F488307

General Info

Members Datasets Scaffolds Average Seq Length
1018 359 1002 141

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100066882|Ga0070706_1000668823
Length 156
Sequence MYRVLNAGGAGRRRVSDQVSYDDVEVGTELAAVSYPATRLSLVKYCGASGDFNVIHWNERIAKAVGLPDVIAHGMLTMAQAGRFVTDWAGLKATVVDFGVRFSSPVVVPDDDVGASITVSGQVEEKLDGQRVALALTARSADTKVLTRARAVVRLP

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
3 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
4 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
5 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
6 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
7 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
8 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
9 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
10 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
11 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
12 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
13 2891562705 Microbispora tritici MT50 Isolate Unclassified
14 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
15 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
16 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
17 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
18 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
19 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
97 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
112 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
113 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
131 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
132 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
134 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
135 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
190 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
192 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
193 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
194 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
199 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
200 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
201 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
202 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
203 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
204 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
205 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
206 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
207 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
208 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
211 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
212 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
213 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
214 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
215 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
216 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
217 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
218 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
219 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
220 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
221 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
222 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
223 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
224 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
225 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
226 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
228 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
229 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
232 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
233 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
234 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
235 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
236 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
237 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
238 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
239 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
240 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
241 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
242 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
243 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
244 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
245 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
246 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
247 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
248 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
249 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
250 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
251 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
252 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
253 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
254 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
255 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
256 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
257 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
258 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
259 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
260 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
261 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
262 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
263 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
264 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
265 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
266 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
267 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
268 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
269 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
270 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
271 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
272 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
273 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
274 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
275 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
276 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
277 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
278 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
279 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
280 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
281 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
282 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
283 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
284 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
285 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
286 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
287 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
288 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
289 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
290 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
291 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
292 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
293 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
294 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
295 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
296 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
297 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
298 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
299 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
300 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
301 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
302 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
303 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
304 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
305 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
306 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
307 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
308 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
309 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
310 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
311 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
312 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
313 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
314 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
315 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
316 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
317 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
318 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
319 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
320 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
321 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
322 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
323 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
324 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
325 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
326 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
327 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
328 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
329 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
334 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
335 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
336 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
337 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
338 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
339 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
340 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
341 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
342 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
343 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
344 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
345 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
346 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
347 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
348 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
349 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
350 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
351 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
352 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
353 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
354 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
355 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
356 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
357 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
358 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
359 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.64
Metatranscriptomes 0.79
Isolates 1.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 6.48
Rhizosphere 89.69
Stem 0
Stem Tuber 0
Unclassified 3.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214554149 2209111006 Bacteria 530
2 JGI24739J22299_10189010 3300001989 Bacteria 605
3 JGI24735J21928_10056808 3300002067 Bacteria 1127
4 JGI24751J29686_10126986 3300002459 Bacteria 537
5 rootL2_10142042 3300003322 Bacteria 10274
6 Ga0070658_10032694 3300005327 Bacteria 4182
7 Ga0070658_10044055 3300005327 Bacteria 3605
8 Ga0070658_10225084 3300005327 Bacteria 1587
9 Ga0070658_10253449 3300005327 Bacteria 1493
10 Ga0070676_10092694 3300005328 Bacteria 1853
11 Ga0070683_101018472 3300005329 Unclassified 795
12 Ga0070690_101490551 3300005330 Bacteria 546
13 Ga0070670_100007475 3300005331 Bacteria 9280
14 Ga0070677_10211359 3300005333 Bacteria 942
15 Ga0068869_100726819 3300005334 Bacteria 848
16 Ga0070680_100004899 3300005336 Bacteria 10083
17 Ga0070682_100009483 3300005337 Bacteria 5508
18 Ga0070682_100150776 3300005337 Bacteria 1595
19 Ga0070682_100493654 3300005337 Bacteria 947
20 Ga0068868_100009185 3300005338 Bacteria 7101
21 Ga0070660_100059595 3300005339 Bacteria 2960
22 Ga0070689_100219489 3300005340 Bacteria 1559
23 Ga0070689_101853195 3300005340 Bacteria 550
24 Ga0070691_10011813 3300005341 Bacteria 3995
25 Ga0070687_100346910 3300005343 Bacteria 957
26 Ga0070661_100212484 3300005344 Bacteria 1481
27 Ga0070692_10034240 3300005345 Bacteria 2564
28 Ga0070692_10701504 3300005345 Bacteria 681
29 Ga0070669_100878517 3300005353 Bacteria 765
30 Ga0070675_100050464 3300005354 Bacteria 3416
31 Ga0070671_100015144 3300005355 Bacteria 6228
32 Ga0070671_100097248 3300005355 Bacteria 2469
33 Ga0070671_100372804 3300005355 Bacteria 1219
34 Ga0070671_101375458 3300005355 Bacteria 623
35 Ga0070674_101378781 3300005356 Bacteria 631
36 Ga0070673_100078474 3300005364 Bacteria 2671
37 Ga0070659_100000294 3300005366 Bacteria 39077
38 Ga0070659_100054304 3300005366 Bacteria 3155
39 Ga0070659_100820742 3300005366 Bacteria 809
40 Ga0070709_10000253 3300005434 Bacteria 34511
41 Ga0070709_10000434 3300005434 Bacteria 25299
42 Ga0070709_10025318 3300005434 Bacteria 3504
43 Ga0070709_10054857 3300005434 Bacteria 2514
44 Ga0070709_10079002 3300005434 Bacteria 2142
45 Ga0070709_10116365 3300005434 Bacteria 1805
46 Ga0070714_100000011 3300005435 Bacteria 231268
47 Ga0070714_100000182 3300005435 Bacteria 50060
48 Ga0070714_100004885 3300005435 Bacteria 10180
49 Ga0070714_100008057 3300005435 Bacteria 8212
50 Ga0070714_100242249 3300005435 Bacteria 1665
51 Ga0070714_100251763 3300005435 Bacteria 1633
52 Ga0070714_100262839 3300005435 Bacteria 1598
53 Ga0070714_100343593 3300005435 Bacteria 1400
54 Ga0070714_100407355 3300005435 Bacteria 1286
55 Ga0070714_100483828 3300005435 Bacteria 1179
56 Ga0070714_100513028 3300005435 Bacteria 1144
57 Ga0070714_100598772 3300005435 Bacteria 1058
58 Ga0070714_100685190 3300005435 Bacteria 988
59 Ga0070714_101489855 3300005435 Bacteria 661
60 Ga0070713_100018743 3300005436 Bacteria 5265
61 Ga0070713_100020537 3300005436 Bacteria 5066
62 Ga0070713_100058657 3300005436 Bacteria 3211
63 Ga0070713_100064993 3300005436 Bacteria 3063
64 Ga0070713_100096149 3300005436 Bacteria 2556
65 Ga0070713_100105557 3300005436 Bacteria 2447
66 Ga0070713_100117350 3300005436 Bacteria 2329
67 Ga0070713_100149306 3300005436 Bacteria 2077
68 Ga0070713_100187917 3300005436 Bacteria 1860
69 Ga0070713_100253054 3300005436 Bacteria 1607
70 Ga0070713_100354450 3300005436 Bacteria 1362
71 Ga0070713_100401363 3300005436 Bacteria 1280
72 Ga0070713_100414938 3300005436 Bacteria 1259
73 Ga0070713_100585911 3300005436 Bacteria 1058
74 Ga0070713_100783133 3300005436 Bacteria 914
75 Ga0070713_102043879 3300005436 Bacteria 556
76 Ga0070710_10000086 3300005437 Bacteria 41898
77 Ga0070710_10004266 3300005437 Bacteria 6777
78 Ga0070710_10010762 3300005437 Bacteria 4499
79 Ga0070710_10027908 3300005437 Bacteria 3015
80 Ga0070710_10060201 3300005437 Bacteria 2159
81 Ga0070701_10107135 3300005438 Bacteria 1556
82 Ga0070711_100004357 3300005439 Bacteria 8338
83 Ga0070711_100020955 3300005439 Bacteria 4221
84 Ga0070711_100094409 3300005439 Bacteria 2162
85 Ga0070711_100122193 3300005439 Bacteria 1928
86 Ga0070711_100402771 3300005439 Bacteria 1111
87 Ga0070700_100030557 3300005441 Bacteria 3221
88 Ga0070708_100006459 3300005445 Bacteria 9333
89 Ga0070708_100007516 3300005445 Bacteria 8725
90 Ga0070708_100026768 3300005445 Bacteria 4940
91 Ga0070708_100274818 3300005445 Bacteria 1585
