1741 |
| 650 | Ga0466958_0436120 | 3300045836 | Bacteria | 848 |
| 651 | Ga0466967_0010205 | 3300045976 | Bacteria | 7028 |
| 652 | Ga0466967_0045499 | 3300045976 | Bacteria | 3814 |
| 653 | Ga0466967_0077947 | 3300045976 | Bacteria | 2984 |
| 654 | Ga0466967_0081934 | 3300045976 | Bacteria | 2915 |
| 655 | Ga0466967_0109228 | 3300045976 | Bacteria | 2539 |
| 656 | Ga0466967_0120753 | 3300045976 | Bacteria | 2421 |
| 657 | Ga0466967_0199443 | 3300045976 | Bacteria | 1895 |
| 658 | Ga0466967_0207505 | 3300045976 | Bacteria | 1857 |
| 659 | Ga0466967_0323759 | 3300045976 | Bacteria | 1487 |
| 660 | Ga0466967_0385136 | 3300045976 | Bacteria | 1362 |
| 661 | Ga0466967_0742497 | 3300045976 | Bacteria | 973 |
| 662 | Ga0495592_0001455 | 3300046454 | Bacteria | 16462 |
| 663 | Ga0495592_0007331 | 3300046454 | Bacteria | 8250 |
| 664 | Ga0495592_0031243 | 3300046454 | Bacteria | 4025 |
| 665 | Ga0495592_0064943 | 3300046454 | Bacteria | 2673 |
| 666 | Ga0495592_0129668 | 3300046454 | Bacteria | 1765 |
| 667 | Ga0495592_0595574 | 3300046454 | Bacteria | 675 |
| 668 | Ga0495603_0474382 | 3300046455 | Bacteria | 716 |
| 669 | Ga0495629_0003377 | 3300046459 | Bacteria | 12067 |
| 670 | Ga0495629_0015076 | 3300046459 | Bacteria | 5555 |
| 671 | Ga0495629_0025772 | 3300046459 | Bacteria | 4178 |
| 672 | Ga0495641_0009158 | 3300046461 | Bacteria | 5920 |
| 673 | Ga0495641_0012173 | 3300046461 | Bacteria | 4833 |
| 674 | Ga0495641_0063786 | 3300046461 | Bacteria | 1660 |
| 675 | Ga0495641_0134931 | 3300046461 | Bacteria | 1102 |
| 676 | Ga0495651_0000614 | 3300046462 | Bacteria | 27686 |
| 677 | Ga0495651_0044722 | 3300046462 | Bacteria | 3431 |
| 678 | Ga0495651_0076191 | 3300046462 | Bacteria | 2541 |
| 679 | Ga0495651_0115830 | 3300046462 | Bacteria | 1975 |
| 680 | Ga0495651_0248035 | 3300046462 | Bacteria | 1217 |
| 681 | Ga0495653_0005337 | 3300046463 | Bacteria | 10459 |
| 682 | Ga0495653_0017535 | 3300046463 | Bacteria | 5822 |
| 683 | Ga0495653_0020711 | 3300046463 | Bacteria | 5327 |
| 684 | Ga0495653_0060635 | 3300046463 | Bacteria | 2865 |
| 685 | Ga0495653_0091505 | 3300046463 | Bacteria | 2223 |
| 686 | Ga0495653_0192235 | 3300046463 | Bacteria | 1391 |
| 687 | Ga0495653_0500902 | 3300046463 | Bacteria | 757 |
| 688 | Ga0495653_0793646 | 3300046463 | Bacteria | 569 |
| 689 | Ga0495580_0295072 | 3300046472 | Bacteria | 1104 |
| 690 | Ga0495580_0435779 | 3300046472 | Bacteria | 880 |
| 691 | Ga0495582_0000633 | 3300046473 | Bacteria | 19392 |
| 692 | Ga0495582_0018939 | 3300046473 | Bacteria | 3766 |
| 693 | Ga0495582_0121544 | 3300046473 | Bacteria | 1471 |
| 694 | Ga0495582_0633239 | 3300046473 | Bacteria | 619 |
| 695 | Ga0495639_0071634 | 3300046475 | Bacteria | 1601 |
| 696 | Ga0495639_0195717 | 3300046475 | Bacteria | 988 |
| 697 | Ga0495639_0476023 | 3300046475 | Bacteria | 636 |
| 698 | Ga0495662_0002306 | 3300046476 | Bacteria | 9617 |
| 699 | Ga0495662_0176990 | 3300046476 | Bacteria | 1051 |
| 700 | Ga0495662_0357194 | 3300046476 | Bacteria | 718 |
| 701 | Ga0495664_0035879 | 3300046477 | Bacteria | 2921 |
| 702 | Ga0495664_0103917 | 3300046477 | Bacteria | 1712 |
| 703 | Ga0495664_0135073 | 3300046477 | Bacteria | 1494 |
| 704 | Ga0495664_0199036 | 3300046477 | Bacteria | 1214 |
| 705 | Ga0495664_0216373 | 3300046477 | Bacteria | 1160 |
| 706 | Ga0495664_0337844 | 3300046477 | Bacteria | 908 |
| 707 | Ga0495585_0403769 | 3300046492 | Bacteria | 658 |
| 708 | Ga0495608_0001069 | 3300046511 | Bacteria | 19294 |
| 709 | Ga0495608_0001601 | 3300046511 | Bacteria | 16213 |
| 710 | Ga0495608_0023206 | 3300046511 | Bacteria | 4253 |
| 711 | Ga0495608_0026488 | 3300046511 | Bacteria | 3951 |
| 712 | Ga0495608_0073754 | 3300046511 | Bacteria | 2225 |
| 713 | Ga0495608_0112239 | 3300046511 | Bacteria | 1752 |
| 714 | Ga0495618_0090381 | 3300046514 | Bacteria | 1958 |
| 715 | Ga0495618_0138204 | 3300046514 | Bacteria | 1558 |
| 716 | Ga0495618_0163081 | 3300046514 | Bacteria | 1420 |
| 717 | Ga0495618_0163346 | 3300046514 | Bacteria | 1419 |
| 718 | Ga0495618_0185289 | 3300046514 | Bacteria | 1321 |
| 719 | Ga0495618_0187179 | 3300046514 | Bacteria | 1314 |
| 720 | Ga0495618_0275484 | 3300046514 | Bacteria | 1050 |
| 721 | Ga0495628_0001819 | 3300046516 | Bacteria | 19354 |
| 722 | Ga0495628_0006554 | 3300046516 | Bacteria | 10159 |
| 723 | Ga0495628_0075381 | 3300046516 | Bacteria | 2627 |
| 724 | Ga0495628_0144151 | 3300046516 | Bacteria | 1816 |
| 725 | Ga0495628_0221997 | 3300046516 | Bacteria | 1419 |
| 726 | Ga0495628_0259717 | 3300046516 | Bacteria | 1295 |
| 727 | Ga0495628_0559341 | 3300046516 | Bacteria | 820 |
| 728 | Ga0495628_0570329 | 3300046516 | Bacteria | 811 |
| 729 | Ga0495630_0014583 | 3300046517 | Bacteria | 5727 |
| 730 | Ga0495630_0035351 | 3300046517 | Bacteria | 3734 |
| 731 | Ga0495630_0046422 | 3300046517 | Bacteria | 3247 |
| 732 | Ga0495630_0345675 | 3300046517 | Bacteria | 1138 |
| 733 | Ga0495666_0043774 | 3300046526 | Bacteria | 2162 |
| 734 | Ga0495666_0330050 | 3300046526 | Bacteria | 688 |
| 735 | Ga0495652_0001605 | 3300046529 | Bacteria | 24694 |
| 736 | Ga0495652_0047090 | 3300046529 | Bacteria | 3699 |
| 737 | Ga0495652_0087251 | 3300046529 | Bacteria | 2559 |
| 738 | Ga0495652_0137351 | 3300046529 | Bacteria | 1927 |
| 739 | Ga0495652_0156758 | 3300046529 | Bacteria | 1772 |
| 740 | Ga0495652_0170625 | 3300046529 | Bacteria | 1679 |
| 741 | Ga0495652_0247817 | 3300046529 | Bacteria | 1321 |
| 742 | Ga0495652_0528856 | 3300046529 | Bacteria | 814 |
| 743 | Ga0495665_0000862 | 3300046531 | Bacteria | 15866 |
| 744 | Ga0495665_0006105 | 3300046531 | Bacteria | 6501 |
| 745 | Ga0495665_0040631 | 3300046531 | Bacteria | 2476 |
| 746 | Ga0495665_0101249 | 3300046531 | Bacteria | 1512 |
| 747 | Ga0495665_0395392 | 3300046531 | Bacteria | 701 |
| 748 | Ga0495640_0032162 | 3300046533 | Bacteria | 3738 |
| 749 | Ga0495640_0052316 | 3300046533 | Bacteria | 2805 |
| 750 | Ga0495640_0053319 | 3300046533 | Bacteria | 2772 |
| 751 | Ga0495640_0064663 | 3300046533 | Bacteria | 2472 |
| 752 | Ga0495640_0108982 | 3300046533 | Bacteria | 1811 |
| 753 | Ga0495640_0156918 | 3300046533 | Bacteria | 1460 |
| 754 | Ga0495640_0358306 | 3300046533 | Bacteria | 899 |
| 755 | Ga0495640_0405067 | 3300046533 | Bacteria | 837 |
| 756 | Ga0495586_0008277 | 3300046535 | Bacteria | 5538 |
| 757 | Ga0495586_0078499 | 3300046535 | Bacteria | 1811 |
| 758 | Ga0495586_0306961 | 3300046535 | Bacteria | 909 |
| 759 | Ga0495587_0000038 | 3300046536 | Bacteria | 116118 |
| 760 | Ga0495587_0009607 | 3300046536 | Bacteria | 6189 |
| 761 | Ga0495587_0014385 | 3300046536 | Bacteria | 4965 |
| 762 | Ga0495587_0091105 | 3300046536 | Bacteria | 1761 |
| 763 | Ga0495645_0024129 | 3300046543 | Bacteria | 4411 |
| 764 | Ga0495645_0104876 | 3300046543 | Bacteria | 2006 |
| 765 | Ga0495645_0307514 | 3300046543 | Bacteria | 1033 |
| 766 | Ga0495645_0432137 | 3300046543 | Bacteria | 834 |
| 767 | Ga0495645_0536564 | 3300046543 | Bacteria | 727 |
| 768 | Ga0495622_0050337 | 3300046557 | Bacteria | 1933 |
| 769 | Ga0495667_0001336 | 3300046559 | Bacteria | 16196 |
| 770 | Ga0495667_0006455 | 3300046559 | Bacteria | 7962 |
| 771 | Ga0495667_0065274 | 3300046559 | Bacteria | 2381 |
| 772 | Ga0495667_0077073 | 3300046559 | Bacteria | 2168 |
| 773 | Ga0495667_0205778 | 3300046559 | Bacteria | 1258 |
| 774 | Ga0495634_0010165 | 3300046642 | Bacteria | 6905 |
| 775 | Ga0495634_0098056 | 3300046642 | Bacteria | 1896 |
| 776 | Ga0495634_0384838 | 3300046642 | Bacteria | 835 |
| 777 | Ga0495635_0010821 | 3300046663 | Bacteria | 6391 |
| 778 | Ga0495635_0093700 | 3300046663 | Bacteria | 2054 |
| 779 | Ga0495635_0134179 | 3300046663 | Bacteria | 1687 |
| 780 | Ga0495635_0154432 | 3300046663 | Bacteria | 1562 |
| 781 | Ga0495635_0177618 | 3300046663 | Bacteria | 1447 |
| 782 | Ga0495635_0178752 | 3300046663 | Bacteria | 1442 |
| 783 | Ga0495635_0507850 | 3300046663 | Bacteria | 793 |
| 784 | Ga0495635_0858320 | 3300046663 | Bacteria | 583 |
| 785 | Ga0495588_0199784 | 3300046674 | Bacteria | 1056 |
| 786 | Ga0495657_0001650 | 3300046675 | Bacteria | 19175 |
| 787 | Ga0495657_0003778 | 3300046675 | Bacteria | 12258 |
| 788 | Ga0495657_0010062 | 3300046675 | Bacteria | 7130 |
| 789 | Ga0495657_0040982 | 3300046675 | Bacteria | 3172 |
| 790 | Ga0495657_0052746 | 3300046675 | Bacteria | 2724 |
| 791 | Ga0495657_0241636 | 3300046675 | Bacteria | 1089 |
| 792 | Ga0495599_0000758 | 3300046678 | Bacteria | 18206 |
| 793 | Ga0495599_0005598 | 3300046678 | Bacteria | 7530 |
| 794 | Ga0495599_0030015 | 3300046678 | Bacteria | 3409 |
| 795 | Ga0495599_0175492 | 3300046678 | Bacteria | 1321 |
| 796 | Ga0495623_0000989 | 3300046679 | Bacteria | 19179 |
| 797 | Ga0495623_0024334 | 3300046679 | Bacteria | 3902 |
| 798 | Ga0495623_0034857 | 3300046679 | Bacteria | 3227 |
| 799 | Ga0495623_0205097 | 3300046679 | Bacteria | 1131 |
| 800 | Ga0495646_0007896 | 3300046680 | Bacteria | 6759 |
| 801 | Ga0495646_0011284 | 3300046680 | Bacteria | 5674 |
| 802 | Ga0495646_0036410 | 3300046680 | Bacteria | 3048 |
| 803 | Ga0495646_0062099 | 3300046680 | Bacteria | 2222 |
| 804 | Ga0495646_0081477 | 3300046680 | Bacteria | 1886 |
| 805 | Ga0495646_0343986 | 3300046680 | Bacteria | 782 |
| 806 | Ga0495647_0080666 | 3300046681 | Bacteria | 1319 |
| 807 | Ga0495647_0097127 | 3300046681 | Bacteria | 1215 |
| 808 | Ga0495658_0015048 | 3300046683 | Bacteria | 3964 |
| 809 | Ga0495658_0033565 | 3300046683 | Bacteria | 2812 |
| 810 | Ga0495658_0232418 | 3300046683 | Bacteria | 1156 |
| 811 | Ga0495658_0616450 | 3300046683 | Bacteria | 695 |
| 812 | Ga0495669_0002047 | 3300046684 | Bacteria | 8268 |
| 813 | Ga0495613_0025110 | 3300046689 | Bacteria | 4440 |
| 814 | Ga0495613_0086135 | 3300046689 | Bacteria | 2278 |
| 815 | Ga0495613_0173570 | 3300046689 | Bacteria | 1529 |
| 816 | Ga0495624_0007371 | 3300046690 | Bacteria | 7726 |
| 817 | Ga0495624_0288964 | 3300046690 | Bacteria | 989 |
| 818 | Ga0495671_0497409 | 3300046692 | Unclassified | 582 |
| 819 | Ga0495649_0134897 | 3300046694 | Bacteria | 1302 |
| 820 | Ga0495600_0003680 | 3300046809 | Bacteria | 9058 |
| 821 | Ga0495600_0014627 | 3300046809 | Bacteria | 4946 |
| 822 | Ga0495600_0022141 | 3300046809 | Bacteria | 4078 |
| 823 | Ga0495600_0039149 | 3300046809 | Bacteria | 3087 |
| 824 | Ga0495600_0833804 | 3300046809 | Bacteria | 547 |
| 825 | Ga0495581_0011292 | 3300047315 | Bacteria | 5165 |
| 826 | Ga0495581_0021500 | 3300047315 | Bacteria | 3738 |
| 827 | Ga0495581_0022089 | 3300047315 | Bacteria | 3687 |
| 828 | Ga0495581_0256013 | 3300047315 | Bacteria | 1024 |
| 829 | Ga0495604_0001351 | 3300047317 | Bacteria | 20054 |
| 830 | Ga0495604_0017594 | 3300047317 | Bacteria | 5722 |
| 831 | Ga0495604_0023708 | 3300047317 | Bacteria | 4897 |
| 832 | Ga0495604_0215741 | 3300047317 | Bacteria | 1324 |
| 833 | Ga0495604_0237975 | 3300047317 | Bacteria | 1246 |
| 834 | Ga0495604_0295461 | 3300047317 | Bacteria | 1089 |
| 835 | Ga0495604_0398917 | 3300047317 | Bacteria | 906 |
| 836 | Ga0495674_0016775 | 3300047319 | Bacteria | 6832 |
| 837 | Ga0495674_0041489 | 3300047319 | Bacteria | 4110 |
| 838 | Ga0495674_0097709 | 3300047319 | Bacteria | 2501 |
| 839 | Ga0495674_0102293 | 3300047319 | Bacteria | 2436 |
| 840 | Ga0495674_0115625 | 3300047319 | Bacteria | 2270 |
| 841 | Ga0495674_0348943 | 3300047319 | Bacteria | 1201 |
| 842 | Ga0495674_1180129 | 3300047319 | Bacteria | 579 |
| 843 | Ga0495676_0085381 | 3300047321 | Bacteria | 2378 |
| 844 | Ga0495676_0182973 | 3300047321 | Bacteria | 1467 |
| 845 | Ga0495676_0225727 | 3300047321 | Bacteria | 1289 |
| 846 | Ga0495680_0003762 | 3300047322 | Bacteria | 14765 |
| 847 | Ga0495680_0011520 | 3300047322 | Bacteria | 7821 |
| 848 | Ga0495680_0023051 | 3300047322 | Bacteria | 5181 |
| 849 | Ga0495680_0056902 | 3300047322 | Bacteria | 3026 |
| 850 | Ga0495680_0072113 | 3300047322 | Bacteria | 2627 |
| 851 | Ga0495680_0149388 | 3300047322 | Bacteria | 1705 |
| 852 | Ga0495680_0177064 | 3300047322 | Bacteria | 1541 |
| 853 | Ga0495680_0432478 | 3300047322 | Bacteria | 903 |
| 854 | Ga0495675_0004390 | 3300047444 | Bacteria | 8535 |
| 855 | Ga0495675_0010355 | 3300047444 | Bacteria | 5829 |