92 Ga0070708_100290409 3300005445 Bacteria 1539
93 Ga0070708_100407327 3300005445 Bacteria 1282
94 Ga0070678_100013171 3300005456 Bacteria 5174
95 Ga0070662_101084040 3300005457 Bacteria 687
96 Ga0070681_10025428 3300005458 Bacteria 5955
97 Ga0070681_10091686 3300005458 Bacteria 2989
98 Ga0070681_10276603 3300005458 Bacteria 1590
99 Ga0070681_11031941 3300005458 Bacteria 742
100 Ga0068867_101061770 3300005459 Bacteria 737
101 Ga0070685_10241303 3300005466 Bacteria 1193
102 Ga0070685_10677311 3300005466 Bacteria 750
103 Ga0070706_100007714 3300005467 Bacteria 10063
104 Ga0070706_100020152 3300005467 Bacteria 6145
105 Ga0070706_100032034 3300005467 Bacteria 4848
106 Ga0070706_100048682 3300005467 Bacteria 3911
107 Ga0070706_100066882 3300005467 Bacteria 3324
108 Ga0070706_100067898 3300005467 Bacteria 3297
109 Ga0070706_100111055 3300005467 Bacteria 2551
110 Ga0070706_100142874 3300005467 Bacteria 2234
111 Ga0070706_100269595 3300005467 Bacteria 1589
112 Ga0070706_100270657 3300005467 Bacteria 1585
113 Ga0070706_100287155 3300005467 Bacteria 1535
114 Ga0070706_100428562 3300005467 Bacteria 1231
115 Ga0070707_100001773 3300005468 Bacteria 20734
116 Ga0070707_100006610 3300005468 Bacteria 10757
117 Ga0070707_100014179 3300005468 Bacteria 7468
118 Ga0070707_100031061 3300005468 Bacteria 5086
119 Ga0070707_100050076 3300005468 Bacteria 4004
120 Ga0070707_100227922 3300005468 Bacteria 1814
121 Ga0070707_100300648 3300005468 Bacteria 1559
122 Ga0070707_100392109 3300005468 Bacteria 1348
123 Ga0070707_101383604 3300005468 Bacteria 670
124 Ga0070707_101617993 3300005468 Bacteria 615
125 Ga0070698_100000667 3300005471 Bacteria 36601
126 Ga0070698_100001429 3300005471 Bacteria 26454
127 Ga0070698_100002054 3300005471 Bacteria 22371
128 Ga0070698_100002497 3300005471 Bacteria 20270
129 Ga0070698_100035947 3300005471 Bacteria 5120
130 Ga0070698_100140483 3300005471 Bacteria 2366
131 Ga0070698_100227011 3300005471 Bacteria 1801
132 Ga0070698_100248998 3300005471 Bacteria 1710
133 Ga0070698_101202636 3300005471 Bacteria 707
134 Ga0070699_100274833 3300005518 Bacteria 1508
135 Ga0070699_100535832 3300005518 Bacteria 1065
136 Ga0070679_100014886 3300005530 Bacteria 7474
137 Ga0070679_101016526 3300005530 Bacteria 773
138 Ga0070684_100260300 3300005535 Bacteria 1587
139 Ga0070697_100083774 3300005536 Bacteria 2630
140 Ga0070697_100278305 3300005536 Bacteria 1435
141 Ga0070686_100215457 3300005544 Bacteria 1385
142 Ga0070686_100278301 3300005544 Bacteria 1233
143 Ga0070695_100073990 3300005545 Bacteria 2238
144 Ga0070696_100852164 3300005546 Bacteria 753
145 Ga0070696_101556981 3300005546 Bacteria 567
146 Ga0070693_100003391 3300005547 Bacteria 7415
147 Ga0070693_100180665 3300005547 Bacteria 1358
148 Ga0070665_100225339 3300005548 Bacteria 1875
149 Ga0070665_100403097 3300005548 Bacteria 1376
150 Ga0070665_100410976 3300005548 Bacteria 1362
151 Ga0070665_100416654 3300005548 Bacteria 1352
152 Ga0070665_100785593 3300005548 Bacteria 965
153 Ga0068854_100104028 3300005578 Bacteria 2132
154 Ga0068856_100008148 3300005614 Bacteria 10222
155 Ga0068856_100049636 3300005614 Bacteria 4136
156 Ga0068856_100186630 3300005614 Bacteria 2087
157 Ga0068856_100408967 3300005614 Bacteria 1376
158 Ga0068856_101064683 3300005614 Bacteria 826
159 Ga0068856_101425191 3300005614 Bacteria 707
160 Ga0070702_100032698 3300005615 Bacteria 2856
161 Ga0068852_100010858 3300005616 Bacteria 6825
162 Ga0068852_102027209 3300005616 Bacteria 597
163 Ga0068859_100183303 3300005617 Bacteria 2177
164 Ga0068864_100036758 3300005618 Bacteria 4176
165 Ga0068864_100434046 3300005618 Bacteria 1254
166 Ga0068864_100743937 3300005618 Bacteria 960
167 Ga0068866_10371841 3300005718 Bacteria 914
168 Ga0068866_10655703 3300005718 Bacteria 715
169 Ga0068861_101612378 3300005719 Bacteria 640
170 Ga0068851_10038963 3300005834 Bacteria 2386
171 Ga0068870_10000616 3300005840 Bacteria 13532
172 Ga0068863_100005041 3300005841 Bacteria 13018
173 Ga0068863_100022217 3300005841 Bacteria 6058
174 Ga0068858_100042199 3300005842 Bacteria 4230
175 Ga0068858_100656683 3300005842 Bacteria 1019
176 Ga0068862_102116551 3300005844 Bacteria 574
177 Ga0081455_10000126 3300005937 Bacteria 88702
178 Ga0081455_10000262 3300005937 Bacteria 69313
179 Ga0081455_10002734 3300005937 Bacteria 20806
180 Ga0081455_10041473 3300005937 Bacteria 4047
181 Ga0081455_10078282 3300005937 Bacteria 2717
182 Ga0081455_10688392 3300005937 Bacteria 653
183 Ga0081540_1000101 3300005983 Bacteria 91600
184 Ga0081540_1000843 3300005983 Bacteria 27907
185 Ga0081540_1020980 3300005983 Bacteria 3909
186 Ga0070717_10006245 3300006028 Bacteria 8751
187 Ga0070717_10022373 3300006028 Bacteria 4995
188 Ga0070717_10031631 3300006028 Bacteria 4259
189 Ga0070717_10073876 3300006028 Bacteria 2850
190 Ga0070717_10175280 3300006028 Bacteria 1867
191 Ga0070717_10202456 3300006028 Bacteria 1739
192 Ga0070717_10367575 3300006028 Bacteria 1288
193 Ga0070717_10436855 3300006028 Bacteria 1178
194 Ga0070717_10609427 3300006028 Bacteria 990
195 Ga0070717_10613218 3300006028 Bacteria 987
196 Ga0070717_10843042 3300006028 Bacteria 834
197 Ga0070717_10845137 3300006028 Bacteria 833
198 Ga0070717_10957675 3300006028 Bacteria 779
199 Ga0070717_11031608 3300006028 Bacteria 749
200 Ga0070717_11522283 3300006028 Bacteria 607
201 Ga0075363_100780997 3300006048 Bacteria 580
202 Ga0070716_100000949 3300006173 Bacteria 12560
203 Ga0070716_100010154 3300006173 Bacteria 4714
204 Ga0070716_100028930 3300006173 Bacteria 2990
205 Ga0070716_100340965 3300006173 Bacteria 1057
206 Ga0070712_100000932 3300006175 Bacteria 17601
207 Ga0070712_100001419 3300006175 Bacteria 14579
208 Ga0070712_100029137 3300006175 Bacteria 3699
209 Ga0070712_100057082 3300006175 Bacteria 2741
210 Ga0070712_100108911 3300006175 Bacteria 2063
211 Ga0070712_100170392 3300006175 Bacteria 1689
212 Ga0070712_100288843 3300006175 Bacteria 1323
213 Ga0070712_100391069 3300006175 Bacteria 1146
214 Ga0097621_100006861 3300006237 Bacteria 8099
215 Ga0097621_100106893 3300006237 Bacteria 2361
216 Ga0068871_100822981 3300006358 Bacteria 857
217 Ga0075431_100317545 3300006847 Bacteria 1571
218 Ga0075433_10005917 3300006852 Bacteria 9635
219 Ga0075433_10144476 3300006852 Bacteria 2115
220 Ga0075433_10207675 3300006852 Bacteria 1741
221 Ga0075434_100017763 3300006871 Bacteria 6859
222 Ga0075434_100029062 3300006871 Bacteria 5436
223 Ga0075434_100032095 3300006871 Bacteria 5178
224 Ga0075434_100190107 3300006871 Bacteria 2073
225 Ga0075434_100504867 3300006871 Bacteria 1230
226 Ga0075429_100031894 3300006880 Bacteria 4581
227 Ga0068865_100123585 3300006881 Bacteria 1928
228 Ga0075436_100007917 3300006914 Bacteria 7274
229 Ga0075436_100047869 3300006914 Bacteria 2950
230 Ga0075436_100051647 3300006914 Bacteria 2837
231 Ga0075436_100085466 3300006914 Bacteria 2190
232 Ga0075436_100086513 3300006914 Bacteria 2177
233 Ga0075436_100868649 3300006914 Bacteria 674
234 Ga0097620_100183303 3300006931 Bacteria 2177
235 Ga0075435_100020308 3300007076 Bacteria 5087
236 Ga0075435_100095370 3300007076 Bacteria 2460
237 Ga0075435_100098424 3300007076 Bacteria 2421
238 Ga0075435_101505836 3300007076 Bacteria 590
239 Ga0075435_101947684 3300007076 Bacteria 516
240 Ga0099794_10049578 3300007265 Bacteria 2018
241 Ga0099794_10338708 3300007265 Bacteria 781
242 Ga0105244_10384026 3300009036 Bacteria 646
243 Ga0105240_10176563 3300009093 Bacteria 2525
244 Ga0111539_10251029 3300009094 Bacteria 2060
245 Ga0111539_10653180 3300009094 Bacteria 1225
246 Ga0111539_12470007 3300009094 Bacteria 603
247 Ga0105245_10021492 3300009098 Bacteria 5661
248 Ga0105245_10097796 3300009098 Bacteria 2711
249 Ga0105245_10115944 3300009098 Bacteria 2497
250 Ga0105247_10011206 3300009101 Bacteria 5407
251 Ga0114129_10030888 3300009147 Bacteria 7576
252 Ga0114129_10066059 3300009147 Bacteria 5045
253 Ga0105243_12639048 3300009148 Bacteria 542
254 Ga0105241_10030008 3300009174 Bacteria 4061
255 Ga0105241_11417065 3300009174 Bacteria 666
256 Ga0105248_10084729 3300009177 Bacteria 3566
257 Ga0105248_10167208 3300009177 Bacteria 2478
258 Ga0105248_11820443 3300009177 Bacteria 691
259 Ga0105237_10581341 3300009545 Bacteria 1127
260 Ga0105237_10895643 3300009545 Bacteria 894
261 Ga0105237_11078751 3300009545 Bacteria 810
262 Ga0105237_11286717 3300009545 Bacteria 738
263 Ga0105238_10969213 3300009551 Bacteria 871
264 Ga0105249_10202647 3300009553 Bacteria 1942
265 Ga0105249_10642107 3300009553 Bacteria 1119
266 Ga0105249_11515264 3300009553 Bacteria 743
267 Ga0105239_10794532 3300010375 Bacteria 1084
268 Ga0105239_11213939 3300010375 Bacteria 869
269 Ga0105246_10008603 3300011119 Bacteria 6276
270 Ga0157317_1033960 3300012475 Bacteria 508
271 Ga0157313_1000372 3300012503 Bacteria 2035
272 Ga0157326_1037816 3300012513 Bacteria 666
273 Ga0157371_10019524 3300013102 Bacteria 4996
274 Ga0157370_10264165 3300013104 Bacteria 1590
275 Ga0157370_11292721 3300013104 Bacteria 657
276 Ga0157369_10001599 3300013105 Bacteria 27722
277 Ga0157369_10014305 3300013105 Bacteria 8963
278 Ga0157369_10042657 3300013105 Bacteria 4949
279 Ga0157369_12577353 3300013105 Bacteria 514
280 Ga0157374_10071283 3300013296 Bacteria 3276
281 Ga0157374_10698261 3300013296 Bacteria 1027
282 Ga0157374_11142788 3300013296 Bacteria 800
283 Ga0157374_12757314 3300013296 Bacteria 519
284 Ga0157378_10053740 3300013297 Bacteria 3586
285 Ga0157372_10040844 3300013307 Bacteria 5127
286 Ga0157375_10042216 3300013308 Bacteria 4413
287 Ga0157375_10126714 3300013308 Bacteria 2669
288 Ga0157375_10986929 3300013308 Bacteria 982
289 Ga0157375_11485342 3300013308 Bacteria 800
290 Ga0163163_10024628 3300014325 Bacteria 5729
291 Ga0163163_10126280 3300014325 Bacteria 2596
292 Ga0163163_10657420 3300014325 Bacteria 1111
293 Ga0163163_10774635 3300014325 Bacteria 1023
294 Ga0163163_11484300 3300014325 Bacteria 739
295 Ga0163163_11715215 3300014325 Bacteria 689
296 Ga0182008_10214915 3300014497 Bacteria 982
297 Ga0157377_10014244 3300014745 Bacteria 4042
298 Ga0157377_11146061 3300014745 Bacteria 598
299 Ga0157379_10060646 3300014968 Bacteria 3382
300 Ga0157376_10235371 3300014969 Bacteria 1703
301 Ga0157376_10338798 3300014969 Bacteria 1436
302 Ga0157376_11044398 3300014969 Bacteria 841
303 Ga0197907_10920250 3300020069 Bacteria 3755
304 Ga0197907_11222404 3300020069 Bacteria 954
305 Ga0206356_11243439 3300020070 Bacteria 2032
306 Ga0206354_11131740 3300020081 Bacteria 1131
307 Ga0206353_11710499 3300020082 Bacteria 805
308 Ga0213874_10055042 3300021377 Bacteria 1231
309 Ga0213875_10000362 3300021388 Bacteria 42266
310 Ga0213875_10052768 3300021388 Bacteria 1904
311 Ga0213875_10128443 3300021388 Bacteria 1185
312 Ga0224712_10070335 3300022467 Bacteria 1419
313 Ga0224712_10155038 3300022467 Bacteria 1018
314 Ga0224569_112527 3300022732 Bacteria 594
315 Ga0224572_1000726 3300024225 Bacteria 4266
316 Ga0207656_10053913 3300025321 Bacteria 1746
317 Ga0207656_10215984 3300025321 Bacteria 931
318 Ga0207692_10000423 3300025898 Bacteria 14836
319 Ga0207692_10007321 3300025898 Bacteria 4519
320 Ga0207692_10010821 3300025898 Bacteria 3859
321 Ga0207692_10061574 3300025898 Bacteria 1945
322 Ga0207688_10003789 3300025901 Bacteria 8246
323 Ga0207688_10463221 3300025901 Bacteria 791
324 Ga0207680_10217205 3300025903 Bacteria 1309
325 Ga0207685_10003834 3300025905 Bacteria 3721
326 Ga0207685_10016177 3300025905 Bacteria 2382
327 Ga0207685_10087272 3300025905 Bacteria 1305
328 Ga0207685_10104796 3300025905 Bacteria 1216
329 Ga0207699_10023198 3300025906 Bacteria 3374
330 Ga0207699_10024559 3300025906 Bacteria 3297
331 Ga0207699_10078888 3300025906 Bacteria 2035
332 Ga0207699_10268236 3300025906 Bacteria 1182
333 Ga0207699_10581790 3300025906 Bacteria 814
334 Ga0207699_10636547 3300025906 Bacteria 778
335 Ga0207699_11170277 3300025906 Bacteria 569
336 Ga0207699_11221291 3300025906 Bacteria 557
337 Ga0207645_10075722 3300025907 Bacteria 2154
338 Ga0207643_10000633 3300025908 Bacteria 22093
339 Ga0207705_10010346 3300025909 Bacteria 6785
340 Ga0207705_10014692 3300025909 Bacteria 5631
341 Ga0207684_10001554 3300025910 Bacteria 24539
342 Ga0207684_10003021 3300025910 Bacteria 16674
343 Ga0207684_10013354 3300025910 Bacteria 7105
344 Ga0207684_10016493 3300025910 Bacteria 6343
345 Ga0207684_10017733 3300025910 Bacteria 6107
346 Ga0207684_10019368 3300025910 Bacteria 5823
347 Ga0207684_10036944 3300025910 Bacteria 4146
348 Ga0207684_10076912 3300025910 Bacteria 2837
349 Ga0207684_10077117 3300025910 Bacteria 2833
350 Ga0207684_10166293 3300025910 Bacteria 1901
351 Ga0207684_10338591 3300025910 Bacteria 1296
352 Ga0207684_10354702 3300025910 Bacteria 1262
353 Ga0207684_10467051 3300025910 Bacteria 1083
354 Ga0207684_10478642 3300025910 Bacteria 1068
355 Ga0207684_10885942 3300025910 Bacteria 751
356 Ga0207654_10002204 3300025911 Bacteria 9984
357 Ga0207707_10019993 3300025912 Bacteria 5843
358 Ga0207695_10292433 3300025913 Bacteria 1521
359 Ga0207695_10362363 3300025913 Bacteria 1336
360 Ga0207671_10901874 3300025914 Bacteria 699
361 Ga0207693_10001190 3300025915 Bacteria 23252
362 Ga0207693_10050846 3300025915 Bacteria 3254
363 Ga0207693_10082948 3300025915 Bacteria 2510
364 Ga0207693_10325052 3300025915 Bacteria 1204
365 Ga0207693_10997688 3300025915 Bacteria 639
366 Ga0207663_10007512 3300025916 Bacteria 5656
367 Ga0207663_10012646 3300025916 Bacteria 4569
368 Ga0207663_10017302 3300025916 Bacteria 4013
369 Ga0207663_10036765 3300025916 Bacteria 2947
370 Ga0207663_10229549 3300025916 Bacteria 1355
371 Ga0207663_10251938 3300025916 Bacteria 1300
372 Ga0207663_10279435 3300025916 Bacteria 1240
373 Ga0207660_10033257 3300025917 Bacteria 3565
374 Ga0207662_10244160 3300025918 Bacteria 1176
375 Ga0207657_10024422 3300025919 Bacteria 5595
376 Ga0207657_10245597 3300025919 Bacteria 1428
377 Ga0207649_10001763 3300025920 Bacteria 12405
378 Ga0207652_10009911 3300025921 Bacteria 7667
379 Ga0207646_10000416 3300025922 Bacteria 56976
380 Ga0207646_10005930 3300025922 Bacteria 12744
381 Ga0207646_10014174 3300025922 Bacteria 7579
382 Ga0207646_10058150 3300025922 Bacteria 3454
383 Ga0207646_10118832 3300025922 Bacteria 2374
384 Ga0207646_10121188 3300025922 Bacteria 2350
385 Ga0207646_10300735 3300025922 Bacteria 1450
386 Ga0207646_10315221 3300025922 Bacteria 1413
387 Ga0207646_11522556 3300025922 Bacteria 579
388 Ga0207694_10557197 3300025924 Bacteria 962
389 Ga0207650_10003245 3300025925 Bacteria 11202
390 Ga0207650_10567148 3300025925 Bacteria 953
391 Ga0207659_10058617 3300025926 Bacteria 2764
392 Ga0207687_10060705 3300025927 Bacteria 2668
393 Ga0207700_10000798 3300025928 Bacteria 18207
394 Ga0207700_10001733 3300025928 Bacteria 12393
395 Ga0207700_10005685 3300025928 Bacteria 7485
396 Ga0207700_10006147 3300025928 Bacteria 7233
397 Ga0207700_10006208 3300025928 Bacteria 7203
398 Ga0207700_10032403 3300025928 Bacteria 3727
399 Ga0207700_10061891 3300025928 Bacteria 2840
400 Ga0207700_10121056 3300025928 Bacteria 2122
401 Ga0207700_10256296 3300025928 Bacteria 1496
402 Ga0207700_10257694 3300025928 Bacteria 1492
403 Ga0207700_10264492 3300025928 Bacteria 1474
404 Ga0207700_10458819 3300025928 Bacteria 1124
405 Ga0207700_11876521 3300025928 Bacteria 525
406 Ga0207664_10000001 3300025929 Bacteria 724213
407 Ga0207664_10000312 3300025929 Bacteria 36120
408 Ga0207664_10013970 3300025929 Bacteria 5788
409 Ga0207664_10042710 3300025929 Bacteria 3541
410 Ga0207664_10046972 3300025929 Bacteria 3390
411 Ga0207664_10070125 3300025929 Bacteria 2820
412 Ga0207664_10114702 3300025929 Bacteria 2245
413 Ga0207664_10149920 3300025929 Bacteria 1980
414 Ga0207664_10181856 3300025929 Bacteria 1805
415 Ga0207664_10365069 3300025929 Bacteria 1280
416 Ga0207664_10532416 3300025929 Bacteria 1053
417 Ga0207664_10532457 3300025929 Bacteria 1053
418 Ga0207664_10732425 3300025929 Bacteria 889
419 Ga0207664_11084316 3300025929 Bacteria 716
420 Ga0207664_11118270 3300025929 Bacteria 704
421 Ga0207644_10010707 3300025931 Bacteria 6047
422 Ga0207644_10293975 3300025931 Bacteria 1307
423 Ga0207690_10001825 3300025932 Bacteria 13064
424 Ga0207690_10011542 3300025932 Bacteria 5277
425 Ga0207706_10159937 3300025933 Bacteria 1980
426 Ga0207665_10000815 3300025939 Bacteria 21105
427 Ga0207665_10001422 3300025939 Bacteria 16092
428 Ga0207665_10105536 3300025939 Bacteria 1973
429 Ga0207665_10308546 3300025939 Bacteria 1185
430 Ga0207691_10022176 3300025940 Bacteria 5989
431 Ga0207711_10110258 3300025941 Bacteria 2447
432 Ga0207711_10211113 3300025941 Bacteria 1773
433 Ga0207689_10024826 3300025942 Bacteria 5025
434 Ga0207661_10011594 3300025944 Bacteria 6394
435 Ga0207679_10003642 3300025945 Bacteria 9547
436 Ga0207667_10080046 3300025949 Bacteria 3385
437 Ga0207667_10453799 3300025949 Bacteria 1302
438 Ga0207667_11472512 3300025949 Bacteria 653
439 Ga0207651_10073792 3300025960 Bacteria 2427
440 Ga0207712_10433582 3300025961 Bacteria 1111
441 Ga0207712_11394972 3300025961 Bacteria 627
442 Ga0207668_10375860 3300025972 Bacteria 1195
443 Ga0207677_10004696 3300026023 Bacteria 7363
444 Ga0207639_10123660 3300026041 Bacteria 2130
445 Ga0207678_10003042 3300026067 Bacteria 15169
446 Ga0207678_10553573 3300026067 Bacteria 1006
447 Ga0207702_10005731 3300026078 Bacteria 10825
448 Ga0207702_10019897 3300026078 Bacteria 5561
449 Ga0207702_10035944 3300026078 Bacteria 4142
450 Ga0207702_10637820 3300026078 Bacteria 1047
451 Ga0207702_11545221 3300026078 Bacteria 657
452 Ga0207641_10031395 3300026088 Bacteria 4406
453 Ga0207641_10034914 3300026088 Bacteria 4185
454 Ga0207641_10102827 3300026088 Bacteria 2520
455 Ga0207648_10427487 3300026089 Bacteria 1203
456 Ga0207648_11216410 3300026089 Bacteria 708
457 Ga0207676_10005774 3300026095 Bacteria 8752
458 Ga0207676_10363296 3300026095 Bacteria 1342
459 Ga0207674_10044865 3300026116 Bacteria 4552
460 Ga0207674_10394881 3300026116 Bacteria 1337
461 Ga0207675_100683460 3300026118 Bacteria 1034
462 Ga0207683_10001550 3300026121 Bacteria 20670
463 Ga0207683_10276332 3300026121 Bacteria 1535
464 Ga0207683_10424165 3300026121 Bacteria 1225
465 Ga0207698_10004969 3300026142 Bacteria 8151
466 Ga0207428_10010009 3300027907 Bacteria 8484
467 Ga0268266_10099843 3300028379 Bacteria 2556
468 Ga0268266_10130904 3300028379 Bacteria 2244
469 Ga0268266_10342281 3300028379 Bacteria 1404
470 Ga0268266_10479697 3300028379 Bacteria 1185
471 Ga0265334_10010253 3300028573 Bacteria 3955
472 Ga0265762_1020801 3300030760 Bacteria 1207
473 Ga0316579_10000498 3300031691 Bacteria 12845
474 Ga0316576_10296302 3300031727 Bacteria 1209
475 Ga0307410_10067471 3300031852 Bacteria 2468
476 Ga0326468_10008292 3300031889 Bacteria 1003
477 Ga0307406_10914039 3300031901 Bacteria 748
478 Ga0307407_10625259 3300031903 Bacteria 804
479 Ga0307409_100080150 3300031995 Bacteria 2633
480 Ga0307507_10009639 3300033179 Bacteria 12775
481 Ga0307507_10081778 3300033179 Bacteria 2837
482 Ga0307510_10130120 3300033180 Bacteria 2193
483 Ga0373950_0003712 3300034818 Bacteria 2202
484 Ga0373938_0008119 3300034957 Bacteria 1868
485 Ga0373926_0004292 3300035083 Bacteria 4663
486 Ga0373926_0017432 3300035083 Bacteria 2464
487 Ga0373926_0280457 3300035083 Bacteria 649
488 Ga0373929_0027779 3300035085 Bacteria 1191
489 Ga0373934_0000674 3300035086 Bacteria 12102
490 Ga0373934_0014530 3300035086 Bacteria 2984
491 Ga0373934_0051912 3300035086 Bacteria 1625
492 Ga0373934_0079784 3300035086 Bacteria 1314
493 Ga0373934_0103757 3300035086 Bacteria 1150
494 Ga0373940_0042379 3300035088 Bacteria 1254
495 Ga0373949_0026609 3300035090 Bacteria 1356
496 Ga0373951_0030870 3300035091 Bacteria 1263
497 Ga0373923_0007318 3300035111 Bacteria 3875
498 Ga0373923_0007399 3300035111 Bacteria 3858
499 Ga0373923_0066149 3300035111 Bacteria 1544
500 Ga0373923_0174313 3300035111 Bacteria 986
501 Ga0373923_0199638 3300035111 Bacteria 924
502 Ga0373936_0017038 3300035113 Bacteria 2794
503 Ga0373936_0089158 3300035113 Bacteria 1292
504 Ga0373936_0204095 3300035113 Bacteria 873
505 Ga0373939_0006966 3300035114 Bacteria 2735
506 Ga0373941_0005012 3300035115 Bacteria 3087
507 Ga0373945_0021950 3300035116 Bacteria 2196
508 Ga0373945_0185029 3300035116 Bacteria 859
509 Ga0373953_0003697 3300035117 Bacteria 4803
510 Ga0373953_0019283 3300035117 Bacteria 2535
511 Ga0373953_0039276 3300035117 Bacteria 1875
512 Ga0373953_0043412 3300035117 Bacteria 1794
513 Ga0373954_0022036 3300035118 Bacteria 2888
514 Ga0373954_0242820 3300035118 Bacteria 886
515 Ga0373956_0000440 3300035119 Bacteria 16919
516 Ga0373956_0007167 3300035119 Bacteria 4488
517 Ga0373956_0014248 3300035119 Bacteria 3320
518 Ga0373956_0089716 3300035119 Bacteria 1417
519 Ga0373956_0124717 3300035119 Bacteria 1204
520 Ga0373957_0000394 3300035120 Bacteria 11075
521 Ga0373957_0017224 3300035120 Bacteria 2512
522 Ga0373957_0042923 3300035120 Bacteria 1707
523 Ga0373957_0084253 3300035120 Bacteria 1257
524 Ga0373960_0021997 3300035121 Bacteria 1702
525 Ga0373960_0112962 3300035121 Bacteria 893
526 Ga0373943_0257486 3300035170 Bacteria 981
527 Ga0373943_0702928 3300035170 Bacteria 599
528 Ga0373946_0032311 3300035171 Bacteria 2101
529 Ga0373946_0053773 3300035171 Bacteria 1692
530 Ga0373946_0169421 3300035171 Bacteria 1030
531 Ga0373946_0246891 3300035171 Bacteria 869
532 Ga0373946_0312692 3300035171 Bacteria 779
533 Ga0373946_0395060 3300035171 Bacteria 697
534 Ga0373955_0001622 3300035172 Bacteria 9628
535 Ga0373955_0009312 3300035172 Bacteria 4597
536 Ga0373955_0019045 3300035172 Bacteria 3423
537 Ga0373955_0168220 3300035172 Bacteria 1296
538 Ga0373955_0213173 3300035172 Bacteria 1152
539 Ga0373955_0335344 3300035172 Bacteria 915
540 Ga0373955_0405635 3300035172 Bacteria 828
541 Ga0373955_0562699 3300035172 Bacteria 698
542 Ga0373942_0149361 3300035207 Bacteria 750
543 Ga0373961_0166327 3300035241 Bacteria 760
544 Ga0316574_0053529 3300035398 Bacteria 2520
545 Ga0316574_0057056 3300035398 Bacteria 2444
546 Ga0373924_0001446 3300035410 Bacteria 7709
547 Ga0373924_0006288 3300035410 Bacteria 4248
548 Ga0373924_0049616 3300035410 Bacteria 1737
549 Ga0373924_0068341 3300035410 Bacteria 1495
550 Ga0373924_0116013 3300035410 Bacteria 1160
551 Ga0373931_0045472 3300035691 Bacteria 2318
552 Ga0373931_0064798 3300035691 Bacteria 1979
553 Ga0373931_0110855 3300035691 Bacteria 1557
554 Ga0373935_0014480 3300035692 Bacteria 4758
555 Ga0373935_0034250 3300035692 Bacteria 3165
556 Ga0373935_0143789 3300035692 Bacteria 1613
557 Ga0373933_0000395 3300035724 Bacteria 27686
558 Ga0373933_0001608 3300035724 Bacteria 13212
559 Ga0373933_0011885 3300035724 Bacteria 4806
560 Ga0373933_0046194 3300035724 Bacteria 2584
561 Ga0373933_0050667 3300035724 Bacteria 2479
562 Ga0373933_0057136 3300035724 Bacteria 2344
563 Ga0373933_0336842 3300035724 Bacteria 979
564 Ga0373947_0000004 3300035725 Bacteria 248228
565 Ga0373947_0084539 3300035725 Bacteria 1969
566 Ga0373947_0105811 3300035725 Bacteria 1773
567 Ga0373947_0265423 3300035725 Bacteria 1138
568 Ga0373947_0306613 3300035725 Bacteria 1059
569 Ga0373937_0000112 3300036401 Bacteria 77473
570 Ga0373937_0021836 3300036401 Bacteria 5746
571 Ga0373937_0088112 3300036401 Bacteria 2873
572 Ga0373937_0341344 3300036401 Bacteria 1418
573 Ga0373937_0347766 3300036401 Bacteria 1404
574 Ga0373925_0014724 3300037068 Bacteria 5650
575 Ga0373925_0066450 3300037068 Bacteria 2718
576 Ga0373925_0091250 3300037068 Bacteria 2329
577 Ga0373925_0162179 3300037068 Bacteria 1761
578 Ga0373925_0184564 3300037068 Bacteria 1653
579 Ga0373925_0202570 3300037068 Bacteria 1578
580 Ga0373925_0366965 3300037068 Bacteria 1171
581 Ga0373925_0440518 3300037068 Bacteria 1066
582 Ga0373925_0767328 3300037068 Bacteria 795
583 Ga0373925_1375628 3300037068 Bacteria 578
584 Ga0395900_0798179 3300037418 Bacteria 872
585 Ga0436364_0497431 3300037853 Bacteria 888
586 Ga0436364_0575601 3300037853 Bacteria 4772
587 Ga0436364_0590629 3300037853 Bacteria 766
588 Ga0436364_0750774 3300037853 Bacteria 1675
589 Ga0436364_0804097 3300037853 Bacteria 39998
590 Ga0436364_0845254 3300037853 Bacteria 1362
591 Ga0436364_1042062 3300037853 Bacteria 2394
592 Ga0436364_1241795 3300037853 Bacteria 1696
593 Ga0395901_0115355 3300038443 Bacteria 2821
594 Ga0436365_0020494 3300039437 Bacteria 967
595 Ga0436365_1487927 3300039437 Bacteria 1062
596 Ga0436360_0506992 3300039438 Bacteria 611
597 Ga0436361_0218806 3300039447 Bacteria 1200
598 Ga0436363_0367458 3300039450 Bacteria 1562
599 Ga0436363_0685852 3300039450 Bacteria 1073
600 Ga0436363_1307140 3300039450 Bacteria 515
601 Ga0436363_1321302 3300039450 Bacteria 2222
602 Ga0436363_1555992 3300039450 Bacteria 1290
603 Ga0436363_1662743 3300039450 Bacteria 774
604 Ga0436362_0041956 3300039453 Bacteria 671
605 Ga0451793_0403868 3300041452 Bacteria 609
606 Ga0451802_0252721 3300041460 Bacteria 734
607 Ga0451802_0659795 3300041460 Bacteria 633
608 Ga0451843_0620187 3300041509 Bacteria 548
609 Ga0451853_2247606 3300041512 Bacteria 509
610 Ga0439448_0114577 3300042005 Bacteria 923
611 Ga0439455_0124192 3300042012 Bacteria 725
612 Ga0439463_100419 3300042016 Bacteria 746
613 Ga0439463_164444 3300042016 Bacteria 575
614 Ga0439458_0161692 3300042157 Bacteria 603
615 Ga0439459_0000753 3300042438 Bacteria 4446
616 Ga0439459_0085020 3300042438 Bacteria 752
617 Ga0466969_0195770 3300044656 Bacteria 923
618 Ga0466969_0471313 3300044656 Bacteria 572
619 Ga0466972_0056538 3300044658 Bacteria 1886
620 Ga0466965_0189629 3300044683 Bacteria 1087
621 Ga0466965_0723432 3300044683 Bacteria 572
622 Ga0466966_0028253 3300044684 Bacteria 3655
623 Ga0466966_0117809 3300044684 Bacteria 1633
624 Ga0466966_0363822 3300044684 Bacteria 869
625 Ga0466961_0050345 3300044693 Bacteria 2660
626 Ga0466961_0188603 3300044693 Bacteria 1279
627 Ga0466961_0209376 3300044693 Bacteria 1204
628 Ga0466963_0010418 3300044694 Bacteria 5628
629 Ga0466963_0038035 3300044694 Bacteria 3145
630 Ga0466963_0191173 3300044694 Bacteria 1430
631 Ga0466963_0194720 3300044694 Bacteria 1417
632 Ga0466964_0097028 3300044706 Bacteria 1293
633 Ga0466964_0114153 3300044706 Bacteria 1209
634 Ga0466964_0308794 3300044706 Bacteria 800
635 Ga0466971_0020889 3300044719 Bacteria 2911
636 Ga0466971_0115010 3300044719 Bacteria 1243
637 Ga0466971_0117611 3300044719 Bacteria 1229
638 Ga0466970_0074630 3300044765 Bacteria 1826
639 Ga0466957_0031665 3300044842 Bacteria 3162
640 Ga0466957_0047275 3300044842 Bacteria 2614
641 Ga0466957_0158693 3300044842 Bacteria 1468
642 Ga0466960_0071412 3300044901 Bacteria 1729
643 Ga0466960_0114236 3300044901 Bacteria 1407
644 Ga0466960_0340273 3300044901 Bacteria 853
645 Ga0466959_0034661 3300045049 Bacteria 3734
646 Ga0466959_0198051 3300045049 Bacteria 1399
647 Ga0466958_0049813 3300045836 Bacteria 2535
648 Ga0466958_0061918 3300045836 Bacteria 2280
649 Ga0466958_0107329 3300045836 Bacteria 1741
650 Ga0466958_0436120 3300045836 Bacteria 848
651 Ga0466967_0010205 3300045976 Bacteria 7028
652 Ga0466967_0045499 3300045976 Bacteria 3814
653 Ga0466967_0077947 3300045976 Bacteria 2984
654 Ga0466967_0081934 3300045976 Bacteria 2915
655 Ga0466967_0109228 3300045976 Bacteria 2539
656 Ga0466967_0120753 3300045976 Bacteria 2421
657 Ga0466967_0199443 3300045976 Bacteria 1895
658 Ga0466967_0207505 3300045976 Bacteria 1857
659 Ga0466967_0323759 3300045976 Bacteria 1487
660 Ga0466967_0385136 3300045976 Bacteria 1362
661 Ga0466967_0742497 3300045976 Bacteria 973
662 Ga0495592_0001455 3300046454 Bacteria 16462
663 Ga0495592_0007331 3300046454 Bacteria 8250
664 Ga0495592_0031243 3300046454 Bacteria 4025
665 Ga0495592_0064943 3300046454 Bacteria 2673
666 Ga0495592_0129668 3300046454 Bacteria 1765
667 Ga0495592_0595574 3300046454 Bacteria 675
668 Ga0495603_0474382 3300046455 Bacteria 716
669 Ga0495629_0003377 3300046459 Bacteria 12067
670 Ga0495629_0015076 3300046459 Bacteria 5555
671 Ga0495629_0025772 3300046459 Bacteria 4178
672 Ga0495641_0009158 3300046461 Bacteria 5920
673 Ga0495641_0012173 3300046461 Bacteria 4833
674 Ga0495641_0063786 3300046461 Bacteria 1660
675 Ga0495641_0134931 3300046461 Bacteria 1102
676 Ga0495651_0000614 3300046462 Bacteria 27686
677 Ga0495651_0044722 3300046462 Bacteria 3431
678 Ga0495651_0076191 3300046462 Bacteria 2541
679 Ga0495651_0115830 3300046462 Bacteria 1975
680 Ga0495651_0248035 3300046462 Bacteria 1217
681 Ga0495653_0005337 3300046463 Bacteria 10459
682 Ga0495653_0017535 3300046463 Bacteria 5822
683 Ga0495653_0020711 3300046463 Bacteria 5327
684 Ga0495653_0060635 3300046463 Bacteria 2865
685 Ga0495653_0091505 3300046463 Bacteria 2223
686 Ga0495653_0192235 3300046463 Bacteria 1391
687 Ga0495653_0500902 3300046463 Bacteria 757
688 Ga0495653_0793646 3300046463 Bacteria 569
689 Ga0495580_0295072 3300046472 Bacteria 1104
690 Ga0495580_0435779 3300046472 Bacteria 880
691 Ga0495582_0000633 3300046473 Bacteria 19392
692 Ga0495582_0018939 3300046473 Bacteria 3766
693 Ga0495582_0121544 3300046473 Bacteria 1471
694 Ga0495582_0633239 3300046473 Bacteria 619
695 Ga0495639_0071634 3300046475 Bacteria 1601
696 Ga0495639_0195717 3300046475 Bacteria 988
697 Ga0495639_0476023 3300046475 Bacteria 636
698 Ga0495662_0002306 3300046476 Bacteria 9617
699 Ga0495662_0176990 3300046476 Bacteria 1051
700 Ga0495662_0357194 3300046476 Bacteria 718
701 Ga0495664_0035879 3300046477 Bacteria 2921
702 Ga0495664_0103917 3300046477 Bacteria 1712
703 Ga0495664_0135073 3300046477 Bacteria 1494
704 Ga0495664_0199036 3300046477 Bacteria 1214
705 Ga0495664_0216373 3300046477 Bacteria 1160
706 Ga0495664_0337844 3300046477 Bacteria 908
707 Ga0495585_0403769 3300046492 Bacteria 658
708 Ga0495608_0001069 3300046511 Bacteria 19294
709 Ga0495608_0001601 3300046511 Bacteria 16213
710 Ga0495608_0023206 3300046511 Bacteria 4253
711 Ga0495608_0026488 3300046511 Bacteria 3951
712 Ga0495608_0073754 3300046511 Bacteria 2225
713 Ga0495608_0112239 3300046511 Bacteria 1752
714 Ga0495618_0090381 3300046514 Bacteria 1958
715 Ga0495618_0138204 3300046514 Bacteria 1558
716 Ga0495618_0163081 3300046514 Bacteria 1420
717 Ga0495618_0163346 3300046514 Bacteria 1419
718 Ga0495618_0185289 3300046514 Bacteria 1321
719 Ga0495618_0187179 3300046514 Bacteria 1314
720 Ga0495618_0275484 3300046514 Bacteria 1050
721 Ga0495628_0001819 3300046516 Bacteria 19354
722 Ga0495628_0006554 3300046516 Bacteria 10159
723 Ga0495628_0075381 3300046516 Bacteria 2627
724 Ga0495628_0144151 3300046516 Bacteria 1816
725 Ga0495628_0221997 3300046516 Bacteria 1419
726 Ga0495628_0259717 3300046516 Bacteria 1295
727 Ga0495628_0559341 3300046516 Bacteria 820
728 Ga0495628_0570329 3300046516 Bacteria 811
729 Ga0495630_0014583 3300046517 Bacteria 5727
730 Ga0495630_0035351 3300046517 Bacteria 3734
731 Ga0495630_0046422 3300046517 Bacteria 3247
732 Ga0495630_0345675 3300046517 Bacteria 1138
733 Ga0495666_0043774 3300046526 Bacteria 2162
734 Ga0495666_0330050 3300046526 Bacteria 688
735 Ga0495652_0001605 3300046529 Bacteria 24694