| 856 | Ga0495675_0053342 | 3300047444 | Bacteria | 2566 |
| 857 | Ga0495684_0005912 | 3300047471 | Bacteria | 9510 |
| 858 | Ga0495684_0013098 | 3300047471 | Bacteria | 6400 |
| 859 | Ga0495684_0032003 | 3300047471 | Bacteria | 4037 |
| 860 | Ga0495684_0066376 | 3300047471 | Bacteria | 2743 |
| 861 | Ga0495684_0099432 | 3300047471 | Bacteria | 2199 |
| 862 | Ga0495684_0628275 | 3300047471 | Bacteria | 721 |
| 863 | Ga0495593_0036689 | 3300047673 | Bacteria | 2656 |
| 864 | Ga0495593_0059361 | 3300047673 | Bacteria | 2004 |
| 865 | Ga0495602_0003390 | 3300048088 | Bacteria | 16477 |
| 866 | Ga0495602_0015662 | 3300048088 | Bacteria | 7642 |
| 867 | Ga0495602_0060055 | 3300048088 | Bacteria | 3315 |
| 868 | Ga0495602_0092006 | 3300048088 | Bacteria | 2513 |
| 869 | Ga0495602_0269413 | 3300048088 | Bacteria | 1259 |
| 870 | Ga0495602_0917701 | 3300048088 | Bacteria | 582 |
| 871 | Ga0495614_0035350 | 3300048089 | Bacteria | 2146 |
| 872 | Ga0495614_0037064 | 3300048089 | Bacteria | 2092 |
| 873 | Ga0496100_0077467 | 3300048903 | Bacteria | 2235 |
| 874 | Ga0496100_0095470 | 3300048903 | Bacteria | 2038 |
| 875 | Ga0496101_0663850 | 3300048904 | Bacteria | 824 |
| 876 | Ga0496101_0726020 | 3300048904 | Bacteria | 784 |
| 877 | Ga0496101_1353754 | 3300048904 | Bacteria | 556 |
| 878 | Ga0496102_0006711 | 3300048905 | Bacteria | 9830 |
| 879 | Ga0496102_0073700 | 3300048905 | Bacteria | 3137 |
| 880 | Ga0496102_0089034 | 3300048905 | Bacteria | 2855 |
| 881 | Ga0496102_0223491 | 3300048905 | Bacteria | 1775 |
| 882 | Ga0496102_0394250 | 3300048905 | Bacteria | 1302 |
| 883 | Ga0496102_1123997 | 3300048905 | Bacteria | 705 |
| 884 | Ga0496103_0089253 | 3300048906 | Bacteria | 1944 |
| 885 | Ga0496103_0168404 | 3300048906 | Bacteria | 1406 |
| 886 | Ga0496103_0400992 | 3300048906 | Bacteria | 881 |
| 887 | Ga0496104_0005668 | 3300048907 | Bacteria | 10935 |
| 888 | Ga0496104_0015590 | 3300048907 | Bacteria | 6888 |
| 889 | Ga0496104_0022073 | 3300048907 | Bacteria | 5849 |
| 890 | Ga0496104_0129027 | 3300048907 | Bacteria | 2428 |
| 891 | Ga0496104_0257572 | 3300048907 | Bacteria | 1658 |
| 892 | Ga0496105_0002576 | 3300048908 | Bacteria | 13179 |
| 893 | Ga0496105_0008991 | 3300048908 | Bacteria | 7791 |
| 894 | Ga0496105_0178037 | 3300048908 | Bacteria | 1741 |
| 895 | Ga0496105_0366172 | 3300048908 | Bacteria | 1149 |
| 896 | Ga0496106_0050968 | 3300048909 | Bacteria | 3120 |
| 897 | Ga0496107_0036160 | 3300048910 | Bacteria | 3542 |
| 898 | Ga0496107_0407922 | 3300048910 | Bacteria | 1010 |
| 899 | Ga0496108_0007310 | 3300048911 | Bacteria | 8953 |
| 900 | Ga0496108_0040237 | 3300048911 | Bacteria | 3895 |
| 901 | Ga0496108_0262005 | 3300048911 | Bacteria | 1504 |
| 902 | Ga0496108_0353118 | 3300048911 | Bacteria | 1283 |
| 903 | Ga0496109_0004986 | 3300048912 | Bacteria | 11085 |
| 904 | Ga0496109_0014629 | 3300048912 | Bacteria | 6827 |
| 905 | Ga0496109_0078270 | 3300048912 | Bacteria | 3044 |
| 906 | Ga0496109_0084140 | 3300048912 | Bacteria | 2934 |
| 907 | Ga0496109_1709205 | 3300048912 | Bacteria | 563 |
| 908 | Ga0496110_0021499 | 3300048913 | Bacteria | 5464 |
| 909 | Ga0496110_0043890 | 3300048913 | Bacteria | 3903 |
| 910 | Ga0496110_0206755 | 3300048913 | Bacteria | 1784 |
| 911 | Ga0496110_0750083 | 3300048913 | Bacteria | 879 |
| 912 | Ga0496111_0002632 | 3300048914 | Bacteria | 10881 |
| 913 | Ga0496111_0003235 | 3300048914 | Bacteria | 10049 |
| 914 | Ga0496111_0062158 | 3300048914 | Bacteria | 2708 |
| 915 | Ga0496111_0166729 | 3300048914 | Bacteria | 1636 |
| 916 | Ga0496112_0053873 | 3300048915 | Bacteria | 3951 |
| 917 | Ga0496112_0079656 | 3300048915 | Bacteria | 3240 |
| 918 | Ga0496112_0146193 | 3300048915 | Bacteria | 2332 |
| 919 | Ga0496112_0272233 | 3300048915 | Bacteria | 1641 |
| 920 | Ga0496112_0428303 | 3300048915 | Bacteria | 1261 |
| 921 | Ga0496113_0004926 | 3300048916 | Bacteria | 8270 |
| 922 | Ga0496113_0039381 | 3300048916 | Bacteria | 3479 |
| 923 | Ga0496113_0052376 | 3300048916 | Bacteria | 3048 |
| 924 | Ga0496113_0063676 | 3300048916 | Bacteria | 2787 |
| 925 | Ga0496113_0083015 | 3300048916 | Bacteria | 2458 |
| 926 | Ga0496114_0131714 | 3300048917 | Bacteria | 2160 |
| 927 | Ga0496114_0286983 | 3300048917 | Bacteria | 1452 |
| 928 | Ga0496114_0290306 | 3300048917 | Bacteria | 1443 |
| 929 | Ga0496114_0376630 | 3300048917 | Bacteria | 1256 |
| 930 | Ga0496114_0438910 | 3300048917 | Bacteria | 1156 |
| 931 | Ga0496114_0731256 | 3300048917 | Bacteria | 866 |
| 932 | Ga0496114_1382866 | 3300048917 | Bacteria | 591 |
| 933 | Ga0496114_1397064 | 3300048917 | Bacteria | 587 |
| 934 | Ga0496115_0006183 | 3300048918 | Bacteria | 8757 |
| 935 | Ga0496115_0091770 | 3300048918 | Bacteria | 2482 |
| 936 | Ga0496126_0000075 | 3300048929 | Bacteria | 235121 |
| 937 | Ga0496126_0184550 | 3300048929 | Bacteria | 1770 |
| 938 | Ga0496126_0682930 | 3300048929 | Bacteria | 800 |
| 939 | Ga0501039_0811278 | 3300049575 | Bacteria | 730 |
| 940 | Ga0501040_1229364 | 3300049576 | Bacteria | 544 |
| 941 | Ga0501042_0008915 | 3300049578 | Bacteria | 6655 |
| 942 | Ga0501047_0000150 | 3300049581 | Bacteria | 85101 |
| 943 | Ga0501068_0135885 | 3300049584 | Bacteria | 1540 |
| 944 | Ga0501069_0208878 | 3300049585 | Bacteria | 1133 |
| 945 | Ga0501072_0833119 | 3300049588 | Bacteria | 722 |
| 946 | Ga0501076_0102642 | 3300049592 | Bacteria | 2306 |
| 947 | Ga0501077_0484835 | 3300049593 | Bacteria | 792 |
| 948 | Ga0501077_1050332 | 3300049593 | Bacteria | 524 |
| 949 | Ga0501079_0291713 | 3300049741 | Bacteria | 1276 |
| 950 | Ga0501080_0835409 | 3300049742 | Bacteria | 806 |
| 951 | Ga0501081_0222502 | 3300049743 | Bacteria | 1373 |
| 952 | nmdc:mga03n38_431597_c1 | 3300050490 | Bacteria | 730 |
| 953 | nmdc:mga07m45_65750_c1 | 3300050496 | Bacteria | 1123 |
| 954 | nmdc:mga05p37_127039_c1 | 3300050507 | Bacteria | 1933 |
| 955 | nmdc:mga05p37_67522_c1 | 3300050507 | Bacteria | 4399 |
| 956 | nmdc:mga09592_486514_c1 | 3300050508 | Bacteria | 1063 |
| 957 | nmdc:mga09592_752305_c1 | 3300050508 | Bacteria | 827 |
| 958 | nmdc:mga06r32_1144457_c1 | 3300050510 | Bacteria | 726 |
| 959 | nmdc:mga06r32_496570_c1 | 3300050510 | Bacteria | 1198 |
| 960 | nmdc:mga06r32_797052_c1 | 3300050510 | Bacteria | 906 |
| 961 | nmdc:mga08y16_228436_c1 | 3300050511 | Bacteria | 1925 |
| 962 | nmdc:mga08y16_70532_c1 | 3300050511 | Bacteria | 3643 |
| 963 | nmdc:mga0n895_109127_c1 | 3300050512 | Bacteria | 2783 |
| 964 | nmdc:mga0n895_13493_c1 | 3300050512 | Bacteria | 7375 |
| 965 | nmdc:mga0n895_53228_c1 | 3300050512 | Bacteria | 3977 |
| 966 | nmdc:mga0n895_7079_c1 | 3300050512 | Bacteria | 9585 |
| 967 | nmdc:mga0rr50_1040_c1 | 3300050513 | Bacteria | 15044 |
| 968 | nmdc:mga0rr50_19349_c1 | 3300050513 | Bacteria | 4594 |
| 969 | nmdc:mga0rr50_30445_c1 | 3300050513 | Bacteria | 3821 |
| 970 | nmdc:mga0rr50_64018_c1 | 3300050513 | Bacteria | 2780 |
| 971 | nmdc:mga08x19_16197_c1 | 3300050514 | Bacteria | 4544 |
| 972 | nmdc:mga08x19_252903_c1 | 3300050514 | Bacteria | 1217 |
| 973 | nmdc:mga08x19_662974_c1 | 3300050514 | Bacteria | 740 |
| 974 | nmdc:mga08x19_673088_c1 | 3300050514 | Bacteria | 734 |
| 975 | nmdc:mga08x19_97392_c1 | 3300050514 | Bacteria | 1948 |
| 976 | nmdc:mga0a205_35541_c1 | 3300050515 | Bacteria | 4785 |
| 977 | nmdc:mga0a205_57226_c1 | 3300050515 | Bacteria | 3765 |
| 978 | Ga0495601_0001775 | 3300053077 | Bacteria | 11951 |
| 979 | Ga0495601_0031216 | 3300053077 | Bacteria | 3311 |
| 980 | Ga0495601_0139521 | 3300053077 | Bacteria | 1581 |
| 981 | Ga0495601_0440666 | 3300053077 | Bacteria | 843 |
| 982 | Ga0495612_0026415 | 3300053078 | Bacteria | 2333 |
| 983 | Ga0495612_0039803 | 3300053078 | Bacteria | 1913 |
| 984 | Ga0495612_0141308 | 3300053078 | Bacteria | 1044 |
| 985 | Ga0495612_0244731 | 3300053078 | Bacteria | 797 |
| 986 | Ga0495612_0414061 | 3300053078 | Bacteria | 613 |
| 987 | Ga0495595_0000411 | 3300053084 | Bacteria | 16271 |
| 988 | Ga0495595_0005457 | 3300053084 | Bacteria | 5148 |
| 989 | Ga0495595_0007476 | 3300053084 | Bacteria | 4474 |
| 990 | Ga0495595_0340782 | 3300053084 | Bacteria | 756 |
| 991 | Ga0495595_0635307 | 3300053084 | Bacteria | 546 |
| 992 | Ga0495619_0030461 | 3300053085 | Bacteria | 3493 |
| 993 | Ga0495619_0037658 | 3300053085 | Bacteria | 3153 |
| 994 | Ga0495619_0071500 | 3300053085 | Bacteria | 2322 |
| 995 | Ga0495619_0072365 | 3300053085 | Bacteria | 2309 |
| 996 | Ga0495619_0140481 | 3300053085 | Bacteria | 1663 |
| 997 | Ga0495619_0200503 | 3300053085 | Bacteria | 1381 |
| 998 | Ga0495619_0253765 | 3300053085 | Bacteria | 1219 |
| 999 | Ga0501082_1260829 | 3300060353 | Bacteria | 646 |
| 1000 | Ga0466962_0101005 | 3300061719 | Bacteria | 1385 |
| 1001 | Ga0466962_0208872 | 3300061719 | Bacteria | 955 |
| 1002 | Ga0530510_0561862 | 3300061734 | Bacteria | 867 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025925 | Ga0207650_10567148 | Ga0207650_105671482 | 109 |
| 2 | 3300044684 | Ga0466966_0363822 | Ga0466966_0363822_482_841 | 114 |
| 3 | 3300044658 | Ga0466972_0056538 | Ga0466972_0056538_348_758 | 119 |
| 4 | 3300046533 | Ga0495640_0405067 | Ga0495640_0405067_448_825 | 119 |
| 5 | 3300048917 | Ga0496114_1382866 | Ga0496114_1382866_35_463 | 119 |
| 6 | 3300049592 | Ga0501076_0102642 | Ga0501076_0102642_149_526 | 119 |
| 7 | 3300049593 | Ga0501077_1050332 | Ga0501077_1050332_17_394 | 119 |
| 8 | 3300049741 | Ga0501079_0291713 | Ga0501079_0291713_381_758 | 119 |
| 9 | 3300049743 | Ga0501081_0222502 | Ga0501081_0222502_861_1238 | 119 |
| 10 | 3300060353 | Ga0501082_1260829 | Ga0501082_1260829_258_635 | 119 |
| 11 | 3300005937 | Ga0081455_10000262 | Ga0081455_1000026225 | 120 |
| 12 | 3300030760 | Ga0265762_1020801 | Ga0265762_10208012 | 121 |
| 13 | 3300046683 | Ga0495658_0616450 | Ga0495658_0616450_130_540 | 121 |
| 14 | 3300005355 | Ga0070671_101375458 | Ga0070671_1013754581 | 123 |
| 15 | 3300005548 | Ga0070665_100410976 | Ga0070665_1004109762 | 123 |
| 16 | 3300005618 | Ga0068864_100434046 | Ga0068864_1004340462 | 123 |
| 17 | 3300005841 | Ga0068863_100022217 | Ga0068863_1000222178 | 123 |
| 18 | 3300009177 | Ga0105248_10167208 | Ga0105248_101672086 | 123 |
| 19 | 3300009545 | Ga0105237_10581341 | Ga0105237_105813412 | 123 |
| 20 | 3300014325 | Ga0163163_10657420 | Ga0163163_106574202 | 123 |
| 21 | 3300014745 | Ga0157377_11146061 | Ga0157377_111460611 | 123 |
| 22 | 3300025941 | Ga0207711_10211113 | Ga0207711_102111134 | 123 |
| 23 | 3300026088 | Ga0207641_10034914 | Ga0207641_100349147 | 123 |
| 24 | 3300026095 | Ga0207676_10363296 | Ga0207676_103632963 | 123 |
| 25 | 3300028379 | Ga0268266_10130904 | Ga0268266_101309043 | 123 |
| 26 | 3300046492 | Ga0495585_0403769 | Ga0495585_0403769_98_484 | 123 |
| 27 | 3300048907 | Ga0496104_0129027 | Ga0496104_0129027_1214_1615 | 123 |
| 28 | 3300048908 | Ga0496105_0366172 | Ga0496105_0366172_484_885 | 123 |
| 29 | 3300048915 | Ga0496112_0272233 | Ga0496112_0272233_1142_1543 | 123 |
| 30 | 3300048915 | Ga0496112_0428303 | Ga0496112_0428303_174_575 | 123 |
| 31 | 3300048916 | Ga0496113_0083015 | Ga0496113_0083015_722_1123 | 123 |
| 32 | 3300005333 | Ga0070677_10211359 | Ga0070677_102113591 | 124 |
| 33 | 3300009098 | Ga0105245_10097796 | Ga0105245_100977961 | 124 |
| 34 | 3300025909 | Ga0207705_10010346 | Ga0207705_1001034610 | 124 |
| 35 | 3300044694 | Ga0466963_0010418 | Ga0466963_0010418_4708_5106 | 124 |
| 36 | 3300044719 | Ga0466971_0020889 | Ga0466971_0020889_1637_2035 | 124 |
| 37 | 3300044842 | Ga0466957_0158693 | Ga0466957_0158693_645_1043 | 124 |
| 38 | 3300045836 | Ga0466958_0107329 | Ga0466958_0107329_901_1299 | 124 |
| 39 | 3300045976 | Ga0466967_0120753 | Ga0466967_0120753_1594_1992 | 124 |
| 40 | 3300046557 | Ga0495622_0050337 | Ga0495622_0050337_808_1233 | 124 |
| 41 | iso_pu_bacteria | 2891326441 | 2891331554 | 124 |
| 42 | 3300009545 | Ga0105237_11286717 | Ga0105237_112867172 | 125 |
| 43 | 3300026078 | Ga0207702_11545221 | Ga0207702_115452212 | 125 |
| 44 | iso_pu_bacteria | 2728369276 | 2729906704 | 125 |
| 45 | 3300031852 | Ga0307410_10067471 | Ga0307410_100674714 | 126 |
| 46 | 3300031889 | Ga0326468_10008292 | Ga0326468_100082922 | 126 |
| 47 | 3300031901 | Ga0307406_10914039 | Ga0307406_109140392 | 126 |