736 Ga0495652_0047090 3300046529 Bacteria 3699
737 Ga0495652_0087251 3300046529 Bacteria 2559
738 Ga0495652_0137351 3300046529 Bacteria 1927
739 Ga0495652_0156758 3300046529 Bacteria 1772
740 Ga0495652_0170625 3300046529 Bacteria 1679
741 Ga0495652_0247817 3300046529 Bacteria 1321
742 Ga0495652_0528856 3300046529 Bacteria 814
743 Ga0495665_0000862 3300046531 Bacteria 15866
744 Ga0495665_0006105 3300046531 Bacteria 6501
745 Ga0495665_0040631 3300046531 Bacteria 2476
746 Ga0495665_0101249 3300046531 Bacteria 1512
747 Ga0495665_0395392 3300046531 Bacteria 701
748 Ga0495640_0032162 3300046533 Bacteria 3738
749 Ga0495640_0052316 3300046533 Bacteria 2805
750 Ga0495640_0053319 3300046533 Bacteria 2772
751 Ga0495640_0064663 3300046533 Bacteria 2472
752 Ga0495640_0108982 3300046533 Bacteria 1811
753 Ga0495640_0156918 3300046533 Bacteria 1460
754 Ga0495640_0358306 3300046533 Bacteria 899
755 Ga0495640_0405067 3300046533 Bacteria 837
756 Ga0495586_0008277 3300046535 Bacteria 5538
757 Ga0495586_0078499 3300046535 Bacteria 1811
758 Ga0495586_0306961 3300046535 Bacteria 909
759 Ga0495587_0000038 3300046536 Bacteria 116118
760 Ga0495587_0009607 3300046536 Bacteria 6189
761 Ga0495587_0014385 3300046536 Bacteria 4965
762 Ga0495587_0091105 3300046536 Bacteria 1761
763 Ga0495645_0024129 3300046543 Bacteria 4411
764 Ga0495645_0104876 3300046543 Bacteria 2006
765 Ga0495645_0307514 3300046543 Bacteria 1033
766 Ga0495645_0432137 3300046543 Bacteria 834
767 Ga0495645_0536564 3300046543 Bacteria 727
768 Ga0495622_0050337 3300046557 Bacteria 1933
769 Ga0495667_0001336 3300046559 Bacteria 16196
770 Ga0495667_0006455 3300046559 Bacteria 7962
771 Ga0495667_0065274 3300046559 Bacteria 2381
772 Ga0495667_0077073 3300046559 Bacteria 2168
773 Ga0495667_0205778 3300046559 Bacteria 1258
774 Ga0495634_0010165 3300046642 Bacteria 6905
775 Ga0495634_0098056 3300046642 Bacteria 1896
776 Ga0495634_0384838 3300046642 Bacteria 835
777 Ga0495635_0010821 3300046663 Bacteria 6391
778 Ga0495635_0093700 3300046663 Bacteria 2054
779 Ga0495635_0134179 3300046663 Bacteria 1687
780 Ga0495635_0154432 3300046663 Bacteria 1562
781 Ga0495635_0177618 3300046663 Bacteria 1447
782 Ga0495635_0178752 3300046663 Bacteria 1442
783 Ga0495635_0507850 3300046663 Bacteria 793
784 Ga0495635_0858320 3300046663 Bacteria 583
785 Ga0495588_0199784 3300046674 Bacteria 1056
786 Ga0495657_0001650 3300046675 Bacteria 19175
787 Ga0495657_0003778 3300046675 Bacteria 12258
788 Ga0495657_0010062 3300046675 Bacteria 7130
789 Ga0495657_0040982 3300046675 Bacteria 3172
790 Ga0495657_0052746 3300046675 Bacteria 2724
791 Ga0495657_0241636 3300046675 Bacteria 1089
792 Ga0495599_0000758 3300046678 Bacteria 18206
793 Ga0495599_0005598 3300046678 Bacteria 7530
794 Ga0495599_0030015 3300046678 Bacteria 3409
795 Ga0495599_0175492 3300046678 Bacteria 1321
796 Ga0495623_0000989 3300046679 Bacteria 19179
797 Ga0495623_0024334 3300046679 Bacteria 3902
798 Ga0495623_0034857 3300046679 Bacteria 3227
799 Ga0495623_0205097 3300046679 Bacteria 1131
800 Ga0495646_0007896 3300046680 Bacteria 6759
801 Ga0495646_0011284 3300046680 Bacteria 5674
802 Ga0495646_0036410 3300046680 Bacteria 3048
803 Ga0495646_0062099 3300046680 Bacteria 2222
804 Ga0495646_0081477 3300046680 Bacteria 1886
805 Ga0495646_0343986 3300046680 Bacteria 782
806 Ga0495647_0080666 3300046681 Bacteria 1319
807 Ga0495647_0097127 3300046681 Bacteria 1215
808 Ga0495658_0015048 3300046683 Bacteria 3964
809 Ga0495658_0033565 3300046683 Bacteria 2812
810 Ga0495658_0232418 3300046683 Bacteria 1156
811 Ga0495658_0616450 3300046683 Bacteria 695
812 Ga0495669_0002047 3300046684 Bacteria 8268
813 Ga0495613_0025110 3300046689 Bacteria 4440
814 Ga0495613_0086135 3300046689 Bacteria 2278
815 Ga0495613_0173570 3300046689 Bacteria 1529
816 Ga0495624_0007371 3300046690 Bacteria 7726
817 Ga0495624_0288964 3300046690 Bacteria 989
818 Ga0495671_0497409 3300046692 Unclassified 582
819 Ga0495649_0134897 3300046694 Bacteria 1302
820 Ga0495600_0003680 3300046809 Bacteria 9058
821 Ga0495600_0014627 3300046809 Bacteria 4946
822 Ga0495600_0022141 3300046809 Bacteria 4078
823 Ga0495600_0039149 3300046809 Bacteria 3087
824 Ga0495600_0833804 3300046809 Bacteria 547
825 Ga0495581_0011292 3300047315 Bacteria 5165
826 Ga0495581_0021500 3300047315 Bacteria 3738
827 Ga0495581_0022089 3300047315 Bacteria 3687
828 Ga0495581_0256013 3300047315 Bacteria 1024
829 Ga0495604_0001351 3300047317 Bacteria 20054
830 Ga0495604_0017594 3300047317 Bacteria 5722
831 Ga0495604_0023708 3300047317 Bacteria 4897
832 Ga0495604_0215741 3300047317 Bacteria 1324
833 Ga0495604_0237975 3300047317 Bacteria 1246
834 Ga0495604_0295461 3300047317 Bacteria 1089
835 Ga0495604_0398917 3300047317 Bacteria 906
836 Ga0495674_0016775 3300047319 Bacteria 6832
837 Ga0495674_0041489 3300047319 Bacteria 4110
838 Ga0495674_0097709 3300047319 Bacteria 2501
839 Ga0495674_0102293 3300047319 Bacteria 2436
840 Ga0495674_0115625 3300047319 Bacteria 2270
841 Ga0495674_0348943 3300047319 Bacteria 1201
842 Ga0495674_1180129 3300047319 Bacteria 579
843 Ga0495676_0085381 3300047321 Bacteria 2378
844 Ga0495676_0182973 3300047321 Bacteria 1467
845 Ga0495676_0225727 3300047321 Bacteria 1289
846 Ga0495680_0003762 3300047322 Bacteria 14765
847 Ga0495680_0011520 3300047322 Bacteria 7821
848 Ga0495680_0023051 3300047322 Bacteria 5181
849 Ga0495680_0056902 3300047322 Bacteria 3026
850 Ga0495680_0072113 3300047322 Bacteria 2627
851 Ga0495680_0149388 3300047322 Bacteria 1705
852 Ga0495680_0177064 3300047322 Bacteria 1541
853 Ga0495680_0432478 3300047322 Bacteria 903
854 Ga0495675_0004390 3300047444 Bacteria 8535
855 Ga0495675_0010355 3300047444 Bacteria 5829
856 Ga0495675_0053342 3300047444 Bacteria 2566
857 Ga0495684_0005912 3300047471 Bacteria 9510
858 Ga0495684_0013098 3300047471 Bacteria 6400
859 Ga0495684_0032003 3300047471 Bacteria 4037
860 Ga0495684_0066376 3300047471 Bacteria 2743
861 Ga0495684_0099432 3300047471 Bacteria 2199
862 Ga0495684_0628275 3300047471 Bacteria 721
863 Ga0495593_0036689 3300047673 Bacteria 2656
864 Ga0495593_0059361 3300047673 Bacteria 2004
865 Ga0495602_0003390 3300048088 Bacteria 16477
866 Ga0495602_0015662 3300048088 Bacteria 7642
867 Ga0495602_0060055 3300048088 Bacteria 3315
868 Ga0495602_0092006 3300048088 Bacteria 2513
869 Ga0495602_0269413 3300048088 Bacteria 1259
870 Ga0495602_0917701 3300048088 Bacteria 582
871 Ga0495614_0035350 3300048089 Bacteria 2146
872 Ga0495614_0037064 3300048089 Bacteria 2092
873 Ga0496100_0077467 3300048903 Bacteria 2235
874 Ga0496100_0095470 3300048903 Bacteria 2038
875 Ga0496101_0663850 3300048904 Bacteria 824
876 Ga0496101_0726020 3300048904 Bacteria 784
877 Ga0496101_1353754 3300048904 Bacteria 556
878 Ga0496102_0006711 3300048905 Bacteria 9830
879 Ga0496102_0073700 3300048905 Bacteria 3137
880 Ga0496102_0089034 3300048905 Bacteria 2855
881 Ga0496102_0223491 3300048905 Bacteria 1775
882 Ga0496102_0394250 3300048905 Bacteria 1302
883 Ga0496102_1123997 3300048905 Bacteria 705
884 Ga0496103_0089253 3300048906 Bacteria 1944
885 Ga0496103_0168404 3300048906 Bacteria 1406
886 Ga0496103_0400992 3300048906 Bacteria 881
887 Ga0496104_0005668 3300048907 Bacteria 10935
888 Ga0496104_0015590 3300048907 Bacteria 6888
889 Ga0496104_0022073 3300048907 Bacteria 5849
890 Ga0496104_0129027 3300048907 Bacteria 2428
891 Ga0496104_0257572 3300048907 Bacteria 1658
892 Ga0496105_0002576 3300048908 Bacteria 13179
893 Ga0496105_0008991 3300048908 Bacteria 7791
894 Ga0496105_0178037 3300048908 Bacteria 1741
895 Ga0496105_0366172 3300048908 Bacteria 1149
896 Ga0496106_0050968 3300048909 Bacteria 3120
897 Ga0496107_0036160 3300048910 Bacteria 3542
898 Ga0496107_0407922 3300048910 Bacteria 1010
899 Ga0496108_0007310 3300048911 Bacteria 8953
900 Ga0496108_0040237 3300048911 Bacteria 3895
901 Ga0496108_0262005 3300048911 Bacteria 1504
902 Ga0496108_0353118 3300048911 Bacteria 1283
903 Ga0496109_0004986 3300048912 Bacteria 11085
904 Ga0496109_0014629 3300048912 Bacteria 6827
905 Ga0496109_0078270 3300048912 Bacteria 3044
906 Ga0496109_0084140 3300048912 Bacteria 2934
907 Ga0496109_1709205 3300048912 Bacteria 563
908 Ga0496110_0021499 3300048913 Bacteria 5464
909 Ga0496110_0043890 3300048913 Bacteria 3903
910 Ga0496110_0206755 3300048913 Bacteria 1784
911 Ga0496110_0750083 3300048913 Bacteria 879
912 Ga0496111_0002632 3300048914 Bacteria 10881
913 Ga0496111_0003235 3300048914 Bacteria 10049
914 Ga0496111_0062158 3300048914 Bacteria 2708
915 Ga0496111_0166729 3300048914 Bacteria 1636
916 Ga0496112_0053873 3300048915 Bacteria 3951
917 Ga0496112_0079656 3300048915 Bacteria 3240
918 Ga0496112_0146193 3300048915 Bacteria 2332
919 Ga0496112_0272233 3300048915 Bacteria 1641
920 Ga0496112_0428303 3300048915 Bacteria 1261
921 Ga0496113_0004926 3300048916 Bacteria 8270
922 Ga0496113_0039381 3300048916 Bacteria 3479
923 Ga0496113_0052376 3300048916 Bacteria 3048
924 Ga0496113_0063676 3300048916 Bacteria 2787
925 Ga0496113_0083015 3300048916 Bacteria 2458
926 Ga0496114_0131714 3300048917 Bacteria 2160
927 Ga0496114_0286983 3300048917 Bacteria 1452
928 Ga0496114_0290306 3300048917 Bacteria 1443
929 Ga0496114_0376630 3300048917 Bacteria 1256
930 Ga0496114_0438910 3300048917 Bacteria 1156
931 Ga0496114_0731256 3300048917 Bacteria 866
932 Ga0496114_1382866 3300048917 Bacteria 591
933 Ga0496114_1397064 3300048917 Bacteria 587
934 Ga0496115_0006183 3300048918 Bacteria 8757
935 Ga0496115_0091770 3300048918 Bacteria 2482
936 Ga0496126_0000075 3300048929 Bacteria 235121
937 Ga0496126_0184550 3300048929 Bacteria 1770
938 Ga0496126_0682930 3300048929 Bacteria 800
939 Ga0501039_0811278 3300049575 Bacteria 730
940 Ga0501040_1229364 3300049576 Bacteria 544
941 Ga0501042_0008915 3300049578 Bacteria 6655
942 Ga0501047_0000150 3300049581 Bacteria 85101
943 Ga0501068_0135885 3300049584 Bacteria 1540
944 Ga0501069_0208878 3300049585 Bacteria 1133
945 Ga0501072_0833119 3300049588 Bacteria 722
946 Ga0501076_0102642 3300049592 Bacteria 2306
947 Ga0501077_0484835 3300049593 Bacteria 792
948 Ga0501077_1050332 3300049593 Bacteria 524
949 Ga0501079_0291713 3300049741 Bacteria 1276
950 Ga0501080_0835409 3300049742 Bacteria 806
951 Ga0501081_0222502 3300049743 Bacteria 1373
952 nmdc:mga03n38_431597_c1 3300050490 Bacteria 730
953 nmdc:mga07m45_65750_c1 3300050496 Bacteria 1123
954 nmdc:mga05p37_127039_c1 3300050507 Bacteria 1933
955 nmdc:mga05p37_67522_c1 3300050507 Bacteria 4399
956 nmdc:mga09592_486514_c1 3300050508 Bacteria 1063
957 nmdc:mga09592_752305_c1 3300050508 Bacteria 827
958 nmdc:mga06r32_1144457_c1 3300050510 Bacteria 726
959 nmdc:mga06r32_496570_c1 3300050510 Bacteria 1198
960 nmdc:mga06r32_797052_c1 3300050510 Bacteria 906
961 nmdc:mga08y16_228436_c1 3300050511 Bacteria 1925
962 nmdc:mga08y16_70532_c1 3300050511 Bacteria 3643
963 nmdc:mga0n895_109127_c1 3300050512 Bacteria 2783
964 nmdc:mga0n895_13493_c1 3300050512 Bacteria 7375
965 nmdc:mga0n895_53228_c1 3300050512 Bacteria 3977
966 nmdc:mga0n895_7079_c1 3300050512 Bacteria 9585
967 nmdc:mga0rr50_1040_c1 3300050513 Bacteria 15044
968 nmdc:mga0rr50_19349_c1 3300050513 Bacteria 4594
969 nmdc:mga0rr50_30445_c1 3300050513 Bacteria 3821
970 nmdc:mga0rr50_64018_c1 3300050513 Bacteria 2780
971 nmdc:mga08x19_16197_c1 3300050514 Bacteria 4544
972 nmdc:mga08x19_252903_c1 3300050514 Bacteria 1217
973 nmdc:mga08x19_662974_c1 3300050514 Bacteria 740
974 nmdc:mga08x19_673088_c1 3300050514 Bacteria 734
975 nmdc:mga08x19_97392_c1 3300050514 Bacteria 1948
976 nmdc:mga0a205_35541_c1 3300050515 Bacteria 4785
977 nmdc:mga0a205_57226_c1 3300050515 Bacteria 3765
978 Ga0495601_0001775 3300053077 Bacteria 11951
979 Ga0495601_0031216 3300053077 Bacteria 3311
980 Ga0495601_0139521 3300053077 Bacteria 1581
981 Ga0495601_0440666 3300053077 Bacteria 843
982 Ga0495612_0026415 3300053078 Bacteria 2333
983 Ga0495612_0039803 3300053078 Bacteria 1913
984 Ga0495612_0141308 3300053078 Bacteria 1044
985 Ga0495612_0244731 3300053078 Bacteria 797
986 Ga0495612_0414061 3300053078 Bacteria 613
987 Ga0495595_0000411 3300053084 Bacteria 16271
988 Ga0495595_0005457 3300053084 Bacteria 5148
989 Ga0495595_0007476 3300053084 Bacteria 4474
990 Ga0495595_0340782 3300053084 Bacteria 756
991 Ga0495595_0635307 3300053084 Bacteria 546
992 Ga0495619_0030461 3300053085 Bacteria 3493
993 Ga0495619_0037658 3300053085 Bacteria 3153
994 Ga0495619_0071500 3300053085 Bacteria 2322
995 Ga0495619_0072365 3300053085 Bacteria 2309
996 Ga0495619_0140481 3300053085 Bacteria 1663
997 Ga0495619_0200503 3300053085 Bacteria 1381
998 Ga0495619_0253765 3300053085 Bacteria 1219
999 Ga0501082_1260829 3300060353 Bacteria 646
1000 Ga0466962_0101005 3300061719 Bacteria 1385
1001 Ga0466962_0208872 3300061719 Bacteria 955
1002 Ga0530510_0561862 3300061734 Bacteria 867

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025925 Ga0207650_10567148 Ga0207650_105671482 109
2 3300044684 Ga0466966_0363822 Ga0466966_0363822_482_841 114
3 3300044658 Ga0466972_0056538 Ga0466972_0056538_348_758 119
4 3300046533 Ga0495640_0405067 Ga0495640_0405067_448_825 119
5 3300048917 Ga0496114_1382866 Ga0496114_1382866_35_463 119
6 3300049592 Ga0501076_0102642 Ga0501076_0102642_149_526 119
7 3300049593 Ga0501077_1050332 Ga0501077_1050332_17_394 119
8 3300049741 Ga0501079_0291713 Ga0501079_0291713_381_758 119
9 3300049743 Ga0501081_0222502 Ga0501081_0222502_861_1238 119
10 3300060353 Ga0501082_1260829 Ga0501082_1260829_258_635 119
11 3300005937 Ga0081455_10000262 Ga0081455_1000026225 120
12 3300030760 Ga0265762_1020801 Ga0265762_10208012 121
13 3300046683 Ga0495658_0616450 Ga0495658_0616450_130_540 121
14 3300005355 Ga0070671_101375458 Ga0070671_1013754581 123
15 3300005548 Ga0070665_100410976 Ga0070665_1004109762 123
16 3300005618 Ga0068864_100434046 Ga0068864_1004340462 123
17 3300005841 Ga0068863_100022217 Ga0068863_1000222178 123
18 3300009177 Ga0105248_10167208 Ga0105248_101672086 123
19 3300009545 Ga0105237_10581341 Ga0105237_105813412 123
20 3300014325 Ga0163163_10657420 Ga0163163_106574202 123
21 3300014745 Ga0157377_11146061 Ga0157377_111460611 123
22 3300025941 Ga0207711_10211113 Ga0207711_102111134 123
23 3300026088 Ga0207641_10034914 Ga0207641_100349147 123
24 3300026095 Ga0207676_10363296 Ga0207676_103632963 123
25 3300028379 Ga0268266_10130904 Ga0268266_101309043 123
26 3300046492 Ga0495585_0403769 Ga0495585_0403769_98_484 123
27 3300048907 Ga0496104_0129027 Ga0496104_0129027_1214_1615 123
28 3300048908 Ga0496105_0366172 Ga0496105_0366172_484_885 123
29 3300048915 Ga0496112_0272233 Ga0496112_0272233_1142_1543 123
30 3300048915 Ga0496112_0428303 Ga0496112_0428303_174_575 123
31 3300048916 Ga0496113_0083015 Ga0496113_0083015_722_1123 123
32 3300005333 Ga0070677_10211359 Ga0070677_102113591 124
33 3300009098 Ga0105245_10097796 Ga0105245_100977961 124
34 3300025909 Ga0207705_10010346 Ga0207705_1001034610 124
35 3300044694 Ga0466963_0010418 Ga0466963_0010418_4708_5106 124
36 3300044719 Ga0466971_0020889 Ga0466971_0020889_1637_2035 124
37 3300044842 Ga0466957_0158693 Ga0466957_0158693_645_1043 124
38 3300045836 Ga0466958_0107329 Ga0466958_0107329_901_1299 124
39 3300045976 Ga0466967_0120753 Ga0466967_0120753_1594_1992 124
40 3300046557 Ga0495622_0050337 Ga0495622_0050337_808_1233 124
41 iso_pu_bacteria 2891326441 2891331554 124
42 3300009545 Ga0105237_11286717 Ga0105237_112867172 125
43 3300026078 Ga0207702_11545221 Ga0207702_115452212 125
44 iso_pu_bacteria 2728369276 2729906704 125
45 3300031852 Ga0307410_10067471 Ga0307410_100674714 126
46 3300031889 Ga0326468_10008292 Ga0326468_100082922 126
47 3300031901 Ga0307406_10914039 Ga0307406_109140392 126
48 3300031903 Ga0307407_10625259 Ga0307407_106252591 126
49 3300031995 Ga0307409_100080150 Ga0307409_1000801502 126
50 3300041460 Ga0451802_0252721 Ga0451802_0252721_274_678 126
51 3300042016 Ga0439463_164444 Ga0439463_164444_72_467 126
52 3300042157 Ga0439458_0161692 Ga0439458_0161692_23_418 126
53 3300042438 Ga0439459_0085020 Ga0439459_0085020_142_537 126
54 3300046684 Ga0495669_0002047 Ga0495669_0002047_3887_4306 126
55 iso_pu_bacteria 2795385470 2795781386 126
56 3300005435 Ga0070714_100000182 Ga0070714_1000001821 128
57 3300005436 Ga0070713_100187917 Ga0070713_1001879172 128
58 3300005467 Ga0070706_100428562 Ga0070706_1004285622 128
59 3300005718 Ga0068866_10655703 Ga0068866_106557031 128
60 3300005937 Ga0081455_10000126 Ga0081455_1000012617 128
61 3300005937 Ga0081455_10041473 Ga0081455_100414732 128
62 3300005983 Ga0081540_1020980 Ga0081540_10209802 128
63 3300006028 Ga0070717_10031631 Ga0070717_100316312 128
64 3300006028 Ga0070717_10613218 Ga0070717_106132182 128
65 3300025906 Ga0207699_11170277 Ga0207699_111702772 128
66 3300025910 Ga0207684_10467051 Ga0207684_104670512 128
67 3300025915 Ga0207693_10997688 Ga0207693_109976882 128
68 3300025928 Ga0207700_10032403 Ga0207700_100324032 128
69 3300025928 Ga0207700_10458819 Ga0207700_104588192 128
70 3300025928 Ga0207700_11876521 Ga0207700_118765211 128
71 3300025929 Ga0207664_10046972 Ga0207664_100469725 128
72 3300025929 Ga0207664_10732425 Ga0207664_107324252 128
73 3300026116 Ga0207674_10394881 Ga0207674_103948811 128
74 3300033179 Ga0307507_10009639 Ga0307507_100096393 128
75 3300033180 Ga0307510_10130120 Ga0307510_101301201 128
76 3300044684 Ga0466966_0117809 Ga0466966_0117809_671_1078 128
77 3300044693 Ga0466961_0050345 Ga0466961_0050345_2134_2541 128
78 3300045049 Ga0466959_0034661 Ga0466959_0034661_436_843 128
79 3300045976 Ga0466967_0045499 Ga0466967_0045499_1387_1791 128
80 3300045976 Ga0466967_0742497 Ga0466967_0742497_472_873 128
81 3300046809 Ga0495600_0833804 Ga0495600_0833804_11_412 128
82 3300005435 Ga0070714_101489855 Ga0070714_1014898551 129
83 3300013105 Ga0157369_12577353 Ga0157369_125773531 129
84 3300025929 Ga0207664_11118270 Ga0207664_111182702 129
85 3300041512 Ga0451853_2247606 Ga0451853_2247606_58_462 129
86 3300045976 Ga0466967_0207505 Ga0466967_0207505_668_1090 129
87 3300005327 Ga0070658_10032694 Ga0070658_100326943 130
88 3300014325 Ga0163163_11715215 Ga0163163_117152152 130
89 3300020082 Ga0206353_11710499 Ga0206353_117104992 130
90 3300025901 Ga0207688_10463221 Ga0207688_104632212 130
91 3300025919 Ga0207657_10245597 Ga0207657_102455972 130
92 3300044683 Ga0466965_0723432 Ga0466965_0723432_20_427 130
93 3300044684 Ga0466966_0028253 Ga0466966_0028253_1080_1502 130
94 3300044693 Ga0466961_0209376 Ga0466961_0209376_297_704 130
95 3300044706 Ga0466964_0097028 Ga0466964_0097028_11_427 130
96 3300044706 Ga0466964_0308794 Ga0466964_0308794_20_436 130
97 3300044719 Ga0466971_0115010 Ga0466971_0115010_107_523 130
98 3300044842 Ga0466957_0031665 Ga0466957_0031665_1564_1980 130
99 3300044901 Ga0466960_0114236 Ga0466960_0114236_771_1187 130
100 3300045049 Ga0466959_0198051 Ga0466959_0198051_613_1035 130
101 3300045836 Ga0466958_0061918 Ga0466958_0061918_718_1134 130
102 3300045976 Ga0466967_0010205 Ga0466967_0010205_3718_4134 130
103 3300045976 Ga0466967_0077947 Ga0466967_0077947_1209_1625 130
104 3300045976 Ga0466967_0109228 Ga0466967_0109228_1536_1952 130
105 3300045976 Ga0466967_0199443 Ga0466967_0199443_1173_1589 130
106 3300061719 Ga0466962_0208872 Ga0466962_0208872_157_573 130
107 3300061734 Ga0530510_0561862 Ga0530510_0561862_254_664 130
108 iso_pu_bacteria 2919446982 2919449282 130
109 3300012475 Ga0157317_1033960 Ga0157317_10339601 131
110 3300035172 Ga0373955_0405635 Ga0373955_0405635_200_673 131
111 3300035398 Ga0316574_0057056 Ga0316574_0057056_1305_1715 131
112 3300046689 Ga0495613_0173570 Ga0495613_0173570_405_908 131
113 iso_pu_bacteria 2818991472 2819742225 131
114 3300001989 JGI24739J22299_10189010 JGI24739J22299_101890101 132
115 3300002067 JGI24735J21928_10056808 JGI24735J21928_100568083 132
116 3300005327 Ga0070658_10225084 Ga0070658_102250842 132
117 3300014325 Ga0163163_10024628 Ga0163163_100246288 132
118 3300037418 Ga0395900_0798179 Ga0395900_0798179_13_435 132
119 3300038443 Ga0395901_0115355 Ga0395901_0115355_264_686 132
120 3300049575 Ga0501039_0811278 Ga0501039_0811278_62_484 132
121 3300049576 Ga0501040_1229364 Ga0501040_1229364_71_490 132
122 3300049588 Ga0501072_0833119 Ga0501072_0833119_42_464 132
123 iso_pu_bacteria 8056207758 8056210767 132
124 3300005330 Ga0070690_101490551 Ga0070690_1014905511 133
125 3300005337 Ga0070682_100150776 Ga0070682_1001507762 133
126 3300005345 Ga0070692_10701504 Ga0070692_107015041 133
127 3300005356 Ga0070674_101378781 Ga0070674_1013787811 133
128 3300005366 Ga0070659_100000294 Ga0070659_10000029445 133
129 3300005434 Ga0070709_10116365 Ga0070709_101163652 133
130 3300005435 Ga0070714_100000011 Ga0070714_10000001138 133
131 3300005435 Ga0070714_100251763 Ga0070714_1002517633 133
132 3300005436 Ga0070713_102043879 Ga0070713_1020438791 133
133 3300005445 Ga0070708_100007516 Ga0070708_1000075166 133
134 3300005459 Ga0068867_101061770 Ga0068867_1010617701 133
135 3300005466 Ga0070685_10677311 Ga0070685_106773112 133
136 3300005467 Ga0070706_100032034 Ga0070706_1000320345 133
137 3300005468 Ga0070707_100006610 Ga0070707_1000066105 133
138 3300005471 Ga0070698_100002497 Ga0070698_1000024977 133
139 3300005546 Ga0070696_100852164 Ga0070696_1008521641 133
140 3300005842 Ga0068858_100656683 Ga0068858_1006566832 133
141 3300005937 Ga0081455_10002734 Ga0081455_100027349 133
142 3300006028 Ga0070717_10006245 Ga0070717_100062456 133
143 3300006028 Ga0070717_11031608 Ga0070717_110316082 133
144 3300006173 Ga0070716_100340965 Ga0070716_1003409652 133
145 3300006871 Ga0075434_100504867 Ga0075434_1005048672 133
146 3300007076 Ga0075435_101947684 Ga0075435_1019476841 133
147 3300009098 Ga0105245_10115944 Ga0105245_101159443 133
148 3300009545 Ga0105237_10895643 Ga0105237_108956432 133
149 3300009545 Ga0105237_11078751 Ga0105237_110787511 133
150 3300009551 Ga0105238_10969213 Ga0105238_109692131 133
151 3300009553 Ga0105249_11515264 Ga0105249_115152641 133
152 3300013296 Ga0157374_10698261 Ga0157374_106982613 133
153 3300013296 Ga0157374_11142788 Ga0157374_111427882 133
154 3300013297 Ga0157378_10053740 Ga0157378_100537403 133
155 3300013308 Ga0157375_10126714 Ga0157375_101267142 133
156 3300013308 Ga0157375_10986929 Ga0157375_109869291 133
157 3300014325 Ga0163163_10774635 Ga0163163_107746352 133
158 3300014325 Ga0163163_11484300 Ga0163163_114843001 133
159 3300014969 Ga0157376_10235371 Ga0157376_102353712 133
160 3300014969 Ga0157376_10338798 Ga0157376_103387982 133
161 3300025321 Ga0207656_10215984 Ga0207656_102159842 133
162 3300025905 Ga0207685_10087272 Ga0207685_100872722 133
163 3300025906 Ga0207699_11221291 Ga0207699_112212912 133
164 3300025910 Ga0207684_10013354 Ga0207684_100133544 133
165 3300025913 Ga0207695_10292433 Ga0207695_102924332 133
166 3300025914 Ga0207671_10901874 Ga0207671_109018742 133
167 3300025916 Ga0207663_10251938 Ga0207663_102519382 133
168 3300025922 Ga0207646_10005930 Ga0207646_1000593012 133
169 3300025929 Ga0207664_10000001 Ga0207664_10000001472 133
170 3300025929 Ga0207664_10365069 Ga0207664_103650692 133
171 3300025932 Ga0207690_10001825 Ga0207690_1000182512 133
172 3300025961 Ga0207712_11394972 Ga0207712_113949721 133
173 3300026089 Ga0207648_10427487 Ga0207648_104274871 133
174 3300026121 Ga0207683_10276332 Ga0207683_102763324 133
175 3300028573 Ga0265334_10010253 Ga0265334_100102534 133
176 3300031691 Ga0316579_10000498 Ga0316579_100004984 133
177 3300041452 Ga0451793_0403868 Ga0451793_0403868_156_584 133
178 3300041460 Ga0451802_0659795 Ga0451802_0659795_90_515 133
179 3300044656 Ga0466969_0195770 Ga0466969_0195770_416_850 133
180 3300044656 Ga0466969_0471313 Ga0466969_0471313_69_494 133
181 3300044693 Ga0466961_0188603 Ga0466961_0188603_841_1257 133
182 3300044694 Ga0466963_0194720 Ga0466963_0194720_751_1167 133
183 3300044765 Ga0466970_0074630 Ga0466970_0074630_267_692 133
184 3300045976 Ga0466967_0081934 Ga0466967_0081934_1465_1890 133
185 3300045976 Ga0466967_0323759 Ga0466967_0323759_446_871 133
186 3300046461 Ga0495641_0063786 Ga0495641_0063786_530_958 133
187 3300046463 Ga0495653_0500902 Ga0495653_0500902_277_702 133
188 3300046473 Ga0495582_0633239 Ga0495582_0633239_53_478 133
189 3300046511 Ga0495608_0112239 Ga0495608_0112239_769_1194 133
190 3300046543 Ga0495645_0536564 Ga0495645_0536564_38_466 133
191 3300046681 Ga0495647_0080666 Ga0495647_0080666_53_481 133
192 3300046692 Ga0495671_0497409 Ga0495671_0497409_27_452 133
193 3300046694 Ga0495649_0134897 Ga0495649_0134897_857_1282 133
194 3300047315 Ga0495581_0256013 Ga0495581_0256013_324_749 133
195 3300047322 Ga0495680_0149388 Ga0495680_0149388_411_836 133
196 3300048088 Ga0495602_0917701 Ga0495602_0917701_110_535 133
197 3300048904 Ga0496101_0663850 Ga0496101_0663850_339_767 133
198 3300048904 Ga0496101_1353754 Ga0496101_1353754_101_526 133
199 3300048905 Ga0496102_0223491 Ga0496102_0223491_792_1220 133
200 3300048905 Ga0496102_0394250 Ga0496102_0394250_156_581 133
201 3300048905 Ga0496102_1123997 Ga0496102_1123997_146_571 133
202 3300048906 Ga0496103_0400992 Ga0496103_0400992_141_566 133
203 3300048907 Ga0496104_0005668 Ga0496104_0005668_7914_8342 133
204 3300048911 Ga0496108_0040237 Ga0496108_0040237_264_692 133
205 3300048911 Ga0496108_0353118 Ga0496108_0353118_101_526 133
206 3300048912 Ga0496109_0004986 Ga0496109_0004986_3819_4247 133
207 3300048912 Ga0496109_1709205 Ga0496109_1709205_112_537 133
208 3300048913 Ga0496110_0021499 Ga0496110_0021499_2053_2481 133
209 3300048914 Ga0496111_0003235 Ga0496111_0003235_3111_3539 133
210 3300048916 Ga0496113_0052376 Ga0496113_0052376_688_1116 133
211 3300048917 Ga0496114_0131714 Ga0496114_0131714_1274_1699 133
212 3300048917 Ga0496114_0286983 Ga0496114_0286983_521_946 133
213 3300048917 Ga0496114_0290306 Ga0496114_0290306_952_1380 133
214 3300048917 Ga0496114_0438910 Ga0496114_0438910_626_1051 133
215 3300048917 Ga0496114_0731256 Ga0496114_0731256_349_774 133
216 3300049584 Ga0501068_0135885 Ga0501068_0135885_586_1014 133
217 3300049593 Ga0501077_0484835 Ga0501077_0484835_340_765 133
218 3300053084 Ga0495595_0635307 Ga0495595_0635307_22_450 133
219 iso_pu_bacteria 2675903060 2676489675 133
220 iso_pu_bacteria 2856741275 2856746097 133
221 iso_pu_bacteria 2873314349 2873314734 133
222 iso_pu_bacteria 2891395885 2891400146 133
223 iso_pu_bacteria 2891554331 2891559908 133
224 iso_pu_bacteria 2891562705 2891567307 133
225 iso_pu_bacteria 2895427314 2895433000 133
226 iso_pu_bacteria 8055172936 8055178716 133
227 2209111006 2214554149 2213601212 134
228 3300002459 JGI24751J29686_10126986 JGI24751J29686_101269861 134
229 3300003322 rootL2_10142042 rootL2_1014204212 134
230 3300005327 Ga0070658_10044055 Ga0070658_100440552 134
231 3300005327 Ga0070658_10253449 Ga0070658_102534491 134
232 3300005328 Ga0070676_10092694 Ga0070676_100926942 134
233 3300005329 Ga0070683_101018472 Ga0070683_1010184722 134
234 3300005331 Ga0070670_100007475 Ga0070670_1000074756 134
235 3300005334 Ga0068869_100726819 Ga0068869_1007268191 134
236 3300005336 Ga0070680_100004899 Ga0070680_10000489910 134
237 3300005337 Ga0070682_100009483 Ga0070682_1000094833 134
238 3300005337 Ga0070682_100493654 Ga0070682_1004936542 134
239 3300005338 Ga0068868_100009185 Ga0068868_1000091857 134
240 3300005339 Ga0070660_100059595 Ga0070660_1000595951 134
241 3300005340 Ga0070689_100219489 Ga0070689_1002194893 134
242 3300005340 Ga0070689_101853195 Ga0070689_1018531951 134
243 3300005341 Ga0070691_10011813 Ga0070691_100118132 134
244 3300005343 Ga0070687_100346910 Ga0070687_1003469102 134
245 3300005344 Ga0070661_100212484 Ga0070661_1002124842 134
246 3300005345 Ga0070692_10034240 Ga0070692_100342402 134
247 3300005353 Ga0070669_100878517 Ga0070669_1008785171 134
248 3300005354 Ga0070675_100050464 Ga0070675_1000504643 134
249 3300005355 Ga0070671_100015144 Ga0070671_1000151443 134
250 3300005355 Ga0070671_100097248 Ga0070671_1000972485 134
251 3300005355 Ga0070671_100372804 Ga0070671_1003728041 134
252 3300005364 Ga0070673_100078474 Ga0070673_1000784742 134
253 3300005366 Ga0070659_100054304 Ga0070659_1000543042 134
254 3300005366 Ga0070659_100820742 Ga0070659_1008207422 134
255 3300005434 Ga0070709_10000253 Ga0070709_1000025325 134
256 3300005434 Ga0070709_10000434 Ga0070709_100004342 134
257 3300005434 Ga0070709_10025318 Ga0070709_100253186 134
258 3300005434 Ga0070709_10054857 Ga0070709_100548573 134
259 3300005434 Ga0070709_10079002 Ga0070709_100790022 134
260 3300005435 Ga0070714_100004885 Ga0070714_10000488510 134
261 3300005435 Ga0070714_100008057 Ga0070714_1000080576 134
262 3300005435 Ga0070714_100242249 Ga0070714_1002422492 134
263 3300005435 Ga0070714_100262839 Ga0070714_1002628392 134
264 3300005435 Ga0070714_100343593 Ga0070714_1003435932 134
265 3300005435 Ga0070714_100407355 Ga0070714_1004073553 134
266 3300005435 Ga0070714_100483828 Ga0070714_1004838282 134
267 3300005435 Ga0070714_100513028 Ga0070714_1005130281 134
268 3300005435 Ga0070714_100598772 Ga0070714_1005987722 134
269 3300005435 Ga0070714_100685190 Ga0070714_1006851902 134
270 3300005436 Ga0070713_100018743 Ga0070713_1000187433 134
271 3300005436 Ga0070713_100020537 Ga0070713_1000205373 134
272 3300005436 Ga0070713_100058657 Ga0070713_1000586574 134
273 3300005436 Ga0070713_100064993 Ga0070713_1000649934 134
274 3300005436 Ga0070713_100096149 Ga0070713_1000961493 134
275 3300005436 Ga0070713_100105557 Ga0070713_1001055573 134
276 3300005436 Ga0070713_100117350 Ga0070713_1001173503 134
277 3300005436 Ga0070713_100149306 Ga0070713_1001493062 134
278 3300005436 Ga0070713_100253054 Ga0070713_1002530542 134
279 3300005436 Ga0070713_100354450 Ga0070713_1003544502 134
280 3300005436 Ga0070713_100401363 Ga0070713_1004013632 134
281 3300005436 Ga0070713_100414938 Ga0070713_1004149382 134
282 3300005436 Ga0070713_100585911 Ga0070713_1005859112 134
283 3300005436 Ga0070713_100783133 Ga0070713_1007831332 134
284 3300005437 Ga0070710_10000086 Ga0070710_1000008614 134
285 3300005437 Ga0070710_10004266 Ga0070710_100042662 134
286 3300005437 Ga0070710_10010762 Ga0070710_100107621 134
287 3300005437 Ga0070710_10027908 Ga0070710_100279082 134
288 3300005437 Ga0070710_10060201 Ga0070710_100602015 134
289 3300005438 Ga0070701_10107135 Ga0070701_101071354 134
290 3300005439 Ga0070711_100004357 Ga0070711_1000043576 134
291 3300005439 Ga0070711_100020955 Ga0070711_1000209554 134
292 3300005439 Ga0070711_100094409 Ga0070711_1000944092 134
293 3300005439 Ga0070711_100122193 Ga0070711_1001221932 134
294 3300005439 Ga0070711_100402771 Ga0070711_1004027712 134
295 3300005441 Ga0070700_100030557 Ga0070700_1000305573 134
296 3300005445 Ga0070708_100006459 Ga0070708_1000064596 134
297 3300005445 Ga0070708_100026768 Ga0070708_1000267687 134
298 3300005445 Ga0070708_100274818 Ga0070708_1002748182 134
299 3300005445 Ga0070708_100290409 Ga0070708_1002904092 134
300 3300005445 Ga0070708_100407327 Ga0070708_1004073271 134
301 3300005456 Ga0070678_100013171 Ga0070678_1000131715 134
302 3300005457 Ga0070662_101084040 Ga0070662_1010840402 134