| 48 | 3300031903 | Ga0307407_10625259 | Ga0307407_106252591 | 126 |
| 49 | 3300031995 | Ga0307409_100080150 | Ga0307409_1000801502 | 126 |
| 50 | 3300041460 | Ga0451802_0252721 | Ga0451802_0252721_274_678 | 126 |
| 51 | 3300042016 | Ga0439463_164444 | Ga0439463_164444_72_467 | 126 |
| 52 | 3300042157 | Ga0439458_0161692 | Ga0439458_0161692_23_418 | 126 |
| 53 | 3300042438 | Ga0439459_0085020 | Ga0439459_0085020_142_537 | 126 |
| 54 | 3300046684 | Ga0495669_0002047 | Ga0495669_0002047_3887_4306 | 126 |
| 55 | iso_pu_bacteria | 2795385470 | 2795781386 | 126 |
| 56 | 3300005435 | Ga0070714_100000182 | Ga0070714_1000001821 | 128 |
| 57 | 3300005436 | Ga0070713_100187917 | Ga0070713_1001879172 | 128 |
| 58 | 3300005467 | Ga0070706_100428562 | Ga0070706_1004285622 | 128 |
| 59 | 3300005718 | Ga0068866_10655703 | Ga0068866_106557031 | 128 |
| 60 | 3300005937 | Ga0081455_10000126 | Ga0081455_1000012617 | 128 |
| 61 | 3300005937 | Ga0081455_10041473 | Ga0081455_100414732 | 128 |
| 62 | 3300005983 | Ga0081540_1020980 | Ga0081540_10209802 | 128 |
| 63 | 3300006028 | Ga0070717_10031631 | Ga0070717_100316312 | 128 |
| 64 | 3300006028 | Ga0070717_10613218 | Ga0070717_106132182 | 128 |
| 65 | 3300025906 | Ga0207699_11170277 | Ga0207699_111702772 | 128 |
| 66 | 3300025910 | Ga0207684_10467051 | Ga0207684_104670512 | 128 |
| 67 | 3300025915 | Ga0207693_10997688 | Ga0207693_109976882 | 128 |
| 68 | 3300025928 | Ga0207700_10032403 | Ga0207700_100324032 | 128 |
| 69 | 3300025928 | Ga0207700_10458819 | Ga0207700_104588192 | 128 |
| 70 | 3300025928 | Ga0207700_11876521 | Ga0207700_118765211 | 128 |
| 71 | 3300025929 | Ga0207664_10046972 | Ga0207664_100469725 | 128 |
| 72 | 3300025929 | Ga0207664_10732425 | Ga0207664_107324252 | 128 |
| 73 | 3300026116 | Ga0207674_10394881 | Ga0207674_103948811 | 128 |
| 74 | 3300033179 | Ga0307507_10009639 | Ga0307507_100096393 | 128 |
| 75 | 3300033180 | Ga0307510_10130120 | Ga0307510_101301201 | 128 |
| 76 | 3300044684 | Ga0466966_0117809 | Ga0466966_0117809_671_1078 | 128 |
| 77 | 3300044693 | Ga0466961_0050345 | Ga0466961_0050345_2134_2541 | 128 |
| 78 | 3300045049 | Ga0466959_0034661 | Ga0466959_0034661_436_843 | 128 |
| 79 | 3300045976 | Ga0466967_0045499 | Ga0466967_0045499_1387_1791 | 128 |
| 80 | 3300045976 | Ga0466967_0742497 | Ga0466967_0742497_472_873 | 128 |
| 81 | 3300046809 | Ga0495600_0833804 | Ga0495600_0833804_11_412 | 128 |
| 82 | 3300005435 | Ga0070714_101489855 | Ga0070714_1014898551 | 129 |
| 83 | 3300013105 | Ga0157369_12577353 | Ga0157369_125773531 | 129 |
| 84 | 3300025929 | Ga0207664_11118270 | Ga0207664_111182702 | 129 |
| 85 | 3300041512 | Ga0451853_2247606 | Ga0451853_2247606_58_462 | 129 |
| 86 | 3300045976 | Ga0466967_0207505 | Ga0466967_0207505_668_1090 | 129 |
| 87 | 3300005327 | Ga0070658_10032694 | Ga0070658_100326943 | 130 |
| 88 | 3300014325 | Ga0163163_11715215 | Ga0163163_117152152 | 130 |
| 89 | 3300020082 | Ga0206353_11710499 | Ga0206353_117104992 | 130 |
| 90 | 3300025901 | Ga0207688_10463221 | Ga0207688_104632212 | 130 |
| 91 | 3300025919 | Ga0207657_10245597 | Ga0207657_102455972 | 130 |
| 92 | 3300044683 | Ga0466965_0723432 | Ga0466965_0723432_20_427 | 130 |
| 93 | 3300044684 | Ga0466966_0028253 | Ga0466966_0028253_1080_1502 | 130 |
| 94 | 3300044693 | Ga0466961_0209376 | Ga0466961_0209376_297_704 | 130 |
| 95 | 3300044706 | Ga0466964_0097028 | Ga0466964_0097028_11_427 | 130 |
| 96 | 3300044706 | Ga0466964_0308794 | Ga0466964_0308794_20_436 | 130 |
| 97 | 3300044719 | Ga0466971_0115010 | Ga0466971_0115010_107_523 | 130 |
| 98 | 3300044842 | Ga0466957_0031665 | Ga0466957_0031665_1564_1980 | 130 |
| 99 | 3300044901 | Ga0466960_0114236 | Ga0466960_0114236_771_1187 | 130 |
| 100 | 3300045049 | Ga0466959_0198051 | Ga0466959_0198051_613_1035 | 130 |
| 101 | 3300045836 | Ga0466958_0061918 | Ga0466958_0061918_718_1134 | 130 |
| 102 | 3300045976 | Ga0466967_0010205 | Ga0466967_0010205_3718_4134 | 130 |
| 103 | 3300045976 | Ga0466967_0077947 | Ga0466967_0077947_1209_1625 | 130 |
| 104 | 3300045976 | Ga0466967_0109228 | Ga0466967_0109228_1536_1952 | 130 |
| 105 | 3300045976 | Ga0466967_0199443 | Ga0466967_0199443_1173_1589 | 130 |
| 106 | 3300061719 | Ga0466962_0208872 | Ga0466962_0208872_157_573 | 130 |
| 107 | 3300061734 | Ga0530510_0561862 | Ga0530510_0561862_254_664 | 130 |
| 108 | iso_pu_bacteria | 2919446982 | 2919449282 | 130 |
| 109 | 3300012475 | Ga0157317_1033960 | Ga0157317_10339601 | 131 |
| 110 | 3300035172 | Ga0373955_0405635 | Ga0373955_0405635_200_673 | 131 |
| 111 | 3300035398 | Ga0316574_0057056 | Ga0316574_0057056_1305_1715 | 131 |
| 112 | 3300046689 | Ga0495613_0173570 | Ga0495613_0173570_405_908 | 131 |
| 113 | iso_pu_bacteria | 2818991472 | 2819742225 | 131 |
| 114 | 3300001989 | JGI24739J22299_10189010 | JGI24739J22299_101890101 | 132 |
| 115 | 3300002067 | JGI24735J21928_10056808 | JGI24735J21928_100568083 | 132 |
| 116 | 3300005327 | Ga0070658_10225084 | Ga0070658_102250842 | 132 |
| 117 | 3300014325 | Ga0163163_10024628 | Ga0163163_100246288 | 132 |
| 118 | 3300037418 | Ga0395900_0798179 | Ga0395900_0798179_13_435 | 132 |
| 119 | 3300038443 | Ga0395901_0115355 | Ga0395901_0115355_264_686 | 132 |
| 120 | 3300049575 | Ga0501039_0811278 | Ga0501039_0811278_62_484 | 132 |
| 121 | 3300049576 | Ga0501040_1229364 | Ga0501040_1229364_71_490 | 132 |
| 122 | 3300049588 | Ga0501072_0833119 | Ga0501072_0833119_42_464 | 132 |
| 123 | iso_pu_bacteria | 8056207758 | 8056210767 | 132 |
| 124 | 3300005330 | Ga0070690_101490551 | Ga0070690_1014905511 | 133 |
| 125 | 3300005337 | Ga0070682_100150776 | Ga0070682_1001507762 | 133 |
| 126 | 3300005345 | Ga0070692_10701504 | Ga0070692_107015041 | 133 |
| 127 | 3300005356 | Ga0070674_101378781 | Ga0070674_1013787811 | 133 |
| 128 | 3300005366 | Ga0070659_100000294 | Ga0070659_10000029445 | 133 |
| 129 | 3300005434 | Ga0070709_10116365 | Ga0070709_101163652 | 133 |
| 130 | 3300005435 | Ga0070714_100000011 | Ga0070714_10000001138 | 133 |
| 131 | 3300005435 | Ga0070714_100251763 | Ga0070714_1002517633 | 133 |
| 132 | 3300005436 | Ga0070713_102043879 | Ga0070713_1020438791 | 133 |
| 133 | 3300005445 | Ga0070708_100007516 | Ga0070708_1000075166 | 133 |
| 134 | 3300005459 | Ga0068867_101061770 | Ga0068867_1010617701 | 133 |
| 135 | 3300005466 | Ga0070685_10677311 | Ga0070685_106773112 | 133 |
| 136 | 3300005467 | Ga0070706_100032034 | Ga0070706_1000320345 | 133 |
| 137 | 3300005468 | Ga0070707_100006610 | Ga0070707_1000066105 | 133 |
| 138 | 3300005471 | Ga0070698_100002497 | Ga0070698_1000024977 | 133 |
| 139 | 3300005546 | Ga0070696_100852164 | Ga0070696_1008521641 | 133 |
| 140 | 3300005842 | Ga0068858_100656683 | Ga0068858_1006566832 | 133 |
| 141 | 3300005937 | Ga0081455_10002734 | Ga0081455_100027349 | 133 |
| 142 | 3300006028 | Ga0070717_10006245 | Ga0070717_100062456 | 133 |
| 143 | 3300006028 | Ga0070717_11031608 | Ga0070717_110316082 | 133 |
| 144 | 3300006173 | Ga0070716_100340965 | Ga0070716_1003409652 | 133 |
| 145 | 3300006871 | Ga0075434_100504867 | Ga0075434_1005048672 | 133 |
| 146 | 3300007076 | Ga0075435_101947684 | Ga0075435_1019476841 | 133 |
| 147 | 3300009098 | Ga0105245_10115944 | Ga0105245_101159443 | 133 |
| 148 | 3300009545 | Ga0105237_10895643 | Ga0105237_108956432 | 133 |
| 149 | 3300009545 | Ga0105237_11078751 | Ga0105237_110787511 | 133 |
| 150 | 3300009551 | Ga0105238_10969213 | Ga0105238_109692131 | 133 |
| 151 | 3300009553 | Ga0105249_11515264 | Ga0105249_115152641 | 133 |
| 152 | 3300013296 | Ga0157374_10698261 | Ga0157374_106982613 | 133 |
| 153 | 3300013296 | Ga0157374_11142788 | Ga0157374_111427882 | 133 |
| 154 | 3300013297 | Ga0157378_10053740 | Ga0157378_100537403 | 133 |
| 155 | 3300013308 | Ga0157375_10126714 | Ga0157375_101267142 | 133 |
| 156 | 3300013308 | Ga0157375_10986929 | Ga0157375_109869291 | 133 |
| 157 | 3300014325 | Ga0163163_10774635 | Ga0163163_107746352 | 133 |
| 158 | 3300014325 | Ga0163163_11484300 | Ga0163163_114843001 | 133 |
| 159 | 3300014969 | Ga0157376_10235371 | Ga0157376_102353712 | 133 |
| 160 | 3300014969 | Ga0157376_10338798 | Ga0157376_103387982 | 133 |
| 161 | 3300025321 | Ga0207656_10215984 | Ga0207656_102159842 | 133 |
| 162 | 3300025905 | Ga0207685_10087272 | Ga0207685_100872722 | 133 |
| 163 | 3300025906 | Ga0207699_11221291 | Ga0207699_112212912 | 133 |
| 164 | 3300025910 | Ga0207684_10013354 | Ga0207684_100133544 | 133 |
| 165 | 3300025913 | Ga0207695_10292433 | Ga0207695_102924332 | 133 |
| 166 | 3300025914 | Ga0207671_10901874 | Ga0207671_109018742 | 133 |
| 167 | 3300025916 | Ga0207663_10251938 | Ga0207663_102519382 | 133 |
| 168 | 3300025922 | Ga0207646_10005930 | Ga0207646_1000593012 | 133 |
| 169 | 3300025929 | Ga0207664_10000001 | Ga0207664_10000001472 | 133 |
| 170 | 3300025929 | Ga0207664_10365069 | Ga0207664_103650692 | 133 |
| 171 | 3300025932 | Ga0207690_10001825 | Ga0207690_1000182512 | 133 |
| 172 | 3300025961 | Ga0207712_11394972 | Ga0207712_113949721 | 133 |
| 173 | 3300026089 | Ga0207648_10427487 | Ga0207648_104274871 | 133 |
| 174 | 3300026121 | Ga0207683_10276332 | Ga0207683_102763324 | 133 |
| 175 | 3300028573 | Ga0265334_10010253 | Ga0265334_100102534 | 133 |
| 176 | 3300031691 | Ga0316579_10000498 | Ga0316579_100004984 | 133 |
| 177 | 3300041452 | Ga0451793_0403868 | Ga0451793_0403868_156_584 | 133 |
| 178 | 3300041460 | Ga0451802_0659795 | Ga0451802_0659795_90_515 | 133 |
| 179 | 3300044656 | Ga0466969_0195770 | Ga0466969_0195770_416_850 | 133 |
| 180 | 3300044656 | Ga0466969_0471313 | Ga0466969_0471313_69_494 | 133 |
| 181 | 3300044693 | Ga0466961_0188603 | Ga0466961_0188603_841_1257 | 133 |
| 182 | 3300044694 | Ga0466963_0194720 | Ga0466963_0194720_751_1167 | 133 |
| 183 | 3300044765 | Ga0466970_0074630 | Ga0466970_0074630_267_692 | 133 |
| 184 | 3300045976 | Ga0466967_0081934 | Ga0466967_0081934_1465_1890 | 133 |
| 185 | 3300045976 | Ga0466967_0323759 | Ga0466967_0323759_446_871 | 133 |
| 186 | 3300046461 | Ga0495641_0063786 | Ga0495641_0063786_530_958 | 133 |
| 187 | 3300046463 | Ga0495653_0500902 | Ga0495653_0500902_277_702 | 133 |
| 188 | 3300046473 | Ga0495582_0633239 | Ga0495582_0633239_53_478 | 133 |
| 189 | 3300046511 | Ga0495608_0112239 | Ga0495608_0112239_769_1194 | 133 |
| 190 | 3300046543 | Ga0495645_0536564 | Ga0495645_0536564_38_466 | 133 |
| 191 | 3300046681 | Ga0495647_0080666 | Ga0495647_0080666_53_481 | 133 |
| 192 | 3300046692 | Ga0495671_0497409 | Ga0495671_0497409_27_452 | 133 |
| 193 | 3300046694 | Ga0495649_0134897 | Ga0495649_0134897_857_1282 | 133 |
| 194 | 3300047315 | Ga0495581_0256013 | Ga0495581_0256013_324_749 | 133 |
| 195 | 3300047322 | Ga0495680_0149388 | Ga0495680_0149388_411_836 | 133 |
| 196 | 3300048088 | Ga0495602_0917701 | Ga0495602_0917701_110_535 | 133 |
| 197 | 3300048904 | Ga0496101_0663850 | Ga0496101_0663850_339_767 | 133 |
| 198 | 3300048904 | Ga0496101_1353754 | Ga0496101_1353754_101_526 | 133 |
| 199 | 3300048905 | Ga0496102_0223491 | Ga0496102_0223491_792_1220 | 133 |
| 200 | 3300048905 | Ga0496102_0394250 | Ga0496102_0394250_156_581 | 133 |
| 201 | 3300048905 | Ga0496102_1123997 | Ga0496102_1123997_146_571 | 133 |
| 202 | 3300048906 | Ga0496103_0400992 | Ga0496103_0400992_141_566 | 133 |
| 203 | 3300048907 | Ga0496104_0005668 | Ga0496104_0005668_7914_8342 | 133 |
| 204 | 3300048911 | Ga0496108_0040237 | Ga0496108_0040237_264_692 | 133 |
| 205 | 3300048911 | Ga0496108_0353118 | Ga0496108_0353118_101_526 | 133 |
| 206 | 3300048912 | Ga0496109_0004986 | Ga0496109_0004986_3819_4247 | 133 |
| 207 | 3300048912 | Ga0496109_1709205 | Ga0496109_1709205_112_537 | 133 |
| 208 | 3300048913 | Ga0496110_0021499 | Ga0496110_0021499_2053_2481 | 133 |
| 209 | 3300048914 | Ga0496111_0003235 | Ga0496111_0003235_3111_3539 | 133 |
| 210 | 3300048916 | Ga0496113_0052376 | Ga0496113_0052376_688_1116 | 133 |
| 211 | 3300048917 | Ga0496114_0131714 | Ga0496114_0131714_1274_1699 | 133 |
| 212 | 3300048917 | Ga0496114_0286983 | Ga0496114_0286983_521_946 | 133 |
| 213 | 3300048917 | Ga0496114_0290306 | Ga0496114_0290306_952_1380 | 133 |
| 214 | 3300048917 | Ga0496114_0438910 | Ga0496114_0438910_626_1051 | 133 |
| 215 | 3300048917 | Ga0496114_0731256 | Ga0496114_0731256_349_774 | 133 |