303 3300005458 Ga0070681_10025428 Ga0070681_100254282 134
304 3300005458 Ga0070681_10091686 Ga0070681_100916865 134
305 3300005458 Ga0070681_10276603 Ga0070681_102766032 134
306 3300005458 Ga0070681_11031941 Ga0070681_110319412 134
307 3300005466 Ga0070685_10241303 Ga0070685_102413032 134
308 3300005467 Ga0070706_100007714 Ga0070706_1000077142 134
309 3300005467 Ga0070706_100020152 Ga0070706_10002015210 134
310 3300005467 Ga0070706_100048682 Ga0070706_1000486824 134
311 3300005467 Ga0070706_100066882 Ga0070706_1000668823 134
312 3300005467 Ga0070706_100067898 Ga0070706_1000678985 134
313 3300005467 Ga0070706_100111055 Ga0070706_1001110553 134
314 3300005467 Ga0070706_100142874 Ga0070706_1001428742 134
315 3300005467 Ga0070706_100269595 Ga0070706_1002695952 134
316 3300005467 Ga0070706_100270657 Ga0070706_1002706571 134
317 3300005467 Ga0070706_100287155 Ga0070706_1002871551 134
318 3300005468 Ga0070707_100001773 Ga0070707_10000177323 134
319 3300005468 Ga0070707_100014179 Ga0070707_1000141792 134
320 3300005468 Ga0070707_100031061 Ga0070707_1000310613 134
321 3300005468 Ga0070707_100050076 Ga0070707_1000500763 134
322 3300005468 Ga0070707_100227922 Ga0070707_1002279222 134
323 3300005468 Ga0070707_100300648 Ga0070707_1003006482 134
324 3300005468 Ga0070707_100392109 Ga0070707_1003921094 134
325 3300005468 Ga0070707_101383604 Ga0070707_1013836042 134
326 3300005468 Ga0070707_101617993 Ga0070707_1016179931 134
327 3300005471 Ga0070698_100000667 Ga0070698_10000066725 134
328 3300005471 Ga0070698_100001429 Ga0070698_1000014298 134
329 3300005471 Ga0070698_100002054 Ga0070698_10000205415 134
330 3300005471 Ga0070698_100035947 Ga0070698_1000359474 134
331 3300005471 Ga0070698_100140483 Ga0070698_1001404833 134
332 3300005471 Ga0070698_100227011 Ga0070698_1002270112 134
333 3300005471 Ga0070698_100248998 Ga0070698_1002489982 134
334 3300005471 Ga0070698_101202636 Ga0070698_1012026361 134
335 3300005518 Ga0070699_100274833 Ga0070699_1002748334 134
336 3300005518 Ga0070699_100535832 Ga0070699_1005358322 134
337 3300005530 Ga0070679_100014886 Ga0070679_1000148863 134
338 3300005530 Ga0070679_101016526 Ga0070679_1010165261 134
339 3300005535 Ga0070684_100260300 Ga0070684_1002603002 134
340 3300005536 Ga0070697_100083774 Ga0070697_1000837745 134
341 3300005536 Ga0070697_100278305 Ga0070697_1002783052 134
342 3300005544 Ga0070686_100215457 Ga0070686_1002154572 134
343 3300005544 Ga0070686_100278301 Ga0070686_1002783012 134
344 3300005545 Ga0070695_100073990 Ga0070695_1000739906 134
345 3300005546 Ga0070696_101556981 Ga0070696_1015569811 134
346 3300005547 Ga0070693_100003391 Ga0070693_1000033917 134
347 3300005547 Ga0070693_100180665 Ga0070693_1001806652 134
348 3300005548 Ga0070665_100225339 Ga0070665_1002253394 134
349 3300005548 Ga0070665_100403097 Ga0070665_1004030972 134
350 3300005548 Ga0070665_100416654 Ga0070665_1004166542 134
351 3300005548 Ga0070665_100785593 Ga0070665_1007855931 134
352 3300005578 Ga0068854_100104028 Ga0068854_1001040282 134
353 3300005614 Ga0068856_100008148 Ga0068856_1000081487 134
354 3300005614 Ga0068856_100049636 Ga0068856_1000496363 134
355 3300005614 Ga0068856_100186630 Ga0068856_1001866302 134
356 3300005614 Ga0068856_100408967 Ga0068856_1004089671 134
357 3300005614 Ga0068856_101064683 Ga0068856_1010646832 134
358 3300005614 Ga0068856_101425191 Ga0068856_1014251912 134
359 3300005615 Ga0070702_100032698 Ga0070702_1000326982 134
360 3300005616 Ga0068852_100010858 Ga0068852_1000108586 134
361 3300005616 Ga0068852_102027209 Ga0068852_1020272091 134
362 3300005617 Ga0068859_100183303 Ga0068859_1001833036 134
363 3300005618 Ga0068864_100036758 Ga0068864_1000367586 134
364 3300005618 Ga0068864_100743937 Ga0068864_1007439372 134
365 3300005718 Ga0068866_10371841 Ga0068866_103718412 134
366 3300005719 Ga0068861_101612378 Ga0068861_1016123781 134
367 3300005834 Ga0068851_10038963 Ga0068851_100389632 134
368 3300005840 Ga0068870_10000616 Ga0068870_1000061615 134
369 3300005841 Ga0068863_100005041 Ga0068863_10000504115 134
370 3300005842 Ga0068858_100042199 Ga0068858_1000421993 134
371 3300005844 Ga0068862_102116551 Ga0068862_1021165511 134
372 3300005937 Ga0081455_10078282 Ga0081455_100782825 134
373 3300005937 Ga0081455_10688392 Ga0081455_106883921 134
374 3300005983 Ga0081540_1000101 Ga0081540_100010182 134
375 3300005983 Ga0081540_1000843 Ga0081540_100084312 134
376 3300006028 Ga0070717_10022373 Ga0070717_100223739 134
377 3300006028 Ga0070717_10073876 Ga0070717_100738765 134
378 3300006028 Ga0070717_10175280 Ga0070717_101752802 134
379 3300006028 Ga0070717_10202456 Ga0070717_102024563 134
380 3300006028 Ga0070717_10367575 Ga0070717_103675752 134
381 3300006028 Ga0070717_10436855 Ga0070717_104368552 134
382 3300006028 Ga0070717_10609427 Ga0070717_106094272 134
383 3300006028 Ga0070717_10843042 Ga0070717_108430422 134
384 3300006028 Ga0070717_10845137 Ga0070717_108451372 134
385 3300006028 Ga0070717_10957675 Ga0070717_109576752 134
386 3300006028 Ga0070717_11522283 Ga0070717_115222832 134
387 3300006048 Ga0075363_100780997 Ga0075363_1007809971 134
388 3300006173 Ga0070716_100000949 Ga0070716_1000009494 134
389 3300006173 Ga0070716_100010154 Ga0070716_1000101544 134
390 3300006173 Ga0070716_100028930 Ga0070716_1000289304 134
391 3300006175 Ga0070712_100000932 Ga0070712_1000009322 134
392 3300006175 Ga0070712_100001419 Ga0070712_1000014199 134
393 3300006175 Ga0070712_100029137 Ga0070712_1000291373 134
394 3300006175 Ga0070712_100057082 Ga0070712_1000570822 134
395 3300006175 Ga0070712_100108911 Ga0070712_1001089113 134
396 3300006175 Ga0070712_100170392 Ga0070712_1001703922 134
397 3300006175 Ga0070712_100288843 Ga0070712_1002888432 134
398 3300006175 Ga0070712_100391069 Ga0070712_1003910692 134
399 3300006237 Ga0097621_100006861 Ga0097621_1000068612 134
400 3300006237 Ga0097621_100106893 Ga0097621_1001068935 134
401 3300006358 Ga0068871_100822981 Ga0068871_1008229812 134
402 3300006847 Ga0075431_100317545 Ga0075431_1003175452 134
403 3300006852 Ga0075433_10005917 Ga0075433_1000591712 134
404 3300006852 Ga0075433_10144476 Ga0075433_101444763 134
405 3300006852 Ga0075433_10207675 Ga0075433_102076753 134
406 3300006871 Ga0075434_100017763 Ga0075434_1000177637 134
407 3300006871 Ga0075434_100029062 Ga0075434_1000290626 134
408 3300006871 Ga0075434_100032095 Ga0075434_1000320956 134
409 3300006871 Ga0075434_100190107 Ga0075434_1001901072 134
410 3300006880 Ga0075429_100031894 Ga0075429_1000318946 134
411 3300006881 Ga0068865_100123585 Ga0068865_1001235853 134
412 3300006914 Ga0075436_100007917 Ga0075436_1000079177 134
413 3300006914 Ga0075436_100047869 Ga0075436_1000478694 134
414 3300006914 Ga0075436_100051647 Ga0075436_1000516473 134
415 3300006914 Ga0075436_100085466 Ga0075436_1000854663 134
416 3300006914 Ga0075436_100086513 Ga0075436_1000865133 134
417 3300006914 Ga0075436_100868649 Ga0075436_1008686491 134
418 3300006931 Ga0097620_100183303 Ga0097620_1001833036 134
419 3300007076 Ga0075435_100020308 Ga0075435_1000203088 134
420 3300007076 Ga0075435_100095370 Ga0075435_1000953703 134
421 3300007076 Ga0075435_100098424 Ga0075435_1000984244 134
422 3300007076 Ga0075435_101505836 Ga0075435_1015058362 134
423 3300007265 Ga0099794_10049578 Ga0099794_100495784 134
424 3300007265 Ga0099794_10338708 Ga0099794_103387082 134
425 3300009036 Ga0105244_10384026 Ga0105244_103840262 134
426 3300009093 Ga0105240_10176563 Ga0105240_101765636 134
427 3300009094 Ga0111539_10251029 Ga0111539_102510293 134
428 3300009094 Ga0111539_10653180 Ga0111539_106531802 134
429 3300009094 Ga0111539_12470007 Ga0111539_124700071 134
430 3300009098 Ga0105245_10021492 Ga0105245_100214921 134
431 3300009101 Ga0105247_10011206 Ga0105247_100112066 134
432 3300009147 Ga0114129_10030888 Ga0114129_100308884 134
433 3300009147 Ga0114129_10066059 Ga0114129_100660595 134
434 3300009148 Ga0105243_12639048 Ga0105243_126390481 134
435 3300009174 Ga0105241_10030008 Ga0105241_100300083 134
436 3300009174 Ga0105241_11417065 Ga0105241_114170652 134
437 3300009177 Ga0105248_10084729 Ga0105248_100847296 134
438 3300009177 Ga0105248_11820443 Ga0105248_118204431 134
439 3300009553 Ga0105249_10202647 Ga0105249_102026476 134
440 3300009553 Ga0105249_10642107 Ga0105249_106421073 134
441 3300010375 Ga0105239_10794532 Ga0105239_107945322 134
442 3300010375 Ga0105239_11213939 Ga0105239_112139392 134
443 3300011119 Ga0105246_10008603 Ga0105246_100086036 134
444 3300012503 Ga0157313_1000372 Ga0157313_10003722 134
445 3300012513 Ga0157326_1037816 Ga0157326_10378162 134
446 3300013102 Ga0157371_10019524 Ga0157371_100195243 134
447 3300013104 Ga0157370_10264165 Ga0157370_102641651 134
448 3300013104 Ga0157370_11292721 Ga0157370_112927211 134
449 3300013105 Ga0157369_10001599 Ga0157369_1000159924 134
450 3300013105 Ga0157369_10014305 Ga0157369_1001430510 134
451 3300013105 Ga0157369_10042657 Ga0157369_100426576 134
452 3300013296 Ga0157374_10071283 Ga0157374_100712836 134
453 3300013296 Ga0157374_12757314 Ga0157374_127573141 134
454 3300013307 Ga0157372_10040844 Ga0157372_100408448 134
455 3300013308 Ga0157375_10042216 Ga0157375_100422165 134
456 3300013308 Ga0157375_11485342 Ga0157375_114853422 134
457 3300014325 Ga0163163_10126280 Ga0163163_101262802 134
458 3300014497 Ga0182008_10214915 Ga0182008_102149152 134
459 3300014745 Ga0157377_10014244 Ga0157377_100142442 134
460 3300014968 Ga0157379_10060646 Ga0157379_100606466 134
461 3300014969 Ga0157376_11044398 Ga0157376_110443982 134
462 3300020069 Ga0197907_10920250 Ga0197907_109202502 134
463 3300020069 Ga0197907_11222404 Ga0197907_112224042 134
464 3300020070 Ga0206356_11243439 Ga0206356_112434391 134
465 3300020081 Ga0206354_11131740 Ga0206354_111317402 134
466 3300021377 Ga0213874_10055042 Ga0213874_100550423 134
467 3300021388 Ga0213875_10000362 Ga0213875_1000036227 134
468 3300021388 Ga0213875_10052768 Ga0213875_100527685 134
469 3300021388 Ga0213875_10128443 Ga0213875_101284433 134
470 3300022467 Ga0224712_10070335 Ga0224712_100703352 134
471 3300022467 Ga0224712_10155038 Ga0224712_101550381 134
472 3300022732 Ga0224569_112527 Ga0224569_1125271 134
473 3300024225 Ga0224572_1000726 Ga0224572_10007262 134
474 3300025321 Ga0207656_10053913 Ga0207656_100539132 134
475 3300025898 Ga0207692_10000423 Ga0207692_100004233 134
476 3300025898 Ga0207692_10007321 Ga0207692_100073212 134
477 3300025898 Ga0207692_10010821 Ga0207692_100108212 134
478 3300025898 Ga0207692_10061574 Ga0207692_100615742 134
479 3300025901 Ga0207688_10003789 Ga0207688_100037896 134
480 3300025903 Ga0207680_10217205 Ga0207680_102172052 134
481 3300025905 Ga0207685_10003834 Ga0207685_100038343 134
482 3300025905 Ga0207685_10016177 Ga0207685_100161772 134
483 3300025905 Ga0207685_10104796 Ga0207685_101047963 134
484 3300025906 Ga0207699_10023198 Ga0207699_100231983 134
485 3300025906 Ga0207699_10024559 Ga0207699_100245592 134
486 3300025906 Ga0207699_10078888 Ga0207699_100788884 134
487 3300025906 Ga0207699_10268236 Ga0207699_102682362 134
488 3300025906 Ga0207699_10581790 Ga0207699_105817902 134
489 3300025906 Ga0207699_10636547 Ga0207699_106365472 134
490 3300025907 Ga0207645_10075722 Ga0207645_100757222 134
491 3300025908 Ga0207643_10000633 Ga0207643_1000063313 134
492 3300025909 Ga0207705_10014692 Ga0207705_100146926 134
493 3300025910 Ga0207684_10001554 Ga0207684_1000155422 134
494 3300025910 Ga0207684_10003021 Ga0207684_1000302118 134
495 3300025910 Ga0207684_10016493 Ga0207684_1001649310 134
496 3300025910 Ga0207684_10017733 Ga0207684_100177336 134
497 3300025910 Ga0207684_10019368 Ga0207684_100193685 134
498 3300025910 Ga0207684_10036944 Ga0207684_100369444 134
499 3300025910 Ga0207684_10076912 Ga0207684_100769122 134
500 3300025910 Ga0207684_10077117 Ga0207684_100771172 134
501 3300025910 Ga0207684_10166293 Ga0207684_101662932 134
502 3300025910 Ga0207684_10338591 Ga0207684_103385913 134
503 3300025910 Ga0207684_10354702 Ga0207684_103547022 134
504 3300025910 Ga0207684_10478642 Ga0207684_104786422 134
505 3300025910 Ga0207684_10885942 Ga0207684_108859421 134
506 3300025911 Ga0207654_10002204 Ga0207654_100022042 134
507 3300025912 Ga0207707_10019993 Ga0207707_100199935 134
508 3300025913 Ga0207695_10362363 Ga0207695_103623632 134
509 3300025915 Ga0207693_10001190 Ga0207693_100011902 134
510 3300025915 Ga0207693_10050846 Ga0207693_100508464 134
511 3300025915 Ga0207693_10082948 Ga0207693_100829485 134
512 3300025915 Ga0207693_10325052 Ga0207693_103250523 134
513 3300025916 Ga0207663_10007512 Ga0207663_100075122 134
514 3300025916 Ga0207663_10012646 Ga0207663_100126462 134
515 3300025916 Ga0207663_10017302 Ga0207663_100173023 134
516 3300025916 Ga0207663_10036765 Ga0207663_100367652 134
517 3300025916 Ga0207663_10229549 Ga0207663_102295492 134
518 3300025916 Ga0207663_10279435 Ga0207663_102794352 134
519 3300025917 Ga0207660_10033257 Ga0207660_100332573 134
520 3300025918 Ga0207662_10244160 Ga0207662_102441602 134
521 3300025919 Ga0207657_10024422 Ga0207657_100244228 134
522 3300025920 Ga0207649_10001763 Ga0207649_100017637 134
523 3300025921 Ga0207652_10009911 Ga0207652_100099117 134
524 3300025922 Ga0207646_10000416 Ga0207646_1000041622 134
525 3300025922 Ga0207646_10014174 Ga0207646_100141747 134
526 3300025922 Ga0207646_10058150 Ga0207646_100581505 134
527 3300025922 Ga0207646_10118832 Ga0207646_101188322 134
528 3300025922 Ga0207646_10121188 Ga0207646_101211883 134
529 3300025922 Ga0207646_10300735 Ga0207646_103007352 134
530 3300025922 Ga0207646_10315221 Ga0207646_103152212 134
531 3300025922 Ga0207646_11522556 Ga0207646_115225561 134
532 3300025924 Ga0207694_10557197 Ga0207694_105571972 134
533 3300025925 Ga0207650_10003245 Ga0207650_100032453 134
534 3300025926 Ga0207659_10058617 Ga0207659_100586172 134
535 3300025927 Ga0207687_10060705 Ga0207687_100607056 134
536 3300025928 Ga0207700_10000798 Ga0207700_100007983 134
537 3300025928 Ga0207700_10001733 Ga0207700_1000173313 134
538 3300025928 Ga0207700_10005685 Ga0207700_100056852 134
539 3300025928 Ga0207700_10006147 Ga0207700_1000614710 134
540 3300025928 Ga0207700_10006208 Ga0207700_100062083 134
541 3300025928 Ga0207700_10061891 Ga0207700_100618916 134
542 3300025928 Ga0207700_10121056 Ga0207700_101210562 134
543 3300025928 Ga0207700_10256296 Ga0207700_102562964 134
544 3300025928 Ga0207700_10257694 Ga0207700_102576942 134
545 3300025928 Ga0207700_10264492 Ga0207700_102644923 134
546 3300025929 Ga0207664_10000312 Ga0207664_1000031214 134
547 3300025929 Ga0207664_10013970 Ga0207664_100139705 134
548 3300025929 Ga0207664_10042710 Ga0207664_100427105 134
549 3300025929 Ga0207664_10070125 Ga0207664_100701252 134
550 3300025929 Ga0207664_10114702 Ga0207664_101147023 134
551 3300025929 Ga0207664_10149920 Ga0207664_101499202 134
552 3300025929 Ga0207664_10181856 Ga0207664_101818562 134
553 3300025929 Ga0207664_10532416 Ga0207664_105324162 134
554 3300025929 Ga0207664_10532457 Ga0207664_105324572 134
555 3300025929 Ga0207664_11084316 Ga0207664_110843161 134
556 3300025931 Ga0207644_10010707 Ga0207644_100107073 134
557 3300025931 Ga0207644_10293975 Ga0207644_102939752 134
558 3300025932 Ga0207690_10011542 Ga0207690_100115426 134
559 3300025933 Ga0207706_10159937 Ga0207706_101599376 134
560 3300025939 Ga0207665_10000815 Ga0207665_1000081516 134
561 3300025939 Ga0207665_10001422 Ga0207665_100014229 134
562 3300025939 Ga0207665_10105536 Ga0207665_101055365 134
563 3300025939 Ga0207665_10308546 Ga0207665_103085462 134
564 3300025940 Ga0207691_10022176 Ga0207691_100221763 134
565 3300025941 Ga0207711_10110258 Ga0207711_101102582 134
566 3300025942 Ga0207689_10024826 Ga0207689_100248265 134
567 3300025944 Ga0207661_10011594 Ga0207661_100115947 134
568 3300025945 Ga0207679_10003642 Ga0207679_100036423 134
569 3300025949 Ga0207667_10080046 Ga0207667_100800466 134
570 3300025949 Ga0207667_10453799 Ga0207667_104537991 134
571 3300025949 Ga0207667_11472512 Ga0207667_114725121 134
572 3300025960 Ga0207651_10073792 Ga0207651_100737923 134
573 3300025961 Ga0207712_10433582 Ga0207712_104335823 134
574 3300025972 Ga0207668_10375860 Ga0207668_103758602 134
575 3300026023 Ga0207677_10004696 Ga0207677_100046966 134
576 3300026041 Ga0207639_10123660 Ga0207639_101236602 134
577 3300026067 Ga0207678_10003042 Ga0207678_100030428 134
578 3300026067 Ga0207678_10553573 Ga0207678_105535732 134
579 3300026078 Ga0207702_10005731 Ga0207702_1000573110 134
580 3300026078 Ga0207702_10019897 Ga0207702_100198978 134
581 3300026078 Ga0207702_10035944 Ga0207702_100359443 134
582 3300026078 Ga0207702_10637820 Ga0207702_106378201 134
583 3300026088 Ga0207641_10031395 Ga0207641_100313956 134
584 3300026088 Ga0207641_10102827 Ga0207641_101028271 134
585 3300026089 Ga0207648_11216410 Ga0207648_112164101 134
586 3300026095 Ga0207676_10005774 Ga0207676_100057748 134
587 3300026116 Ga0207674_10044865 Ga0207674_100448657 134
588 3300026118 Ga0207675_100683460 Ga0207675_1006834602 134
589 3300026121 Ga0207683_10001550 Ga0207683_100015503 134
590 3300026121 Ga0207683_10424165 Ga0207683_104241652 134
591 3300026142 Ga0207698_10004969 Ga0207698_100049698 134
592 3300027907 Ga0207428_10010009 Ga0207428_100100096 134
593 3300028379 Ga0268266_10099843 Ga0268266_100998431 134
594 3300028379 Ga0268266_10342281 Ga0268266_103422812 134
595 3300028379 Ga0268266_10479697 Ga0268266_104796973 134
596 3300031727 Ga0316576_10296302 Ga0316576_102963022 134
597 3300033179 Ga0307507_10081778 Ga0307507_100817782 134
598 3300034818 Ga0373950_0003712 Ga0373950_0003712_82_519 134
599 3300034957 Ga0373938_0008119 Ga0373938_0008119_460_897 134
600 3300035083 Ga0373926_0004292 Ga0373926_0004292_238_675 134
601 3300035083 Ga0373926_0017432 Ga0373926_0017432_1667_2095 134
602 3300035083 Ga0373926_0280457 Ga0373926_0280457_209_637 134
603 3300035085 Ga0373929_0027779 Ga0373929_0027779_177_614 134
604 3300035086 Ga0373934_0000674 Ga0373934_0000674_6612_7049 134
605 3300035086 Ga0373934_0014530 Ga0373934_0014530_1066_1488 134
606 3300035086 Ga0373934_0051912 Ga0373934_0051912_786_1214 134
607 3300035086 Ga0373934_0079784 Ga0373934_0079784_448_867 134
608 3300035086 Ga0373934_0103757 Ga0373934_0103757_476_904 134
609 3300035088 Ga0373940_0042379 Ga0373940_0042379_36_473 134
610 3300035090 Ga0373949_0026609 Ga0373949_0026609_892_1329 134
611 3300035091 Ga0373951_0030870 Ga0373951_0030870_737_1174 134
612 3300035111 Ga0373923_0007318 Ga0373923_0007318_1506_1934 134
613 3300035111 Ga0373923_0007399 Ga0373923_0007399_2467_2886 134
614 3300035111 Ga0373923_0066149 Ga0373923_0066149_50_487 134
615 3300035111 Ga0373923_0174313 Ga0373923_0174313_239_661 134
616 3300035111 Ga0373923_0199638 Ga0373923_0199638_214_642 134
617 3300035113 Ga0373936_0017038 Ga0373936_0017038_1442_1861 134
618 3300035113 Ga0373936_0089158 Ga0373936_0089158_97_516 134
619 3300035113 Ga0373936_0204095 Ga0373936_0204095_95_523 134
620 3300035114 Ga0373939_0006966 Ga0373939_0006966_840_1277 134
621 3300035115 Ga0373941_0005012 Ga0373941_0005012_192_629 134
622 3300035116 Ga0373945_0021950 Ga0373945_0021950_477_905 134
623 3300035116 Ga0373945_0185029 Ga0373945_0185029_256_675 134
624 3300035117 Ga0373953_0003697 Ga0373953_0003697_1516_1944 134
625 3300035117 Ga0373953_0019283 Ga0373953_0019283_1452_1889 134
626 3300035117 Ga0373953_0039276 Ga0373953_0039276_503_931 134
627 3300035117 Ga0373953_0043412 Ga0373953_0043412_448_867 134
628 3300035118 Ga0373954_0022036 Ga0373954_0022036_1175_1594 134
629 3300035118 Ga0373954_0242820 Ga0373954_0242820_147_575 134
630 3300035119 Ga0373956_0000440 Ga0373956_0000440_11480_11917 134
631 3300035119 Ga0373956_0007167 Ga0373956_0007167_985_1404 134
632 3300035119 Ga0373956_0014248 Ga0373956_0014248_1378_1800 134
633 3300035119 Ga0373956_0089716 Ga0373956_0089716_25_453 134
634 3300035119 Ga0373956_0124717 Ga0373956_0124717_555_977 134
635 3300035120 Ga0373957_0000394 Ga0373957_0000394_5595_6032 134
636 3300035120 Ga0373957_0017224 Ga0373957_0017224_1121_1540 134
637 3300035120 Ga0373957_0042923 Ga0373957_0042923_598_1026 134
638 3300035120 Ga0373957_0084253 Ga0373957_0084253_639_1061 134
639 3300035121 Ga0373960_0021997 Ga0373960_0021997_111_539 134
640 3300035121 Ga0373960_0112962 Ga0373960_0112962_421_858 134
641 3300035170 Ga0373943_0257486 Ga0373943_0257486_241_669 134
642 3300035170 Ga0373943_0702928 Ga0373943_0702928_119_538 134
643 3300035171 Ga0373946_0032311 Ga0373946_0032311_1118_1546 134
644 3300035171 Ga0373946_0053773 Ga0373946_0053773_848_1267 134
645 3300035171 Ga0373946_0169421 Ga0373946_0169421_591_1010 134
646 3300035171 Ga0373946_0246891 Ga0373946_0246891_407_835 134
647 3300035171 Ga0373946_0312692 Ga0373946_0312692_137_574 134
648 3300035171 Ga0373946_0395060 Ga0373946_0395060_113_541 134
649 3300035172 Ga0373955_0001622 Ga0373955_0001622_6846_7283 134
650 3300035172 Ga0373955_0009312 Ga0373955_0009312_3255_3674 134
651 3300035172 Ga0373955_0019045 Ga0373955_0019045_547_969 134
652 3300035172 Ga0373955_0168220 Ga0373955_0168220_550_978 134
653 3300035172 Ga0373955_0213173 Ga0373955_0213173_652_1077 134
654 3300035172 Ga0373955_0335344 Ga0373955_0335344_55_483 134
655 3300035172 Ga0373955_0562699 Ga0373955_0562699_98_520 134
656 3300035207 Ga0373942_0149361 Ga0373942_0149361_72_509 134
657 3300035241 Ga0373961_0166327 Ga0373961_0166327_283_720 134
658 3300035398 Ga0316574_0053529 Ga0316574_0053529_1295_1723 134
659 3300035410 Ga0373924_0001446 Ga0373924_0001446_625_1062 134
660 3300035410 Ga0373924_0006288 Ga0373924_0006288_3255_3674 134
661 3300035410 Ga0373924_0049616 Ga0373924_0049616_1130_1552 134
662 3300035410 Ga0373924_0068341 Ga0373924_0068341_373_801 134
663 3300035410 Ga0373924_0116013 Ga0373924_0116013_472_894 134
664 3300035691 Ga0373931_0045472 Ga0373931_0045472_1861_2298 134
665 3300035691 Ga0373931_0064798 Ga0373931_0064798_722_1156 134
666 3300035691 Ga0373931_0110855 Ga0373931_0110855_588_1025 134
667 3300035692 Ga0373935_0014480 Ga0373935_0014480_1217_1636 134
668 3300035692 Ga0373935_0034250 Ga0373935_0034250_2000_2437 134
669 3300035692 Ga0373935_0143789 Ga0373935_0143789_319_738 134
670 3300035724 Ga0373933_0000395 Ga0373933_0000395_5051_5488 134
671 3300035724 Ga0373933_0001608 Ga0373933_0001608_11007_11435 134
672 3300035724 Ga0373933_0011885 Ga0373933_0011885_1175_1594 134
673 3300035724 Ga0373933_0046194 Ga0373933_0046194_1940_2362 134
674 3300035724 Ga0373933_0050667 Ga0373933_0050667_753_1181 134
675 3300035724 Ga0373933_0057136 Ga0373933_0057136_446_868 134
676 3300035724 Ga0373933_0336842 Ga0373933_0336842_78_503 134
677 3300035725 Ga0373947_0000004 Ga0373947_0000004_134555_134992 134
678 3300035725 Ga0373947_0084539 Ga0373947_0084539_341_769 134
679 3300035725 Ga0373947_0105811 Ga0373947_0105811_843_1271 134
680 3300035725 Ga0373947_0265423 Ga0373947_0265423_262_681 134
681 3300035725 Ga0373947_0306613 Ga0373947_0306613_528_956 134
682 3300036401 Ga0373937_0000112 Ga0373937_0000112_5029_5466 134
683 3300036401 Ga0373937_0021836 Ga0373937_0021836_1491_1919 134
684 3300036401 Ga0373937_0088112 Ga0373937_0088112_903_1322 134
685 3300036401 Ga0373937_0341344 Ga0373937_0341344_69_491 134
686 3300036401 Ga0373937_0347766 Ga0373937_0347766_13_441 134
687 3300037068 Ga0373925_0014724 Ga0373925_0014724_3291_3719 134
688 3300037068 Ga0373925_0066450 Ga0373925_0066450_1935_2363 134
689 3300037068 Ga0373925_0091250 Ga0373925_0091250_736_1155 134
690 3300037068 Ga0373925_0162179 Ga0373925_0162179_295_723 134
691 3300037068 Ga0373925_0184564 Ga0373925_0184564_288_722 134
692 3300037068 Ga0373925_0202570 Ga0373925_0202570_661_1089 134
693 3300037068 Ga0373925_0366965 Ga0373925_0366965_227_649 134
694 3300037068 Ga0373925_0440518 Ga0373925_0440518_66_485 134
695 3300037068 Ga0373925_0767328 Ga0373925_0767328_134_556 134
696 3300037068 Ga0373925_1375628 Ga0373925_1375628_48_476 134
697 3300037853 Ga0436364_0497431 Ga0436364_0497431_23_442 134
698 3300037853 Ga0436364_0575601 Ga0436364_0575601_3166_3591 134
699 3300037853 Ga0436364_0590629 Ga0436364_0590629_193_612 134
700 3300037853 Ga0436364_0750774 Ga0436364_0750774_1059_1481 134
701 3300037853 Ga0436364_0804097 Ga0436364_0804097_27539_27964 134
702 3300037853 Ga0436364_0845254 Ga0436364_0845254_321_743 134
703 3300037853 Ga0436364_1042062 Ga0436364_1042062_392_820 134
704 3300037853 Ga0436364_1241795 Ga0436364_1241795_716_1141 134
705 3300039437 Ga0436365_0020494 Ga0436365_0020494_178_603 134
706 3300039437 Ga0436365_1487927 Ga0436365_1487927_495_914 134
707 3300039438 Ga0436360_0506992 Ga0436360_0506992_129_569 134
708 3300039447 Ga0436361_0218806 Ga0436361_0218806_731_1159 134
709 3300039450 Ga0436363_0367458 Ga0436363_0367458_817_1242 134
710 3300039450 Ga0436363_0685852 Ga0436363_0685852_517_942 134
711 3300039450 Ga0436363_1307140 Ga0436363_1307140_19_483 134
712 3300039450 Ga0436363_1321302 Ga0436363_1321302_1201_1626 134
713 3300039450 Ga0436363_1555992 Ga0436363_1555992_734_1153 134
714 3300039450 Ga0436363_1662743 Ga0436363_1662743_52_480 134
715 3300039453 Ga0436362_0041956 Ga0436362_0041956_175_594 134
716 3300041509 Ga0451843_0620187 Ga0451843_0620187_57_479 134
717 3300042005 Ga0439448_0114577 Ga0439448_0114577_305_739 134
718 3300042012 Ga0439455_0124192 Ga0439455_0124192_239_673 134
719 3300042016 Ga0439463_100419 Ga0439463_100419_255_689 134
720 3300042438 Ga0439459_0000753 Ga0439459_0000753_2130_2564 134
721 3300044683 Ga0466965_0189629 Ga0466965_0189629_108_533 134
722 3300044694 Ga0466963_0038035 Ga0466963_0038035_103_528 134
723 3300044694 Ga0466963_0191173 Ga0466963_0191173_623_1042 134
724 3300044706 Ga0466964_0114153 Ga0466964_0114153_766_1191 134
725 3300044719 Ga0466971_0117611 Ga0466971_0117611_301_726 134
726 3300044842 Ga0466957_0047275 Ga0466957_0047275_1943_2368 134
727 3300044901 Ga0466960_0071412 Ga0466960_0071412_744_1169 134
728 3300044901 Ga0466960_0340273 Ga0466960_0340273_356_772 134
729 3300045836 Ga0466958_0049813 Ga0466958_0049813_316_741 134
730 3300045836 Ga0466958_0436120 Ga0466958_0436120_11_430 134
731 3300045976 Ga0466967_0385136 Ga0466967_0385136_818_1243 134
732 3300046454 Ga0495592_0001455 Ga0495592_0001455_13687_14124 134
733 3300046454 Ga0495592_0007331 Ga0495592_0007331_6886_7314 134
734 3300046454 Ga0495592_0031243 Ga0495592_0031243_1961_2389 134
735 3300046454 Ga0495592_0064943 Ga0495592_0064943_1680_2099 134
736 3300046454 Ga0495592_0129668 Ga0495592_0129668_1098_1520 134
737 3300046454 Ga0495592_0595574 Ga0495592_0595574_223_651 134
738 3300046455 Ga0495603_0474382 Ga0495603_0474382_93_521 134
739 3300046459 Ga0495629_0003377 Ga0495629_0003377_11185_11604 134
740 3300046459 Ga0495629_0015076 Ga0495629_0015076_4471_4899 134
741 3300046459 Ga0495629_0025772 Ga0495629_0025772_783_1211 134
742 3300046461 Ga0495641_0009158 Ga0495641_0009158_2666_3085 134
743 3300046461 Ga0495641_0012173 Ga0495641_0012173_1685_2113 134
744 3300046461 Ga0495641_0134931 Ga0495641_0134931_501_929 134
745 3300046462 Ga0495651_0000614 Ga0495651_0000614_22199_22636 134
746 3300046462 Ga0495651_0044722 Ga0495651_0044722_1502_1930 134
747 3300046462 Ga0495651_0076191 Ga0495651_0076191_298_720 134
748 3300046462 Ga0495651_0115830 Ga0495651_0115830_1455_1883 134
749 3300046462 Ga0495651_0248035 Ga0495651_0248035_351_770 134
750 3300046463 Ga0495653_0005337 Ga0495653_0005337_8855_9283 134
751 3300046463 Ga0495653_0017535 Ga0495653_0017535_4229_4648 134
752 3300046463 Ga0495653_0020711 Ga0495653_0020711_1538_1975 134
753 3300046463 Ga0495653_0060635 Ga0495653_0060635_1649_2077 134
754 3300046463 Ga0495653_0091505 Ga0495653_0091505_550_978 134
755 3300046463 Ga0495653_0192235 Ga0495653_0192235_527_949 134
756 3300046463 Ga0495653_0793646 Ga0495653_0793646_66_488 134
757 3300046472 Ga0495580_0295072 Ga0495580_0295072_658_1086 134
758 3300046472 Ga0495580_0435779 Ga0495580_0435779_273_701 134
759 3300046473 Ga0495582_0000633 Ga0495582_0000633_9180_9599 134
760 3300046473 Ga0495582_0018939 Ga0495582_0018939_1583_2011 134
761 3300046473 Ga0495582_0121544 Ga0495582_0121544_534_962 134
762 3300046475 Ga0495639_0071634 Ga0495639_0071634_660_1088 134
763 3300046475 Ga0495639_0195717 Ga0495639_0195717_92_511 134
764 3300046475 Ga0495639_0476023 Ga0495639_0476023_175_594 134
765 3300046476 Ga0495662_0002306 Ga0495662_0002306_6114_6533 134
766 3300046476 Ga0495662_0176990 Ga0495662_0176990_61_489 134
767 3300046476 Ga0495662_0357194 Ga0495662_0357194_96_524 134
768 3300046477 Ga0495664_0035879 Ga0495664_0035879_1050_1472 134
769 3300046477 Ga0495664_0103917 Ga0495664_0103917_260_688 134
770 3300046477 Ga0495664_0135073 Ga0495664_0135073_725_1144 134
771 3300046477 Ga0495664_0199036 Ga0495664_0199036_244_672 134
772 3300046477 Ga0495664_0216373 Ga0495664_0216373_85_507 134
773 3300046477 Ga0495664_0337844 Ga0495664_0337844_141_569 134
774 3300046511 Ga0495608_0001069 Ga0495608_0001069_13804_14241 134
775 3300046511 Ga0495608_0001601 Ga0495608_0001601_12910_13338 134
776 3300046511 Ga0495608_0023206 Ga0495608_0023206_1359_1787 134
777 3300046511 Ga0495608_0026488 Ga0495608_0026488_845_1264 134
778 3300046511 Ga0495608_0073754 Ga0495608_0073754_1217_1639 134
779 3300046514 Ga0495618_0090381 Ga0495618_0090381_539_967 134
780 3300046514 Ga0495618_0138204 Ga0495618_0138204_580_1008 134
781 3300046514 Ga0495618_0163081 Ga0495618_0163081_446_868 134
782 3300046514 Ga0495618_0163346 Ga0495618_0163346_133_552 134
783 3300046514 Ga0495618_0185289 Ga0495618_0185289_223_642 134
784 3300046514 Ga0495618_0187179 Ga0495618_0187179_207_635 134
785 3300046514 Ga0495618_0275484 Ga0495618_0275484_429_857 134
786 3300046516 Ga0495628_0001819 Ga0495628_0001819_5002_5439 134
787 3300046516 Ga0495628_0006554 Ga0495628_0006554_2845_3273 134
788 3300046516 Ga0495628_0075381 Ga0495628_0075381_1151_1573 134
789 3300046516 Ga0495628_0144151 Ga0495628_0144151_1175_1594 134
790 3300046516 Ga0495628_0221997 Ga0495628_0221997_891_1319 134
791 3300046516 Ga0495628_0259717 Ga0495628_0259717_619_1047 134
792 3300046516 Ga0495628_0559341 Ga0495628_0559341_140_559 134
793 3300046516 Ga0495628_0570329 Ga0495628_0570329_242_670 134
794 3300046517 Ga0495630_0014583 Ga0495630_0014583_845_1264 134
795 3300046517 Ga0495630_0035351 Ga0495630_0035351_2945_3373 134
796 3300046517 Ga0495630_0046422 Ga0495630_0046422_2128_2556 134
797 3300046517 Ga0495630_0345675 Ga0495630_0345675_94_522 134
798 3300046526 Ga0495666_0043774 Ga0495666_0043774_961_1380 134
799 3300046526 Ga0495666_0330050 Ga0495666_0330050_205_633 134
800 3300046529 Ga0495652_0001605 Ga0495652_0001605_19207_19644 134
801 3300046529 Ga0495652_0047090 Ga0495652_0047090_12_434 134
802 3300046529 Ga0495652_0087251 Ga0495652_0087251_992_1420 134
803 3300046529 Ga0495652_0137351 Ga0495652_0137351_461_889 134
804 3300046529 Ga0495652_0156758 Ga0495652_0156758_89_511 134
805 3300046529 Ga0495652_0170625 Ga0495652_0170625_556_984 134
806 3300046529 Ga0495652_0247817 Ga0495652_0247817_223_642 134
807 3300046529 Ga0495652_0528856 Ga0495652_0528856_68_496 134