| 216 | 3300049584 | Ga0501068_0135885 | Ga0501068_0135885_586_1014 | 133 |
| 217 | 3300049593 | Ga0501077_0484835 | Ga0501077_0484835_340_765 | 133 |
| 218 | 3300053084 | Ga0495595_0635307 | Ga0495595_0635307_22_450 | 133 |
| 219 | iso_pu_bacteria | 2675903060 | 2676489675 | 133 |
| 220 | iso_pu_bacteria | 2856741275 | 2856746097 | 133 |
| 221 | iso_pu_bacteria | 2873314349 | 2873314734 | 133 |
| 222 | iso_pu_bacteria | 2891395885 | 2891400146 | 133 |
| 223 | iso_pu_bacteria | 2891554331 | 2891559908 | 133 |
| 224 | iso_pu_bacteria | 2891562705 | 2891567307 | 133 |
| 225 | iso_pu_bacteria | 2895427314 | 2895433000 | 133 |
| 226 | iso_pu_bacteria | 8055172936 | 8055178716 | 133 |
| 227 | 2209111006 | 2214554149 | 2213601212 | 134 |
| 228 | 3300002459 | JGI24751J29686_10126986 | JGI24751J29686_101269861 | 134 |
| 229 | 3300003322 | rootL2_10142042 | rootL2_1014204212 | 134 |
| 230 | 3300005327 | Ga0070658_10044055 | Ga0070658_100440552 | 134 |
| 231 | 3300005327 | Ga0070658_10253449 | Ga0070658_102534491 | 134 |
| 232 | 3300005328 | Ga0070676_10092694 | Ga0070676_100926942 | 134 |
| 233 | 3300005329 | Ga0070683_101018472 | Ga0070683_1010184722 | 134 |
| 234 | 3300005331 | Ga0070670_100007475 | Ga0070670_1000074756 | 134 |
| 235 | 3300005334 | Ga0068869_100726819 | Ga0068869_1007268191 | 134 |
| 236 | 3300005336 | Ga0070680_100004899 | Ga0070680_10000489910 | 134 |
| 237 | 3300005337 | Ga0070682_100009483 | Ga0070682_1000094833 | 134 |
| 238 | 3300005337 | Ga0070682_100493654 | Ga0070682_1004936542 | 134 |
| 239 | 3300005338 | Ga0068868_100009185 | Ga0068868_1000091857 | 134 |
| 240 | 3300005339 | Ga0070660_100059595 | Ga0070660_1000595951 | 134 |
| 241 | 3300005340 | Ga0070689_100219489 | Ga0070689_1002194893 | 134 |
| 242 | 3300005340 | Ga0070689_101853195 | Ga0070689_1018531951 | 134 |
| 243 | 3300005341 | Ga0070691_10011813 | Ga0070691_100118132 | 134 |
| 244 | 3300005343 | Ga0070687_100346910 | Ga0070687_1003469102 | 134 |
| 245 | 3300005344 | Ga0070661_100212484 | Ga0070661_1002124842 | 134 |
| 246 | 3300005345 | Ga0070692_10034240 | Ga0070692_100342402 | 134 |
| 247 | 3300005353 | Ga0070669_100878517 | Ga0070669_1008785171 | 134 |
| 248 | 3300005354 | Ga0070675_100050464 | Ga0070675_1000504643 | 134 |
| 249 | 3300005355 | Ga0070671_100015144 | Ga0070671_1000151443 | 134 |
| 250 | 3300005355 | Ga0070671_100097248 | Ga0070671_1000972485 | 134 |
| 251 | 3300005355 | Ga0070671_100372804 | Ga0070671_1003728041 | 134 |
| 252 | 3300005364 | Ga0070673_100078474 | Ga0070673_1000784742 | 134 |
| 253 | 3300005366 | Ga0070659_100054304 | Ga0070659_1000543042 | 134 |
| 254 | 3300005366 | Ga0070659_100820742 | Ga0070659_1008207422 | 134 |
| 255 | 3300005434 | Ga0070709_10000253 | Ga0070709_1000025325 | 134 |
| 256 | 3300005434 | Ga0070709_10000434 | Ga0070709_100004342 | 134 |
| 257 | 3300005434 | Ga0070709_10025318 | Ga0070709_100253186 | 134 |
| 258 | 3300005434 | Ga0070709_10054857 | Ga0070709_100548573 | 134 |
| 259 | 3300005434 | Ga0070709_10079002 | Ga0070709_100790022 | 134 |
| 260 | 3300005435 | Ga0070714_100004885 | Ga0070714_10000488510 | 134 |
| 261 | 3300005435 | Ga0070714_100008057 | Ga0070714_1000080576 | 134 |
| 262 | 3300005435 | Ga0070714_100242249 | Ga0070714_1002422492 | 134 |
| 263 | 3300005435 | Ga0070714_100262839 | Ga0070714_1002628392 | 134 |
| 264 | 3300005435 | Ga0070714_100343593 | Ga0070714_1003435932 | 134 |
| 265 | 3300005435 | Ga0070714_100407355 | Ga0070714_1004073553 | 134 |
| 266 | 3300005435 | Ga0070714_100483828 | Ga0070714_1004838282 | 134 |
| 267 | 3300005435 | Ga0070714_100513028 | Ga0070714_1005130281 | 134 |
| 268 | 3300005435 | Ga0070714_100598772 | Ga0070714_1005987722 | 134 |
| 269 | 3300005435 | Ga0070714_100685190 | Ga0070714_1006851902 | 134 |
| 270 | 3300005436 | Ga0070713_100018743 | Ga0070713_1000187433 | 134 |
| 271 | 3300005436 | Ga0070713_100020537 | Ga0070713_1000205373 | 134 |
| 272 | 3300005436 | Ga0070713_100058657 | Ga0070713_1000586574 | 134 |
| 273 | 3300005436 | Ga0070713_100064993 | Ga0070713_1000649934 | 134 |
| 274 | 3300005436 | Ga0070713_100096149 | Ga0070713_1000961493 | 134 |
| 275 | 3300005436 | Ga0070713_100105557 | Ga0070713_1001055573 | 134 |
| 276 | 3300005436 | Ga0070713_100117350 | Ga0070713_1001173503 | 134 |
| 277 | 3300005436 | Ga0070713_100149306 | Ga0070713_1001493062 | 134 |
| 278 | 3300005436 | Ga0070713_100253054 | Ga0070713_1002530542 | 134 |
| 279 | 3300005436 | Ga0070713_100354450 | Ga0070713_1003544502 | 134 |
| 280 | 3300005436 | Ga0070713_100401363 | Ga0070713_1004013632 | 134 |
| 281 | 3300005436 | Ga0070713_100414938 | Ga0070713_1004149382 | 134 |
| 282 | 3300005436 | Ga0070713_100585911 | Ga0070713_1005859112 | 134 |
| 283 | 3300005436 | Ga0070713_100783133 | Ga0070713_1007831332 | 134 |
| 284 | 3300005437 | Ga0070710_10000086 | Ga0070710_1000008614 | 134 |
| 285 | 3300005437 | Ga0070710_10004266 | Ga0070710_100042662 | 134 |
| 286 | 3300005437 | Ga0070710_10010762 | Ga0070710_100107621 | 134 |
| 287 | 3300005437 | Ga0070710_10027908 | Ga0070710_100279082 | 134 |
| 288 | 3300005437 | Ga0070710_10060201 | Ga0070710_100602015 | 134 |
| 289 | 3300005438 | Ga0070701_10107135 | Ga0070701_101071354 | 134 |
| 290 | 3300005439 | Ga0070711_100004357 | Ga0070711_1000043576 | 134 |
| 291 | 3300005439 | Ga0070711_100020955 | Ga0070711_1000209554 | 134 |
| 292 | 3300005439 | Ga0070711_100094409 | Ga0070711_1000944092 | 134 |
| 293 | 3300005439 | Ga0070711_100122193 | Ga0070711_1001221932 | 134 |
| 294 | 3300005439 | Ga0070711_100402771 | Ga0070711_1004027712 | 134 |
| 295 | 3300005441 | Ga0070700_100030557 | Ga0070700_1000305573 | 134 |
| 296 | 3300005445 | Ga0070708_100006459 | Ga0070708_1000064596 | 134 |
| 297 | 3300005445 | Ga0070708_100026768 | Ga0070708_1000267687 | 134 |
| 298 | 3300005445 | Ga0070708_100274818 | Ga0070708_1002748182 | 134 |
| 299 | 3300005445 | Ga0070708_100290409 | Ga0070708_1002904092 | 134 |
| 300 | 3300005445 | Ga0070708_100407327 | Ga0070708_1004073271 | 134 |
| 301 | 3300005456 | Ga0070678_100013171 | Ga0070678_1000131715 | 134 |
| 302 | 3300005457 | Ga0070662_101084040 | Ga0070662_1010840402 | 134 |
| 303 | 3300005458 | Ga0070681_10025428 | Ga0070681_100254282 | 134 |
| 304 | 3300005458 | Ga0070681_10091686 | Ga0070681_100916865 | 134 |
| 305 | 3300005458 | Ga0070681_10276603 | Ga0070681_102766032 | 134 |
| 306 | 3300005458 | Ga0070681_11031941 | Ga0070681_110319412 | 134 |
| 307 | 3300005466 | Ga0070685_10241303 | Ga0070685_102413032 | 134 |
| 308 | 3300005467 | Ga0070706_100007714 | Ga0070706_1000077142 | 134 |
| 309 | 3300005467 | Ga0070706_100020152 | Ga0070706_10002015210 | 134 |
| 310 | 3300005467 | Ga0070706_100048682 | Ga0070706_1000486824 | 134 |
| 311 | 3300005467 | Ga0070706_100066882 | Ga0070706_1000668823 | 134 |
| 312 | 3300005467 | Ga0070706_100067898 | Ga0070706_1000678985 | 134 |
| 313 | 3300005467 | Ga0070706_100111055 | Ga0070706_1001110553 | 134 |
| 314 | 3300005467 | Ga0070706_100142874 | Ga0070706_1001428742 | 134 |
| 315 | 3300005467 | Ga0070706_100269595 | Ga0070706_1002695952 | 134 |
| 316 | 3300005467 | Ga0070706_100270657 | Ga0070706_1002706571 | 134 |
| 317 | 3300005467 | Ga0070706_100287155 | Ga0070706_1002871551 | 134 |
| 318 | 3300005468 | Ga0070707_100001773 | Ga0070707_10000177323 | 134 |
| 319 | 3300005468 | Ga0070707_100014179 | Ga0070707_1000141792 | 134 |
| 320 | 3300005468 | Ga0070707_100031061 | Ga0070707_1000310613 | 134 |
| 321 | 3300005468 | Ga0070707_100050076 | Ga0070707_1000500763 | 134 |
| 322 | 3300005468 | Ga0070707_100227922 | Ga0070707_1002279222 | 134 |
| 323 | 3300005468 | Ga0070707_100300648 | Ga0070707_1003006482 | 134 |
| 324 | 3300005468 | Ga0070707_100392109 | Ga0070707_1003921094 | 134 |
| 325 | 3300005468 | Ga0070707_101383604 | Ga0070707_1013836042 | 134 |
| 326 | 3300005468 | Ga0070707_101617993 | Ga0070707_1016179931 | 134 |
| 327 | 3300005471 | Ga0070698_100000667 | Ga0070698_10000066725 | 134 |
| 328 | 3300005471 | Ga0070698_100001429 | Ga0070698_1000014298 | 134 |
| 329 | 3300005471 | Ga0070698_100002054 | Ga0070698_10000205415 | 134 |
| 330 | 3300005471 | Ga0070698_100035947 | Ga0070698_1000359474 | 134 |
| 331 | 3300005471 | Ga0070698_100140483 | Ga0070698_1001404833 | 134 |
| 332 | 3300005471 | Ga0070698_100227011 | Ga0070698_1002270112 | 134 |
| 333 | 3300005471 | Ga0070698_100248998 | Ga0070698_1002489982 | 134 |
| 334 | 3300005471 | Ga0070698_101202636 | Ga0070698_1012026361 | 134 |
| 335 | 3300005518 | Ga0070699_100274833 | Ga0070699_1002748334 | 134 |
| 336 | 3300005518 | Ga0070699_100535832 | Ga0070699_1005358322 | 134 |
| 337 | 3300005530 | Ga0070679_100014886 | Ga0070679_1000148863 | 134 |
| 338 | 3300005530 | Ga0070679_101016526 | Ga0070679_1010165261 | 134 |
| 339 | 3300005535 | Ga0070684_100260300 | Ga0070684_1002603002 | 134 |
| 340 | 3300005536 | Ga0070697_100083774 | Ga0070697_1000837745 | 134 |
| 341 | 3300005536 | Ga0070697_100278305 | Ga0070697_1002783052 | 134 |
| 342 | 3300005544 | Ga0070686_100215457 | Ga0070686_1002154572 | 134 |
| 343 | 3300005544 | Ga0070686_100278301 | Ga0070686_1002783012 | 134 |
| 344 | 3300005545 | Ga0070695_100073990 | Ga0070695_1000739906 | 134 |
| 345 | 3300005546 | Ga0070696_101556981 | Ga0070696_1015569811 | 134 |
| 346 | 3300005547 | Ga0070693_100003391 | Ga0070693_1000033917 | 134 |
| 347 | 3300005547 | Ga0070693_100180665 | Ga0070693_1001806652 | 134 |
| 348 | 3300005548 | Ga0070665_100225339 | Ga0070665_1002253394 | 134 |
| 349 | 3300005548 | Ga0070665_100403097 | Ga0070665_1004030972 | 134 |
| 350 | 3300005548 | Ga0070665_100416654 | Ga0070665_1004166542 | 134 |
| 351 | 3300005548 | Ga0070665_100785593 | Ga0070665_1007855931 | 134 |
| 352 | 3300005578 | Ga0068854_100104028 | Ga0068854_1001040282 | 134 |
| 353 | 3300005614 | Ga0068856_100008148 | Ga0068856_1000081487 | 134 |
| 354 | 3300005614 | Ga0068856_100049636 | Ga0068856_1000496363 | 134 |
| 355 | 3300005614 | Ga0068856_100186630 | Ga0068856_1001866302 | 134 |
| 356 | 3300005614 | Ga0068856_100408967 | Ga0068856_1004089671 | 134 |
| 357 | 3300005614 | Ga0068856_101064683 | Ga0068856_1010646832 | 134 |
| 358 | 3300005614 | Ga0068856_101425191 | Ga0068856_1014251912 | 134 |
| 359 | 3300005615 | Ga0070702_100032698 | Ga0070702_1000326982 | 134 |
| 360 | 3300005616 | Ga0068852_100010858 | Ga0068852_1000108586 | 134 |
| 361 | 3300005616 | Ga0068852_102027209 | Ga0068852_1020272091 | 134 |
| 362 | 3300005617 | Ga0068859_100183303 | Ga0068859_1001833036 | 134 |
| 363 | 3300005618 | Ga0068864_100036758 | Ga0068864_1000367586 | 134 |
| 364 | 3300005618 | Ga0068864_100743937 | Ga0068864_1007439372 | 134 |
| 365 | 3300005718 | Ga0068866_10371841 | Ga0068866_103718412 | 134 |
| 366 | 3300005719 | Ga0068861_101612378 | Ga0068861_1016123781 | 134 |
| 367 | 3300005834 | Ga0068851_10038963 | Ga0068851_100389632 | 134 |
| 368 | 3300005840 | Ga0068870_10000616 | Ga0068870_1000061615 | 134 |
| 369 | 3300005841 | Ga0068863_100005041 | Ga0068863_10000504115 | 134 |
| 370 | 3300005842 | Ga0068858_100042199 | Ga0068858_1000421993 | 134 |
| 371 | 3300005844 | Ga0068862_102116551 | Ga0068862_1021165511 | 134 |
| 372 | 3300005937 | Ga0081455_10078282 | Ga0081455_100782825 | 134 |
| 373 | 3300005937 | Ga0081455_10688392 | Ga0081455_106883921 | 134 |
| 374 | 3300005983 | Ga0081540_1000101 | Ga0081540_100010182 | 134 |
| 375 | 3300005983 | Ga0081540_1000843 | Ga0081540_100084312 | 134 |
| 376 | 3300006028 | Ga0070717_10022373 | Ga0070717_100223739 | 134 |
| 377 | 3300006028 | Ga0070717_10073876 | Ga0070717_100738765 | 134 |
| 378 | 3300006028 | Ga0070717_10175280 | Ga0070717_101752802 | 134 |
| 379 | 3300006028 | Ga0070717_10202456 | Ga0070717_102024563 | 134 |
| 380 | 3300006028 | Ga0070717_10367575 | Ga0070717_103675752 | 134 |
| 381 | 3300006028 | Ga0070717_10436855 | Ga0070717_104368552 | 134 |
| 382 | 3300006028 | Ga0070717_10609427 | Ga0070717_106094272 | 134 |
| 383 | 3300006028 | Ga0070717_10843042 | Ga0070717_108430422 | 134 |
| 384 | 3300006028 | Ga0070717_10845137 | Ga0070717_108451372 | 134 |
| 385 | 3300006028 | Ga0070717_10957675 | Ga0070717_109576752 | 134 |
| 386 | 3300006028 | Ga0070717_11522283 | Ga0070717_115222832 | 134 |
| 387 | 3300006048 | Ga0075363_100780997 | Ga0075363_1007809971 | 134 |
| 388 | 3300006173 | Ga0070716_100000949 | Ga0070716_1000009494 | 134 |
| 389 | 3300006173 | Ga0070716_100010154 | Ga0070716_1000101544 | 134 |
| 390 | 3300006173 | Ga0070716_100028930 | Ga0070716_1000289304 | 134 |
| 391 | 3300006175 | Ga0070712_100000932 | Ga0070712_1000009322 | 134 |
| 392 | 3300006175 | Ga0070712_100001419 | Ga0070712_1000014199 | 134 |
| 393 | 3300006175 | Ga0070712_100029137 | Ga0070712_1000291373 | 134 |
| 394 | 3300006175 | Ga0070712_100057082 | Ga0070712_1000570822 | 134 |
| 395 | 3300006175 | Ga0070712_100108911 | Ga0070712_1001089113 | 134 |
| 396 | 3300006175 | Ga0070712_100170392 | Ga0070712_1001703922 | 134 |
| 397 | 3300006175 | Ga0070712_100288843 | Ga0070712_1002888432 | 134 |
| 398 | 3300006175 | Ga0070712_100391069 | Ga0070712_1003910692 | 134 |
| 399 | 3300006237 | Ga0097621_100006861 | Ga0097621_1000068612 | 134 |
| 400 | 3300006237 | Ga0097621_100106893 | Ga0097621_1001068935 | 134 |
| 401 | 3300006358 | Ga0068871_100822981 | Ga0068871_1008229812 | 134 |
| 402 | 3300006847 | Ga0075431_100317545 | Ga0075431_1003175452 | 134 |
| 403 | 3300006852 | Ga0075433_10005917 | Ga0075433_1000591712 | 134 |
| 404 | 3300006852 | Ga0075433_10144476 | Ga0075433_101444763 | 134 |
| 405 | 3300006852 | Ga0075433_10207675 | Ga0075433_102076753 | 134 |
| 406 | 3300006871 | Ga0075434_100017763 | Ga0075434_1000177637 | 134 |
| 407 | 3300006871 | Ga0075434_100029062 | Ga0075434_1000290626 | 134 |
| 408 | 3300006871 | Ga0075434_100032095 | Ga0075434_1000320956 | 134 |
| 409 | 3300006871 | Ga0075434_100190107 | Ga0075434_1001901072 | 134 |
| 410 | 3300006880 | Ga0075429_100031894 | Ga0075429_1000318946 | 134 |
| 411 | 3300006881 | Ga0068865_100123585 | Ga0068865_1001235853 | 134 |
| 412 | 3300006914 | Ga0075436_100007917 | Ga0075436_1000079177 | 134 |
| 413 | 3300006914 | Ga0075436_100047869 | Ga0075436_1000478694 | 134 |
| 414 | 3300006914 | Ga0075436_100051647 | Ga0075436_1000516473 | 134 |
| 415 | 3300006914 | Ga0075436_100085466 | Ga0075436_1000854663 | 134 |
| 416 | 3300006914 | Ga0075436_100086513 | Ga0075436_1000865133 | 134 |
| 417 | 3300006914 | Ga0075436_100868649 | Ga0075436_1008686491 | 134 |
| 418 | 3300006931 | Ga0097620_100183303 | Ga0097620_1001833036 | 134 |
| 419 | 3300007076 | Ga0075435_100020308 | Ga0075435_1000203088 | 134 |
| 420 | 3300007076 | Ga0075435_100095370 | Ga0075435_1000953703 | 134 |
| 421 | 3300007076 | Ga0075435_100098424 | Ga0075435_1000984244 | 134 |
| 422 | 3300007076 | Ga0075435_101505836 | Ga0075435_1015058362 | 134 |
| 423 | 3300007265 | Ga0099794_10049578 | Ga0099794_100495784 | 134 |
| 424 | 3300007265 | Ga0099794_10338708 | Ga0099794_103387082 | 134 |
| 425 | 3300009036 | Ga0105244_10384026 | Ga0105244_103840262 | 134 |
| 426 | 3300009093 | Ga0105240_10176563 | Ga0105240_101765636 | 134 |
| 427 | 3300009094 | Ga0111539_10251029 | Ga0111539_102510293 | 134 |
| 428 | 3300009094 | Ga0111539_10653180 | Ga0111539_106531802 | 134 |
| 429 | 3300009094 | Ga0111539_12470007 | Ga0111539_124700071 | 134 |
| 430 | 3300009098 | Ga0105245_10021492 | Ga0105245_100214921 | 134 |
| 431 | 3300009101 | Ga0105247_10011206 | Ga0105247_100112066 | 134 |
| 432 | 3300009147 | Ga0114129_10030888 | Ga0114129_100308884 | 134 |
| 433 | 3300009147 | Ga0114129_10066059 | Ga0114129_100660595 | 134 |
| 434 | 3300009148 | Ga0105243_12639048 | Ga0105243_126390481 | 134 |
| 435 | 3300009174 | Ga0105241_10030008 | Ga0105241_100300083 | 134 |
| 436 | 3300009174 | Ga0105241_11417065 | Ga0105241_114170652 | 134 |
| 437 | 3300009177 | Ga0105248_10084729 | Ga0105248_100847296 | 134 |
| 438 | 3300009177 | Ga0105248_11820443 | Ga0105248_118204431 | 134 |
| 439 | 3300009553 | Ga0105249_10202647 | Ga0105249_102026476 | 134 |
| 440 | 3300009553 | Ga0105249_10642107 | Ga0105249_106421073 | 134 |
| 441 | 3300010375 | Ga0105239_10794532 | Ga0105239_107945322 | 134 |
| 442 | 3300010375 | Ga0105239_11213939 | Ga0105239_112139392 | 134 |
| 443 | 3300011119 | Ga0105246_10008603 | Ga0105246_100086036 | 134 |
| 444 | 3300012503 | Ga0157313_1000372 | Ga0157313_10003722 | 134 |
| 445 | 3300012513 | Ga0157326_1037816 | Ga0157326_10378162 | 134 |
| 446 | 3300013102 | Ga0157371_10019524 | Ga0157371_100195243 | 134 |
| 447 | 3300013104 | Ga0157370_10264165 | Ga0157370_102641651 | 134 |
| 448 | 3300013104 | Ga0157370_11292721 | Ga0157370_112927211 | 134 |
| 449 | 3300013105 | Ga0157369_10001599 | Ga0157369_1000159924 | 134 |
| 450 | 3300013105 | Ga0157369_10014305 | Ga0157369_1001430510 | 134 |
| 451 | 3300013105 | Ga0157369_10042657 | Ga0157369_100426576 | 134 |
| 452 | 3300013296 | Ga0157374_10071283 | Ga0157374_100712836 | 134 |
| 453 | 3300013296 | Ga0157374_12757314 | Ga0157374_127573141 | 134 |
| 454 | 3300013307 | Ga0157372_10040844 | Ga0157372_100408448 | 134 |
| 455 | 3300013308 | Ga0157375_10042216 | Ga0157375_100422165 | 134 |
| 456 | 3300013308 | Ga0157375_11485342 | Ga0157375_114853422 | 134 |
| 457 | 3300014325 | Ga0163163_10126280 | Ga0163163_101262802 | 134 |
| 458 | 3300014497 | Ga0182008_10214915 | Ga0182008_102149152 | 134 |
| 459 | 3300014745 | Ga0157377_10014244 | Ga0157377_100142442 | 134 |
| 460 | 3300014968 | Ga0157379_10060646 | Ga0157379_100606466 | 134 |
| 461 | 3300014969 | Ga0157376_11044398 | Ga0157376_110443982 | 134 |
| 462 | 3300020069 | Ga0197907_10920250 | Ga0197907_109202502 | 134 |
| 463 | 3300020069 | Ga0197907_11222404 | Ga0197907_112224042 | 134 |
| 464 | 3300020070 | Ga0206356_11243439 | Ga0206356_112434391 | 134 |
| 465 | 3300020081 | Ga0206354_11131740 | Ga0206354_111317402 | 134 |
| 466 | 3300021377 | Ga0213874_10055042 | Ga0213874_100550423 | 134 |
| 467 | 3300021388 | Ga0213875_10000362 | Ga0213875_1000036227 | 134 |
| 468 | 3300021388 | Ga0213875_10052768 | Ga0213875_100527685 | 134 |
| 469 | 3300021388 | Ga0213875_10128443 | Ga0213875_101284433 | 134 |
| 470 | 3300022467 | Ga0224712_10070335 | Ga0224712_100703352 | 134 |
| 471 | 3300022467 | Ga0224712_10155038 | Ga0224712_101550381 | 134 |
| 472 | 3300022732 | Ga0224569_112527 | Ga0224569_1125271 | 134 |
| 473 | 3300024225 | Ga0224572_1000726 | Ga0224572_10007262 | 134 |
| 474 | 3300025321 | Ga0207656_10053913 | Ga0207656_100539132 | 134 |
| 475 | 3300025898 | Ga0207692_10000423 | Ga0207692_100004233 | 134 |
| 476 | 3300025898 | Ga0207692_10007321 | Ga0207692_100073212 | 134 |
| 477 | 3300025898 | Ga0207692_10010821 | Ga0207692_100108212 | 134 |
| 478 | 3300025898 | Ga0207692_10061574 | Ga0207692_100615742 | 134 |
| 479 | 3300025901 | Ga0207688_10003789 | Ga0207688_100037896 | 134 |
| 480 | 3300025903 | Ga0207680_10217205 | Ga0207680_102172052 | 134 |
| 481 | 3300025905 | Ga0207685_10003834 | Ga0207685_100038343 | 134 |
| 482 | 3300025905 | Ga0207685_10016177 | Ga0207685_100161772 | 134 |
| 483 | 3300025905 | Ga0207685_10104796 | Ga0207685_101047963 | 134 |
| 484 | 3300025906 | Ga0207699_10023198 | Ga0207699_100231983 | 134 |
| 485 | 3300025906 | Ga0207699_10024559 | Ga0207699_100245592 | 134 |
| 486 | 3300025906 | Ga0207699_10078888 | Ga0207699_100788884 | 134 |
| 487 | 3300025906 | Ga0207699_10268236 | Ga0207699_102682362 | 134 |
| 488 | 3300025906 | Ga0207699_10581790 | Ga0207699_105817902 | 134 |
| 489 | 3300025906 | Ga0207699_10636547 | Ga0207699_106365472 | 134 |
| 490 | 3300025907 | Ga0207645_10075722 | Ga0207645_100757222 | 134 |
| 491 | 3300025908 | Ga0207643_10000633 | Ga0207643_1000063313 | 134 |
| 492 | 3300025909 | Ga0207705_10014692 | Ga0207705_100146926 | 134 |
| 493 | 3300025910 | Ga0207684_10001554 | Ga0207684_1000155422 | 134 |
| 494 | 3300025910 | Ga0207684_10003021 | Ga0207684_1000302118 | 134 |
| 495 | 3300025910 | Ga0207684_10016493 | Ga0207684_1001649310 | 134 |
| 496 | 3300025910 | Ga0207684_10017733 | Ga0207684_100177336 | 134 |
| 497 | 3300025910 | Ga0207684_10019368 | Ga0207684_100193685 | 134 |
| 498 | 3300025910 | Ga0207684_10036944 | Ga0207684_100369444 | 134 |
| 499 | 3300025910 | Ga0207684_10076912 | Ga0207684_100769122 | 134 |
| 500 | 3300025910 | Ga0207684_10077117 | Ga0207684_100771172 | 134 |
| 501 | 3300025910 | Ga0207684_10166293 | Ga0207684_101662932 | 134 |
| 502 | 3300025910 | Ga0207684_10338591 | Ga0207684_103385913 | 134 |
| 503 | 3300025910 | Ga0207684_10354702 | Ga0207684_103547022 | 134 |
| 504 | 3300025910 | Ga0207684_10478642 | Ga0207684_104786422 | 134 |
| 505 | 3300025910 | Ga0207684_10885942 | Ga0207684_108859421 | 134 |
| 506 | 3300025911 | Ga0207654_10002204 | Ga0207654_100022042 | 134 |
| 507 | 3300025912 | Ga0207707_10019993 | Ga0207707_100199935 | 134 |
| 508 | 3300025913 | Ga0207695_10362363 | Ga0207695_103623632 | 134 |
| 509 | 3300025915 | Ga0207693_10001190 | Ga0207693_100011902 | 134 |
| 510 | 3300025915 | Ga0207693_10050846 | Ga0207693_100508464 | 134 |
| 511 | 3300025915 | Ga0207693_10082948 | Ga0207693_100829485 | 134 |
| 512 | 3300025915 | Ga0207693_10325052 | Ga0207693_103250523 | 134 |
| 513 | 3300025916 | Ga0207663_10007512 | Ga0207663_100075122 | 134 |
| 514 | 3300025916 | Ga0207663_10012646 | Ga0207663_100126462 | 134 |
| 515 | 3300025916 | Ga0207663_10017302 | Ga0207663_100173023 | 134 |
| 516 | 3300025916 | Ga0207663_10036765 | Ga0207663_100367652 | 134 |
| 517 | 3300025916 | Ga0207663_10229549 | Ga0207663_102295492 | 134 |
| 518 | 3300025916 | Ga0207663_10279435 | Ga0207663_102794352 | 134 |
| 519 | 3300025917 | Ga0207660_10033257 | Ga0207660_100332573 | 134 |
| 520 | 3300025918 | Ga0207662_10244160 | Ga0207662_102441602 | 134 |
| 521 | 3300025919 | Ga0207657_10024422 | Ga0207657_100244228 | 134 |
| 522 | 3300025920 | Ga0207649_10001763 | Ga0207649_100017637 | 134 |
| 523 | 3300025921 | Ga0207652_10009911 | Ga0207652_100099117 | 134 |
| 524 | 3300025922 | Ga0207646_10000416 | Ga0207646_1000041622 | 134 |
| 525 | 3300025922 | Ga0207646_10014174 | Ga0207646_100141747 | 134 |
| 526 | 3300025922 | Ga0207646_10058150 | Ga0207646_100581505 | 134 |
| 527 | 3300025922 | Ga0207646_10118832 | Ga0207646_101188322 | 134 |
| 528 | 3300025922 | Ga0207646_10121188 | Ga0207646_101211883 | 134 |
| 529 | 3300025922 | Ga0207646_10300735 | Ga0207646_103007352 | 134 |
| 530 | 3300025922 | Ga0207646_10315221 | Ga0207646_103152212 | 134 |
| 531 | 3300025922 | Ga0207646_11522556 | Ga0207646_115225561 | 134 |
| 532 | 3300025924 | Ga0207694_10557197 | Ga0207694_105571972 | 134 |
| 533 | 3300025925 | Ga0207650_10003245 | Ga0207650_100032453 | 134 |
| 534 | 3300025926 | Ga0207659_10058617 | Ga0207659_100586172 | 134 |
| 535 | 3300025927 | Ga0207687_10060705 | Ga0207687_100607056 | 134 |
| 536 | 3300025928 | Ga0207700_10000798 | Ga0207700_100007983 | 134 |
| 537 | 3300025928 | Ga0207700_10001733 | Ga0207700_1000173313 | 134 |
| 538 | 3300025928 | Ga0207700_10005685 | Ga0207700_100056852 | 134 |
| 539 | 3300025928 | Ga0207700_10006147 | Ga0207700_1000614710 | 134 |
| 540 | 3300025928 | Ga0207700_10006208 | Ga0207700_100062083 | 134 |
| 541 | 3300025928 | Ga0207700_10061891 | Ga0207700_100618916 | 134 |
| 542 | 3300025928 | Ga0207700_10121056 | Ga0207700_101210562 | 134 |
| 543 | 3300025928 | Ga0207700_10256296 | Ga0207700_102562964 | 134 |
| 544 | 3300025928 | Ga0207700_10257694 | Ga0207700_102576942 | 134 |
| 545 | 3300025928 | Ga0207700_10264492 | Ga0207700_102644923 | 134 |
| 546 | 3300025929 | Ga0207664_10000312 | Ga0207664_1000031214 | 134 |
| 547 | 3300025929 | Ga0207664_10013970 | Ga0207664_100139705 | 134 |
| 548 | 3300025929 | Ga0207664_10042710 | Ga0207664_100427105 | 134 |
| 549 | 3300025929 | Ga0207664_10070125 | Ga0207664_100701252 | 134 |
| 550 | 3300025929 | Ga0207664_10114702 | Ga0207664_101147023 | 134 |
| 551 | 3300025929 | Ga0207664_10149920 | Ga0207664_101499202 | 134 |
| 552 | 3300025929 | Ga0207664_10181856 | Ga0207664_101818562 | 134 |
| 553 | 3300025929 | Ga0207664_10532416 | Ga0207664_105324162 | 134 |
| 554 | 3300025929 | Ga0207664_10532457 | Ga0207664_105324572 | 134 |
| 555 | 3300025929 | Ga0207664_11084316 | Ga0207664_110843161 | 134 |
| 556 | 3300025931 | Ga0207644_10010707 | Ga0207644_100107073 | 134 |
| 557 | 3300025931 | Ga0207644_10293975 | Ga0207644_102939752 | 134 |
| 558 | 3300025932 | Ga0207690_10011542 | Ga0207690_100115426 | 134 |
| 559 | 3300025933 | Ga0207706_10159937 | Ga0207706_101599376 | 134 |