808 3300046531 Ga0495665_0000862 Ga0495665_0000862_9605_10024 134
809 3300046531 Ga0495665_0006105 Ga0495665_0006105_3984_4412 134
810 3300046531 Ga0495665_0040631 Ga0495665_0040631_1778_2206 134
811 3300046531 Ga0495665_0101249 Ga0495665_0101249_466_894 134
812 3300046531 Ga0495665_0395392 Ga0495665_0395392_52_474 134
813 3300046533 Ga0495640_0032162 Ga0495640_0032162_503_931 134
814 3300046533 Ga0495640_0052316 Ga0495640_0052316_26_448 134
815 3300046533 Ga0495640_0053319 Ga0495640_0053319_351_770 134
816 3300046533 Ga0495640_0064663 Ga0495640_0064663_1119_1547 134
817 3300046533 Ga0495640_0108982 Ga0495640_0108982_496_924 134
818 3300046533 Ga0495640_0156918 Ga0495640_0156918_923_1345 134
819 3300046533 Ga0495640_0358306 Ga0495640_0358306_346_774 134
820 3300046535 Ga0495586_0008277 Ga0495586_0008277_3659_4078 134
821 3300046535 Ga0495586_0078499 Ga0495586_0078499_567_995 134
822 3300046535 Ga0495586_0306961 Ga0495586_0306961_420_839 134
823 3300046536 Ga0495587_0000038 Ga0495587_0000038_110653_111090 134
824 3300046536 Ga0495587_0009607 Ga0495587_0009607_1019_1447 134
825 3300046536 Ga0495587_0014385 Ga0495587_0014385_325_747 134
826 3300046536 Ga0495587_0091105 Ga0495587_0091105_223_642 134
827 3300046543 Ga0495645_0024129 Ga0495645_0024129_39_467 134
828 3300046543 Ga0495645_0104876 Ga0495645_0104876_1365_1784 134
829 3300046543 Ga0495645_0307514 Ga0495645_0307514_484_903 134
830 3300046543 Ga0495645_0432137 Ga0495645_0432137_325_771 134
831 3300046559 Ga0495667_0001336 Ga0495667_0001336_10709_11146 134
832 3300046559 Ga0495667_0006455 Ga0495667_0006455_4744_5172 134
833 3300046559 Ga0495667_0065274 Ga0495667_0065274_338_760 134
834 3300046559 Ga0495667_0077073 Ga0495667_0077073_576_995 134
835 3300046559 Ga0495667_0205778 Ga0495667_0205778_123_545 134
836 3300046642 Ga0495634_0010165 Ga0495634_0010165_351_770 134
837 3300046642 Ga0495634_0098056 Ga0495634_0098056_970_1398 134
838 3300046642 Ga0495634_0384838 Ga0495634_0384838_14_436 134
839 3300046663 Ga0495635_0010821 Ga0495635_0010821_1160_1588 134
840 3300046663 Ga0495635_0093700 Ga0495635_0093700_949_1377 134
841 3300046663 Ga0495635_0134179 Ga0495635_0134179_599_1027 134
842 3300046663 Ga0495635_0154432 Ga0495635_0154432_1112_1534 134
843 3300046663 Ga0495635_0177618 Ga0495635_0177618_93_515 134
844 3300046663 Ga0495635_0178752 Ga0495635_0178752_576_995 134
845 3300046663 Ga0495635_0507850 Ga0495635_0507850_176_613 134
846 3300046663 Ga0495635_0858320 Ga0495635_0858320_142_570 134
847 3300046674 Ga0495588_0199784 Ga0495588_0199784_276_704 134
848 3300046675 Ga0495657_0001650 Ga0495657_0001650_13685_14122 134
849 3300046675 Ga0495657_0003778 Ga0495657_0003778_3003_3431 134
850 3300046675 Ga0495657_0010062 Ga0495657_0010062_5641_6063 134
851 3300046675 Ga0495657_0040982 Ga0495657_0040982_1138_1560 134
852 3300046675 Ga0495657_0052746 Ga0495657_0052746_1601_2029 134
853 3300046675 Ga0495657_0241636 Ga0495657_0241636_448_867 134
854 3300046678 Ga0495599_0000758 Ga0495599_0000758_15437_15874 134
855 3300046678 Ga0495599_0005598 Ga0495599_0005598_2791_3219 134
856 3300046678 Ga0495599_0030015 Ga0495599_0030015_965_1393 134
857 3300046678 Ga0495599_0175492 Ga0495599_0175492_680_1099 134
858 3300046679 Ga0495623_0000989 Ga0495623_0000989_5054_5491 134
859 3300046679 Ga0495623_0024334 Ga0495623_0024334_3261_3680 134
860 3300046679 Ga0495623_0034857 Ga0495623_0034857_1061_1489 134
861 3300046679 Ga0495623_0205097 Ga0495623_0205097_371_799 134
862 3300046680 Ga0495646_0007896 Ga0495646_0007896_620_1048 134
863 3300046680 Ga0495646_0011284 Ga0495646_0011284_4716_5138 134
864 3300046680 Ga0495646_0036410 Ga0495646_0036410_730_1167 134
865 3300046680 Ga0495646_0062099 Ga0495646_0062099_959_1378 134
866 3300046680 Ga0495646_0081477 Ga0495646_0081477_908_1336 134
867 3300046680 Ga0495646_0343986 Ga0495646_0343986_101_523 134
868 3300046681 Ga0495647_0097127 Ga0495647_0097127_271_699 134
869 3300046683 Ga0495658_0015048 Ga0495658_0015048_551_979 134
870 3300046683 Ga0495658_0033565 Ga0495658_0033565_1348_1767 134
871 3300046683 Ga0495658_0232418 Ga0495658_0232418_187_615 134
872 3300046689 Ga0495613_0025110 Ga0495613_0025110_1366_1785 134
873 3300046689 Ga0495613_0086135 Ga0495613_0086135_1649_2077 134
874 3300046690 Ga0495624_0007371 Ga0495624_0007371_1189_1608 134
875 3300046690 Ga0495624_0288964 Ga0495624_0288964_190_618 134
876 3300046809 Ga0495600_0003680 Ga0495600_0003680_715_1152 134
877 3300046809 Ga0495600_0014627 Ga0495600_0014627_1939_2367 134
878 3300046809 Ga0495600_0022141 Ga0495600_0022141_3085_3504 134
879 3300046809 Ga0495600_0039149 Ga0495600_0039149_452_874 134
880 3300047315 Ga0495581_0011292 Ga0495581_0011292_1082_1501 134
881 3300047315 Ga0495581_0021500 Ga0495581_0021500_1662_2090 134
882 3300047315 Ga0495581_0022089 Ga0495581_0022089_374_802 134
883 3300047317 Ga0495604_0001351 Ga0495604_0001351_5046_5483 134
884 3300047317 Ga0495604_0017594 Ga0495604_0017594_4931_5359 134
885 3300047317 Ga0495604_0023708 Ga0495604_0023708_1541_1978 134
886 3300047317 Ga0495604_0215741 Ga0495604_0215741_537_965 134
887 3300047317 Ga0495604_0237975 Ga0495604_0237975_370_792 134
888 3300047317 Ga0495604_0295461 Ga0495604_0295461_448_867 134
889 3300047317 Ga0495604_0398917 Ga0495604_0398917_253_675 134
890 3300047319 Ga0495674_0016775 Ga0495674_0016775_255_683 134
891 3300047319 Ga0495674_0041489 Ga0495674_0041489_2685_3113 134
892 3300047319 Ga0495674_0097709 Ga0495674_0097709_1888_2307 134
893 3300047319 Ga0495674_0102293 Ga0495674_0102293_973_1392 134
894 3300047319 Ga0495674_0115625 Ga0495674_0115625_842_1264 134
895 3300047319 Ga0495674_0348943 Ga0495674_0348943_694_1122 134
896 3300047319 Ga0495674_1180129 Ga0495674_1180129_132_554 134
897 3300047321 Ga0495676_0085381 Ga0495676_0085381_168_596 134
898 3300047321 Ga0495676_0182973 Ga0495676_0182973_433_861 134
899 3300047321 Ga0495676_0225727 Ga0495676_0225727_93_527 134
900 3300047322 Ga0495680_0003762 Ga0495680_0003762_13709_14146 134
901 3300047322 Ga0495680_0011520 Ga0495680_0011520_4736_5164 134
902 3300047322 Ga0495680_0023051 Ga0495680_0023051_1959_2387 134
903 3300047322 Ga0495680_0056902 Ga0495680_0056902_928_1347 134
904 3300047322 Ga0495680_0072113 Ga0495680_0072113_561_989 134
905 3300047322 Ga0495680_0177064 Ga0495680_0177064_673_1095 134
906 3300047322 Ga0495680_0432478 Ga0495680_0432478_159_581 134
907 3300047444 Ga0495675_0004390 Ga0495675_0004390_5774_6211 134
908 3300047444 Ga0495675_0010355 Ga0495675_0010355_999_1427 134
909 3300047444 Ga0495675_0053342 Ga0495675_0053342_973_1392 134
910 3300047471 Ga0495684_0005912 Ga0495684_0005912_2763_3191 134
911 3300047471 Ga0495684_0013098 Ga0495684_0013098_5137_5556 134
912 3300047471 Ga0495684_0032003 Ga0495684_0032003_572_1000 134
913 3300047471 Ga0495684_0066376 Ga0495684_0066376_1620_2048 134
914 3300047471 Ga0495684_0099432 Ga0495684_0099432_1257_1679 134
915 3300047471 Ga0495684_0628275 Ga0495684_0628275_23_451 134
916 3300047673 Ga0495593_0036689 Ga0495593_0036689_1294_1713 134
917 3300047673 Ga0495593_0059361 Ga0495593_0059361_452_880 134
918 3300048088 Ga0495602_0003390 Ga0495602_0003390_5054_5491 134
919 3300048088 Ga0495602_0015662 Ga0495602_0015662_6065_6493 134
920 3300048088 Ga0495602_0060055 Ga0495602_0060055_1255_1683 134
921 3300048088 Ga0495602_0092006 Ga0495602_0092006_928_1347 134
922 3300048088 Ga0495602_0269413 Ga0495602_0269413_608_1030 134
923 3300048089 Ga0495614_0035350 Ga0495614_0035350_169_597 134
924 3300048089 Ga0495614_0037064 Ga0495614_0037064_588_1007 134
925 3300048903 Ga0496100_0077467 Ga0496100_0077467_22_459 134
926 3300048903 Ga0496100_0095470 Ga0496100_0095470_943_1380 134
927 3300048904 Ga0496101_0726020 Ga0496101_0726020_187_615 134
928 3300048905 Ga0496102_0006711 Ga0496102_0006711_2258_2695 134
929 3300048905 Ga0496102_0073700 Ga0496102_0073700_578_1015 134
930 3300048905 Ga0496102_0089034 Ga0496102_0089034_1741_2169 134
931 3300048906 Ga0496103_0089253 Ga0496103_0089253_191_628 134
932 3300048906 Ga0496103_0168404 Ga0496103_0168404_578_1015 134
933 3300048907 Ga0496104_0015590 Ga0496104_0015590_1284_1712 134
934 3300048907 Ga0496104_0022073 Ga0496104_0022073_2964_3401 134
935 3300048907 Ga0496104_0257572 Ga0496104_0257572_458_886 134
936 3300048908 Ga0496105_0002576 Ga0496105_0002576_8195_8632 134
937 3300048908 Ga0496105_0008991 Ga0496105_0008991_3373_3801 134
938 3300048908 Ga0496105_0178037 Ga0496105_0178037_922_1359 134
939 3300048909 Ga0496106_0050968 Ga0496106_0050968_202_639 134
940 3300048910 Ga0496107_0036160 Ga0496107_0036160_503_940 134
941 3300048910 Ga0496107_0407922 Ga0496107_0407922_402_830 134
942 3300048911 Ga0496108_0007310 Ga0496108_0007310_6785_7222 134
943 3300048911 Ga0496108_0262005 Ga0496108_0262005_196_633 134
944 3300048912 Ga0496109_0014629 Ga0496109_0014629_3432_3869 134
945 3300048912 Ga0496109_0078270 Ga0496109_0078270_2497_2925 134
946 3300048912 Ga0496109_0084140 Ga0496109_0084140_337_774 134
947 3300048913 Ga0496110_0043890 Ga0496110_0043890_1777_2214 134
948 3300048913 Ga0496110_0206755 Ga0496110_0206755_776_1204 134
949 3300048913 Ga0496110_0750083 Ga0496110_0750083_159_593 134
950 3300048914 Ga0496111_0002632 Ga0496111_0002632_3811_4248 134
951 3300048914 Ga0496111_0062158 Ga0496111_0062158_1216_1653 134
952 3300048914 Ga0496111_0166729 Ga0496111_0166729_688_1116 134
953 3300048915 Ga0496112_0053873 Ga0496112_0053873_910_1347 134
954 3300048915 Ga0496112_0079656 Ga0496112_0079656_1898_2335 134
955 3300048915 Ga0496112_0146193 Ga0496112_0146193_910_1338 134
956 3300048916 Ga0496113_0004926 Ga0496113_0004926_7116_7553 134
957 3300048916 Ga0496113_0039381 Ga0496113_0039381_1550_1978 134
958 3300048916 Ga0496113_0063676 Ga0496113_0063676_906_1343 134
959 3300048917 Ga0496114_0376630 Ga0496114_0376630_630_1058 134
960 3300048917 Ga0496114_1397064 Ga0496114_1397064_98_517 134
961 3300048918 Ga0496115_0006183 Ga0496115_0006183_6927_7355 134
962 3300048918 Ga0496115_0091770 Ga0496115_0091770_511_981 134
963 3300048929 Ga0496126_0000075 Ga0496126_0000075_160489_160920 134
964 3300048929 Ga0496126_0184550 Ga0496126_0184550_867_1295 134
965 3300048929 Ga0496126_0682930 Ga0496126_0682930_109_579 134
966 3300049578 Ga0501042_0008915 Ga0501042_0008915_5573_6004 134
967 3300049581 Ga0501047_0000150 Ga0501047_0000150_31991_32413 134
968 3300049585 Ga0501069_0208878 Ga0501069_0208878_187_615 134
969 3300049742 Ga0501080_0835409 Ga0501080_0835409_329_751 134
970 3300050490 nmdc:mga03n38_431597_c1 nmdc:mga03n38_431597_c1_30_461 134
971 3300050496 nmdc:mga07m45_65750_c1 nmdc:mga07m45_65750_c1_16_447 134
972 3300050507 nmdc:mga05p37_127039_c1 nmdc:mga05p37_127039_c1_374_811 134
973 3300050507 nmdc:mga05p37_67522_c1 nmdc:mga05p37_67522_c1_1577_2011 134
974 3300050508 nmdc:mga09592_486514_c1 nmdc:mga09592_486514_c1_323_757 134
975 3300050508 nmdc:mga09592_752305_c1 nmdc:mga09592_752305_c1_298_735 134
976 3300050510 nmdc:mga06r32_1144457_c1 nmdc:mga06r32_1144457_c1_38_475 134
977 3300050510 nmdc:mga06r32_496570_c1 nmdc:mga06r32_496570_c1_574_993 134
978 3300050510 nmdc:mga06r32_797052_c1 nmdc:mga06r32_797052_c1_318_737 134
979 3300050511 nmdc:mga08y16_228436_c1 nmdc:mga08y16_228436_c1_430_867 134
980 3300050511 nmdc:mga08y16_70532_c1 nmdc:mga08y16_70532_c1_1690_2127 134
981 3300050512 nmdc:mga0n895_109127_c1 nmdc:mga0n895_109127_c1_1410_1847 134
982 3300050512 nmdc:mga0n895_13493_c1 nmdc:mga0n895_13493_c1_3272_3709 134
983 3300050512 nmdc:mga0n895_53228_c1 nmdc:mga0n895_53228_c1_1936_2355 134
984 3300050512 nmdc:mga0n895_7079_c1 nmdc:mga0n895_7079_c1_8007_8435 134
985 3300050513 nmdc:mga0rr50_1040_c1 nmdc:mga0rr50_1040_c1_5922_6359 134
986 3300050513 nmdc:mga0rr50_19349_c1 nmdc:mga0rr50_19349_c1_2379_2798 134
987 3300050513 nmdc:mga0rr50_30445_c1 nmdc:mga0rr50_30445_c1_1921_2349 134
988 3300050513 nmdc:mga0rr50_64018_c1 nmdc:mga0rr50_64018_c1_839_1276 134
989 3300050514 nmdc:mga08x19_16197_c1 nmdc:mga08x19_16197_c1_3603_4040 134
990 3300050514 nmdc:mga08x19_252903_c1 nmdc:mga08x19_252903_c1_663_1082 134
991 3300050514 nmdc:mga08x19_662974_c1 nmdc:mga08x19_662974_c1_218_646 134
992 3300050514 nmdc:mga08x19_673088_c1 nmdc:mga08x19_673088_c1_168_587 134
993 3300050514 nmdc:mga08x19_97392_c1 nmdc:mga08x19_97392_c1_1430_1867 134
994 3300050515 nmdc:mga0a205_35541_c1 nmdc:mga0a205_35541_c1_186_623 134
995 3300050515 nmdc:mga0a205_57226_c1 nmdc:mga0a205_57226_c1_1350_1769 134
996 3300053077 Ga0495601_0001775 Ga0495601_0001775_2588_3007 134
997 3300053077 Ga0495601_0031216 Ga0495601_0031216_1252_1671 134
998 3300053077 Ga0495601_0139521 Ga0495601_0139521_356_784 134
999 3300053077 Ga0495601_0440666 Ga0495601_0440666_239_661 134
1000 3300053078 Ga0495612_0026415 Ga0495612_0026415_1047_1466 134
1001 3300053078 Ga0495612_0039803 Ga0495612_0039803_494_922 134
1002 3300053078 Ga0495612_0141308 Ga0495612_0141308_456_884 134
1003 3300053078 Ga0495612_0244731 Ga0495612_0244731_68_487 134
1004 3300053078 Ga0495612_0414061 Ga0495612_0414061_55_483 134
1005 3300053084 Ga0495595_0000411 Ga0495595_0000411_13522_13959 134
1006 3300053084 Ga0495595_0005457 Ga0495595_0005457_2460_2879 134
1007 3300053084 Ga0495595_0007476 Ga0495595_0007476_430_858 134
1008 3300053084 Ga0495595_0340782 Ga0495595_0340782_231_653 134
1009 3300053085 Ga0495619_0030461 Ga0495619_0030461_2501_2920 134
1010 3300053085 Ga0495619_0037658 Ga0495619_0037658_1594_2022 134
1011 3300053085 Ga0495619_0071500 Ga0495619_0071500_1297_1719 134
1012 3300053085 Ga0495619_0072365 Ga0495619_0072365_1808_2236 134
1013 3300053085 Ga0495619_0140481 Ga0495619_0140481_540_977 134
1014 3300053085 Ga0495619_0200503 Ga0495619_0200503_464_892 134
1015 3300053085 Ga0495619_0253765 Ga0495619_0253765_125_547 134
1016 3300061719 Ga0466962_0101005 Ga0466962_0101005_511_936 134
1017 iso_pu_bacteria 2675903058 2676476423 134
1018 iso_pu_bacteria 2827628540 2827632231 134

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

23

141

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rv2-assembly1.cif.gz_B-2 crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium smegmatis 0.9694 2 133
4rlj-assembly1.cif.gz_B crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis 0.9554 1 133
4v12-assembly1.cif.gz_A-2 crystal structure of the msmeg_6754 dehydratase from mycobacterium smegmatis 0.9493 3 133
5i7n-assembly1.cif.gz_A-2 maoc-like dehydratase 0.9491 2 133
4rv2-assembly1.cif.gz_B-2 crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium smegmatis 0.9484 2 133
ID Description Score Start End Superfamily
4rltB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9589 1 133 3.10.129.10
4rltB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9452 1 133 3.10.129.10
1iq6A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8848 7 133 3.10.129.10
4w78F00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8839 8 133 3.10.129.10
3k67A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8758 6 133 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A1C6VAW7-F1-model_v4 Acyl dehydratase 0.9831 11 133 GO:0004312
GO:0005835
GO:0006633
AF-A0A6B3HFS5-F1-model_v4 Dehydratase 0.9828 34 133
AF-A0A3M9MAQ5-F1-model_v4 Acyl dehydratase 0.9814 7 133 GO:0004312
GO:0005835
GO:0006633
AF-A0A0H3CVT9-F1-model_v4 MaoC-like dehydratase 0.9808 7 133
AF-A0A6J7QZ86-F1-model_v4 Unannotated protein 0.9808 49 133

Feature Viewer

pLDDT pTM Quality
96.94 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map