| 560 | 3300025939 | Ga0207665_10000815 | Ga0207665_1000081516 | 134 |
| 561 | 3300025939 | Ga0207665_10001422 | Ga0207665_100014229 | 134 |
| 562 | 3300025939 | Ga0207665_10105536 | Ga0207665_101055365 | 134 |
| 563 | 3300025939 | Ga0207665_10308546 | Ga0207665_103085462 | 134 |
| 564 | 3300025940 | Ga0207691_10022176 | Ga0207691_100221763 | 134 |
| 565 | 3300025941 | Ga0207711_10110258 | Ga0207711_101102582 | 134 |
| 566 | 3300025942 | Ga0207689_10024826 | Ga0207689_100248265 | 134 |
| 567 | 3300025944 | Ga0207661_10011594 | Ga0207661_100115947 | 134 |
| 568 | 3300025945 | Ga0207679_10003642 | Ga0207679_100036423 | 134 |
| 569 | 3300025949 | Ga0207667_10080046 | Ga0207667_100800466 | 134 |
| 570 | 3300025949 | Ga0207667_10453799 | Ga0207667_104537991 | 134 |
| 571 | 3300025949 | Ga0207667_11472512 | Ga0207667_114725121 | 134 |
| 572 | 3300025960 | Ga0207651_10073792 | Ga0207651_100737923 | 134 |
| 573 | 3300025961 | Ga0207712_10433582 | Ga0207712_104335823 | 134 |
| 574 | 3300025972 | Ga0207668_10375860 | Ga0207668_103758602 | 134 |
| 575 | 3300026023 | Ga0207677_10004696 | Ga0207677_100046966 | 134 |
| 576 | 3300026041 | Ga0207639_10123660 | Ga0207639_101236602 | 134 |
| 577 | 3300026067 | Ga0207678_10003042 | Ga0207678_100030428 | 134 |
| 578 | 3300026067 | Ga0207678_10553573 | Ga0207678_105535732 | 134 |
| 579 | 3300026078 | Ga0207702_10005731 | Ga0207702_1000573110 | 134 |
| 580 | 3300026078 | Ga0207702_10019897 | Ga0207702_100198978 | 134 |
| 581 | 3300026078 | Ga0207702_10035944 | Ga0207702_100359443 | 134 |
| 582 | 3300026078 | Ga0207702_10637820 | Ga0207702_106378201 | 134 |
| 583 | 3300026088 | Ga0207641_10031395 | Ga0207641_100313956 | 134 |
| 584 | 3300026088 | Ga0207641_10102827 | Ga0207641_101028271 | 134 |
| 585 | 3300026089 | Ga0207648_11216410 | Ga0207648_112164101 | 134 |
| 586 | 3300026095 | Ga0207676_10005774 | Ga0207676_100057748 | 134 |
| 587 | 3300026116 | Ga0207674_10044865 | Ga0207674_100448657 | 134 |
| 588 | 3300026118 | Ga0207675_100683460 | Ga0207675_1006834602 | 134 |
| 589 | 3300026121 | Ga0207683_10001550 | Ga0207683_100015503 | 134 |
| 590 | 3300026121 | Ga0207683_10424165 | Ga0207683_104241652 | 134 |
| 591 | 3300026142 | Ga0207698_10004969 | Ga0207698_100049698 | 134 |
| 592 | 3300027907 | Ga0207428_10010009 | Ga0207428_100100096 | 134 |
| 593 | 3300028379 | Ga0268266_10099843 | Ga0268266_100998431 | 134 |
| 594 | 3300028379 | Ga0268266_10342281 | Ga0268266_103422812 | 134 |
| 595 | 3300028379 | Ga0268266_10479697 | Ga0268266_104796973 | 134 |
| 596 | 3300031727 | Ga0316576_10296302 | Ga0316576_102963022 | 134 |
| 597 | 3300033179 | Ga0307507_10081778 | Ga0307507_100817782 | 134 |
| 598 | 3300034818 | Ga0373950_0003712 | Ga0373950_0003712_82_519 | 134 |
| 599 | 3300034957 | Ga0373938_0008119 | Ga0373938_0008119_460_897 | 134 |
| 600 | 3300035083 | Ga0373926_0004292 | Ga0373926_0004292_238_675 | 134 |
| 601 | 3300035083 | Ga0373926_0017432 | Ga0373926_0017432_1667_2095 | 134 |
| 602 | 3300035083 | Ga0373926_0280457 | Ga0373926_0280457_209_637 | 134 |
| 603 | 3300035085 | Ga0373929_0027779 | Ga0373929_0027779_177_614 | 134 |
| 604 | 3300035086 | Ga0373934_0000674 | Ga0373934_0000674_6612_7049 | 134 |
| 605 | 3300035086 | Ga0373934_0014530 | Ga0373934_0014530_1066_1488 | 134 |
| 606 | 3300035086 | Ga0373934_0051912 | Ga0373934_0051912_786_1214 | 134 |
| 607 | 3300035086 | Ga0373934_0079784 | Ga0373934_0079784_448_867 | 134 |
| 608 | 3300035086 | Ga0373934_0103757 | Ga0373934_0103757_476_904 | 134 |
| 609 | 3300035088 | Ga0373940_0042379 | Ga0373940_0042379_36_473 | 134 |
| 610 | 3300035090 | Ga0373949_0026609 | Ga0373949_0026609_892_1329 | 134 |
| 611 | 3300035091 | Ga0373951_0030870 | Ga0373951_0030870_737_1174 | 134 |
| 612 | 3300035111 | Ga0373923_0007318 | Ga0373923_0007318_1506_1934 | 134 |
| 613 | 3300035111 | Ga0373923_0007399 | Ga0373923_0007399_2467_2886 | 134 |
| 614 | 3300035111 | Ga0373923_0066149 | Ga0373923_0066149_50_487 | 134 |
| 615 | 3300035111 | Ga0373923_0174313 | Ga0373923_0174313_239_661 | 134 |
| 616 | 3300035111 | Ga0373923_0199638 | Ga0373923_0199638_214_642 | 134 |
| 617 | 3300035113 | Ga0373936_0017038 | Ga0373936_0017038_1442_1861 | 134 |
| 618 | 3300035113 | Ga0373936_0089158 | Ga0373936_0089158_97_516 | 134 |
| 619 | 3300035113 | Ga0373936_0204095 | Ga0373936_0204095_95_523 | 134 |
| 620 | 3300035114 | Ga0373939_0006966 | Ga0373939_0006966_840_1277 | 134 |
| 621 | 3300035115 | Ga0373941_0005012 | Ga0373941_0005012_192_629 | 134 |
| 622 | 3300035116 | Ga0373945_0021950 | Ga0373945_0021950_477_905 | 134 |
| 623 | 3300035116 | Ga0373945_0185029 | Ga0373945_0185029_256_675 | 134 |
| 624 | 3300035117 | Ga0373953_0003697 | Ga0373953_0003697_1516_1944 | 134 |
| 625 | 3300035117 | Ga0373953_0019283 | Ga0373953_0019283_1452_1889 | 134 |
| 626 | 3300035117 | Ga0373953_0039276 | Ga0373953_0039276_503_931 | 134 |
| 627 | 3300035117 | Ga0373953_0043412 | Ga0373953_0043412_448_867 | 134 |
| 628 | 3300035118 | Ga0373954_0022036 | Ga0373954_0022036_1175_1594 | 134 |
| 629 | 3300035118 | Ga0373954_0242820 | Ga0373954_0242820_147_575 | 134 |
| 630 | 3300035119 | Ga0373956_0000440 | Ga0373956_0000440_11480_11917 | 134 |
| 631 | 3300035119 | Ga0373956_0007167 | Ga0373956_0007167_985_1404 | 134 |
| 632 | 3300035119 | Ga0373956_0014248 | Ga0373956_0014248_1378_1800 | 134 |
| 633 | 3300035119 | Ga0373956_0089716 | Ga0373956_0089716_25_453 | 134 |
| 634 | 3300035119 | Ga0373956_0124717 | Ga0373956_0124717_555_977 | 134 |
| 635 | 3300035120 | Ga0373957_0000394 | Ga0373957_0000394_5595_6032 | 134 |
| 636 | 3300035120 | Ga0373957_0017224 | Ga0373957_0017224_1121_1540 | 134 |
| 637 | 3300035120 | Ga0373957_0042923 | Ga0373957_0042923_598_1026 | 134 |
| 638 | 3300035120 | Ga0373957_0084253 | Ga0373957_0084253_639_1061 | 134 |
| 639 | 3300035121 | Ga0373960_0021997 | Ga0373960_0021997_111_539 | 134 |
| 640 | 3300035121 | Ga0373960_0112962 | Ga0373960_0112962_421_858 | 134 |
| 641 | 3300035170 | Ga0373943_0257486 | Ga0373943_0257486_241_669 | 134 |
| 642 | 3300035170 | Ga0373943_0702928 | Ga0373943_0702928_119_538 | 134 |
| 643 | 3300035171 | Ga0373946_0032311 | Ga0373946_0032311_1118_1546 | 134 |
| 644 | 3300035171 | Ga0373946_0053773 | Ga0373946_0053773_848_1267 | 134 |
| 645 | 3300035171 | Ga0373946_0169421 | Ga0373946_0169421_591_1010 | 134 |
| 646 | 3300035171 | Ga0373946_0246891 | Ga0373946_0246891_407_835 | 134 |
| 647 | 3300035171 | Ga0373946_0312692 | Ga0373946_0312692_137_574 | 134 |
| 648 | 3300035171 | Ga0373946_0395060 | Ga0373946_0395060_113_541 | 134 |
| 649 | 3300035172 | Ga0373955_0001622 | Ga0373955_0001622_6846_7283 | 134 |
| 650 | 3300035172 | Ga0373955_0009312 | Ga0373955_0009312_3255_3674 | 134 |
| 651 | 3300035172 | Ga0373955_0019045 | Ga0373955_0019045_547_969 | 134 |
| 652 | 3300035172 | Ga0373955_0168220 | Ga0373955_0168220_550_978 | 134 |
| 653 | 3300035172 | Ga0373955_0213173 | Ga0373955_0213173_652_1077 | 134 |
| 654 | 3300035172 | Ga0373955_0335344 | Ga0373955_0335344_55_483 | 134 |
| 655 | 3300035172 | Ga0373955_0562699 | Ga0373955_0562699_98_520 | 134 |
| 656 | 3300035207 | Ga0373942_0149361 | Ga0373942_0149361_72_509 | 134 |
| 657 | 3300035241 | Ga0373961_0166327 | Ga0373961_0166327_283_720 | 134 |
| 658 | 3300035398 | Ga0316574_0053529 | Ga0316574_0053529_1295_1723 | 134 |
| 659 | 3300035410 | Ga0373924_0001446 | Ga0373924_0001446_625_1062 | 134 |
| 660 | 3300035410 | Ga0373924_0006288 | Ga0373924_0006288_3255_3674 | 134 |
| 661 | 3300035410 | Ga0373924_0049616 | Ga0373924_0049616_1130_1552 | 134 |
| 662 | 3300035410 | Ga0373924_0068341 | Ga0373924_0068341_373_801 | 134 |
| 663 | 3300035410 | Ga0373924_0116013 | Ga0373924_0116013_472_894 | 134 |
| 664 | 3300035691 | Ga0373931_0045472 | Ga0373931_0045472_1861_2298 | 134 |
| 665 | 3300035691 | Ga0373931_0064798 | Ga0373931_0064798_722_1156 | 134 |
| 666 | 3300035691 | Ga0373931_0110855 | Ga0373931_0110855_588_1025 | 134 |
| 667 | 3300035692 | Ga0373935_0014480 | Ga0373935_0014480_1217_1636 | 134 |
| 668 | 3300035692 | Ga0373935_0034250 | Ga0373935_0034250_2000_2437 | 134 |
| 669 | 3300035692 | Ga0373935_0143789 | Ga0373935_0143789_319_738 | 134 |
| 670 | 3300035724 | Ga0373933_0000395 | Ga0373933_0000395_5051_5488 | 134 |
| 671 | 3300035724 | Ga0373933_0001608 | Ga0373933_0001608_11007_11435 | 134 |
| 672 | 3300035724 | Ga0373933_0011885 | Ga0373933_0011885_1175_1594 | 134 |
| 673 | 3300035724 | Ga0373933_0046194 | Ga0373933_0046194_1940_2362 | 134 |
| 674 | 3300035724 | Ga0373933_0050667 | Ga0373933_0050667_753_1181 | 134 |
| 675 | 3300035724 | Ga0373933_0057136 | Ga0373933_0057136_446_868 | 134 |
| 676 | 3300035724 | Ga0373933_0336842 | Ga0373933_0336842_78_503 | 134 |
| 677 | 3300035725 | Ga0373947_0000004 | Ga0373947_0000004_134555_134992 | 134 |
| 678 | 3300035725 | Ga0373947_0084539 | Ga0373947_0084539_341_769 | 134 |
| 679 | 3300035725 | Ga0373947_0105811 | Ga0373947_0105811_843_1271 | 134 |
| 680 | 3300035725 | Ga0373947_0265423 | Ga0373947_0265423_262_681 | 134 |
| 681 | 3300035725 | Ga0373947_0306613 | Ga0373947_0306613_528_956 | 134 |
| 682 | 3300036401 | Ga0373937_0000112 | Ga0373937_0000112_5029_5466 | 134 |
| 683 | 3300036401 | Ga0373937_0021836 | Ga0373937_0021836_1491_1919 | 134 |
| 684 | 3300036401 | Ga0373937_0088112 | Ga0373937_0088112_903_1322 | 134 |
| 685 | 3300036401 | Ga0373937_0341344 | Ga0373937_0341344_69_491 | 134 |
| 686 | 3300036401 | Ga0373937_0347766 | Ga0373937_0347766_13_441 | 134 |
| 687 | 3300037068 | Ga0373925_0014724 | Ga0373925_0014724_3291_3719 | 134 |
| 688 | 3300037068 | Ga0373925_0066450 | Ga0373925_0066450_1935_2363 | 134 |
| 689 | 3300037068 | Ga0373925_0091250 | Ga0373925_0091250_736_1155 | 134 |
| 690 | 3300037068 | Ga0373925_0162179 | Ga0373925_0162179_295_723 | 134 |
| 691 | 3300037068 | Ga0373925_0184564 | Ga0373925_0184564_288_722 | 134 |
| 692 | 3300037068 | Ga0373925_0202570 | Ga0373925_0202570_661_1089 | 134 |
| 693 | 3300037068 | Ga0373925_0366965 | Ga0373925_0366965_227_649 | 134 |
| 694 | 3300037068 | Ga0373925_0440518 | Ga0373925_0440518_66_485 | 134 |
| 695 | 3300037068 | Ga0373925_0767328 | Ga0373925_0767328_134_556 | 134 |
| 696 | 3300037068 | Ga0373925_1375628 | Ga0373925_1375628_48_476 | 134 |
| 697 | 3300037853 | Ga0436364_0497431 | Ga0436364_0497431_23_442 | 134 |
| 698 | 3300037853 | Ga0436364_0575601 | Ga0436364_0575601_3166_3591 | 134 |
| 699 | 3300037853 | Ga0436364_0590629 | Ga0436364_0590629_193_612 | 134 |
| 700 | 3300037853 | Ga0436364_0750774 | Ga0436364_0750774_1059_1481 | 134 |
| 701 | 3300037853 | Ga0436364_0804097 | Ga0436364_0804097_27539_27964 | 134 |
| 702 | 3300037853 | Ga0436364_0845254 | Ga0436364_0845254_321_743 | 134 |
| 703 | 3300037853 | Ga0436364_1042062 | Ga0436364_1042062_392_820 | 134 |
| 704 | 3300037853 | Ga0436364_1241795 | Ga0436364_1241795_716_1141 | 134 |
| 705 | 3300039437 | Ga0436365_0020494 | Ga0436365_0020494_178_603 | 134 |
| 706 | 3300039437 | Ga0436365_1487927 | Ga0436365_1487927_495_914 | 134 |
| 707 | 3300039438 | Ga0436360_0506992 | Ga0436360_0506992_129_569 | 134 |
| 708 | 3300039447 | Ga0436361_0218806 | Ga0436361_0218806_731_1159 | 134 |
| 709 | 3300039450 | Ga0436363_0367458 | Ga0436363_0367458_817_1242 | 134 |
| 710 | 3300039450 | Ga0436363_0685852 | Ga0436363_0685852_517_942 | 134 |
| 711 | 3300039450 | Ga0436363_1307140 | Ga0436363_1307140_19_483 | 134 |
| 712 | 3300039450 | Ga0436363_1321302 | Ga0436363_1321302_1201_1626 | 134 |
| 713 | 3300039450 | Ga0436363_1555992 | Ga0436363_1555992_734_1153 | 134 |
| 714 | 3300039450 | Ga0436363_1662743 | Ga0436363_1662743_52_480 | 134 |
| 715 | 3300039453 | Ga0436362_0041956 | Ga0436362_0041956_175_594 | 134 |
| 716 | 3300041509 | Ga0451843_0620187 | Ga0451843_0620187_57_479 | 134 |
| 717 | 3300042005 | Ga0439448_0114577 | Ga0439448_0114577_305_739 | 134 |
| 718 | 3300042012 | Ga0439455_0124192 | Ga0439455_0124192_239_673 | 134 |
| 719 | 3300042016 | Ga0439463_100419 | Ga0439463_100419_255_689 | 134 |
| 720 | 3300042438 | Ga0439459_0000753 | Ga0439459_0000753_2130_2564 | 134 |
| 721 | 3300044683 | Ga0466965_0189629 | Ga0466965_0189629_108_533 | 134 |
| 722 | 3300044694 | Ga0466963_0038035 | Ga0466963_0038035_103_528 | 134 |
| 723 | 3300044694 | Ga0466963_0191173 | Ga0466963_0191173_623_1042 | 134 |
| 724 | 3300044706 | Ga0466964_0114153 | Ga0466964_0114153_766_1191 | 134 |
| 725 | 3300044719 | Ga0466971_0117611 | Ga0466971_0117611_301_726 | 134 |
| 726 | 3300044842 | Ga0466957_0047275 | Ga0466957_0047275_1943_2368 | 134 |
| 727 | 3300044901 | Ga0466960_0071412 | Ga0466960_0071412_744_1169 | 134 |
| 728 | 3300044901 | Ga0466960_0340273 | Ga0466960_0340273_356_772 | 134 |
| 729 | 3300045836 | Ga0466958_0049813 | Ga0466958_0049813_316_741 | 134 |
| 730 | 3300045836 | Ga0466958_0436120 | Ga0466958_0436120_11_430 | 134 |
| 731 | 3300045976 | Ga0466967_0385136 | Ga0466967_0385136_818_1243 | 134 |
| 732 | 3300046454 | Ga0495592_0001455 | Ga0495592_0001455_13687_14124 | 134 |
| 733 | 3300046454 | Ga0495592_0007331 | Ga0495592_0007331_6886_7314 | 134 |
| 734 | 3300046454 | Ga0495592_0031243 | Ga0495592_0031243_1961_2389 | 134 |
| 735 | 3300046454 | Ga0495592_0064943 | Ga0495592_0064943_1680_2099 | 134 |
| 736 | 3300046454 | Ga0495592_0129668 | Ga0495592_0129668_1098_1520 | 134 |
| 737 | 3300046454 | Ga0495592_0595574 | Ga0495592_0595574_223_651 | 134 |
| 738 | 3300046455 | Ga0495603_0474382 | Ga0495603_0474382_93_521 | 134 |
| 739 | 3300046459 | Ga0495629_0003377 | Ga0495629_0003377_11185_11604 | 134 |
| 740 | 3300046459 | Ga0495629_0015076 | Ga0495629_0015076_4471_4899 | 134 |
| 741 | 3300046459 | Ga0495629_0025772 | Ga0495629_0025772_783_1211 | 134 |
| 742 | 3300046461 | Ga0495641_0009158 | Ga0495641_0009158_2666_3085 | 134 |
| 743 | 3300046461 | Ga0495641_0012173 | Ga0495641_0012173_1685_2113 | 134 |
| 744 | 3300046461 | Ga0495641_0134931 | Ga0495641_0134931_501_929 | 134 |
| 745 | 3300046462 | Ga0495651_0000614 | Ga0495651_0000614_22199_22636 | 134 |
| 746 | 3300046462 | Ga0495651_0044722 | Ga0495651_0044722_1502_1930 | 134 |
| 747 | 3300046462 | Ga0495651_0076191 | Ga0495651_0076191_298_720 | 134 |
| 748 | 3300046462 | Ga0495651_0115830 | Ga0495651_0115830_1455_1883 | 134 |
| 749 | 3300046462 | Ga0495651_0248035 | Ga0495651_0248035_351_770 | 134 |
| 750 | 3300046463 | Ga0495653_0005337 | Ga0495653_0005337_8855_9283 | 134 |
| 751 | 3300046463 | Ga0495653_0017535 | Ga0495653_0017535_4229_4648 | 134 |
| 752 | 3300046463 | Ga0495653_0020711 | Ga0495653_0020711_1538_1975 | 134 |
| 753 | 3300046463 | Ga0495653_0060635 | Ga0495653_0060635_1649_2077 | 134 |
| 754 | 3300046463 | Ga0495653_0091505 | Ga0495653_0091505_550_978 | 134 |
| 755 | 3300046463 | Ga0495653_0192235 | Ga0495653_0192235_527_949 | 134 |
| 756 | 3300046463 | Ga0495653_0793646 | Ga0495653_0793646_66_488 | 134 |
| 757 | 3300046472 | Ga0495580_0295072 | Ga0495580_0295072_658_1086 | 134 |
| 758 | 3300046472 | Ga0495580_0435779 | Ga0495580_0435779_273_701 | 134 |
| 759 | 3300046473 | Ga0495582_0000633 | Ga0495582_0000633_9180_9599 | 134 |
| 760 | 3300046473 | Ga0495582_0018939 | Ga0495582_0018939_1583_2011 | 134 |
| 761 | 3300046473 | Ga0495582_0121544 | Ga0495582_0121544_534_962 | 134 |
| 762 | 3300046475 | Ga0495639_0071634 | Ga0495639_0071634_660_1088 | 134 |
| 763 | 3300046475 | Ga0495639_0195717 | Ga0495639_0195717_92_511 | 134 |
| 764 | 3300046475 | Ga0495639_0476023 | Ga0495639_0476023_175_594 | 134 |
| 765 | 3300046476 | Ga0495662_0002306 | Ga0495662_0002306_6114_6533 | 134 |
| 766 | 3300046476 | Ga0495662_0176990 | Ga0495662_0176990_61_489 | 134 |
| 767 | 3300046476 | Ga0495662_0357194 | Ga0495662_0357194_96_524 | 134 |
| 768 | 3300046477 | Ga0495664_0035879 | Ga0495664_0035879_1050_1472 | 134 |
| 769 | 3300046477 | Ga0495664_0103917 | Ga0495664_0103917_260_688 | 134 |
| 770 | 3300046477 | Ga0495664_0135073 | Ga0495664_0135073_725_1144 | 134 |
| 771 | 3300046477 | Ga0495664_0199036 | Ga0495664_0199036_244_672 | 134 |
| 772 | 3300046477 | Ga0495664_0216373 | Ga0495664_0216373_85_507 | 134 |
| 773 | 3300046477 | Ga0495664_0337844 | Ga0495664_0337844_141_569 | 134 |
| 774 | 3300046511 | Ga0495608_0001069 | Ga0495608_0001069_13804_14241 | 134 |
| 775 | 3300046511 | Ga0495608_0001601 | Ga0495608_0001601_12910_13338 | 134 |
| 776 | 3300046511 | Ga0495608_0023206 | Ga0495608_0023206_1359_1787 | 134 |
| 777 | 3300046511 | Ga0495608_0026488 | Ga0495608_0026488_845_1264 | 134 |
| 778 | 3300046511 | Ga0495608_0073754 | Ga0495608_0073754_1217_1639 | 134 |
| 779 | 3300046514 | Ga0495618_0090381 | Ga0495618_0090381_539_967 | 134 |
| 780 | 3300046514 | Ga0495618_0138204 | Ga0495618_0138204_580_1008 | 134 |
| 781 | 3300046514 | Ga0495618_0163081 | Ga0495618_0163081_446_868 | 134 |
| 782 | 3300046514 | Ga0495618_0163346 | Ga0495618_0163346_133_552 | 134 |
| 783 | 3300046514 | Ga0495618_0185289 | Ga0495618_0185289_223_642 | 134 |
| 784 | 3300046514 | Ga0495618_0187179 | Ga0495618_0187179_207_635 | 134 |
| 785 | 3300046514 | Ga0495618_0275484 | Ga0495618_0275484_429_857 | 134 |
| 786 | 3300046516 | Ga0495628_0001819 | Ga0495628_0001819_5002_5439 | 134 |
| 787 | 3300046516 | Ga0495628_0006554 | Ga0495628_0006554_2845_3273 | 134 |
| 788 | 3300046516 | Ga0495628_0075381 | Ga0495628_0075381_1151_1573 | 134 |
| 789 | 3300046516 | Ga0495628_0144151 | Ga0495628_0144151_1175_1594 | 134 |
| 790 | 3300046516 | Ga0495628_0221997 | Ga0495628_0221997_891_1319 | 134 |
| 791 | 3300046516 | Ga0495628_0259717 | Ga0495628_0259717_619_1047 | 134 |
| 792 | 3300046516 | Ga0495628_0559341 | Ga0495628_0559341_140_559 | 134 |
| 793 | 3300046516 | Ga0495628_0570329 | Ga0495628_0570329_242_670 | 134 |
| 794 | 3300046517 | Ga0495630_0014583 | Ga0495630_0014583_845_1264 | 134 |
| 795 | 3300046517 | Ga0495630_0035351 | Ga0495630_0035351_2945_3373 | 134 |
| 796 | 3300046517 | Ga0495630_0046422 | Ga0495630_0046422_2128_2556 | 134 |
| 797 | 3300046517 | Ga0495630_0345675 | Ga0495630_0345675_94_522 | 134 |
| 798 | 3300046526 | Ga0495666_0043774 | Ga0495666_0043774_961_1380 | 134 |
| 799 | 3300046526 | Ga0495666_0330050 | Ga0495666_0330050_205_633 | 134 |
| 800 | 3300046529 | Ga0495652_0001605 | Ga0495652_0001605_19207_19644 | 134 |
| 801 | 3300046529 | Ga0495652_0047090 | Ga0495652_0047090_12_434 | 134 |
| 802 | 3300046529 | Ga0495652_0087251 | Ga0495652_0087251_992_1420 | 134 |
| 803 | 3300046529 | Ga0495652_0137351 | Ga0495652_0137351_461_889 | 134 |
| 804 | 3300046529 | Ga0495652_0156758 | Ga0495652_0156758_89_511 | 134 |
| 805 | 3300046529 | Ga0495652_0170625 | Ga0495652_0170625_556_984 | 134 |
| 806 | 3300046529 | Ga0495652_0247817 | Ga0495652_0247817_223_642 | 134 |
| 807 | 3300046529 | Ga0495652_0528856 | Ga0495652_0528856_68_496 | 134 |
| 808 | 3300046531 | Ga0495665_0000862 | Ga0495665_0000862_9605_10024 | 134 |
| 809 | 3300046531 | Ga0495665_0006105 | Ga0495665_0006105_3984_4412 | 134 |
| 810 | 3300046531 | Ga0495665_0040631 | Ga0495665_0040631_1778_2206 | 134 |
| 811 | 3300046531 | Ga0495665_0101249 | Ga0495665_0101249_466_894 | 134 |
| 812 | 3300046531 | Ga0495665_0395392 | Ga0495665_0395392_52_474 | 134 |
| 813 | 3300046533 | Ga0495640_0032162 | Ga0495640_0032162_503_931 | 134 |
| 814 | 3300046533 | Ga0495640_0052316 | Ga0495640_0052316_26_448 | 134 |
| 815 | 3300046533 | Ga0495640_0053319 | Ga0495640_0053319_351_770 | 134 |
| 816 | 3300046533 | Ga0495640_0064663 | Ga0495640_0064663_1119_1547 | 134 |
| 817 | 3300046533 | Ga0495640_0108982 | Ga0495640_0108982_496_924 | 134 |
| 818 | 3300046533 | Ga0495640_0156918 | Ga0495640_0156918_923_1345 | 134 |
| 819 | 3300046533 | Ga0495640_0358306 | Ga0495640_0358306_346_774 | 134 |
| 820 | 3300046535 | Ga0495586_0008277 | Ga0495586_0008277_3659_4078 | 134 |
| 821 | 3300046535 | Ga0495586_0078499 | Ga0495586_0078499_567_995 | 134 |
| 822 | 3300046535 | Ga0495586_0306961 | Ga0495586_0306961_420_839 | 134 |
| 823 | 3300046536 | Ga0495587_0000038 | Ga0495587_0000038_110653_111090 | 134 |
| 824 | 3300046536 | Ga0495587_0009607 | Ga0495587_0009607_1019_1447 | 134 |
| 825 | 3300046536 | Ga0495587_0014385 | Ga0495587_0014385_325_747 | 134 |
| 826 | 3300046536 | Ga0495587_0091105 | Ga0495587_0091105_223_642 | 134 |
| 827 | 3300046543 | Ga0495645_0024129 | Ga0495645_0024129_39_467 | 134 |
| 828 | 3300046543 | Ga0495645_0104876 | Ga0495645_0104876_1365_1784 | 134 |
| 829 | 3300046543 | Ga0495645_0307514 | Ga0495645_0307514_484_903 | 134 |
| 830 | 3300046543 | Ga0495645_0432137 | Ga0495645_0432137_325_771 | 134 |
| 831 | 3300046559 | Ga0495667_0001336 | Ga0495667_0001336_10709_11146 | 134 |
| 832 | 3300046559 | Ga0495667_0006455 | Ga0495667_0006455_4744_5172 | 134 |
| 833 | 3300046559 | Ga0495667_0065274 | Ga0495667_0065274_338_760 | 134 |
| 834 | 3300046559 | Ga0495667_0077073 | Ga0495667_0077073_576_995 | 134 |
| 835 | 3300046559 | Ga0495667_0205778 | Ga0495667_0205778_123_545 | 134 |
| 836 | 3300046642 | Ga0495634_0010165 | Ga0495634_0010165_351_770 | 134 |
| 837 | 3300046642 | Ga0495634_0098056 | Ga0495634_0098056_970_1398 | 134 |
| 838 | 3300046642 | Ga0495634_0384838 | Ga0495634_0384838_14_436 | 134 |
| 839 | 3300046663 | Ga0495635_0010821 | Ga0495635_0010821_1160_1588 | 134 |
| 840 | 3300046663 | Ga0495635_0093700 | Ga0495635_0093700_949_1377 | 134 |
| 841 | 3300046663 | Ga0495635_0134179 | Ga0495635_0134179_599_1027 | 134 |
| 842 | 3300046663 | Ga0495635_0154432 | Ga0495635_0154432_1112_1534 | 134 |
| 843 | 3300046663 | Ga0495635_0177618 | Ga0495635_0177618_93_515 | 134 |
| 844 | 3300046663 | Ga0495635_0178752 | Ga0495635_0178752_576_995 | 134 |
| 845 | 3300046663 | Ga0495635_0507850 | Ga0495635_0507850_176_613 | 134 |
| 846 | 3300046663 | Ga0495635_0858320 | Ga0495635_0858320_142_570 | 134 |
| 847 | 3300046674 | Ga0495588_0199784 | Ga0495588_0199784_276_704 | 134 |
| 848 | 3300046675 | Ga0495657_0001650 | Ga0495657_0001650_13685_14122 | 134 |
| 849 | 3300046675 | Ga0495657_0003778 | Ga0495657_0003778_3003_3431 | 134 |
| 850 | 3300046675 | Ga0495657_0010062 | Ga0495657_0010062_5641_6063 | 134 |
| 851 | 3300046675 | Ga0495657_0040982 | Ga0495657_0040982_1138_1560 | 134 |
| 852 | 3300046675 | Ga0495657_0052746 | Ga0495657_0052746_1601_2029 | 134 |
| 853 | 3300046675 | Ga0495657_0241636 | Ga0495657_0241636_448_867 | 134 |
| 854 | 3300046678 | Ga0495599_0000758 | Ga0495599_0000758_15437_15874 | 134 |
| 855 | 3300046678 | Ga0495599_0005598 | Ga0495599_0005598_2791_3219 | 134 |
| 856 | 3300046678 | Ga0495599_0030015 | Ga0495599_0030015_965_1393 | 134 |
| 857 | 3300046678 | Ga0495599_0175492 | Ga0495599_0175492_680_1099 | 134 |
| 858 | 3300046679 | Ga0495623_0000989 | Ga0495623_0000989_5054_5491 | 134 |
| 859 | 3300046679 | Ga0495623_0024334 | Ga0495623_0024334_3261_3680 | 134 |
| 860 | 3300046679 | Ga0495623_0034857 | Ga0495623_0034857_1061_1489 | 134 |
| 861 | 3300046679 | Ga0495623_0205097 | Ga0495623_0205097_371_799 | 134 |
| 862 | 3300046680 | Ga0495646_0007896 | Ga0495646_0007896_620_1048 | 134 |
| 863 | 3300046680 | Ga0495646_0011284 | Ga0495646_0011284_4716_5138 | 134 |
| 864 | 3300046680 | Ga0495646_0036410 | Ga0495646_0036410_730_1167 | 134 |
| 865 | 3300046680 | Ga0495646_0062099 | Ga0495646_0062099_959_1378 | 134 |
| 866 | 3300046680 | Ga0495646_0081477 | Ga0495646_0081477_908_1336 | 134 |
| 867 | 3300046680 | Ga0495646_0343986 | Ga0495646_0343986_101_523 | 134 |
| 868 | 3300046681 | Ga0495647_0097127 | Ga0495647_0097127_271_699 | 134 |
| 869 | 3300046683 | Ga0495658_0015048 | Ga0495658_0015048_551_979 | 134 |
| 870 | 3300046683 | Ga0495658_0033565 | Ga0495658_0033565_1348_1767 | 134 |
| 871 | 3300046683 | Ga0495658_0232418 | Ga0495658_0232418_187_615 | 134 |
| 872 | 3300046689 | Ga0495613_0025110 | Ga0495613_0025110_1366_1785 | 134 |
| 873 | 3300046689 | Ga0495613_0086135 | Ga0495613_0086135_1649_2077 | 134 |
| 874 | 3300046690 | Ga0495624_0007371 | Ga0495624_0007371_1189_1608 | 134 |
| 875 | 3300046690 | Ga0495624_0288964 | Ga0495624_0288964_190_618 | 134 |
| 876 | 3300046809 | Ga0495600_0003680 | Ga0495600_0003680_715_1152 | 134 |
| 877 | 3300046809 | Ga0495600_0014627 | Ga0495600_0014627_1939_2367 | 134 |
| 878 | 3300046809 | Ga0495600_0022141 | Ga0495600_0022141_3085_3504 | 134 |
| 879 | 3300046809 | Ga0495600_0039149 | Ga0495600_0039149_452_874 | 134 |
| 880 | 3300047315 | Ga0495581_0011292 | Ga0495581_0011292_1082_1501 | 134 |
| 881 | 3300047315 | Ga0495581_0021500 | Ga0495581_0021500_1662_2090 | 134 |
| 882 | 3300047315 | Ga0495581_0022089 | Ga0495581_0022089_374_802 | 134 |
| 883 | 3300047317 | Ga0495604_0001351 | Ga0495604_0001351_5046_5483 | 134 |
| 884 | 3300047317 | Ga0495604_0017594 | Ga0495604_0017594_4931_5359 | 134 |
| 885 | 3300047317 | Ga0495604_0023708 | Ga0495604_0023708_1541_1978 | 134 |
| 886 | 3300047317 | Ga0495604_0215741 | Ga0495604_0215741_537_965 | 134 |
| 887 | 3300047317 | Ga0495604_0237975 | Ga0495604_0237975_370_792 | 134 |
| 888 | 3300047317 | Ga0495604_0295461 | Ga0495604_0295461_448_867 | 134 |
| 889 | 3300047317 | Ga0495604_0398917 | Ga0495604_0398917_253_675 | 134 |
| 890 | 3300047319 | Ga0495674_0016775 | Ga0495674_0016775_255_683 | 134 |
| 891 | 3300047319 | Ga0495674_0041489 | Ga0495674_0041489_2685_3113 | 134 |
| 892 | 3300047319 | Ga0495674_0097709 | Ga0495674_0097709_1888_2307 | 134 |
| 893 | 3300047319 | Ga0495674_0102293 | Ga0495674_0102293_973_1392 | 134 |
| 894 | 3300047319 | Ga0495674_0115625 | Ga0495674_0115625_842_1264 | 134 |
| 895 | 3300047319 | Ga0495674_0348943 | Ga0495674_0348943_694_1122 | 134 |
| 896 | 3300047319 | Ga0495674_1180129 | Ga0495674_1180129_132_554 | 134 |
| 897 | 3300047321 | Ga0495676_0085381 | Ga0495676_0085381_168_596 | 134 |
| 898 | 3300047321 | Ga0495676_0182973 | Ga0495676_0182973_433_861 | 134 |
| 899 | 3300047321 | Ga0495676_0225727 | Ga0495676_0225727_93_527 | 134 |
| 900 | 3300047322 | Ga0495680_0003762 | Ga0495680_0003762_13709_14146 | 134 |
| 901 | 3300047322 | Ga0495680_0011520 | Ga0495680_0011520_4736_5164 | 134 |
| 902 | 3300047322 | Ga0495680_0023051 | Ga0495680_0023051_1959_2387 | 134 |
| 903 | 3300047322 | Ga0495680_0056902 | Ga0495680_0056902_928_1347 | 134 |
| 904 | 3300047322 | Ga0495680_0072113 | Ga0495680_0072113_561_989 | 134 |
| 905 | 3300047322 | Ga0495680_0177064 | Ga0495680_0177064_673_1095 | 134 |
| 906 | 3300047322 | Ga0495680_0432478 | Ga0495680_0432478_159_581 | 134 |
| 907 | 3300047444 | Ga0495675_0004390 | Ga0495675_0004390_5774_6211 | 134 |
| 908 | 3300047444 | Ga0495675_0010355 | Ga0495675_0010355_999_1427 | 134 |
| 909 | 3300047444 | Ga0495675_0053342 | Ga0495675_0053342_973_1392 | 134 |
| 910 | 3300047471 | Ga0495684_0005912 | Ga0495684_0005912_2763_3191 | 134 |
| 911 | 3300047471 | Ga0495684_0013098 | Ga0495684_0013098_5137_5556 | 134 |
| 912 | 3300047471 | Ga0495684_0032003 | Ga0495684_0032003_572_1000 | 134 |
| 913 | 3300047471 | Ga0495684_0066376 | Ga0495684_0066376_1620_2048 | 134 |
| 914 | 3300047471 | Ga0495684_0099432 | Ga0495684_0099432_1257_1679 | 134 |
| 915 | 3300047471 | Ga0495684_0628275 | Ga0495684_0628275_23_451 | 134 |
| 916 | 3300047673 | Ga0495593_0036689 | Ga0495593_0036689_1294_1713 | 134 |
| 917 | 3300047673 | Ga0495593_0059361 | Ga0495593_0059361_452_880 | 134 |
| 918 | 3300048088 | Ga0495602_0003390 | Ga0495602_0003390_5054_5491 | 134 |
| 919 | 3300048088 | Ga0495602_0015662 | Ga0495602_0015662_6065_6493 | 134 |
| 920 | 3300048088 | Ga0495602_0060055 | Ga0495602_0060055_1255_1683 | 134 |
| 921 | 3300048088 | Ga0495602_0092006 | Ga0495602_0092006_928_1347 | 134 |
| 922 | 3300048088 | Ga0495602_0269413 | Ga0495602_0269413_608_1030 | 134 |
| 923 | 3300048089 | Ga0495614_0035350 | Ga0495614_0035350_169_597 | 134 |
| 924 | 3300048089 | Ga0495614_0037064 | Ga0495614_0037064_588_1007 | 134 |
| 925 | 3300048903 | Ga0496100_0077467 | Ga0496100_0077467_22_459 | 134 |
| 926 | 3300048903 | Ga0496100_0095470 | Ga0496100_0095470_943_1380 | 134 |
| 927 | 3300048904 | Ga0496101_0726020 | Ga0496101_0726020_187_615 | 134 |
| 928 | 3300048905 | Ga0496102_0006711 | Ga0496102_0006711_2258_2695 | 134 |
| 929 | 3300048905 | Ga0496102_0073700 | Ga0496102_0073700_578_1015 | 134 |
| 930 | 3300048905 | Ga0496102_0089034 | Ga0496102_0089034_1741_2169 | 134 |
| 931 | 3300048906 | Ga0496103_0089253 | Ga0496103_0089253_191_628 | 134 |
| 932 | 3300048906 | Ga0496103_0168404 | Ga0496103_0168404_578_1015 | 134 |
| 933 | 3300048907 | Ga0496104_0015590 | Ga0496104_0015590_1284_1712 | 134 |
| 934 | 3300048907 | Ga0496104_0022073 | Ga0496104_0022073_2964_3401 | 134 |
| 935 | 3300048907 | Ga0496104_0257572 | Ga0496104_0257572_458_886 | 134 |
| 936 | 3300048908 | Ga0496105_0002576 | Ga0496105_0002576_8195_8632 | 134 |
| 937 | 3300048908 | Ga0496105_0008991 | Ga0496105_0008991_3373_3801 | 134 |
| 938 | 3300048908 | Ga0496105_0178037 | Ga0496105_0178037_922_1359 | 134 |
| 939 | 3300048909 | Ga0496106_0050968 | Ga0496106_0050968_202_639 | 134 |
| 940 | 3300048910 | Ga0496107_0036160 | Ga0496107_0036160_503_940 | 134 |
| 941 | 3300048910 | Ga0496107_0407922 | Ga0496107_0407922_402_830 | 134 |
| 942 | 3300048911 | Ga0496108_0007310 | Ga0496108_0007310_6785_7222 | 134 |
| 943 | 3300048911 | Ga0496108_0262005 | Ga0496108_0262005_196_633 | 134 |
| 944 | 3300048912 | Ga0496109_0014629 | Ga0496109_0014629_3432_3869 | 134 |
| 945 | 3300048912 | Ga0496109_0078270 | Ga0496109_0078270_2497_2925 | 134 |
| 946 | 3300048912 | Ga0496109_0084140 | Ga0496109_0084140_337_774 | 134 |
| 947 | 3300048913 | Ga0496110_0043890 | Ga0496110_0043890_1777_2214 | 134 |
| 948 | 3300048913 | Ga0496110_0206755 | Ga0496110_0206755_776_1204 | 134 |
| 949 | 3300048913 | Ga0496110_0750083 | Ga0496110_0750083_159_593 | 134 |
| 950 | 3300048914 | Ga0496111_0002632 | Ga0496111_0002632_3811_4248 | 134 |
| 951 | 3300048914 | Ga0496111_0062158 | Ga0496111_0062158_1216_1653 | 134 |
| 952 | 3300048914 | Ga0496111_0166729 | Ga0496111_0166729_688_1116 | 134 |
| 953 | 3300048915 | Ga0496112_0053873 | Ga0496112_0053873_910_1347 | 134 |
| 954 | 3300048915 | Ga0496112_0079656 | Ga0496112_0079656_1898_2335 | 134 |
| 955 | 3300048915 | Ga0496112_0146193 | Ga0496112_0146193_910_1338 | 134 |
| 956 | 3300048916 | Ga0496113_0004926 | Ga0496113_0004926_7116_7553 | 134 |
| 957 | 3300048916 | Ga0496113_0039381 | Ga0496113_0039381_1550_1978 | 134 |
| 958 | 3300048916 | Ga0496113_0063676 | Ga0496113_0063676_906_1343 | 134 |
| 959 | 3300048917 | Ga0496114_0376630 | Ga0496114_0376630_630_1058 | 134 |
| 960 | 3300048917 | Ga0496114_1397064 | Ga0496114_1397064_98_517 | 134 |
| 961 | 3300048918 | Ga0496115_0006183 | Ga0496115_0006183_6927_7355 | 134 |
| 962 | 3300048918 | Ga0496115_0091770 | Ga0496115_0091770_511_981 | 134 |
| 963 | 3300048929 | Ga0496126_0000075 | Ga0496126_0000075_160489_160920 | 134 |
| 964 | 3300048929 | Ga0496126_0184550 | Ga0496126_0184550_867_1295 | 134 |
| 965 | 3300048929 | Ga0496126_0682930 | Ga0496126_0682930_109_579 | 134 |
| 966 | 3300049578 | Ga0501042_0008915 | Ga0501042_0008915_5573_6004 | 134 |
| 967 | 3300049581 | Ga0501047_0000150 | Ga0501047_0000150_31991_32413 | 134 |
| 968 | 3300049585 | Ga0501069_0208878 | Ga0501069_0208878_187_615 | 134 |
| 969 | 3300049742 | Ga0501080_0835409 | Ga0501080_0835409_329_751 | 134 |
| 970 | 3300050490 | nmdc:mga03n38_431597_c1 | nmdc:mga03n38_431597_c1_30_461 | 134 |
| 971 | 3300050496 | nmdc:mga07m45_65750_c1 | nmdc:mga07m45_65750_c1_16_447 | 134 |
| 972 | 3300050507 | nmdc:mga05p37_127039_c1 | nmdc:mga05p37_127039_c1_374_811 | 134 |
| 973 | 3300050507 | nmdc:mga05p37_67522_c1 | nmdc:mga05p37_67522_c1_1577_2011 | 134 |
| 974 | 3300050508 | nmdc:mga09592_486514_c1 | nmdc:mga09592_486514_c1_323_757 | 134 |
| 975 | 3300050508 | nmdc:mga09592_752305_c1 | nmdc:mga09592_752305_c1_298_735 | 134 |
| 976 | 3300050510 | nmdc:mga06r32_1144457_c1 | nmdc:mga06r32_1144457_c1_38_475 | 134 |
| 977 | 3300050510 | nmdc:mga06r32_496570_c1 | nmdc:mga06r32_496570_c1_574_993 | 134 |
| 978 | 3300050510 | nmdc:mga06r32_797052_c1 | nmdc:mga06r32_797052_c1_318_737 | 134 |
| 979 | 3300050511 | nmdc:mga08y16_228436_c1 | nmdc:mga08y16_228436_c1_430_867 | 134 |
| 980 | 3300050511 | nmdc:mga08y16_70532_c1 | nmdc:mga08y16_70532_c1_1690_2127 | 134 |
| 981 | 3300050512 | nmdc:mga0n895_109127_c1 | nmdc:mga0n895_109127_c1_1410_1847 | 134 |
| 982 | 3300050512 | nmdc:mga0n895_13493_c1 | nmdc:mga0n895_13493_c1_3272_3709 | 134 |
| 983 | 3300050512 | nmdc:mga0n895_53228_c1 | nmdc:mga0n895_53228_c1_1936_2355 | 134 |
| 984 | 3300050512 | nmdc:mga0n895_7079_c1 | nmdc:mga0n895_7079_c1_8007_8435 | 134 |
| 985 | 3300050513 | nmdc:mga0rr50_1040_c1 | nmdc:mga0rr50_1040_c1_5922_6359 | 134 |
| 986 | 3300050513 | nmdc:mga0rr50_19349_c1 | nmdc:mga0rr50_19349_c1_2379_2798 | 134 |
| 987 | 3300050513 | nmdc:mga0rr50_30445_c1 | nmdc:mga0rr50_30445_c1_1921_2349 | 134 |
| 988 | 3300050513 | nmdc:mga0rr50_64018_c1 | nmdc:mga0rr50_64018_c1_839_1276 | 134 |
| 989 | 3300050514 | nmdc:mga08x19_16197_c1 | nmdc:mga08x19_16197_c1_3603_4040 | 134 |
| 990 | 3300050514 | nmdc:mga08x19_252903_c1 | nmdc:mga08x19_252903_c1_663_1082 | 134 |
| 991 | 3300050514 | nmdc:mga08x19_662974_c1 | nmdc:mga08x19_662974_c1_218_646 | 134 |
| 992 | 3300050514 | nmdc:mga08x19_673088_c1 | nmdc:mga08x19_673088_c1_168_587 | 134 |
| 993 | 3300050514 | nmdc:mga08x19_97392_c1 | nmdc:mga08x19_97392_c1_1430_1867 | 134 |
| 994 | 3300050515 | nmdc:mga0a205_35541_c1 | nmdc:mga0a205_35541_c1_186_623 | 134 |
| 995 | 3300050515 | nmdc:mga0a205_57226_c1 | nmdc:mga0a205_57226_c1_1350_1769 | 134 |
| 996 | 3300053077 | Ga0495601_0001775 | Ga0495601_0001775_2588_3007 | 134 |
| 997 | 3300053077 | Ga0495601_0031216 | Ga0495601_0031216_1252_1671 | 134 |
| 998 | 3300053077 | Ga0495601_0139521 | Ga0495601_0139521_356_784 | 134 |
| 999 | 3300053077 | Ga0495601_0440666 | Ga0495601_0440666_239_661 | 134 |
| 1000 | 3300053078 | Ga0495612_0026415 | Ga0495612_0026415_1047_1466 | 134 |
| 1001 | 3300053078 | Ga0495612_0039803 | Ga0495612_0039803_494_922 | 134 |
| 1002 | 3300053078 | Ga0495612_0141308 | Ga0495612_0141308_456_884 | 134 |
| 1003 | 3300053078 | Ga0495612_0244731 | Ga0495612_0244731_68_487 | 134 |
| 1004 | 3300053078 | Ga0495612_0414061 | Ga0495612_0414061_55_483 | 134 |
| 1005 | 3300053084 | Ga0495595_0000411 | Ga0495595_0000411_13522_13959 | 134 |
| 1006 | 3300053084 | Ga0495595_0005457 | Ga0495595_0005457_2460_2879 | 134 |
| 1007 | 3300053084 | Ga0495595_0007476 | Ga0495595_0007476_430_858 | 134 |
| 1008 | 3300053084 | Ga0495595_0340782 | Ga0495595_0340782_231_653 | 134 |
| 1009 | 3300053085 | Ga0495619_0030461 | Ga0495619_0030461_2501_2920 | 134 |
| 1010 | 3300053085 | Ga0495619_0037658 | Ga0495619_0037658_1594_2022 | 134 |
| 1011 | 3300053085 | Ga0495619_0071500 | Ga0495619_0071500_1297_1719 | 134 |
| 1012 | 3300053085 | Ga0495619_0072365 | Ga0495619_0072365_1808_2236 | 134 |
| 1013 | 3300053085 | Ga0495619_0140481 | Ga0495619_0140481_540_977 | 134 |
| 1014 | 3300053085 | Ga0495619_0200503 | Ga0495619_0200503_464_892 | 134 |
| 1015 | 3300053085 | Ga0495619_0253765 | Ga0495619_0253765_125_547 | 134 |
| 1016 | 3300061719 | Ga0466962_0101005 | Ga0466962_0101005_511_936 | 134 |
| 1017 | iso_pu_bacteria | 2675903058 | 2676476423 | 134 |
| 1018 | iso_pu_bacteria | 2827628540 | 2827632231 | 134 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4rv2-assembly1.cif.gz_B-2 | crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium smegmatis | 0.9694 | 2 | 133 |
| 4rlj-assembly1.cif.gz_B | crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis | 0.9554 | 1 | 133 |
| 4v12-assembly1.cif.gz_A-2 | crystal structure of the msmeg_6754 dehydratase from mycobacterium smegmatis | 0.9493 | 3 | 133 |
| 5i7n-assembly1.cif.gz_A-2 | maoc-like dehydratase | 0.9491 | 2 | 133 |
| 4rv2-assembly1.cif.gz_B-2 | crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium smegmatis | 0.9484 | 2 | 133 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4rltB00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9589 | 1 | 133 | 3.10.129.10 |
| 4rltB00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9452 | 1 | 133 | 3.10.129.10 |
| 1iq6A00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8848 | 7 | 133 | 3.10.129.10 |
| 4w78F00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8839 | 8 | 133 | 3.10.129.10 |
| 3k67A00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8758 | 6 | 133 | 3.10.129.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1C6VAW7-F1-model_v4 | Acyl dehydratase | 0.9831 | 11 | 133 |
GO:0004312
GO:0005835 GO:0006633 |
| AF-A0A6B3HFS5-F1-model_v4 | Dehydratase | 0.9828 | 34 | 133 |
|
| AF-A0A3M9MAQ5-F1-model_v4 | Acyl dehydratase | 0.9814 | 7 | 133 |
GO:0004312
GO:0005835 GO:0006633 |
| AF-A0A0H3CVT9-F1-model_v4 | MaoC-like dehydratase | 0.9808 | 7 | 133 |
|
| AF-A0A6J7QZ86-F1-model_v4 | Unannotated protein | 0.9808 | 49 | 133 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar